F495884

General Info

Members Datasets Scaffolds Average Seq Length
1847 529 3694 438

Family's Representative Sequence

Representative Sequence 3300042139|Ga0450904_002772|Ga0450904_002772_146_1435
Length 416
Sequence MALHAKAKAEAGYRFYALYDKISRDDVLAHAWVQCRSNKGAPGADGQDFADVEAYGVQRWLGELALALREETYRPGPIRRVFIPKANGKLRPLGISSLRDRVCMTAAMLVLEPIFEADLPPEQYAYRPGRNAQQAVIAVQETLFGGHPEVVDADLADYFGSIPHAELMLSLARRIVDARVLHLLRMWLECPVEETDDRGQRTRTTEAKEQRRGIPQGSPMSPLLASLYMRRFVLGWKKLGLEEGLGSRIVSYADDLVILCRRGKAQEALAHMRELMERLKLSVNEEKTRICKVPEGQFDFLGYTFGQMYSKTTGKARLAMWPSKKSIRRMVEKVHDLTAVQTGWQEITANYFQVGTVNQAYRALDNYTAPRLRRWLRHKHKVRQRKGGSYPLSHLYGHFWLVRLTARGRNESWVKA

Samples

Sample ID Description Type Environment
1 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
15 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
16 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
106 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
123 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300019161 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
140 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
141 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
144 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300023660 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300024123 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 Metagenome Unclassified
147 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
148 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
149 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
150 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
213 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
217 3300028010 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
222 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
223 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
224 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
227 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
228 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
231 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
232 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
233 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
234 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
235 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
236 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
237 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
238 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
239 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
240 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
241 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
242 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
243 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
244 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
245 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
246 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
247 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
248 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
249 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
251 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
252 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
253 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
254 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
255 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
256 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
257 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
258 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
259 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
260 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
261 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
262 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
263 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
264 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
265 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
266 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
268 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
269 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
270 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
271 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
272 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
273 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
274 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
275 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
276 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
277 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
278 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
279 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
280 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
281 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
282 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
283 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
284 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
285 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
286 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
287 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
288 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
289 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
290 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
291 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
292 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
293 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
294 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
295 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
296 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
297 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
298 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
299 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
300 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
301 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
302 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
303 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
304 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
305 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
306 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
307 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
308 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
309 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
310 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
311 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
312 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
313 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
314 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
315 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
316 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
317 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
318 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
319 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
320 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
321 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
322 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
323 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
324 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
325 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
326 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
327 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
328 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
329 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
330 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
331 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
332 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
333 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
334 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
335 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
336 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
337 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
338 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
339 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
340 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
341 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
342 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
343 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
344 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
345 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
346 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
347 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
348 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
349 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
350 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
351 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
352 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
353 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
354 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
355 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
356 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
357 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
358 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
359 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
360 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
361 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
362 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
363 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
364 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
365 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
366 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
367 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
368 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
369 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
370 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
371 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
372 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
373 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
374 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
375 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
376 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
377 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
378 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
379 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
380 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
381 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
382 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
383 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
384 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
385 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
386 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
387 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
388 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
389 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
390 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
391 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
392 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
393 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
394 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
395 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
396 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
397 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
398 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
399 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
400 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
401 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
402 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
403 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
404 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
405 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
406 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
407 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
408 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
409 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
410 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
411 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
412 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
413 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
414 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
415 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
416 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
417 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
418 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
419 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
420 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
421 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
422 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
423 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
424 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
425 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
426 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
427 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
428 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
429 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
430 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
431 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
432 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
433 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
434 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
435 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
436 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
437 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
438 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
439 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
440 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
441 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
442 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
443 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
444 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
445 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
446 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
447 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
448 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
449 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
450 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
451 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
452 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
453 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
454 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
455 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
456 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
457 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
458 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
459 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
460 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
461 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
462 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
463 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
464 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
465 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
466 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
467 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
468 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
469 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
470 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
471 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
472 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
473 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
474 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
475 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
476 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
477 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
478 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
479 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
480 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
481 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
482 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
483 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
484 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
485 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
486 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
487 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
488 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
489 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
490 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
491 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
492 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
493 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
494 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
495 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
496 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
497 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
498 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
499 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
500 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
506 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
507 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
508 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
509 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
510 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
511 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
512 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
513 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
514 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
515 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
516 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
517 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
518 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
519 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
520 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
521 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
522 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
523 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
524 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
525 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
526 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
527 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
528 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
529 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.81
Metatranscriptomes 0.81
Isolates 2.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.89
Nodule 1.41
Rhizoplane 6.12
Rhizosphere 86.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0450904_002772 3300042139 Bacteria 2004
2 SwRhRL2b_contig_1818751 2162886007 Bacteria 1871
3 SwRhRL2b_contig_2236331 2162886007 Bacteria 1968
4 ARSoilOldRDRAFT_c002146 3300000044 Bacteria 1775
5 JGI24747J21853_1000925 3300001978 Bacteria 2049
6 JGI24740J21852_10025448 3300001979 Bacteria 1995
7 JGI24739J22299_10025517 3300001989 Bacteria 2078
8 JGI24739J22299_10027983 3300001989 Bacteria 1967
9 JGI24739J22299_10028900 3300001989 Bacteria 1931
10 JGI24743J22301_10006376 3300001991 Bacteria 2009
11 JGI24743J22301_10007064 3300001991 Bacteria 1936
12 JGI24735J21928_10015983 3300002067 Bacteria 2336
13 JGI24735J21928_10018333 3300002067 Bacteria 2158
14 JGI24735J21928_10019976 3300002067 Bacteria 2055
15 JGI24735J21928_10020152 3300002067 Bacteria 2045
16 JGI24735J21928_10022282 3300002067 Bacteria 1930
17 JGI24750J21931_1003093 3300002070 Bacteria 1997
18 JGI24750J21931_1003276 3300002070 Bacteria 1943
19 JGI24745J21846_1002072 3300002073 Bacteria 2013
20 JGI24748J21848_1003376 3300002074 Bacteria 1823
21 JGI24749J21850_1005242 3300002076 Bacteria 1819
22 JGI24744J21845_10009246 3300002077 Bacteria 2023
23 JGI24744J21845_10010202 3300002077 Bacteria 1925
24 JGI24035J26624_1001816 3300002126 Bacteria 1996
25 JGI24033J26618_1002484 3300002155 Bacteria 1892
26 JGI24033J26618_1002773 3300002155 Bacteria 1811
27 JGI24034J26672_10004231 3300002239 Bacteria 2025
28 JGI24742J22300_10006045 3300002244 Bacteria 1995
29 JGI24742J22300_10006688 3300002244 Bacteria 1901
30 JGI24742J22300_10007104 3300002244 Bacteria 1845
31 JGI24742J22300_10007679 3300002244 Bacteria 1781
32 JGI24742J22300_10008609 3300002244 Bacteria 1684
33 Ga0007429J51699_1014162 3300003579 Bacteria 1990
34 Ga0007429J51699_1089451 3300003579 Bacteria 1736
35 JGI25404J52841_10008353 3300003659 Bacteria 2203
36 JGI25404J52841_10012942 3300003659 Bacteria 1810
37 Ga0032354_1096766 3300003693 Bacteria 1620
38 JGI25405J52794_10014531 3300003911 Bacteria 1539
39 Ga0058860_10059007 3300004801 Bacteria 1686
40 Ga0065704_10116717 3300005289 Bacteria 1848
41 Ga0065712_10089177 3300005290 Bacteria 2466
42 Ga0065715_10015540 3300005293 Bacteria 2203
43 Ga0065715_10023536 3300005293 Bacteria 1714
44 Ga0065715_10109413 3300005293 Bacteria 2669
45 Ga0065707_10126004 3300005295 Bacteria 2012
46 Ga0065707_10168001 3300005295 Bacteria 1507
47 Ga0070676_10059480 3300005328 Bacteria 2267
48 Ga0070676_10083531 3300005328 Bacteria 1942
49 Ga0070690_100013888 3300005330 Bacteria 4774
50 Ga0070670_100242450 3300005331 Bacteria 1569
51 Ga0068869_100160943 3300005334 Bacteria 1747
52 Ga0068869_100178928 3300005334 Bacteria 1662
53 Ga0070666_10060153 3300005335 Bacteria 2570
54 Ga0070666_10077044 3300005335 Bacteria 2275
55 Ga0070666_10106110 3300005335 Bacteria 1940
56 Ga0070666_10120690 3300005335 Bacteria 1818
57 Ga0070666_10159663 3300005335 Bacteria 1575
58 Ga0070680_100120669 3300005336 Bacteria 2188
59 Ga0070682_100079109 3300005337 Bacteria 2122
60 Ga0068868_100102700 3300005338 Bacteria 2315
61 Ga0070660_100092236 3300005339 Bacteria 2390
62 Ga0070689_100167762 3300005340 Bacteria 1778
63 Ga0070691_10042188 3300005341 Bacteria 2158
64 Ga0070687_100045834 3300005343 Bacteria 2235
65 Ga0070692_10035532 3300005345 Bacteria 2523
66 Ga0070668_100160598 3300005347 Bacteria 1823
67 Ga0070668_100168171 3300005347 Bacteria 1783
68 Ga0070668_100200694 3300005347 Bacteria 1637
69 Ga0070668_100257730 3300005347 Bacteria 1450
70 Ga0070669_100108423 3300005353 Bacteria 2104
71 Ga0070669_100138567 3300005353 Bacteria 1873
72 Ga0070675_100097854 3300005354 Bacteria 2467
73 Ga0070675_100126769 3300005354 Bacteria 2172
74 Ga0070671_100112257 3300005355 Bacteria 2290
75 Ga0070671_100175436 3300005355 Bacteria 1813
76 Ga0070671_100201818 3300005355 Bacteria 1686
77 Ga0070674_100067592 3300005356 Bacteria 2514
78 Ga0070674_100089876 3300005356 Bacteria 2214
79 Ga0070674_100172272 3300005356 Bacteria 1651
80 Ga0070674_100189980 3300005356 Bacteria 1579
81 Ga0070673_100036965 3300005364 Bacteria 3717
82 Ga0070673_100051846 3300005364 Bacteria 3216
83 Ga0070673_100092211 3300005364 Bacteria 2477
84 Ga0070673_100286879 3300005364 Bacteria 1445
85 Ga0070688_100083733 3300005365 Bacteria 2070
86 Ga0070659_100146298 3300005366 Bacteria 1925
87 Ga0070667_100140745 3300005367 Bacteria 2113
88 Ga0070667_100168492 3300005367 Bacteria 1932
89 Ga0070667_100195859 3300005367 Bacteria 1791
90 Ga0070709_10092037 3300005434 Bacteria 2002
91 Ga0070714_100104075 3300005435 Bacteria 2505
92 Ga0070713_100114860 3300005436 Bacteria 2352
93 Ga0070713_100152610 3300005436 Bacteria 2056
94 Ga0070713_100166102 3300005436 Bacteria 1973
95 Ga0070710_10035257 3300005437 Bacteria 2727
96 Ga0070710_10066094 3300005437 Bacteria 2073
97 Ga0070710_10073803 3300005437 Bacteria 1973
98 Ga0070710_10149468 3300005437 Bacteria 1439
99 Ga0070701_10048407 3300005438 Bacteria 2193
100 Ga0070701_10061082 3300005438 Bacteria 1986
101 Ga0070711_100091561 3300005439 Bacteria 2192
102 Ga0070711_100113545 3300005439 Bacteria 1992
103 Ga0070711_100116411 3300005439 Bacteria 1970
104 Ga0070711_100152229 3300005439 Bacteria 1745
105 Ga0070711_100154125 3300005439 Bacteria 1735
106 Ga0070711_100201419 3300005439 Bacteria 1536
107 Ga0070711_100249113 3300005439 Bacteria 1392
108 Ga0070705_100102714 3300005440 Bacteria 1808
109 Ga0070705_100131852 3300005440 Bacteria 1631
110 Ga0070700_100101127 3300005441 Bacteria 1899
111 Ga0070694_100090081 3300005444 Bacteria 2150
112 Ga0070708_100147329 3300005445 Bacteria 2187
113 Ga0070708_100266566 3300005445 Bacteria 1610
114 Ga0070708_100271307 3300005445 Bacteria 1596
115 Ga0070663_100089294 3300005455 Bacteria 2280
116 Ga0070663_100217249 3300005455 Bacteria 1499
117 Ga0070678_100083899 3300005456 Bacteria 2423
118 Ga0070678_100107456 3300005456 Bacteria 2176
119 Ga0070662_100065714 3300005457 Bacteria 2659
120 Ga0070662_100089124 3300005457 Bacteria 2313
121 Ga0070662_100098978 3300005457 Bacteria 2204
122 Ga0070662_100133921 3300005457 Bacteria 1914
123 Ga0070662_100193370 3300005457 Bacteria 1610
124 Ga0070681_10124952 3300005458 Bacteria 2505
125 Ga0068867_100039606 3300005459 Bacteria 3436
126 Ga0068867_100103524 3300005459 Bacteria 2177
127 Ga0068867_100142373 3300005459 Bacteria 1876
128 Ga0068867_100203354 3300005459 Bacteria 1586
129 Ga0070698_100351190 3300005471 Bacteria 1406
130 Ga0070699_100094955 3300005518 Bacteria 2610
131 Ga0070699_100198348 3300005518 Bacteria 1784
132 Ga0070679_100272135 3300005530 Bacteria 1648
133 Ga0070697_100118037 3300005536 Bacteria 2216
134 Ga0070697_100244341 3300005536 Bacteria 1533
135 Ga0068853_100141576 3300005539 Bacteria 2159
136 Ga0068853_100201937 3300005539 Bacteria 1809
137 Ga0070672_100085695 3300005543 Bacteria 2532
138 Ga0070686_100082615 3300005544 Bacteria 2131
139 Ga0070686_100090623 3300005544 Bacteria 2045
140 Ga0070696_100057008 3300005546 Bacteria 2726
141 Ga0070693_100031520 3300005547 Bacteria 2906
142 Ga0070693_100052946 3300005547 Bacteria 2328
143 Ga0070693_100141769 3300005547 Bacteria 1514
144 Ga0070665_100145136 3300005548 Bacteria 2376
145 Ga0070665_100158810 3300005548 Bacteria 2262
146 Ga0070665_100217162 3300005548 Bacteria 1913
147 Ga0068855_100189125 3300005563 Bacteria 2323
148 Ga0068856_100200794 3300005614 Bacteria 2008
149 Ga0070702_100029407 3300005615 Bacteria 2987
150 Ga0070702_100058493 3300005615 Bacteria 2233
151 Ga0070702_100096244 3300005615 Bacteria 1806
152 Ga0068859_100195774 3300005617 Bacteria 2105
153 Ga0068859_100232988 3300005617 Bacteria 1930
154 Ga0068864_100156037 3300005618 Bacteria 2072
155 Ga0068864_100182270 3300005618 Bacteria 1920
156 Ga0068866_10036796 3300005718 Bacteria 2399
157 Ga0068866_10049292 3300005718 Bacteria 2133
158 Ga0068866_10062740 3300005718 Bacteria 1934
159 Ga0068866_10138346 3300005718 Bacteria 1394
160 Ga0068861_100097458 3300005719 Bacteria 2332
161 Ga0068861_100131413 3300005719 Bacteria 2032
162 Ga0068861_100189914 3300005719 Bacteria 1716
163 Ga0068861_100234008 3300005719 Bacteria 1559
164 Ga0068863_100190138 3300005841 Bacteria 1973
165 Ga0068863_100222830 3300005841 Bacteria 1817
166 Ga0068863_100287572 3300005841 Bacteria 1593
167 Ga0068858_100119981 3300005842 Bacteria 2458
168 Ga0068858_100135764 3300005842 Bacteria 2308
169 Ga0068860_100191276 3300005843 Bacteria 1980
170 Ga0068860_100210802 3300005843 Bacteria 1885
171 Ga0068862_100135518 3300005844 Bacteria 2182
172 Ga0068862_100144061 3300005844 Bacteria 2116
173 Ga0068862_100182407 3300005844 Bacteria 1885
174 Ga0068862_100218061 3300005844 Bacteria 1726
175 Ga0081455_10048300 3300005937 Bacteria 3679
176 Ga0081455_10048429 3300005937 Bacteria 3673
177 Ga0081455_10176784 3300005937 Bacteria 1620
178 Ga0081540_1018457 3300005983 Bacteria 4277
179 Ga0081540_1049607 3300005983 Bacteria 2093
180 Ga0070717_10103610 3300006028 Bacteria 2419
181 Ga0070717_10117214 3300006028 Bacteria 2277
182 Ga0070717_10141225 3300006028 Bacteria 2077
183 Ga0070717_10203599 3300006028 Bacteria 1734
184 Ga0070717_10206803 3300006028 Bacteria 1721
185 Ga0075432_10029878 3300006058 Bacteria 1882
186 Ga0075432_10029908 3300006058 Bacteria 1882
187 Ga0070715_10018084 3300006163 Bacteria 2680
188 Ga0070716_100017253 3300006173 Bacteria 3739
189 Ga0070712_100076616 3300006175 Bacteria 2408
190 Ga0070712_100083289 3300006175 Bacteria 2322
191 Ga0070712_100085816 3300006175 Bacteria 2293
192 Ga0075367_10066085 3300006178 Bacteria 2166
193 Ga0075367_10070539 3300006178 Bacteria 2100
194 Ga0097621_100075112 3300006237 Bacteria 2800
195 Ga0097621_100081983 3300006237 Bacteria 2685
196 Ga0097621_100124602 3300006237 Bacteria 2188
197 Ga0097621_100132074 3300006237 Bacteria 2126
198 Ga0097621_100211245 3300006237 Bacteria 1688
199 Ga0075370_10030816 3300006353 Bacteria 2993
200 Ga0075370_10088763 3300006353 Bacteria 1782
201 Ga0068871_100077330 3300006358 Bacteria 2750
202 Ga0068871_100090289 3300006358 Bacteria 2551
203 Ga0068871_100101588 3300006358 Bacteria 2410
204 Ga0068871_100156098 3300006358 Bacteria 1949
205 Ga0068871_100170857 3300006358 Bacteria 1863
206 Ga0075428_100126163 3300006844 Bacteria 2785
207 Ga0075428_100156511 3300006844 Bacteria 2475
208 Ga0075428_100160693 3300006844 Bacteria 2439
209 Ga0075428_100180867 3300006844 Bacteria 2282
210 Ga0075428_100272944 3300006844 Bacteria 1819
211 Ga0075428_100305665 3300006844 Bacteria 1710
212 Ga0075430_100108667 3300006846 Bacteria 2314
213 Ga0075431_100166112 3300006847 Bacteria 2269
214 Ga0075431_100169366 3300006847 Bacteria 2245
215 Ga0075433_10098207 3300006852 Bacteria 2592
216 Ga0075433_10167470 3300006852 Bacteria 1955
217 Ga0075433_10186499 3300006852 Bacteria 1845
218 Ga0075434_100097928 3300006871 Bacteria 2938
219 Ga0075434_100167829 3300006871 Bacteria 2215
220 Ga0075434_100184059 3300006871 Bacteria 2109
221 Ga0075434_100217533 3300006871 Bacteria 1930
222 Ga0075434_100226849 3300006871 Bacteria 1887
223 Ga0075434_100236016 3300006871 Bacteria 1848
224 Ga0075434_100245585 3300006871 Bacteria 1810
225 Ga0075434_100254344 3300006871 Bacteria 1776
226 Ga0075434_100261227 3300006871 Bacteria 1750
227 Ga0068865_100092021 3300006881 Bacteria 2202
228 Ga0068865_100099083 3300006881 Bacteria 2130
229 Ga0068865_100111496 3300006881 Bacteria 2019
230 Ga0068865_100240391 3300006881 Bacteria 1424
231 Ga0075436_100080103 3300006914 Bacteria 2262
232 Ga0075436_100083782 3300006914 Bacteria 2213
233 Ga0097620_100195769 3300006931 Bacteria 2105
234 Ga0097620_100232990 3300006931 Bacteria 1930
235 Ga0075435_100100197 3300007076 Bacteria 2400
236 Ga0075435_100145204 3300007076 Bacteria 1993
237 Ga0075435_100168819 3300007076 Bacteria 1845
238 Ga0075435_100170048 3300007076 Bacteria 1838
239 Ga0075435_100207168 3300007076 Bacteria 1662
240 Ga0075435_100248981 3300007076 Bacteria 1512
241 Ga0099795_10025187 3300007788 Bacteria 1993
242 Ga0099795_10027906 3300007788 Bacteria 1914
243 Ga0105251_10073241 3300009011 Bacteria 1592
244 Ga0105240_10246158 3300009093 Bacteria 2070
245 Ga0111539_10157373 3300009094 Bacteria 2658
246 Ga0111539_10194587 3300009094 Bacteria 2365
247 Ga0111539_10213376 3300009094 Bacteria 2249
248 Ga0111539_10260072 3300009094 Bacteria 2020
249 Ga0111539_10379671 3300009094 Bacteria 1645
250 Ga0105245_10115794 3300009098 Bacteria 2498
251 Ga0105245_10116031 3300009098 Bacteria 2496
252 Ga0105247_10019146 3300009101 Bacteria 4110
253 Ga0105247_10054498 3300009101 Bacteria 2467
254 Ga0105247_10061858 3300009101 Bacteria 2322
255 Ga0105247_10075826 3300009101 Bacteria 2111
256 Ga0105247_10086359 3300009101 Bacteria 1985
257 Ga0114129_10214800 3300009147 Bacteria 2597
258 Ga0114129_10303264 3300009147 Bacteria 2128
259 Ga0114129_10360832 3300009147 Bacteria 1923
260 Ga0105243_10174977 3300009148 Bacteria 1862
261 Ga0105243_10267779 3300009148 Bacteria 1533
262 Ga0105241_10138150 3300009174 Bacteria 1981
263 Ga0105241_10178062 3300009174 Bacteria 1761
264 Ga0105242_10109037 3300009176 Bacteria 2357
265 Ga0105242_10133770 3300009176 Bacteria 2144
266 Ga0105242_10214288 3300009176 Bacteria 1718
267 Ga0105242_10244898 3300009176 Bacteria 1613
268 Ga0105242_10245433 3300009176 Bacteria 1611
269 Ga0105248_10187030 3300009177 Bacteria 2334
270 Ga0105248_10203259 3300009177 Bacteria 2232
271 Ga0105248_10356655 3300009177 Bacteria 1646
272 Ga0105237_10364086 3300009545 Bacteria 1450
273 Ga0105238_10161381 3300009551 Bacteria 2217
274 Ga0105238_10178299 3300009551 Bacteria 2101
275 Ga0105249_10111800 3300009553 Bacteria 2583
276 Ga0105249_10159978 3300009553 Bacteria 2175
277 Ga0105249_10199796 3300009553 Bacteria 1956
278 Ga0105249_10242695 3300009553 Bacteria 1782
279 Ga0099796_10016496 3300010159 Bacteria 2182
280 Ga0099796_10036954 3300010159 Bacteria 1629
281 Ga0105239_10197836 3300010375 Bacteria 2251
282 Ga0105239_10274749 3300010375 Bacteria 1896
283 Ga0105246_10051787 3300011119 Bacteria 2820
284 Ga0105246_10060309 3300011119 Bacteria 2635
285 Ga0157329_1000722 3300012491 Bacteria 1436
286 Ga0157339_1001501 3300012505 Bacteria 1438
287 Ga0157371_10094289 3300013102 Bacteria 2121
288 Ga0157371_10099508 3300013102 Bacteria 2062
289 Ga0157370_10237980 3300013104 Bacteria 1685
290 Ga0157369_10165763 3300013105 Bacteria 2330
291 Ga0157374_10314873 3300013296 Bacteria 1550
292 Ga0157378_10092630 3300013297 Bacteria 2749
293 Ga0157378_10094718 3300013297 Bacteria 2719
294 Ga0157378_10098004 3300013297 Bacteria 2673
295 Ga0163162_10431924 3300013306 Bacteria 1449
296 Ga0157375_10158487 3300013308 Bacteria 2404
297 Ga0157375_10248901 3300013308 Bacteria 1938
298 Ga0157375_10268965 3300013308 Bacteria 1866
299 Ga0163163_10158463 3300014325 Bacteria 2308
300 Ga0157380_10071568 3300014326 Bacteria 2805
301 Ga0157380_10165488 3300014326 Bacteria 1926
302 Ga0182008_10036739 3300014497 Bacteria 2451
303 Ga0157377_10000080 3300014745 Bacteria 74445
304 Ga0157379_10067755 3300014968 Bacteria 3190
305 Ga0157379_10153307 3300014968 Bacteria 2078
306 Ga0157379_10232685 3300014968 Bacteria 1671
307 Ga0157376_10061616 3300014969 Bacteria 3154
308 Ga0157376_10134277 3300014969 Bacteria 2212
309 Ga0157376_10137641 3300014969 Bacteria 2187
310 Ga0157376_10162089 3300014969 Bacteria 2028
311 Ga0157376_10178629 3300014969 Bacteria 1938
312 Ga0157376_10190126 3300014969 Bacteria 1882
313 Ga0157376_10308218 3300014969 Bacteria 1501
314 Ga0163161_10117052 3300017792 Bacteria 1998
315 Ga0163161_10118653 3300017792 Bacteria 1986
316 Ga0184602_121534 3300019161 Bacteria 1957
317 Ga0213873_10000875 3300021358 Bacteria 4859
318 Ga0213872_10020991 3300021361 Bacteria 3007
319 Ga0213872_10051235 3300021361 Bacteria 1873
320 Ga0213874_10011415 3300021377 Bacteria 2249
321 Ga0213876_10059055 3300021384 Bacteria 2024
322 Ga0224570_101704 3300022730 Bacteria 1578
323 Ga0247551_100096 3300023552 Bacteria 1937
324 Ga0247550_100048 3300023660 Bacteria 2066
325 Ga0228600_1001536 3300024123 Bacteria 1874
326 Ga0224572_1007934 3300024225 Bacteria 1955
327 Ga0224572_1007992 3300024225 Bacteria 1949
328 Ga0228598_1002583 3300024227 Bacteria 3933
329 Ga0228598_1005183 3300024227 Bacteria 2738
330 Ga0228598_1008875 3300024227 Bacteria 2021
331 Ga0209759_1013527 3300025256 Bacteria 2203
332 Ga0209051_1005278 3300025303 Bacteria 7614
333 Ga0207697_10008948 3300025315 Bacteria 4349
334 Ga0207697_10028389 3300025315 Bacteria 2289
335 Ga0207697_10038129 3300025315 Bacteria 1970
336 Ga0207713_1020043 3300025735 Bacteria 3253
337 Ga0207692_10049268 3300025898 Bacteria 2125
338 Ga0207692_10050782 3300025898 Bacteria 2099
339 Ga0207692_10053785 3300025898 Bacteria 2052
340 Ga0207692_10054721 3300025898 Bacteria 2039
341 Ga0207692_10055787 3300025898 Bacteria 2024
342 Ga0207692_10083458 3300025898 Bacteria 1714
343 Ga0207642_10034813 3300025899 Bacteria 2145
344 Ga0207642_10035574 3300025899 Bacteria 2129
345 Ga0207642_10040934 3300025899 Bacteria 2025
346 Ga0207642_10043355 3300025899 Bacteria 1984
347 Ga0207642_10058109 3300025899 Bacteria 1783
348 Ga0207710_10024444 3300025900 Bacteria 2602
349 Ga0207710_10026108 3300025900 Bacteria 2522
350 Ga0207710_10038893 3300025900 Bacteria 2104
351 Ga0207688_10021442 3300025901 Bacteria 3530
352 Ga0207688_10043468 3300025901 Bacteria 2502
353 Ga0207688_10060308 3300025901 Bacteria 2137
354 Ga0207688_10078293 3300025901 Bacteria 1884
355 Ga0207680_10010514 3300025903 Bacteria 4631
356 Ga0207680_10025747 3300025903 Bacteria 3249
357 Ga0207647_10001640 3300025904 Bacteria 17218
358 Ga0207647_10064697 3300025904 Bacteria 2222
359 Ga0207685_10025291 3300025905 Bacteria 2048
360 Ga0207685_10025827 3300025905 Bacteria 2034
361 Ga0207699_10068315 3300025906 Bacteria 2164
362 Ga0207699_10077102 3300025906 Bacteria 2055
363 Ga0207699_10077674 3300025906 Bacteria 2049
364 Ga0207699_10078249 3300025906 Bacteria 2042
365 Ga0207699_10084483 3300025906 Bacteria 1977
366 Ga0207699_10092182 3300025906 Bacteria 1904
367 Ga0207643_10053535 3300025908 Bacteria 2293
368 Ga0207643_10073050 3300025908 Bacteria 1977
369 Ga0207643_10089674 3300025908 Bacteria 1791
370 Ga0207705_10115699 3300025909 Bacteria 1985
371 Ga0207684_10039964 3300025910 Bacteria 3977
372 Ga0207684_10147851 3300025910 Bacteria 2021
373 Ga0207684_10151815 3300025910 Bacteria 1993
374 Ga0207684_10221647 3300025910 Bacteria 1632
375 Ga0207654_10016416 3300025911 Bacteria 3856
376 Ga0207654_10076549 3300025911 Bacteria 2003
377 Ga0207654_10123075 3300025911 Bacteria 1632
378 Ga0207707_10134235 3300025912 Bacteria 2164
379 Ga0207707_10146561 3300025912 Bacteria 2064
380 Ga0207695_10111573 3300025913 Bacteria 2714
381 Ga0207695_10249725 3300025913 Bacteria 1674
382 Ga0207671_10195376 3300025914 Bacteria 1579
383 Ga0207693_10103936 3300025915 Bacteria 2228
384 Ga0207693_10120699 3300025915 Bacteria 2058
385 Ga0207663_10013149 3300025916 Bacteria 4493
386 Ga0207663_10024929 3300025916 Bacteria 3450
387 Ga0207663_10076671 3300025916 Bacteria 2173
388 Ga0207663_10081324 3300025916 Bacteria 2121
389 Ga0207663_10086419 3300025916 Bacteria 2068
390 Ga0207663_10090789 3300025916 Bacteria 2026
391 Ga0207663_10103566 3300025916 Bacteria 1917
392 Ga0207663_10118526 3300025916 Bacteria 1808
393 Ga0207663_10140603 3300025916 Bacteria 1681
394 Ga0207663_10169762 3300025916 Bacteria 1548
395 Ga0207663_10179351 3300025916 Bacteria 1511
396 Ga0207663_10201753 3300025916 Bacteria 1435
397 Ga0207660_10166207 3300025917 Bacteria 1705
398 Ga0207657_10120075 3300025919 Bacteria 2163
399 Ga0207652_10283120 3300025921 Bacteria 1496
400 Ga0207652_10292687 3300025921 Bacteria 1469
401 Ga0207646_10171009 3300025922 Bacteria 1962
402 Ga0207681_10091025 3300025923 Bacteria 2178
403 Ga0207694_10114462 3300025924 Bacteria 2148
404 Ga0207694_10150664 3300025924 Bacteria 1873
405 Ga0207650_10027168 3300025925 Bacteria 4093
406 Ga0207650_10030800 3300025925 Bacteria 3869
407 Ga0207659_10113592 3300025926 Bacteria 2063
408 Ga0207659_10127470 3300025926 Bacteria 1959
409 Ga0207687_10060974 3300025927 Bacteria 2663
410 Ga0207687_10110126 3300025927 Bacteria 2042
411 Ga0207700_10025509 3300025928 Bacteria 4106
412 Ga0207700_10028818 3300025928 Bacteria 3911
413 Ga0207700_10053130 3300025928 Bacteria 3033
414 Ga0207700_10122323 3300025928 Bacteria 2112
415 Ga0207700_10144416 3300025928 Bacteria 1959
416 Ga0207700_10155152 3300025928 Bacteria 1896
417 Ga0207700_10157136 3300025928 Bacteria 1885
418 Ga0207700_10177655 3300025928 Bacteria 1780
419 Ga0207700_10235798 3300025928 Bacteria 1558
420 Ga0207664_10026373 3300025929 Bacteria 4391
421 Ga0207664_10066158 3300025929 Bacteria 2896
422 Ga0207664_10095710 3300025929 Bacteria 2443
423 Ga0207664_10109833 3300025929 Bacteria 2292
424 Ga0207664_10128610 3300025929 Bacteria 2129
425 Ga0207664_10137192 3300025929 Bacteria 2065
426 Ga0207644_10135513 3300025931 Bacteria 1890
427 Ga0207644_10164098 3300025931 Bacteria 1729
428 Ga0207690_10147595 3300025932 Bacteria 1740
429 Ga0207706_10101197 3300025933 Bacteria 2535
430 Ga0207706_10121870 3300025933 Bacteria 2293
431 Ga0207706_10139809 3300025933 Bacteria 2130
432 Ga0207706_10159787 3300025933 Bacteria 1981
433 Ga0207686_10092140 3300025934 Bacteria 2003
434 Ga0207686_10113912 3300025934 Bacteria 1829
435 Ga0207686_10157390 3300025934 Bacteria 1589
436 Ga0207686_10171030 3300025934 Bacteria 1532
437 Ga0207709_10002054 3300025935 Bacteria 13015
438 Ga0207709_10018016 3300025935 Bacteria 3950
439 Ga0207709_10096643 3300025935 Bacteria 1944
440 Ga0207709_10136562 3300025935 Bacteria 1680
441 Ga0207709_10163753 3300025935 Bacteria 1554
442 Ga0207670_10087130 3300025936 Bacteria 2199
443 Ga0207670_10144003 3300025936 Bacteria 1760
444 Ga0207669_10013077 3300025937 Bacteria 4107
445 Ga0207669_10086231 3300025937 Bacteria 2029
446 Ga0207669_10091441 3300025937 Bacteria 1982
447 Ga0207669_10092571 3300025937 Bacteria 1972
448 Ga0207669_10095754 3300025937 Bacteria 1946
449 Ga0207669_10161169 3300025937 Bacteria 1584
450 Ga0207704_10041408 3300025938 Bacteria 2701
451 Ga0207704_10071290 3300025938 Bacteria 2204
452 Ga0207704_10091267 3300025938 Bacteria 2001
453 Ga0207704_10098245 3300025938 Bacteria 1944
454 Ga0207665_10030968 3300025939 Bacteria 3539
455 Ga0207665_10038767 3300025939 Bacteria 3175
456 Ga0207665_10125508 3300025939 Bacteria 1817
457 Ga0207665_10201050 3300025939 Bacteria 1452
458 Ga0207691_10071251 3300025940 Bacteria 3137
459 Ga0207691_10166443 3300025940 Bacteria 1932
460 Ga0207691_10247672 3300025940 Bacteria 1539
461 Ga0207691_10283038 3300025940 Bacteria 1427
462 Ga0207711_10121333 3300025941 Bacteria 2334
463 Ga0207711_10182370 3300025941 Bacteria 1910
464 Ga0207711_10266520 3300025941 Bacteria 1575
465 Ga0207689_10141624 3300025942 Bacteria 1981
466 Ga0207689_10200912 3300025942 Bacteria 1645
467 Ga0207679_10124852 3300025945 Bacteria 2055
468 Ga0207679_10145269 3300025945 Bacteria 1923
469 Ga0207667_10280797 3300025949 Bacteria 1701
470 Ga0207667_10321923 3300025949 Bacteria 1579
471 Ga0207651_10063040 3300025960 Bacteria 2586
472 Ga0207651_10119659 3300025960 Bacteria 1994
473 Ga0207651_10144860 3300025960 Bacteria 1840
474 Ga0207712_10115145 3300025961 Bacteria 2024
475 Ga0207712_10115278 3300025961 Bacteria 2023
476 Ga0207712_10116479 3300025961 Bacteria 2014
477 Ga0207712_10170288 3300025961 Bacteria 1702
478 Ga0207668_10000119 3300025972 Bacteria 55547
479 Ga0207668_10097230 3300025972 Bacteria 2178
480 Ga0207668_10108196 3300025972 Bacteria 2080
481 Ga0207668_10114556 3300025972 Bacteria 2029
482 Ga0207640_10078926 3300025981 Bacteria 2242
483 Ga0207640_10079266 3300025981 Bacteria 2238
484 Ga0207658_10000347 3300025986 Bacteria 45971
485 Ga0207658_10186684 3300025986 Bacteria 1720
486 Ga0207677_10090393 3300026023 Bacteria 2225
487 Ga0207677_10103935 3300026023 Bacteria 2098
488 Ga0207703_10057586 3300026035 Bacteria 3170
489 Ga0207703_10116296 3300026035 Bacteria 2289
490 Ga0207703_10136429 3300026035 Bacteria 2124
491 Ga0207703_10179601 3300026035 Bacteria 1867
492 Ga0207639_10088768 3300026041 Bacteria 2468
493 Ga0207678_10043629 3300026067 Bacteria 3880
494 Ga0207678_10052514 3300026067 Bacteria 3516
495 Ga0207678_10072082 3300026067 Bacteria 2960
496 Ga0207678_10140520 3300026067 Bacteria 2061
497 Ga0207678_10223047 3300026067 Bacteria 1614
498 Ga0207708_10021338 3300026075 Bacteria 4883
499 Ga0207708_10114963 3300026075 Bacteria 2092
500 Ga0207708_10115901 3300026075 Bacteria 2084
501 Ga0207702_10113880 3300026078 Bacteria 2410
502 Ga0207702_10166230 3300026078 Bacteria 2018
503 Ga0207702_10265246 3300026078 Bacteria 1618
504 Ga0207641_10001333 3300026088 Bacteria 24434
505 Ga0207641_10166400 3300026088 Bacteria 2008
506 Ga0207648_10004849 3300026089 Bacteria 13717
507 Ga0207648_10039981 3300026089 Bacteria 4122
508 Ga0207648_10057334 3300026089 Bacteria 3398
509 Ga0207648_10077576 3300026089 Bacteria 2896
510 Ga0207648_10237828 3300026089 Bacteria 1621
511 Ga0207676_10157008 3300026095 Bacteria 1966
512 Ga0207676_10186691 3300026095 Bacteria 1820
513 Ga0207675_100097550 3300026118 Bacteria 2768
514 Ga0207675_100098959 3300026118 Bacteria 2747
515 Ga0207675_100121127 3300026118 Bacteria 2475
516 Ga0207675_100145037 3300026118 Bacteria 2257
517 Ga0207675_100224673 3300026118 Bacteria 1810
518 Ga0207675_100308456 3300026118 Bacteria 1543
519 Ga0207683_10025310 3300026121 Bacteria 5119
520 Ga0207683_10055568 3300026121 Bacteria 3472
521 Ga0207683_10127085 3300026121 Bacteria 2291
522 Ga0207683_10145603 3300026121 Bacteria 2136
523 Ga0207683_10150692 3300026121 Bacteria 2099
524 Ga0207698_10141670 3300026142 Bacteria 2073
525 Ga0207698_10180795 3300026142 Bacteria 1868
526 Ga0209489_120183 3300027361 Bacteria 1989
527 Ga0209179_1005488 3300027512 Bacteria 1989
528 Ga0209179_1005541 3300027512 Bacteria 1983
529 Ga0209179_1005904 3300027512 Bacteria 1943
530 Ga0209588_1022308 3300027671 Bacteria 1992
531 Ga0209588_1028465 3300027671 Bacteria 1778
532 Ga0209998_10009772 3300027717 Bacteria 1991
533 Ga0207428_10088428 3300027907 Bacteria 2409
534 Ga0207428_10103419 3300027907 Bacteria 2199
535 Ga0207428_10119816 3300027907 Bacteria 2019
536 Ga0207428_10140768 3300027907 Bacteria 1841
537 Ga0265358_100065 3300028010 Bacteria 1689
538 Ga0268266_10137271 3300028379 Bacteria 2191
539 Ga0268266_10210322 3300028379 Bacteria 1783
540 Ga0268265_10151381 3300028380 Bacteria 1957
541 Ga0268265_10220359 3300028380 Bacteria 1659
542 Ga0268265_10236418 3300028380 Bacteria 1609
543 Ga0268264_10142849 3300028381 Bacteria 2137
544 Ga0268264_10157528 3300028381 Bacteria 2042
545 Ga0268264_10168443 3300028381 Bacteria 1979
546 Ga0268264_10181814 3300028381 Bacteria 1910
547 Ga0268264_10275185 3300028381 Bacteria 1574
548 Ga0265334_10033696 3300028573 Bacteria 2036
549 Ga0265323_10021400 3300028653 Bacteria 2477
550 Ga0307517_10000970 3300028786 Bacteria 48633
551 Ga0307515_10132139 3300028794 Bacteria 2740
552 Ga0307515_10203441 3300028794 Bacteria 1848
553 Ga0307515_10242633 3300028794 Bacteria 1569
554 Ga0307515_10245417 3300028794 Bacteria 1553
555 Ga0265338_10110805 3300028800 Bacteria 2211
556 Ga0265324_10000366 3300029957 Bacteria 32818
557 Ga0307512_10021953 3300030522 Bacteria 5747
558 Ga0265769_100271 3300030888 Bacteria 1975
559 Ga0265760_10024581 3300031090 Bacteria 1755
560 Ga0265330_10016360 3300031235 Bacteria 3424
561 Ga0265330_10032230 3300031235 Bacteria 2348
562 Ga0265332_10034970 3300031238 Bacteria 2182
563 Ga0265328_10033570 3300031239 Bacteria 1902
564 Ga0265320_10027217 3300031240 Bacteria 2984
565 Ga0265325_10029379 3300031241 Bacteria 2955
566 Ga0265340_10036886 3300031247 Bacteria 2421
567 Ga0265331_10034908 3300031250 Bacteria 2477
568 Ga0265331_10047843 3300031250 Bacteria 2058
569 Ga0265316_10071769 3300031344 Bacteria 2668
570 Ga0265316_10093854 3300031344 Bacteria 2286
571 Ga0307513_10186603 3300031456 Bacteria 1930
572 Ga0307509_10053465 3300031507 Bacteria 4307
573 Ga0307509_10156853 3300031507 Bacteria 2180
574 Ga0265313_10003842 3300031595 Bacteria 11852
575 Ga0307508_10112232 3300031616 Bacteria 2326
576 Ga0307514_10089125 3300031649 Bacteria 2255
577 Ga0265314_10038445 3300031711 Bacteria 3456
578 Ga0265314_10105935 3300031711 Bacteria 1797
579 Ga0265342_10008005 3300031712 Bacteria 7654
580 Ga0316576_10060506 3300031727 Bacteria 2774
581 Ga0316578_10065563 3300031728 Bacteria 2144
582 Ga0307516_10150346 3300031730 Bacteria 2089
583 Ga0307516_10245789 3300031730 Bacteria 1486
584 Ga0316577_10067535 3300031733 Bacteria 1995
585 Ga0247548_100136 3300031814 Bacteria 2112
586 Ga0307510_10057847 3300033180 Bacteria 4019
587 Ga0373930_0002644 3300034816 Bacteria 2786
588 Ga0373930_0004626 3300034816 Bacteria 2249
589 Ga0373948_0004183 3300034817 Bacteria 2267
590 Ga0373948_0004293 3300034817 Bacteria 2246
591 Ga0373948_0005540 3300034817 Bacteria 2052
592 Ga0373950_0000581 3300034818 Bacteria 4496
593 Ga0373950_0004905 3300034818 Bacteria 1979
594 Ga0373950_0005622 3300034818 Bacteria 1879
595 Ga0373950_0005701 3300034818 Bacteria 1868
596 Ga0373958_0000620 3300034819 Bacteria 4429
597 Ga0373958_0003223 3300034819 Bacteria 2340
598 Ga0373959_0001167 3300034820 Bacteria 4244
599 Ga0373959_0006673 3300034820 Bacteria 1924
600 Ga0373959_0009224 3300034820 Bacteria 1696
601 Ga0373938_0001296 3300034957 Bacteria 4014
602 Ga0373938_0006526 3300034957 Bacteria 2019
603 Ga0373938_0007560 3300034957 Bacteria 1915
604 Ga0373938_0013661 3300034957 Bacteria 1544
605 Ga0373926_0006995 3300035083 Bacteria 3752
606 Ga0373926_0022456 3300035083 Bacteria 2189
607 Ga0373926_0026624 3300035083 Bacteria 2023
608 Ga0373926_0028835 3300035083 Bacteria 1949
609 Ga0373926_0029075 3300035083 Bacteria 1941
610 Ga0373926_0032719 3300035083 Bacteria 1835
611 Ga0373926_0043432 3300035083 Bacteria 1608
612 Ga0373926_0047324 3300035083 Bacteria 1545
613 Ga0373928_0000946 3300035084 Bacteria 5703
614 Ga0373928_0006891 3300035084 Bacteria 2189
615 Ga0373928_0007300 3300035084 Bacteria 2130
616 Ga0373928_0012096 3300035084 Bacteria 1717
617 Ga0373929_0001929 3300035085 Bacteria 3878
618 Ga0373929_0006669 3300035085 Bacteria 2090
619 Ga0373929_0007206 3300035085 Bacteria 2026
620 Ga0373929_0009835 3300035085 Bacteria 1778
621 Ga0373934_0013577 3300035086 Bacteria 3081
622 Ga0373934_0019405 3300035086 Bacteria 2609
623 Ga0373934_0032039 3300035086 Bacteria 2060
624 Ga0373934_0035872 3300035086 Bacteria 1952
625 Ga0373934_0046783 3300035086 Bacteria 1711
626 Ga0373940_0010842 3300035088 Bacteria 2152
627 Ga0373940_0011128 3300035088 Bacteria 2130
628 Ga0373940_0018103 3300035088 Bacteria 1763
629 Ga0373944_0014855 3300035089 Bacteria 2178
630 Ga0373944_0016429 3300035089 Bacteria 2087
631 Ga0373944_0021383 3300035089 Bacteria 1872
632 Ga0373944_0024960 3300035089 Bacteria 1756
633 Ga0373944_0034650 3300035089 Bacteria 1535
634 Ga0373944_0043614 3300035089 Bacteria 1394
635 Ga0373949_0001694 3300035090 Bacteria 6130
636 Ga0373949_0011756 3300035090 Bacteria 1931
637 Ga0373949_0012743 3300035090 Bacteria 1861
638 Ga0373949_0013882 3300035090 Bacteria 1790
639 Ga0373949_0015030 3300035090 Bacteria 1726
640 Ga0373949_0015471 3300035090 Bacteria 1704
641 Ga0373951_0009019 3300035091 Bacteria 2249
642 Ga0373951_0009934 3300035091 Bacteria 2138
643 Ga0373952_0003657 3300035092 Bacteria 2773
644 Ga0373952_0006744 3300035092 Bacteria 2132
645 Ga0373952_0007845 3300035092 Bacteria 2010
646 Ga0373952_0008810 3300035092 Bacteria 1919
647 Ga0373952_0010261 3300035092 Bacteria 1807
648 Ga0373952_0010284 3300035092 Bacteria 1805
649 Ga0373923_0018483 3300035111 Bacteria 2683
650 Ga0373923_0019969 3300035111 Bacteria 2598
651 Ga0373923_0025648 3300035111 Bacteria 2338
652 Ga0373923_0035979 3300035111 Bacteria 2018
653 Ga0373923_0053186 3300035111 Bacteria 1702
654 Ga0373932_0011001 3300035112 Bacteria 2202
655 Ga0373932_0015965 3300035112 Bacteria 1911
656 Ga0373932_0017556 3300035112 Bacteria 1838
657 Ga0373932_0019952 3300035112 Bacteria 1752
658 Ga0373932_0020402 3300035112 Bacteria 1737
659 Ga0373936_0018499 3300035113 Bacteria 2691
660 Ga0373936_0022073 3300035113 Bacteria 2478
661 Ga0373936_0029203 3300035113 Bacteria 2169
662 Ga0373936_0034041 3300035113 Bacteria 2022
663 Ga0373936_0034852 3300035113 Bacteria 2001
664 Ga0373936_0041728 3300035113 Bacteria 1840
665 Ga0373936_0048543 3300035113 Bacteria 1713
666 Ga0373936_0049141 3300035113 Bacteria 1703
667 Ga0373939_0000507 3300035114 Bacteria 9762
668 Ga0373939_0013571 3300035114 Bacteria 2099
669 Ga0373939_0014089 3300035114 Bacteria 2069
670 Ga0373939_0014583 3300035114 Bacteria 2042
671 Ga0373939_0017108 3300035114 Bacteria 1921
672 Ga0373939_0021455 3300035114 Bacteria 1768
673 Ga0373939_0025090 3300035114 Bacteria 1667
674 Ga0373941_0001278 3300035115 Bacteria 5292
675 Ga0373941_0002870 3300035115 Bacteria 3842
676 Ga0373941_0015100 3300035115 Bacteria 2075
677 Ga0373941_0016533 3300035115 Bacteria 2007
678 Ga0373941_0017809 3300035115 Bacteria 1953
679 Ga0373941_0041112 3300035115 Bacteria 1429
680 Ga0373945_0009851 3300035116 Bacteria 3135
681 Ga0373945_0017013 3300035116 Bacteria 2460
682 Ga0373945_0020459 3300035116 Bacteria 2265
683 Ga0373945_0022026 3300035116 Bacteria 2192
684 Ga0373945_0024237 3300035116 Bacteria 2101
685 Ga0373945_0024265 3300035116 Bacteria 2100
686 Ga0373945_0041168 3300035116 Bacteria 1669
687 Ga0373945_0041335 3300035116 Bacteria 1666
688 Ga0373945_0043898 3300035116 Bacteria 1623
689 Ga0373953_0012133 3300035117 Bacteria 3044
690 Ga0373953_0027360 3300035117 Bacteria 2191
691 Ga0373953_0028221 3300035117 Bacteria 2162
692 Ga0373953_0033980 3300035117 Bacteria 1997
693 Ga0373953_0039261 3300035117 Bacteria 1875
694 Ga0373953_0052928 3300035117 Bacteria 1644
695 Ga0373954_0035637 3300035118 Bacteria 2308
696 Ga0373954_0050070 3300035118 Bacteria 1959
697 Ga0373954_0052661 3300035118 Bacteria 1912
698 Ga0373954_0107734 3300035118 Bacteria 1346
699 Ga0373956_0013609 3300035119 Bacteria 3386
700 Ga0373956_0031977 3300035119 Bacteria 2307
701 Ga0373956_0032118 3300035119 Bacteria 2302
702 Ga0373956_0042988 3300035119 Bacteria 2010
703 Ga0373956_0046191 3300035119 Bacteria 1944
704 Ga0373956_0046381 3300035119 Bacteria 1941
705 Ga0373956_0056176 3300035119 Bacteria 1776
706 Ga0373957_0022818 3300035120 Bacteria 2232
707 Ga0373957_0027498 3300035120 Bacteria 2066
708 Ga0373957_0037771 3300035120 Bacteria 1805
709 Ga0373960_0002145 3300035121 Bacteria 4444
710 Ga0373960_0006003 3300035121 Bacteria 2831
711 Ga0373960_0012402 3300035121 Bacteria 2117
712 Ga0373960_0013073 3300035121 Bacteria 2074
713 Ga0373960_0014294 3300035121 Bacteria 2008
714 Ga0373960_0015841 3300035121 Bacteria 1930
715 Ga0373943_0022194 3300035170 Bacteria 2938
716 Ga0373943_0042122 3300035170 Bacteria 2211
717 Ga0373943_0045956 3300035170 Bacteria 2129
718 Ga0373943_0046084 3300035170 Bacteria 2126
719 Ga0373943_0046303 3300035170 Bacteria 2122
720 Ga0373943_0047595 3300035170 Bacteria 2097
721 Ga0373943_0052071 3300035170 Bacteria 2017
722 Ga0373943_0054791 3300035170 Bacteria 1973
723 Ga0373943_0055165 3300035170 Bacteria 1967
724 Ga0373943_0061960 3300035170 Bacteria 1871
725 Ga0373943_0074271 3300035170 Bacteria 1728
726 Ga0373943_0087541 3300035170 Bacteria 1607
727 Ga0373946_0023384 3300035171 Bacteria 2413
728 Ga0373946_0025465 3300035171 Bacteria 2326
729 Ga0373946_0027639 3300035171 Bacteria 2245
730 Ga0373946_0031856 3300035171 Bacteria 2114
731 Ga0373946_0047257 3300035171 Bacteria 1787
732 Ga0373946_0062722 3300035171 Bacteria 1585
733 Ga0373946_0075821 3300035171 Bacteria 1462
734 Ga0373955_0038184 3300035172 Bacteria 2557
735 Ga0373955_0050316 3300035172 Bacteria 2265
736 Ga0373955_0067671 3300035172 Bacteria 1988
737 Ga0373955_0084848 3300035172 Bacteria 1796
738 Ga0373955_0112589 3300035172 Bacteria 1574
739 Ga0373955_0114714 3300035172 Bacteria 1560
740 Ga0373942_0007684 3300035207 Bacteria 2506
741 Ga0373942_0008614 3300035207 Bacteria 2380
742 Ga0373942_0015948 3300035207 Bacteria 1837
743 Ga0373942_0019623 3300035207 Bacteria 1689
744 Ga0373961_0009229 3300035241 Bacteria 2410
745 Ga0373961_0012145 3300035241 Bacteria 2150
746 Ga0373961_0014244 3300035241 Bacteria 2017
747 Ga0373961_0021166 3300035241 Bacteria 1727
748 Ga0373962_0001001 3300035242 Bacteria 6532
749 Ga0373962_0012988 3300035242 Bacteria 2103
750 Ga0373962_0013251 3300035242 Bacteria 2084
751 Ga0373962_0014584 3300035242 Bacteria 2004
752 Ga0373962_0014884 3300035242 Bacteria 1987
753 Ga0373962_0026227 3300035242 Bacteria 1569
754 Ga0316574_0024526 3300035398 Bacteria 3610
755 Ga0316574_0077602 3300035398 Bacteria 2105
756 Ga0373924_0023989 3300035410 Bacteria 2399
757 Ga0373924_0025605 3300035410 Bacteria 2333
758 Ga0373924_0033533 3300035410 Bacteria 2073
759 Ga0373924_0038516 3300035410 Bacteria 1950
760 Ga0373931_0005795 3300035691 Bacteria 5742
761 Ga0373931_0011895 3300035691 Bacteria 4209
762 Ga0373931_0041301 3300035691 Bacteria 2422
763 Ga0373931_0041780 3300035691 Bacteria 2409
764 Ga0373931_0048262 3300035691 Bacteria 2256
765 Ga0373931_0055425 3300035691 Bacteria 2121
766 Ga0373931_0061126 3300035691 Bacteria 2030
767 Ga0373931_0063323 3300035691 Bacteria 1998
768 Ga0373931_0108319 3300035691 Bacteria 1572
769 Ga0373931_0110886 3300035691 Bacteria 1556
770 Ga0373935_0047080 3300035692 Bacteria 2725
771 Ga0373935_0073803 3300035692 Bacteria 2204
772 Ga0373935_0077338 3300035692 Bacteria 2156
773 Ga0373935_0086766 3300035692 Bacteria 2042
774 Ga0373935_0087760 3300035692 Bacteria 2031
775 Ga0373935_0088573 3300035692 Bacteria 2022
776 Ga0373935_0092325 3300035692 Bacteria 1983
777 Ga0373935_0100090 3300035692 Bacteria 1909
778 Ga0373935_0126734 3300035692 Bacteria 1711
779 Ga0373935_0127803 3300035692 Bacteria 1704
780 Ga0373935_0137298 3300035692 Bacteria 1648
781 Ga0373927_0007068 3300035695 Bacteria 7612
782 Ga0373927_0014831 3300035695 Bacteria 5153
783 Ga0373927_0057521 3300035695 Bacteria 2514
784 Ga0373927_0065844 3300035695 Bacteria 2343
785 Ga0373927_0073016 3300035695 Bacteria 2221
786 Ga0373927_0083316 3300035695 Bacteria 2073
787 Ga0373927_0086758 3300035695 Bacteria 2031
788 Ga0373927_0088128 3300035695 Bacteria 2014
789 Ga0373927_0091587 3300035695 Bacteria 1974
790 Ga0373927_0091884 3300035695 Bacteria 1971
791 Ga0373927_0104679 3300035695 Bacteria 1842
792 Ga0373927_0119149 3300035695 Bacteria 1722
793 Ga0373927_0124794 3300035695 Bacteria 1680
794 Ga0373927_0176869 3300035695 Bacteria 1399
795 Ga0373933_0027794 3300035724 Bacteria 3260
796 Ga0373933_0057552 3300035724 Bacteria 2336
797 Ga0373933_0067829 3300035724 Bacteria 2165
798 Ga0373933_0070012 3300035724 Bacteria 2133
799 Ga0373933_0086353 3300035724 Bacteria 1930
800 Ga0373933_0097530 3300035724 Bacteria 1820
801 Ga0373933_0141414 3300035724 Bacteria 1519
802 Ga0373933_0153653 3300035724 Bacteria 1458
803 Ga0373947_0025663 3300035725 Bacteria 3436
804 Ga0373947_0036040 3300035725 Bacteria 2931
805 Ga0373947_0072958 3300035725 Bacteria 2108
806 Ga0373947_0074042 3300035725 Bacteria 2094
807 Ga0373947_0075735 3300035725 Bacteria 2072
808 Ga0373947_0078723 3300035725 Bacteria 2035
809 Ga0373947_0087998 3300035725 Bacteria 1932
810 Ga0373947_0093467 3300035725 Bacteria 1879
811 Ga0373947_0127573 3300035725 Bacteria 1621
812 Ga0373947_0132125 3300035725 Bacteria 1594
813 Ga0373947_0163066 3300035725 Bacteria 1442
814 Ga0373937_0007313 3300036401 Bacteria 9557
815 Ga0373937_0019580 3300036401 Bacteria 6057
816 Ga0373937_0078280 3300036401 Bacteria 3055
817 Ga0373937_0119884 3300036401 Bacteria 2451
818 Ga0373937_0126289 3300036401 Bacteria 2386
819 Ga0373937_0134547 3300036401 Bacteria 2310
820 Ga0373937_0156136 3300036401 Bacteria 2138
821 Ga0373937_0166916 3300036401 Bacteria 2064
822 Ga0373937_0176371 3300036401 Bacteria 2006
823 Ga0373937_0176532 3300036401 Bacteria 2005
824 Ga0373937_0187234 3300036401 Bacteria 1944
825 Ga0373937_0239078 3300036401 Bacteria 1711
826 Ga0316582_0066463 3300036647 Bacteria 2324
827 Ga0316584_0089511 3300036712 Bacteria 2304
828 Ga0373925_0060284 3300037068 Bacteria 2849
829 Ga0373925_0078393 3300037068 Bacteria 2508
830 Ga0373925_0087543 3300037068 Bacteria 2377
831 Ga0373925_0089419 3300037068 Bacteria 2352
832 Ga0373925_0098733 3300037068 Bacteria 2241
833 Ga0373925_0109080 3300037068 Bacteria 2136
834 Ga0373925_0112429 3300037068 Bacteria 2105
835 Ga0373925_0118313 3300037068 Bacteria 2054
836 Ga0373925_0126950 3300037068 Bacteria 1985
837 Ga0373925_0161988 3300037068 Bacteria 1762
838 Ga0373925_0163238 3300037068 Bacteria 1755
839 Ga0373925_0176561 3300037068 Bacteria 1688
840 Ga0373925_0203343 3300037068 Bacteria 1575
841 Ga0395900_0103240 3300037418 Bacteria 2928
842 Ga0400487_34578 3300039110 Bacteria 1893
843 Ga0436365_0312816 3300039437 Bacteria 3221
844 Ga0436365_0382575 3300039437 Bacteria 2749
845 Ga0436360_0942193 3300039438 Bacteria 1630
846 Ga0436360_1200571 3300039438 Bacteria 2163
847 Ga0436361_0246471 3300039447 Bacteria 2252
848 Ga0436361_0473542 3300039447 Bacteria 2478
849 Ga0436361_0636700 3300039447 Bacteria 4079
850 Ga0436361_0670461 3300039447 Bacteria 3483
851 Ga0436361_0698129 3300039447 Bacteria 2209
852 Ga0436361_0718864 3300039447 Bacteria 1619
853 Ga0436363_0131824 3300039450 Bacteria 5098
854 Ga0436363_0158283 3300039450 Bacteria 3095
855 Ga0436362_0106990 3300039453 Bacteria 2275
856 Ga0436362_0261345 3300039453 Bacteria 2851
857 Ga0436362_0534509 3300039453 Bacteria 1673
858 Ga0439453_0003922 3300041408 Bacteria 2179
859 Ga0439441_001846 3300042001 Bacteria 2881
860 Ga0439448_0007438 3300042005 Bacteria 3175
861 Ga0439450_000217 3300042008 Bacteria 6866
862 Ga0439455_0008214 3300042012 Bacteria 2232
863 Ga0450923_005932 3300042125 Bacteria 1995
864 Ga0439458_0007191 3300042157 Bacteria 2477
865 Ga0439444_0004221 3300042437 Bacteria 2077
866 Ga0439459_0002947 3300042438 Bacteria 2665
867 Ga0439464_0000038 3300042439 Bacteria 16614
868 Ga0439460_0027438 3300042461 Bacteria 1599
869 Ga0466972_0048971 3300044658 Bacteria 2041
870 Ga0466972_0051164 3300044658 Bacteria 1993
871 Ga0466965_0040755 3300044683 Bacteria 2287
872 Ga0466964_0010858 3300044706 Bacteria 3440
873 Ga0453684_0003111 3300044712 Bacteria 38224
874 Ga0466968_0001716 3300044735 Bacteria 7903
875 Ga0466960_0029442 3300044901 Bacteria 2520
876 Ga0451576_0263042 3300045051 Bacteria 1803
877 Ga0466967_0246701 3300045976 Bacteria 1704
878 Ga0495617_008605 3300046452 Bacteria 3513
879 Ga0495617_020509 3300046452 Bacteria 2233
880 Ga0495617_023689 3300046452 Bacteria 2073
881 Ga0495617_025672 3300046452 Bacteria 1985
882 Ga0495617_030838 3300046452 Bacteria 1801
883 Ga0495617_038542 3300046452 Bacteria 1598
884 Ga0495627_019853 3300046453 Bacteria 2247
885 Ga0495627_026179 3300046453 Bacteria 1883
886 Ga0495592_0011412 3300046454 Bacteria 6723
887 Ga0495592_0040501 3300046454 Bacteria 3496
888 Ga0495592_0043444 3300046454 Bacteria 3362
889 Ga0495592_0050071 3300046454 Bacteria 3104
890 Ga0495592_0056195 3300046454 Bacteria 2909
891 Ga0495592_0069982 3300046454 Bacteria 2557
892 Ga0495592_0081367 3300046454 Bacteria 2341
893 Ga0495592_0094297 3300046454 Bacteria 2142
894 Ga0495592_0102495 3300046454 Bacteria 2037
895 Ga0495592_0138453 3300046454 Bacteria 1695
896 Ga0495592_0150097 3300046454 Bacteria 1612
897 Ga0495603_0018781 3300046455 Bacteria 4184
898 Ga0495603_0063660 3300046455 Bacteria 2175
899 Ga0495603_0070247 3300046455 Bacteria 2058
900 Ga0495603_0071214 3300046455 Bacteria 2043
901 Ga0495603_0075984 3300046455 Bacteria 1971
902 Ga0495603_0076895 3300046455 Bacteria 1958
903 Ga0495603_0078817 3300046455 Bacteria 1931
904 Ga0495603_0086777 3300046455 Bacteria 1831
905 Ga0495590_0002715 3300046457 Bacteria 7313
906 Ga0495590_0027418 3300046457 Bacteria 1998
907 Ga0495590_0037365 3300046457 Bacteria 1693
908 Ga0495591_016384 3300046458 Bacteria 2582
909 Ga0495629_0006149 3300046459 Bacteria 8916
910 Ga0495629_0037338 3300046459 Bacteria 3424
911 Ga0495629_0042309 3300046459 Bacteria 3202
912 Ga0495629_0067262 3300046459 Bacteria 2500
913 Ga0495629_0090664 3300046459 Bacteria 2133
914 Ga0495629_0090856 3300046459 Bacteria 2130
915 Ga0495629_0102877 3300046459 Bacteria 1992
916 Ga0495629_0109757 3300046459 Bacteria 1923
917 Ga0495629_0114280 3300046459 Bacteria 1881
918 Ga0495629_0140062 3300046459 Bacteria 1683
919 Ga0495629_0141265 3300046459 Bacteria 1675
920 Ga0495638_0018463 3300046460 Bacteria 4631
921 Ga0495638_0075879 3300046460 Bacteria 2048
922 Ga0495638_0081079 3300046460 Bacteria 1970
923 Ga0495638_0102866 3300046460 Bacteria 1706
924 Ga0495641_0012648 3300046461 Bacteria 4702
925 Ga0495641_0033106 3300046461 Bacteria 2455
926 Ga0495641_0034995 3300046461 Bacteria 2370
927 Ga0495641_0035897 3300046461 Bacteria 2332
928 Ga0495641_0046260 3300046461 Bacteria 2001
929 Ga0495641_0061712 3300046461 Bacteria 1691
930 Ga0495651_0035973 3300046462 Bacteria 3854
931 Ga0495651_0047705 3300046462 Bacteria 3309
932 Ga0495651_0048217 3300046462 Bacteria 3290
933 Ga0495651_0080442 3300046462 Bacteria 2461
934 Ga0495651_0085280 3300046462 Bacteria 2378
935 Ga0495651_0098957 3300046462 Bacteria 2175
936 Ga0495651_0103181 3300046462 Bacteria 2119
937 Ga0495651_0104839 3300046462 Bacteria 2098
938 Ga0495651_0105388 3300046462 Bacteria 2091
939 Ga0495651_0105553 3300046462 Bacteria 2089
940 Ga0495651_0111624 3300046462 Bacteria 2020
941 Ga0495653_0036782 3300046463 Bacteria 3853
942 Ga0495653_0051123 3300046463 Bacteria 3174
943 Ga0495653_0069246 3300046463 Bacteria 2644
944 Ga0495653_0095913 3300046463 Bacteria 2157
945 Ga0495653_0124359 3300046463 Bacteria 1833
946 Ga0495653_0151367 3300046463 Bacteria 1620
947 Ga0495653_0159121 3300046463 Bacteria 1569
948 Ga0495650_0032615 3300046471 Bacteria 2327
949 Ga0495650_0039373 3300046471 Bacteria 2040
950 Ga0495650_0039980 3300046471 Bacteria 2018
951 Ga0495650_0040413 3300046471 Bacteria 2002
952 Ga0495650_0040515 3300046471 Bacteria 1998
953 Ga0495650_0044241 3300046471 Bacteria 1883
954 Ga0495580_0000880 3300046472 Bacteria 26042
955 Ga0495580_0048764 3300046472 Bacteria 2996
956 Ga0495580_0054131 3300046472 Bacteria 2831
957 Ga0495580_0093419 3300046472 Bacteria 2093
958 Ga0495580_0103160 3300046472 Bacteria 1982
959 Ga0495580_0106586 3300046472 Bacteria 1946
960 Ga0495580_0114240 3300046472 Bacteria 1875
961 Ga0495580_0119052 3300046472 Bacteria 1833
962 Ga0495580_0125337 3300046472 Bacteria 1782
963 Ga0495580_0132887 3300046472 Bacteria 1725
964 Ga0495580_0133443 3300046472 Bacteria 1721
965 Ga0495582_0010960 3300046473 Bacteria 4989
966 Ga0495582_0030790 3300046473 Bacteria 2947
967 Ga0495582_0052335 3300046473 Bacteria 2251
968 Ga0495582_0052831 3300046473 Bacteria 2240
969 Ga0495582_0066369 3300046473 Bacteria 1993
970 Ga0495582_0070271 3300046473 Bacteria 1936
971 Ga0495582_0074957 3300046473 Bacteria 1873
972 Ga0495582_0127235 3300046473 Bacteria 1438
973 Ga0495605_0021678 3300046474 Bacteria 3400
974 Ga0495605_0025911 3300046474 Bacteria 3051
975 Ga0495605_0031097 3300046474 Bacteria 2729
976 Ga0495605_0041011 3300046474 Bacteria 2307
977 Ga0495605_0044532 3300046474 Bacteria 2193
978 Ga0495605_0066557 3300046474 Bacteria 1711
979 Ga0495639_0013188 3300046475 Bacteria 3566
980 Ga0495639_0017612 3300046475 Bacteria 3104
981 Ga0495639_0026386 3300046475 Bacteria 2567
982 Ga0495639_0035445 3300046475 Bacteria 2232
983 Ga0495639_0045413 3300046475 Bacteria 1987
984 Ga0495639_0073528 3300046475 Bacteria 1582
985 Ga0495662_0008404 3300046476 Bacteria 5077
986 Ga0495662_0025773 3300046476 Bacteria 2839
987 Ga0495662_0028706 3300046476 Bacteria 2685
988 Ga0495662_0039611 3300046476 Bacteria 2276
989 Ga0495662_0043105 3300046476 Bacteria 2178
990 Ga0495662_0045297 3300046476 Bacteria 2123
991 Ga0495662_0047303 3300046476 Bacteria 2076
992 Ga0495662_0050709 3300046476 Bacteria 2003
993 Ga0495662_0057550 3300046476 Bacteria 1877
994 Ga0495662_0073563 3300046476 Bacteria 1657
995 Ga0495664_0020362 3300046477 Bacteria 3825
996 Ga0495664_0020432 3300046477 Bacteria 3819
997 Ga0495664_0033433 3300046477 Bacteria 3021
998 Ga0495664_0060965 3300046477 Bacteria 2246
999 Ga0495664_0068180 3300046477 Bacteria 2122
1000 Ga0495664_0088641 3300046477 Bacteria 1859
1001 Ga0495664_0102074 3300046477 Bacteria 1728
1002 Ga0495664_0117936 3300046477 Bacteria 1604
1003 Ga0495664_0162135 3300046477 Bacteria 1356
1004 Ga0495584_0014579 3300046491 Bacteria 4006
1005 Ga0495584_0045356 3300046491 Bacteria 2217
1006 Ga0495584_0052355 3300046491 Bacteria 2054
1007 Ga0495584_0054238 3300046491 Bacteria 2017
1008 Ga0495585_0016070 3300046492 Bacteria 4339
1009 Ga0495585_0030086 3300046492 Bacteria 3089
1010 Ga0495585_0038965 3300046492 Bacteria 2673
1011 Ga0495585_0054498 3300046492 Bacteria 2210
1012 Ga0495585_0056407 3300046492 Bacteria 2169
1013 Ga0495585_0061064 3300046492 Bacteria 2073
1014 Ga0495585_0064709 3300046492 Bacteria 2004
1015 Ga0495594_0020857 3300046499 Bacteria 3493
1016 Ga0495594_0037871 3300046499 Bacteria 2632
1017 Ga0495594_0052904 3300046499 Bacteria 2235
1018 Ga0495594_0059598 3300046499 Bacteria 2111
1019 Ga0495594_0062521 3300046499 Bacteria 2061
1020 Ga0495594_0065479 3300046499 Bacteria 2015
1021 Ga0495594_0121191 3300046499 Bacteria 1478
1022 Ga0495596_0016574 3300046500 Bacteria 3059
1023 Ga0495596_0026630 3300046500 Bacteria 2328
1024 Ga0495596_0027666 3300046500 Bacteria 2278
1025 Ga0495596_0033435 3300046500 Bacteria 2046
1026 Ga0495596_0035538 3300046500 Bacteria 1975
1027 Ga0495596_0035974 3300046500 Bacteria 1962
1028 Ga0495596_0040697 3300046500 Bacteria 1834
1029 Ga0495596_0043665 3300046500 Bacteria 1766
1030 Ga0495596_0050725 3300046500 Bacteria 1626
1031 Ga0495607_0020383 3300046501 Bacteria 4192
1032 Ga0495607_0064600 3300046501 Bacteria 2066
1033 Ga0495607_0068901 3300046501 Bacteria 1982
1034 Ga0495607_0077116 3300046501 Bacteria 1841
1035 Ga0495583_0029046 3300046506 Bacteria 2709
1036 Ga0495583_0043912 3300046506 Bacteria 2078
1037 Ga0495606_0065670 3300046507 Bacteria 2304
1038 Ga0495606_0068819 3300046507 Bacteria 2238
1039 Ga0495606_0071302 3300046507 Bacteria 2188
1040 Ga0495606_0130195 3300046507 Bacteria 1496
1041 Ga0495608_0014629 3300046511 Bacteria 5443
1042 Ga0495608_0034014 3300046511 Bacteria 3441
1043 Ga0495608_0050596 3300046511 Bacteria 2756
1044 Ga0495608_0060196 3300046511 Bacteria 2499
1045 Ga0495608_0079876 3300046511 Bacteria 2126
1046 Ga0495608_0086848 3300046511 Bacteria 2026
1047 Ga0495608_0097009 3300046511 Bacteria 1903
1048 Ga0495608_0108826 3300046511 Bacteria 1782
1049 Ga0495610_0013838 3300046512 Bacteria 4770
1050 Ga0495610_0047181 3300046512 Bacteria 2120
1051 Ga0495610_0049342 3300046512 Bacteria 2061
1052 Ga0495616_0024318 3300046513 Bacteria 3249
1053 Ga0495616_0040654 3300046513 Bacteria 2374
1054 Ga0495616_0043367 3300046513 Bacteria 2285
1055 Ga0495616_0049485 3300046513 Bacteria 2106
1056 Ga0495618_0034860 3300046514 Bacteria 3158
1057 Ga0495618_0044246 3300046514 Bacteria 2808
1058 Ga0495618_0061014 3300046514 Bacteria 2391
1059 Ga0495618_0064599 3300046514 Bacteria 2325
1060 Ga0495618_0071592 3300046514 Bacteria 2205
1061 Ga0495620_0045055 3300046515 Bacteria 1913
1062 Ga0495628_0004856 3300046516 Bacteria 11833
1063 Ga0495628_0042604 3300046516 Bacteria 3620
1064 Ga0495628_0079254 3300046516 Bacteria 2553
1065 Ga0495628_0092681 3300046516 Bacteria 2336
1066 Ga0495628_0093770 3300046516 Bacteria 2321
1067 Ga0495628_0110516 3300046516 Bacteria 2114
1068 Ga0495628_0125313 3300046516 Bacteria 1968
1069 Ga0495628_0131756 3300046516 Bacteria 1911
1070 Ga0495630_0045276 3300046517 Bacteria 3287
1071 Ga0495630_0052557 3300046517 Bacteria 3050
1072 Ga0495630_0101079 3300046517 Bacteria 2181
1073 Ga0495630_0103202 3300046517 Bacteria 2157
1074 Ga0495630_0107175 3300046517 Bacteria 2116
1075 Ga0495630_0113875 3300046517 Bacteria 2049
1076 Ga0495631_0006458 3300046518 Bacteria 6051
1077 Ga0495631_0020194 3300046518 Bacteria 3115
1078 Ga0495631_0021815 3300046518 Bacteria 2980
1079 Ga0495631_0036836 3300046518 Bacteria 2182
1080 Ga0495631_0038131 3300046518 Bacteria 2137
1081 Ga0495631_0040872 3300046518 Bacteria 2053
1082 Ga0495631_0048622 3300046518 Bacteria 1859
1083 Ga0495631_0060397 3300046518 Bacteria 1644
1084 Ga0495632_0028974 3300046519 Bacteria 2886
1085 Ga0495632_0037177 3300046519 Bacteria 2472
1086 Ga0495632_0073629 3300046519 Bacteria 1637
1087 Ga0495637_0020653 3300046520 Bacteria 3027
1088 Ga0495637_0039829 3300046520 Bacteria 2025
1089 Ga0495637_0041797 3300046520 Bacteria 1964
1090 Ga0495643_0047491 3300046522 Bacteria 2324
1091 Ga0495644_0023582 3300046523 Bacteria 2342
1092 Ga0495644_0028617 3300046523 Bacteria 2108
1093 Ga0495644_0030987 3300046523 Bacteria 2019
1094 Ga0495644_0031018 3300046523 Bacteria 2018
1095 Ga0495644_0035425 3300046523 Bacteria 1884
1096 Ga0495644_0040698 3300046523 Bacteria 1751
1097 Ga0495644_0048045 3300046523 Bacteria 1602
1098 Ga0495648_0012902 3300046524 Bacteria 6206
1099 Ga0495648_0056926 3300046524 Bacteria 2348
1100 Ga0495648_0075440 3300046524 Bacteria 1939
1101 Ga0495648_0077293 3300046524 Bacteria 1908
1102 Ga0495648_0084760 3300046524 Bacteria 1792
1103 Ga0495663_0015446 3300046525 Bacteria 2151
1104 Ga0495663_0016062 3300046525 Bacteria 2114
1105 Ga0495663_0017858 3300046525 Bacteria 2016
1106 Ga0495663_0018904 3300046525 Bacteria 1965
1107 Ga0495663_0018947 3300046525 Bacteria 1963
1108 Ga0495666_0016750 3300046526 Bacteria 3649
1109 Ga0495666_0022058 3300046526 Bacteria 3153
1110 Ga0495666_0023259 3300046526 Bacteria 3064
1111 Ga0495666_0041216 3300046526 Bacteria 2236
1112 Ga0495666_0044454 3300046526 Bacteria 2144
1113 Ga0495666_0044584 3300046526 Bacteria 2140
1114 Ga0495666_0052870 3300046526 Bacteria 1950
1115 Ga0495666_0077042 3300046526 Bacteria 1580
1116 Ga0495666_0092897 3300046526 Bacteria 1423
1117 Ga0495642_0020825 3300046528 Bacteria 2578
1118 Ga0495642_0032613 3300046528 Bacteria 2090
1119 Ga0495642_0033883 3300046528 Bacteria 2054
1120 Ga0495642_0035371 3300046528 Bacteria 2015
1121 Ga0495642_0043162 3300046528 Bacteria 1838
1122 Ga0495642_0060192 3300046528 Bacteria 1574
1123 Ga0495652_0048344 3300046529 Bacteria 3645
1124 Ga0495652_0049250 3300046529 Bacteria 3607
1125 Ga0495652_0054943 3300046529 Bacteria 3388
1126 Ga0495652_0062851 3300046529 Bacteria 3128
1127 Ga0495652_0079071 3300046529 Bacteria 2720
1128 Ga0495652_0080947 3300046529 Bacteria 2680
1129 Ga0495652_0089016 3300046529 Bacteria 2528
1130 Ga0495652_0094216 3300046529 Bacteria 2442
1131 Ga0495652_0177482 3300046529 Bacteria 1638
1132 Ga0495654_0014800 3300046530 Bacteria 4148
1133 Ga0495654_0019427 3300046530 Bacteria 3553
1134 Ga0495654_0020068 3300046530 Bacteria 3488
1135 Ga0495654_0063469 3300046530 Bacteria 1768
1136 Ga0495654_0076339 3300046530 Bacteria 1579
1137 Ga0495665_0003029 3300046531 Bacteria 9077
1138 Ga0495665_0027501 3300046531 Bacteria 3052
1139 Ga0495665_0052306 3300046531 Bacteria 2162
1140 Ga0495665_0054511 3300046531 Bacteria 2112
1141 Ga0495665_0056543 3300046531 Bacteria 2071
1142 Ga0495665_0057527 3300046531 Bacteria 2052
1143 Ga0495665_0058208 3300046531 Bacteria 2040
1144 Ga0495665_0059320 3300046531 Bacteria 2019
1145 Ga0495665_0064412 3300046531 Bacteria 1934
1146 Ga0495665_0085517 3300046531 Bacteria 1657
1147 Ga0495665_0092561 3300046531 Bacteria 1588
1148 Ga0495640_0024783 3300046533 Bacteria 4359
1149 Ga0495640_0028141 3300046533 Bacteria 4048
1150 Ga0495640_0072256 3300046533 Bacteria 2312
1151 Ga0495640_0073346 3300046533 Bacteria 2291
1152 Ga0495640_0077616 3300046533 Bacteria 2213
1153 Ga0495640_0078047 3300046533 Bacteria 2206
1154 Ga0495640_0089823 3300046533 Bacteria 2028
1155 Ga0495640_0135955 3300046533 Bacteria 1587
1156 Ga0495640_0140880 3300046533 Bacteria 1554
1157 Ga0495586_0020384 3300046535 Bacteria 3531
1158 Ga0495586_0027514 3300046535 Bacteria 3042
1159 Ga0495586_0038083 3300046535 Bacteria 2581
1160 Ga0495586_0043125 3300046535 Bacteria 2430
1161 Ga0495586_0052389 3300046535 Bacteria 2209
1162 Ga0495586_0067346 3300046535 Bacteria 1952
1163 Ga0495586_0088717 3300046535 Bacteria 1706
1164 Ga0495587_0011536 3300046536 Bacteria 5594
1165 Ga0495587_0020418 3300046536 Bacteria 4090
1166 Ga0495587_0035885 3300046536 Bacteria 2985
1167 Ga0495587_0041088 3300046536 Bacteria 2760
1168 Ga0495587_0052910 3300046536 Bacteria 2394
1169 Ga0495587_0054912 3300046536 Bacteria 2346
1170 Ga0495587_0058230 3300046536 Bacteria 2270
1171 Ga0495587_0071458 3300046536 Bacteria 2018
1172 Ga0495587_0071907 3300046536 Bacteria 2011
1173 Ga0495587_0077330 3300046536 Bacteria 1932
1174 Ga0495587_0078300 3300046536 Bacteria 1918
1175 Ga0495587_0090596 3300046536 Bacteria 1766
1176 Ga0495587_0107585 3300046536 Bacteria 1603
1177 Ga0495598_0008844 3300046537 Bacteria 2357
1178 Ga0495598_0017112 3300046537 Bacteria 1863
1179 Ga0495598_0019449 3300046537 Bacteria 1781
1180 Ga0495609_0030368 3300046538 Bacteria 2459
1181 Ga0495609_0038789 3300046538 Bacteria 2146
1182 Ga0495609_0043373 3300046538 Bacteria 2019
1183 Ga0495609_0044208 3300046538 Bacteria 1998
1184 Ga0495609_0045169 3300046538 Bacteria 1974
1185 Ga0495621_0007581 3300046539 Bacteria 3221
1186 Ga0495621_0020080 3300046539 Bacteria 2188
1187 Ga0495621_0020565 3300046539 Bacteria 2167
1188 Ga0495621_0023642 3300046539 Bacteria 2045
1189 Ga0495621_0024274 3300046539 Bacteria 2024
1190 Ga0495621_0034668 3300046539 Bacteria 1744
1191 Ga0495621_0038333 3300046539 Bacteria 1671
1192 Ga0495621_0038904 3300046539 Bacteria 1661
1193 Ga0495621_0047343 3300046539 Bacteria 1528
1194 Ga0495597_0039555 3300046542 Bacteria 2111
1195 Ga0495597_0040728 3300046542 Bacteria 2076
1196 Ga0495597_0040785 3300046542 Bacteria 2074
1197 Ga0495645_0006552 3300046543 Bacteria 8087
1198 Ga0495645_0043096 3300046543 Bacteria 3291
1199 Ga0495645_0060671 3300046543 Bacteria 2741
1200 Ga0495645_0076582 3300046543 Bacteria 2407
1201 Ga0495645_0077563 3300046543 Bacteria 2388
1202 Ga0495645_0099966 3300046543 Bacteria 2063
1203 Ga0495645_0102976 3300046543 Bacteria 2028
1204 Ga0495645_0185116 3300046543 Bacteria 1423
1205 Ga0495645_0201764 3300046543 Bacteria 1348
1206 Ga0495622_0013934 3300046557 Bacteria 3731
1207 Ga0495622_0042867 3300046557 Bacteria 2103
1208 Ga0495622_0048450 3300046557 Bacteria 1974
1209 Ga0495622_0067333 3300046557 Bacteria 1654
1210 Ga0495622_0073962 3300046557 Bacteria 1571
1211 Ga0495633_0037709 3300046558 Bacteria 2311
1212 Ga0495633_0037713 3300046558 Bacteria 2311
1213 Ga0495633_0038281 3300046558 Bacteria 2291
1214 Ga0495633_0043974 3300046558 Bacteria 2117
1215 Ga0495633_0049606 3300046558 Bacteria 1980
1216 Ga0495633_0050373 3300046558 Bacteria 1963
1217 Ga0495633_0052718 3300046558 Bacteria 1915
1218 Ga0495633_0071103 3300046558 Bacteria 1623
1219 Ga0495633_0081410 3300046558 Bacteria 1506
1220 Ga0495667_0056626 3300046559 Bacteria 2577
1221 Ga0495667_0056661 3300046559 Bacteria 2576
1222 Ga0495667_0066155 3300046559 Bacteria 2363
1223 Ga0495667_0066894 3300046559 Bacteria 2348
1224 Ga0495667_0079781 3300046559 Bacteria 2127
1225 Ga0495667_0081374 3300046559 Bacteria 2105
1226 Ga0495667_0083563 3300046559 Bacteria 2073
1227 Ga0495667_0083780 3300046559 Bacteria 2070
1228 Ga0495667_0094245 3300046559 Bacteria 1938
1229 Ga0495667_0100051 3300046559 Bacteria 1876
1230 Ga0495667_0182454 3300046559 Bacteria 1346
1231 Ga0495656_0019432 3300046615 Bacteria 2622
1232 Ga0495656_0024257 3300046615 Bacteria 2393
1233 Ga0495656_0033132 3300046615 Bacteria 2106
1234 Ga0495656_0033950 3300046615 Bacteria 2085
1235 Ga0495656_0035583 3300046615 Bacteria 2046
1236 Ga0495656_0037253 3300046615 Bacteria 2007
1237 Ga0495656_0046150 3300046615 Bacteria 1842
1238 Ga0495668_0045799 3300046616 Bacteria 2431
1239 Ga0495668_0045859 3300046616 Bacteria 2429
1240 Ga0495668_0056678 3300046616 Bacteria 2162
1241 Ga0495668_0071304 3300046616 Bacteria 1909
1242 Ga0495634_0020538 3300046642 Bacteria 4682
1243 Ga0495634_0049509 3300046642 Bacteria 2825
1244 Ga0495634_0072191 3300046642 Bacteria 2270
1245 Ga0495634_0072813 3300046642 Bacteria 2260
1246 Ga0495634_0080011 3300046642 Bacteria 2139
1247 Ga0495634_0086066 3300046642 Bacteria 2047
1248 Ga0495634_0087992 3300046642 Bacteria 2020
1249 Ga0495634_0090058 3300046642 Bacteria 1993
1250 Ga0495634_0102889 3300046642 Bacteria 1844
1251 Ga0495634_0109724 3300046642 Bacteria 1775
1252 Ga0495634_0140364 3300046642 Bacteria 1534
1253 Ga0495611_0026294 3300046648 Bacteria 2538
1254 Ga0495611_0027575 3300046648 Bacteria 2483
1255 Ga0495611_0040329 3300046648 Bacteria 2081
1256 Ga0495611_0044614 3300046648 Bacteria 1983
1257 Ga0495625_0081765 3300046660 Bacteria 2247
1258 Ga0495625_0124665 3300046660 Bacteria 1749
1259 Ga0495625_0144949 3300046660 Bacteria 1599
1260 Ga0495635_0002979 3300046663 Bacteria 11620
1261 Ga0495635_0027913 3300046663 Bacteria 3925
1262 Ga0495635_0035500 3300046663 Bacteria 3456
1263 Ga0495635_0059712 3300046663 Bacteria 2622
1264 Ga0495635_0085309 3300046663 Bacteria 2160
1265 Ga0495635_0089635 3300046663 Bacteria 2104
1266 Ga0495635_0094472 3300046663 Bacteria 2044
1267 Ga0495635_0094808 3300046663 Bacteria 2040
1268 Ga0495635_0107936 3300046663 Bacteria 1901
1269 Ga0495635_0240344 3300046663 Bacteria 1222
1270 Ga0495659_0006430 3300046664 Bacteria 3707
1271 Ga0495659_0015791 3300046664 Bacteria 2485
1272 Ga0495659_0023853 3300046664 Bacteria 2081
1273 Ga0495659_0024405 3300046664 Bacteria 2062
1274 Ga0495659_0027133 3300046664 Bacteria 1973
1275 Ga0495661_0054055 3300046665 Bacteria 2412
1276 Ga0495661_0064668 3300046665 Bacteria 2157
1277 Ga0495661_0067868 3300046665 Bacteria 2093
1278 Ga0495661_0070877 3300046665 Bacteria 2038
1279 Ga0495661_0088218 3300046665 Bacteria 1771
1280 Ga0495588_0028149 3300046674 Bacteria 2811
1281 Ga0495588_0048702 3300046674 Bacteria 2177
1282 Ga0495588_0053996 3300046674 Bacteria 2072
1283 Ga0495588_0057846 3300046674 Bacteria 2003
1284 Ga0495588_0075131 3300046674 Bacteria 1760
1285 Ga0495588_0095669 3300046674 Bacteria 1557
1286 Ga0495657_0023797 3300046675 Bacteria 4372
1287 Ga0495657_0041514 3300046675 Bacteria 3146
1288 Ga0495657_0041696 3300046675 Bacteria 3139
1289 Ga0495657_0063083 3300046675 Bacteria 2445
1290 Ga0495657_0069497 3300046675 Bacteria 2304
1291 Ga0495657_0079730 3300046675 Bacteria 2120
1292 Ga0495657_0088575 3300046675 Bacteria 1989
1293 Ga0495657_0093043 3300046675 Bacteria 1930
1294 Ga0495657_0099063 3300046675 Bacteria 1859
1295 Ga0495657_0122957 3300046675 Bacteria 1633
1296 Ga0495657_0138232 3300046675 Bacteria 1520
1297 Ga0495657_0138522 3300046675 Bacteria 1518
1298 Ga0495599_0019366 3300046678 Bacteria 4242
1299 Ga0495599_0040766 3300046678 Bacteria 2915
1300 Ga0495599_0041173 3300046678 Bacteria 2901
1301 Ga0495599_0059385 3300046678 Bacteria 2392
1302 Ga0495599_0060938 3300046678 Bacteria 2358
1303 Ga0495599_0071195 3300046678 Bacteria 2170
1304 Ga0495599_0073672 3300046678 Bacteria 2131
1305 Ga0495599_0078119 3300046678 Bacteria 2066
1306 Ga0495599_0078633 3300046678 Bacteria 2059
1307 Ga0495599_0079350 3300046678 Bacteria 2049
1308 Ga0495599_0134255 3300046678 Bacteria 1536
1309 Ga0495623_0031253 3300046679 Bacteria 3423
1310 Ga0495623_0042678 3300046679 Bacteria 2888
1311 Ga0495623_0045734 3300046679 Bacteria 2780
1312 Ga0495623_0067241 3300046679 Bacteria 2237
1313 Ga0495623_0069670 3300046679 Bacteria 2191
1314 Ga0495623_0071450 3300046679 Bacteria 2159
1315 Ga0495623_0073924 3300046679 Bacteria 2118
1316 Ga0495623_0073982 3300046679 Bacteria 2117
1317 Ga0495623_0118561 3300046679 Bacteria 1596
1318 Ga0495646_0010082 3300046680 Bacteria 6008
1319 Ga0495646_0026121 3300046680 Bacteria 3668
1320 Ga0495646_0035044 3300046680 Bacteria 3114
1321 Ga0495646_0050763 3300046680 Bacteria 2512
1322 Ga0495646_0052661 3300046680 Bacteria 2457
1323 Ga0495646_0069763 3300046680 Bacteria 2072
1324 Ga0495646_0070946 3300046680 Bacteria 2050
1325 Ga0495646_0120882 3300046680 Bacteria 1482
1326 Ga0495647_0008647 3300046681 Bacteria 3426
1327 Ga0495647_0025989 3300046681 Bacteria 2142
1328 Ga0495647_0028325 3300046681 Bacteria 2064
1329 Ga0495647_0028396 3300046681 Bacteria 2062
1330 Ga0495647_0031429 3300046681 Bacteria 1974
1331 Ga0495647_0035710 3300046681 Bacteria 1867
1332 Ga0495647_0042211 3300046681 Bacteria 1740
1333 Ga0495658_0032854 3300046683 Bacteria 2836
1334 Ga0495658_0046233 3300046683 Bacteria 2446
1335 Ga0495658_0048064 3300046683 Bacteria 2404
1336 Ga0495658_0055193 3300046683 Bacteria 2262
1337 Ga0495658_0055508 3300046683 Bacteria 2256
1338 Ga0495658_0076021 3300046683 Bacteria 1961
1339 Ga0495658_0077784 3300046683 Bacteria 1940
1340 Ga0495658_0097561 3300046683 Bacteria 1749
1341 Ga0495658_0144772 3300046683 Bacteria 1455
1342 Ga0495669_0008081 3300046684 Bacteria 4415
1343 Ga0495669_0016951 3300046684 Bacteria 3124
1344 Ga0495669_0039704 3300046684 Bacteria 2084
1345 Ga0495669_0041491 3300046684 Bacteria 2043
1346 Ga0495669_0042757 3300046684 Bacteria 2015
1347 Ga0495669_0043272 3300046684 Bacteria 2004
1348 Ga0495669_0043740 3300046684 Bacteria 1994
1349 Ga0495669_0045601 3300046684 Bacteria 1955
1350 Ga0495613_0027564 3300046689 Bacteria 4228
1351 Ga0495613_0054710 3300046689 Bacteria 2933
1352 Ga0495613_0054744 3300046689 Bacteria 2932
1353 Ga0495613_0087754 3300046689 Bacteria 2254
1354 Ga0495613_0093289 3300046689 Bacteria 2179
1355 Ga0495613_0101882 3300046689 Bacteria 2073
1356 Ga0495613_0102320 3300046689 Bacteria 2068
1357 Ga0495613_0107574 3300046689 Bacteria 2011
1358 Ga0495613_0109965 3300046689 Bacteria 1986
1359 Ga0495613_0114537 3300046689 Bacteria 1940
1360 Ga0495613_0120899 3300046689 Bacteria 1880
1361 Ga0495624_0007398 3300046690 Bacteria 7707
1362 Ga0495624_0053248 3300046690 Bacteria 2555
1363 Ga0495624_0067784 3300046690 Bacteria 2225
1364 Ga0495624_0074050 3300046690 Bacteria 2116
1365 Ga0495624_0074973 3300046690 Bacteria 2101
1366 Ga0495624_0076382 3300046690 Bacteria 2078
1367 Ga0495624_0080252 3300046690 Bacteria 2021
1368 Ga0495624_0081275 3300046690 Bacteria 2007
1369 Ga0495624_0086146 3300046690 Bacteria 1940
1370 Ga0495624_0089820 3300046690 Bacteria 1895
1371 Ga0495624_0137289 3300046690 Bacteria 1498
1372 Ga0495670_0047099 3300046691 Bacteria 2154
1373 Ga0495670_0051352 3300046691 Bacteria 2063
1374 Ga0495670_0053877 3300046691 Bacteria 2014
1375 Ga0495670_0058467 3300046691 Bacteria 1935
1376 Ga0495670_0058627 3300046691 Bacteria 1932
1377 Ga0495671_0023097 3300046692 Bacteria 3251
1378 Ga0495671_0034217 3300046692 Bacteria 2584
1379 Ga0495671_0046966 3300046692 Bacteria 2158
1380 Ga0495671_0052703 3300046692 Bacteria 2021
1381 Ga0495671_0054883 3300046692 Bacteria 1974
1382 Ga0495671_0057348 3300046692 Bacteria 1927
1383 Ga0495671_0059373 3300046692 Bacteria 1890
1384 Ga0495671_0079382 3300046692 Bacteria 1608
1385 Ga0495649_0009131 3300046694 Bacteria 5911
1386 Ga0495649_0043306 3300046694 Bacteria 2457
1387 Ga0495649_0059104 3300046694 Bacteria 2064
1388 Ga0495649_0072737 3300046694 Bacteria 1842
1389 Ga0495649_0075377 3300046694 Bacteria 1806
1390 Ga0495589_0038649 3300046794 Bacteria 2387
1391 Ga0495589_0049000 3300046794 Bacteria 2090
1392 Ga0495589_0053758 3300046794 Bacteria 1986
1393 Ga0495589_0054364 3300046794 Bacteria 1974
1394 Ga0495589_0054523 3300046794 Bacteria 1971
1395 Ga0495589_0057791 3300046794 Bacteria 1907
1396 Ga0495589_0073731 3300046794 Bacteria 1665
1397 Ga0495600_0034021 3300046809 Bacteria 3309
1398 Ga0495600_0077153 3300046809 Bacteria 2175
1399 Ga0495600_0084620 3300046809 Bacteria 2069
1400 Ga0495600_0085222 3300046809 Bacteria 2061
1401 Ga0495600_0087976 3300046809 Bacteria 2026
1402 Ga0495600_0089214 3300046809 Bacteria 2011
1403 Ga0495600_0094170 3300046809 Bacteria 1953
1404 Ga0495600_0103283 3300046809 Bacteria 1857
1405 Ga0495600_0126453 3300046809 Bacteria 1662
1406 Ga0495600_0148531 3300046809 Bacteria 1518
1407 Ga0495660_0033908 3300046810 Bacteria 2859
1408 Ga0495660_0052081 3300046810 Bacteria 2225
1409 Ga0495660_0064625 3300046810 Bacteria 1955
1410 Ga0495660_0081745 3300046810 Bacteria 1693
1411 Ga0495581_0016597 3300047315 Bacteria 4279
1412 Ga0495581_0021001 3300047315 Bacteria 3787
1413 Ga0495581_0048598 3300047315 Bacteria 2449
1414 Ga0495581_0060942 3300047315 Bacteria 2180
1415 Ga0495581_0062156 3300047315 Bacteria 2157
1416 Ga0495581_0062262 3300047315 Bacteria 2155
1417 Ga0495581_0067589 3300047315 Bacteria 2066
1418 Ga0495581_0125343 3300047315 Bacteria 1495
1419 Ga0495604_0049482 3300047317 Bacteria 3265
1420 Ga0495604_0058038 3300047317 Bacteria 2973
1421 Ga0495604_0071204 3300047317 Bacteria 2630
1422 Ga0495604_0082997 3300047317 Bacteria 2395
1423 Ga0495604_0105918 3300047317 Bacteria 2057
1424 Ga0495604_0106005 3300047317 Bacteria 2056
1425 Ga0495604_0106802 3300047317 Bacteria 2047
1426 Ga0495604_0108362 3300047317 Bacteria 2029
1427 Ga0495604_0109646 3300047317 Bacteria 2014
1428 Ga0495604_0172127 3300047317 Bacteria 1521
1429 Ga0495636_0026435 3300047318 Bacteria 2361
1430 Ga0495636_0028033 3300047318 Bacteria 2294
1431 Ga0495636_0055681 3300047318 Bacteria 1663
1432 Ga0495674_0005170 3300047319 Bacteria 12532
1433 Ga0495674_0046151 3300047319 Bacteria 3867
1434 Ga0495674_0047017 3300047319 Bacteria 3828
1435 Ga0495674_0056352 3300047319 Bacteria 3442
1436 Ga0495674_0088888 3300047319 Bacteria 2641
1437 Ga0495674_0100796 3300047319 Bacteria 2457
1438 Ga0495674_0105279 3300047319 Bacteria 2397
1439 Ga0495674_0126068 3300047319 Bacteria 2160
1440 Ga0495674_0154825 3300047319 Bacteria 1920
1441 Ga0495674_0162572 3300047319 Bacteria 1867
1442 Ga0495674_0175923 3300047319 Bacteria 1783
1443 Ga0495674_0188826 3300047319 Bacteria 1713
1444 Ga0495674_0240333 3300047319 Bacteria 1492
1445 Ga0495674_0251156 3300047319 Bacteria 1455
1446 Ga0495672_0037745 3300047320 Bacteria 2953
1447 Ga0495672_0093999 3300047320 Bacteria 1640
1448 Ga0495676_0053403 3300047321 Bacteria 3220
1449 Ga0495676_0062588 3300047321 Bacteria 2904
1450 Ga0495676_0082137 3300047321 Bacteria 2439
1451 Ga0495676_0086275 3300047321 Bacteria 2362
1452 Ga0495676_0089962 3300047321 Bacteria 2298
1453 Ga0495676_0090875 3300047321 Bacteria 2283
1454 Ga0495676_0127198 3300047321 Bacteria 1845
1455 Ga0495676_0138754 3300047321 Bacteria 1744
1456 Ga0495676_0139572 3300047321 Bacteria 1738
1457 Ga0495680_0004184 3300047322 Bacteria 13861
1458 Ga0495680_0047477 3300047322 Bacteria 3377
1459 Ga0495680_0066829 3300047322 Bacteria 2750
1460 Ga0495680_0095413 3300047322 Bacteria 2223
1461 Ga0495680_0102361 3300047322 Bacteria 2132
1462 Ga0495680_0103209 3300047322 Bacteria 2122
1463 Ga0495680_0109829 3300047322 Bacteria 2044
1464 Ga0495683_0018610 3300047323 Bacteria 3588
1465 Ga0495683_0021599 3300047323 Bacteria 3316
1466 Ga0495683_0032950 3300047323 Bacteria 2638
1467 Ga0495683_0040651 3300047323 Bacteria 2349
1468 Ga0495683_0055276 3300047323 Bacteria 1976
1469 Ga0495683_0055517 3300047323 Bacteria 1971
1470 Ga0495687_014824 3300047443 Bacteria 3988
1471 Ga0495675_0026516 3300047444 Bacteria 3695
1472 Ga0495675_0029225 3300047444 Bacteria 3515
1473 Ga0495675_0048693 3300047444 Bacteria 2695
1474 Ga0495675_0070619 3300047444 Bacteria 2204
1475 Ga0495675_0078317 3300047444 Bacteria 2081
1476 Ga0495675_0082631 3300047444 Bacteria 2022
1477 Ga0495675_0083874 3300047444 Bacteria 2005
1478 Ga0495677_0021279 3300047445 Bacteria 2350
1479 Ga0495677_0027133 3300047445 Bacteria 2077
1480 Ga0495677_0029995 3300047445 Bacteria 1978
1481 Ga0495677_0031250 3300047445 Bacteria 1938
1482 Ga0495677_0044238 3300047445 Bacteria 1632
1483 Ga0495679_015342 3300047446 Bacteria 2804
1484 Ga0495679_019576 3300047446 Bacteria 2374
1485 Ga0495679_022585 3300047446 Bacteria 2150
1486 Ga0495685_016625 3300047447 Bacteria 2514
1487 Ga0495685_027332 3300047447 Bacteria 1962
1488 Ga0495685_027828 3300047447 Bacteria 1944
1489 Ga0495673_0028659 3300047469 Bacteria 2635
1490 Ga0495673_0041736 3300047469 Bacteria 2063
1491 Ga0495673_0045736 3300047469 Bacteria 1943
1492 Ga0495681_0036277 3300047470 Bacteria 2439
1493 Ga0495681_0053784 3300047470 Bacteria 1883
1494 Ga0495681_0061792 3300047470 Bacteria 1724
1495 Ga0495684_0034067 3300047471 Bacteria 3907
1496 Ga0495684_0089247 3300047471 Bacteria 2336
1497 Ga0495684_0096866 3300047471 Bacteria 2232
1498 Ga0495684_0098660 3300047471 Bacteria 2208
1499 Ga0495684_0099181 3300047471 Bacteria 2202
1500 Ga0495684_0100644 3300047471 Bacteria 2185
1501 Ga0495684_0101819 3300047471 Bacteria 2171
1502 Ga0495684_0111466 3300047471 Bacteria 2064
1503 Ga0495684_0112114 3300047471 Bacteria 2057
1504 Ga0495684_0116989 3300047471 Bacteria 2009
1505 Ga0495684_0177899 3300047471 Bacteria 1578
1506 Ga0495684_0232871 3300047471 Bacteria 1346
1507 Ga0495686_0073301 3300047472 Bacteria 2103
1508 Ga0495593_0015021 3300047673 Bacteria 4397
1509 Ga0495593_0032514 3300047673 Bacteria 2843
1510 Ga0495593_0035357 3300047673 Bacteria 2713
1511 Ga0495593_0037000 3300047673 Bacteria 2643
1512 Ga0495593_0058103 3300047673 Bacteria 2030
1513 Ga0495593_0059259 3300047673 Bacteria 2006
1514 Ga0495593_0059320 3300047673 Bacteria 2005
1515 Ga0495593_0062483 3300047673 Bacteria 1946
1516 Ga0495593_0071394 3300047673 Bacteria 1803
1517 Ga0495602_0035035 3300048088 Bacteria 4685
1518 Ga0495602_0049663 3300048088 Bacteria 3755
1519 Ga0495602_0080881 3300048088 Bacteria 2734
1520 Ga0495602_0106288 3300048088 Bacteria 2291
1521 Ga0495602_0109229 3300048088 Bacteria 2250
1522 Ga0495602_0119989 3300048088 Bacteria 2117
1523 Ga0495602_0125551 3300048088 Bacteria 2056
1524 Ga0495602_0129255 3300048088 Bacteria 2017
1525 Ga0495614_0017237 3300048089 Bacteria 3138
1526 Ga0495614_0032792 3300048089 Bacteria 2234
1527 Ga0495614_0033990 3300048089 Bacteria 2192
1528 Ga0495614_0036862 3300048089 Bacteria 2098
1529 Ga0495614_0043029 3300048089 Bacteria 1936
1530 Ga0495614_0050148 3300048089 Bacteria 1789
1531 Ga0495614_0060350 3300048089 Bacteria 1629
1532 Ga0495615_0004037 3300048090 Bacteria 2522
1533 Ga0495615_0007383 3300048090 Bacteria 2084
1534 Ga0495626_0032603 3300048091 Bacteria 2501
1535 Ga0495626_0034139 3300048091 Bacteria 2435
1536 Ga0495626_0043559 3300048091 Bacteria 2104
1537 Ga0495626_0050534 3300048091 Bacteria 1920
1538 Ga0496100_0000672 3300048903 Bacteria 16276
1539 Ga0496100_0045295 3300048903 Bacteria 2822
1540 Ga0496100_0050208 3300048903 Bacteria 2701
1541 Ga0496100_0062798 3300048903 Bacteria 2452
1542 Ga0496100_0089641 3300048903 Bacteria 2095
1543 Ga0496100_0090793 3300048903 Bacteria 2083
1544 Ga0496100_0104957 3300048903 Bacteria 1953
1545 Ga0496100_0108567 3300048903 Bacteria 1924
1546 Ga0496100_0189760 3300048903 Bacteria 1491
1547 Ga0496101_0004114 3300048904 Bacteria 9105
1548 Ga0496101_0016725 3300048904 Bacteria 4963
1549 Ga0496101_0051876 3300048904 Bacteria 2956
1550 Ga0496101_0112529 3300048904 Bacteria 2050
1551 Ga0496101_0114723 3300048904 Bacteria 2031
1552 Ga0496101_0115866 3300048904 Bacteria 2021
1553 Ga0496101_0141701 3300048904 Bacteria 1832
1554 Ga0496101_0169078 3300048904 Bacteria 1679
1555 Ga0496101_0248186 3300048904 Bacteria 1386
1556 Ga0496102_0015290 3300048905 Bacteria 6682
1557 Ga0496102_0055795 3300048905 Bacteria 3602
1558 Ga0496102_0075273 3300048905 Bacteria 3103
1559 Ga0496102_0145727 3300048905 Bacteria 2222
1560 Ga0496102_0154835 3300048905 Bacteria 2154
1561 Ga0496102_0168697 3300048905 Bacteria 2060
1562 Ga0496102_0215990 3300048905 Bacteria 1807
1563 Ga0496102_0219369 3300048905 Bacteria 1792
1564 Ga0496102_0219398 3300048905 Bacteria 1792
1565 Ga0496102_0284186 3300048905 Bacteria 1559
1566 Ga0496103_0007026 3300048906 Bacteria 6719
1567 Ga0496103_0058312 3300048906 Bacteria 2398
1568 Ga0496103_0076928 3300048906 Bacteria 2094
1569 Ga0496103_0077199 3300048906 Bacteria 2090
1570 Ga0496103_0082231 3300048906 Bacteria 2026
1571 Ga0496103_0082512 3300048906 Bacteria 2023
1572 Ga0496103_0086282 3300048906 Bacteria 1978
1573 Ga0496103_0086437 3300048906 Bacteria 1976
1574 Ga0496104_0001705 3300048907 Bacteria 18970
1575 Ga0496104_0019385 3300048907 Bacteria 6222
1576 Ga0496104_0039985 3300048907 Bacteria 4393
1577 Ga0496104_0040528 3300048907 Bacteria 4365
1578 Ga0496104_0063093 3300048907 Bacteria 3514
1579 Ga0496104_0117848 3300048907 Bacteria 2548
1580 Ga0496104_0146435 3300048907 Bacteria 2268
1581 Ga0496104_0153844 3300048907 Bacteria 2207
1582 Ga0496104_0163919 3300048907 Bacteria 2131
1583 Ga0496104_0228416 3300048907 Bacteria 1773
1584 Ga0496105_0001112 3300048908 Bacteria 18704
1585 Ga0496105_0009874 3300048908 Bacteria 7485
1586 Ga0496105_0053167 3300048908 Bacteria 3344
1587 Ga0496105_0124764 3300048908 Bacteria 2122
1588 Ga0496105_0131478 3300048908 Bacteria 2063
1589 Ga0496105_0152000 3300048908 Bacteria 1902
1590 Ga0496106_0017946 3300048909 Bacteria 5233
1591 Ga0496106_0040006 3300048909 Bacteria 3510
1592 Ga0496106_0054310 3300048909 Bacteria 3026
1593 Ga0496106_0110099 3300048909 Bacteria 2143
1594 Ga0496106_0112788 3300048909 Bacteria 2118
1595 Ga0496106_0116571 3300048909 Bacteria 2083
1596 Ga0496106_0122434 3300048909 Bacteria 2034
1597 Ga0496106_0141401 3300048909 Bacteria 1893
1598 Ga0496107_0052726 3300048910 Bacteria 2933
1599 Ga0496107_0060295 3300048910 Bacteria 2746
1600 Ga0496107_0090811 3300048910 Bacteria 2231
1601 Ga0496107_0093281 3300048910 Bacteria 2201
1602 Ga0496107_0101544 3300048910 Bacteria 2109
1603 Ga0496107_0105318 3300048910 Bacteria 2070
1604 Ga0496107_0113571 3300048910 Bacteria 1992
1605 Ga0496108_0073540 3300048911 Bacteria 2885
1606 Ga0496108_0098873 3300048911 Bacteria 2486
1607 Ga0496108_0132589 3300048911 Bacteria 2141
1608 Ga0496108_0153287 3300048911 Bacteria 1989
1609 Ga0496108_0186375 3300048911 Bacteria 1797
1610 Ga0496109_0078418 3300048912 Bacteria 3041
1611 Ga0496109_0162847 3300048912 Bacteria 2090
1612 Ga0496109_0183184 3300048912 Bacteria 1967
1613 Ga0496109_0185076 3300048912 Bacteria 1957
1614 Ga0496109_0204293 3300048912 Bacteria 1857
1615 Ga0496109_0266637 3300048912 Bacteria 1613
1616 Ga0496110_0109441 3300048913 Bacteria 2481
1617 Ga0496110_0113851 3300048913 Bacteria 2433
1618 Ga0496110_0130306 3300048913 Bacteria 2270
1619 Ga0496110_0151610 3300048913 Bacteria 2099
1620 Ga0496110_0234769 3300048913 Bacteria 1668
1621 Ga0496111_0034746 3300048914 Bacteria 3600
1622 Ga0496111_0104413 3300048914 Bacteria 2084
1623 Ga0496111_0106237 3300048914 Bacteria 2066
1624 Ga0496111_0108966 3300048914 Bacteria 2039
1625 Ga0496111_0175170 3300048914 Bacteria 1594
1626 Ga0496112_0161202 3300048915 Bacteria 2209
1627 Ga0496112_0190419 3300048915 Bacteria 2013
1628 Ga0496112_0192106 3300048915 Bacteria 2003
1629 Ga0496112_0244510 3300048915 Bacteria 1746
1630 Ga0496113_0115226 3300048916 Bacteria 2096
1631 Ga0496113_0125925 3300048916 Bacteria 2006
1632 Ga0496114_0040626 3300048917 Bacteria 3851
1633 Ga0496114_0067168 3300048917 Bacteria 3007
1634 Ga0496114_0137843 3300048917 Bacteria 2110
1635 Ga0496114_0139163 3300048917 Bacteria 2100
1636 Ga0496114_0147849 3300048917 Bacteria 2037
1637 Ga0496114_0170685 3300048917 Bacteria 1895
1638 Ga0496114_0178141 3300048917 Bacteria 1855
1639 Ga0496114_0182784 3300048917 Bacteria 1831
1640 Ga0496114_0194513 3300048917 Bacteria 1775
1641 Ga0496115_0039711 3300048918 Bacteria 3738
1642 Ga0496115_0051785 3300048918 Bacteria 3291
1643 Ga0496115_0060487 3300048918 Bacteria 3052
1644 Ga0496115_0092717 3300048918 Bacteria 2469
1645 Ga0496115_0106251 3300048918 Bacteria 2304
1646 Ga0496115_0116289 3300048918 Bacteria 2199
1647 Ga0496115_0141182 3300048918 Bacteria 1987
1648 Ga0496115_0145860 3300048918 Bacteria 1953
1649 Ga0496115_0202770 3300048918 Bacteria 1638
1650 Ga0496115_0207041 3300048918 Bacteria 1620
1651 Ga0496116_0023238 3300048919 Bacteria 4622
1652 Ga0496117_0006792 3300048920 Bacteria 11409
1653 Ga0496117_0039313 3300048920 Bacteria 3493
1654 Ga0496117_0073620 3300048920 Bacteria 2278
1655 Ga0496117_0083921 3300048920 Bacteria 2080
1656 Ga0496117_0124415 3300048920 Bacteria 1577
1657 Ga0496118_0055678 3300048921 Bacteria 2981
1658 Ga0496118_0058201 3300048921 Bacteria 2890
1659 Ga0496118_0099648 3300048921 Bacteria 1968
1660 Ga0496118_0101503 3300048921 Bacteria 1942
1661 Ga0496119_0008659 3300048922 Bacteria 8902
1662 Ga0496119_0066048 3300048922 Bacteria 2139
1663 Ga0496119_0072207 3300048922 Bacteria 2017
1664 Ga0496119_0078005 3300048922 Bacteria 1917
1665 Ga0496119_0079277 3300048922 Bacteria 1897
1666 Ga0496120_0048391 3300048923 Bacteria 2447
1667 Ga0496120_0052999 3300048923 Bacteria 2306
1668 Ga0496120_0085661 3300048923 Bacteria 1695
1669 Ga0496120_0095242 3300048923 Bacteria 1583
1670 Ga0496121_0041096 3300048924 Bacteria 4047
1671 Ga0496121_0078624 3300048924 Bacteria 2621
1672 Ga0496121_0113113 3300048924 Bacteria 2066
1673 Ga0496121_0133479 3300048924 Bacteria 1853
1674 Ga0496122_0038660 3300048925 Bacteria 3817
1675 Ga0496122_0126306 3300048925 Bacteria 1636
1676 Ga0496123_0092929 3300048926 Bacteria 1783
1677 Ga0496124_0119134 3300048927 Bacteria 2112
1678 Ga0496124_0120854 3300048927 Bacteria 2093
1679 Ga0496124_0126759 3300048927 Bacteria 2032
1680 Ga0496125_0049739 3300048928 Bacteria 3479
1681 Ga0496125_0054915 3300048928 Bacteria 3251
1682 Ga0496125_0147995 3300048928 Bacteria 1619
1683 Ga0496126_0094618 3300048929 Bacteria 2622
1684 Ga0496126_0107470 3300048929 Bacteria 2433
1685 Ga0496126_0107711 3300048929 Bacteria 2430
1686 Ga0496126_0210040 3300048929 Bacteria 1639
1687 Ga0495678_019042 3300049459 Bacteria 3073
1688 Ga0495682_0013874 3300049460 Bacteria 3059
1689 Ga0495682_0030442 3300049460 Bacteria 1996
1690 Ga0495682_0062518 3300049460 Bacteria 1343
1691 Ga0501291_000951 3300049514 Bacteria 3327
1692 Ga0501067_0022408 3300049583 Bacteria 3496
1693 Ga0501067_0081267 3300049583 Bacteria 1796
1694 Ga0501069_0067551 3300049585 Bacteria 2000
1695 Ga0501069_0084232 3300049585 Bacteria 1793
1696 Ga0501070_0115317 3300049586 Bacteria 2219
1697 Ga0501076_0178655 3300049592 Bacteria 1730
1698 Ga0501235_001462 3300049669 Bacteria 5048
1699 Ga0501250_000659 3300049680 Bacteria 2468
1700 Ga0501251_001617 3300049681 Bacteria 2126
1701 Ga0501252_000606 3300049682 Bacteria 2858
1702 Ga0501225_0010575 3300049705 Bacteria 2613
1703 Ga0501079_0213954 3300049741 Bacteria 1505
1704 Ga0501081_0081363 3300049743 Bacteria 2268
1705 Ga0501241_007521 3300049758 Bacteria 1994
1706 nmdc:mga06z11_25769_c1 3300050494 Bacteria 2791
1707 nmdc:mga04h51_31326_c1 3300050495 Bacteria 1680
1708 nmdc:mga07m45_53547_c1 3300050496 Bacteria 2280
1709 nmdc:mga07m45_68669_c1 3300050496 Bacteria 2015
1710 nmdc:mga05p37_223130_c1 3300050507 Bacteria 2274
1711 nmdc:mga05p37_279433_c1 3300050507 Bacteria 1992
1712 nmdc:mga05p37_347935_c1 3300050507 Bacteria 1746
1713 nmdc:mga0qj67_101206_c1 3300050509 Bacteria 2323
1714 nmdc:mga0qj67_132787_c1 3300050509 Bacteria 2017
1715 nmdc:mga06r32_145914_c1 3300050510 Bacteria 2344
1716 nmdc:mga06r32_180946_c1 3300050510 Bacteria 2094
1717 nmdc:mga06r32_25133_c1 3300050510 Bacteria 5536
1718 nmdc:mga06r32_252095_c1 3300050510 Bacteria 1753
1719 nmdc:mga08y16_155948_c1 3300050511 Bacteria 2373
1720 nmdc:mga08y16_193525_c1 3300050511 Bacteria 2109
1721 nmdc:mga08y16_211858_c1 3300050511 Bacteria 2007
1722 nmdc:mga08y16_232732_c1 3300050511 Bacteria 1906
1723 nmdc:mga08y16_234901_c1 3300050511 Bacteria 1896
1724 nmdc:mga08y16_253344_c1 3300050511 Bacteria 1819
1725 nmdc:mga08y16_95583_c1 3300050511 Bacteria 3095
1726 nmdc:mga0n895_160517_c1 3300050512 Bacteria 2280
1727 nmdc:mga0n895_200852_c1 3300050512 Bacteria 2025
1728 nmdc:mga0n895_216713_c1 3300050512 Bacteria 1944
1729 nmdc:mga0n895_223204_c1 3300050512 Bacteria 1913
1730 nmdc:mga0n895_229910_c1 3300050512 Bacteria 1883
1731 nmdc:mga0n895_236300_c1 3300050512 Bacteria 1855
1732 nmdc:mga0n895_279247_c1 3300050512 Bacteria 1694
1733 nmdc:mga0rr50_123157_c1 3300050513 Bacteria 2067
1734 nmdc:mga0rr50_137056_c1 3300050513 Bacteria 1966
1735 nmdc:mga0rr50_205996_c1 3300050513 Bacteria 1619
1736 nmdc:mga0rr50_228092_c1 3300050513 Bacteria 1540
1737 nmdc:mga0rr50_233160_c1 3300050513 Bacteria 1524
1738 nmdc:mga0rr50_71232_c1 3300050513 Bacteria 2652
1739 nmdc:mga08x19_125136_c1 3300050514 Bacteria 1726
1740 nmdc:mga0a205_150320_c1 3300050515 Bacteria 2229
1741 nmdc:mga0a205_153471_c1 3300050515 Bacteria 2202
1742 nmdc:mga0a205_170169_c1 3300050515 Bacteria 2075
1743 nmdc:mga0a205_171628_c1 3300050515 Bacteria 2065
1744 nmdc:mga0a205_6547_c2 3300050515 Bacteria 2538
1745 Ga0495601_0033150 3300053077 Bacteria 3217
1746 Ga0495601_0044902 3300053077 Bacteria 2777
1747 Ga0495601_0062551 3300053077 Bacteria 2364
1748 Ga0495601_0066615 3300053077 Bacteria 2292
1749 Ga0495601_0100646 3300053077 Bacteria 1866
1750 Ga0495612_0013907 3300053078 Bacteria 3242
1751 Ga0495612_0016415 3300053078 Bacteria 2967
1752 Ga0495612_0018459 3300053078 Bacteria 2793
1753 Ga0495612_0025642 3300053078 Bacteria 2367
1754 Ga0495612_0029145 3300053078 Bacteria 2222
1755 Ga0495612_0030929 3300053078 Bacteria 2157
1756 Ga0495612_0047582 3300053078 Bacteria 1757
1757 Ga0495595_0007104 3300053084 Bacteria 4576
1758 Ga0495595_0013654 3300053084 Bacteria 3433
1759 Ga0495595_0014010 3300053084 Bacteria 3394
1760 Ga0495595_0021234 3300053084 Bacteria 2834
1761 Ga0495595_0036714 3300053084 Bacteria 2224
1762 Ga0495595_0039832 3300053084 Bacteria 2145
1763 Ga0495595_0044492 3300053084 Bacteria 2039
1764 Ga0495619_0036729 3300053085 Bacteria 3191
1765 Ga0495619_0068635 3300053085 Bacteria 2368
1766 Ga0495619_0080615 3300053085 Bacteria 2190
1767 Ga0495619_0080727 3300053085 Bacteria 2189
1768 Ga0495619_0082379 3300053085 Bacteria 2168
1769 Ga0495619_0092316 3300053085 Bacteria 2050
1770 Ga0495619_0092691 3300053085 Bacteria 2046
1771 Ga0495619_0104272 3300053085 Bacteria 1932
1772 Ga0500578_0075563 3300053086 Bacteria 2146
1773 Ga0500643_012830 3300053087 Bacteria 2987
1774 Ga0500651_0000666 3300053093 Bacteria 17091
1775 Ga0500651_0084164 3300053093 Bacteria 1967
1776 Ga0500641_0008723 3300053096 Bacteria 3627
1777 Ga0500641_0067478 3300053096 Bacteria 1499
1778 Ga0500650_0043581 3300053098 Bacteria 2075
1779 Ga0500562_016489 3300053108 Bacteria 1900
1780 Ga0500582_018410 3300053114 Bacteria 1934
1781 Ga0500592_003775 3300053116 Bacteria 2415
1782 Ga0500595_000309 3300053119 Bacteria 32082
1783 Ga0500642_0060990 3300053130 Bacteria 1693
1784 Ga0500658_0035903 3300053134 Bacteria 1964
1785 Ga0500559_0008740 3300053136 Bacteria 4418
1786 Ga0500577_0023178 3300053142 Bacteria 2070
1787 Ga0500579_071191 3300053143 Bacteria 2005
1788 Ga0500588_0012604 3300053146 Bacteria 2101
1789 Ga0500589_008456 3300053147 Bacteria 4291
1790 Ga0500604_0015925 3300053151 Bacteria 2065
1791 Ga0500622_0014532 3300053156 Bacteria 4226
1792 Ga0500627_0009532 3300053158 Bacteria 3500
1793 Ga0500627_0069718 3300053158 Bacteria 1556
1794 Ga0500634_0009635 3300053161 Bacteria 4904
1795 Ga0500634_0080746 3300053161 Bacteria 1677
1796 Ga0500636_0044694 3300053177 Bacteria 2612
1797 Ga0500645_026521 3300053730 Bacteria 1762
1798 Ga0587077_002586 3300059493 Bacteria 2168
1799 Ga0587082_002402 3300059504 Bacteria 2111
1800 Ga0587085_001833 3300059506 Bacteria 2064
1801 Ga0587062_003294 3300059639 Bacteria 1620
1802 Ga0587072_003897 3300059643 Bacteria 2131
1803 Ga0530510_0199987 3300061734 Bacteria 1484
1804 2512348742 2512047030 Bacteria 9031815
1805 2512351805 2512047030 Bacteria 9031815
1806 2512351965 2512047030 Bacteria 9031815
1807 2513558040 2513237082 Bacteria 8640282
1808 2513720832 2513237104 Bacteria 10034502
1809 2513723419 2513237104 Bacteria 10034502
1810 2513723448 2513237104 Bacteria 10034502
1811 2513723775 2513237104 Bacteria 10034502
1812 2513723950 2513237104 Bacteria 10034502
1813 2558860608 2558860100 Bacteria 8458965
1814 2558862065 2558860100 Bacteria 8458965
1815 2558862441 2558860100 Bacteria 8458965
1816 2558865755 2558860100 Bacteria 8458965
1817 2585264054 2582581305 Bacteria 4895574
1818 2644027856 2643221603 Bacteria 6147767
1819 2745075108 2744054633 Bacteria 8678936
1820 2776257752 2775506901 Bacteria 9631051
1821 2776260100 2775506901 Bacteria 9631051
1822 2776263843 2775506901 Bacteria 9631051
1823 2776264600 2775506901 Bacteria 9631051
1824 2776264778 2775506901 Bacteria 9631051
1825 2776264893 2775506901 Bacteria 9631051
1826 2776265028 2775506901 Bacteria 9631051
1827 2776266631 2775506901 Bacteria 9631051
1828 2776266847 2775506901 Bacteria 9631051
1829 2842329858 2842324504 Bacteria 9364110
1830 2842354676 2842348783 Bacteria 9002918
1831 2842460125 2842454564 Bacteria 8730687
1832 2874130496 2874123672 Bacteria 7238285
1833 2876763805 2876761206 Bacteria 10111113
1834 2876763981 2876761206 Bacteria 10111113
1835 2876767391 2876761206 Bacteria 10111113
1836 2881671454 2881665667 Bacteria 8175609
1837 2885383402 2885374607 Bacteria 8927485
1838 2885414001 2885409591 Bacteria 9235467
1839 2889791694 2889790730 Bacteria 5689708
1840 2900642728 2900634093 Bacteria 10263517
1841 2903778253 2903768456 Bacteria 9749579
1842 2922363016 2922361189 Bacteria 7436256
1843 2935769730 2935760218 Bacteria 9817913
1844 2941538491 2941531003 Bacteria 7653939
1845 8006985137 8006984368 Bacteria 9651211
1846 8019649190 8019648815 Bacteria 10014479
1847 8019657173 8019648815 Bacteria 10014479
1848 Ga0450904_002772
1849 SwRhRL2b_contig_1818751
1850 SwRhRL2b_contig_2236331
1851 ARSoilOldRDRAFT_c002146
1852 JGI24747J21853_1000925
1853 JGI24740J21852_10025448
1854 JGI24739J22299_10025517
1855 JGI24739J22299_10027983
1856 JGI24739J22299_10028900
1857 JGI24743J22301_10006376
1858 JGI24743J22301_10007064
1859 JGI24735J21928_10015983
1860 JGI24735J21928_10018333
1861 JGI24735J21928_10019976
1862 JGI24735J21928_10020152
1863 JGI24735J21928_10022282
1864 JGI24750J21931_1003093
1865 JGI24750J21931_1003276
1866 JGI24745J21846_1002072
1867 JGI24748J21848_1003376
1868 JGI24749J21850_1005242
1869 JGI24744J21845_10009246
1870 JGI24744J21845_10010202
1871 JGI24035J26624_1001816
1872 JGI24033J26618_1002484
1873 JGI24033J26618_1002773
1874 JGI24034J26672_10004231
1875 JGI24742J22300_10006045
1876 JGI24742J22300_10006688
1877 JGI24742J22300_10007104
1878 JGI24742J22300_10007679
1879 JGI24742J22300_10008609
1880 Ga0007429J51699_1014162
1881 Ga0007429J51699_1089451
1882 JGI25404J52841_10008353
1883 JGI25404J52841_10012942
1884 Ga0032354_1096766
1885 JGI25405J52794_10014531
1886 Ga0058860_10059007
1887 Ga0065704_10116717
1888 Ga0065712_10089177
1889 Ga0065715_10015540
1890 Ga0065715_10023536
1891 Ga0065715_10109413
1892 Ga0065707_10126004
1893 Ga0065707_10168001
1894 Ga0070676_10059480
1895 Ga0070676_10083531
1896 Ga0070690_100013888
1897 Ga0070670_100242450
1898 Ga0068869_100160943
1899 Ga0068869_100178928
1900 Ga0070666_10060153
1901 Ga0070666_10077044
1902 Ga0070666_10106110
1903 Ga0070666_10120690
1904 Ga0070666_10159663
1905 Ga0070680_100120669
1906 Ga0070682_100079109
1907 Ga0068868_100102700
1908 Ga0070660_100092236
1909 Ga0070689_100167762
1910 Ga0070691_10042188
1911 Ga0070687_100045834
1912 Ga0070692_10035532
1913 Ga0070668_100160598
1914 Ga0070668_100168171
1915 Ga0070668_100200694
1916 Ga0070668_100257730
1917 Ga0070669_100108423
1918 Ga0070669_100138567
1919 Ga0070675_100097854
1920 Ga0070675_100126769
1921 Ga0070671_100112257
1922 Ga0070671_100175436
1923 Ga0070671_100201818
1924 Ga0070674_100067592
1925 Ga0070674_100089876
1926 Ga0070674_100172272
1927 Ga0070674_100189980
1928 Ga0070673_100036965
1929 Ga0070673_100051846
1930 Ga0070673_100092211
1931 Ga0070673_100286879
1932 Ga0070688_100083733
1933 Ga0070659_100146298
1934 Ga0070667_100140745
1935 Ga0070667_100168492
1936 Ga0070667_100195859
1937 Ga0070709_10092037
1938 Ga0070714_100104075
1939 Ga0070713_100114860
1940 Ga0070713_100152610
1941 Ga0070713_100166102
1942 Ga0070710_10035257
1943 Ga0070710_10066094
1944 Ga0070710_10073803
1945 Ga0070710_10149468
1946 Ga0070701_10048407
1947 Ga0070701_10061082
1948 Ga0070711_100091561
1949 Ga0070711_100113545
1950 Ga0070711_100116411
1951 Ga0070711_100152229
1952 Ga0070711_100154125
1953 Ga0070711_100201419
1954 Ga0070711_100249113
1955 Ga0070705_100102714
1956 Ga0070705_100131852
1957 Ga0070700_100101127
1958 Ga0070694_100090081
1959 Ga0070708_100147329
1960 Ga0070708_100266566
1961 Ga0070708_100271307
1962 Ga0070663_100089294
1963 Ga0070663_100217249
1964 Ga0070678_100083899
1965 Ga0070678_100107456
1966 Ga0070662_100065714
1967 Ga0070662_100089124
1968 Ga0070662_100098978
1969 Ga0070662_100133921
1970 Ga0070662_100193370
1971 Ga0070681_10124952
1972 Ga0068867_100039606
1973 Ga0068867_100103524
1974 Ga0068867_100142373
1975 Ga0068867_100203354
1976 Ga0070698_100351190
1977 Ga0070699_100094955
1978 Ga0070699_100198348
1979 Ga0070679_100272135
1980 Ga0070697_100118037
1981 Ga0070697_100244341
1982 Ga0068853_100141576
1983 Ga0068853_100201937
1984 Ga0070672_100085695
1985 Ga0070686_100082615
1986 Ga0070686_100090623
1987 Ga0070696_100057008
1988 Ga0070693_100031520
1989 Ga0070693_100052946
1990 Ga0070693_100141769
1991 Ga0070665_100145136
1992 Ga0070665_100158810
1993 Ga0070665_100217162
1994 Ga0068855_100189125
1995 Ga0068856_100200794
1996 Ga0070702_100029407
1997 Ga0070702_100058493
1998 Ga0070702_100096244
1999 Ga0068859_100195774
2000 Ga0068859_100232988
2001 Ga0068864_100156037
2002 Ga0068864_100182270
2003 Ga0068866_10036796
2004 Ga0068866_10049292
2005 Ga0068866_10062740
2006 Ga0068866_10138346
2007 Ga0068861_100097458
2008 Ga0068861_100131413
2009 Ga0068861_100189914
2010 Ga0068861_100234008
2011 Ga0068863_100190138
2012 Ga0068863_100222830
2013 Ga0068863_100287572
2014 Ga0068858_100119981
2015 Ga0068858_100135764
2016 Ga0068860_100191276
2017 Ga0068860_100210802
2018 Ga0068862_100135518
2019 Ga0068862_100144061
2020 Ga0068862_100182407
2021 Ga0068862_100218061
2022 Ga0081455_10048300
2023 Ga0081455_10048429
2024 Ga0081455_10176784
2025 Ga0081540_1018457
2026 Ga0081540_1049607
2027 Ga0070717_10103610
2028 Ga0070717_10117214
2029 Ga0070717_10141225
2030 Ga0070717_10203599
2031 Ga0070717_10206803
2032 Ga0075432_10029878
2033 Ga0075432_10029908
2034 Ga0070715_10018084
2035 Ga0070716_100017253
2036 Ga0070712_100076616
2037 Ga0070712_100083289
2038 Ga0070712_100085816
2039 Ga0075367_10066085
2040 Ga0075367_10070539
2041 Ga0097621_100075112
2042 Ga0097621_100081983
2043 Ga0097621_100124602
2044 Ga0097621_100132074
2045 Ga0097621_100211245
2046 Ga0075370_10030816
2047 Ga0075370_10088763
2048 Ga0068871_100077330
2049 Ga0068871_100090289
2050 Ga0068871_100101588
2051 Ga0068871_100156098
2052 Ga0068871_100170857
2053 Ga0075428_100126163
2054 Ga0075428_100156511
2055 Ga0075428_100160693
2056 Ga0075428_100180867
2057 Ga0075428_100272944
2058 Ga0075428_100305665
2059 Ga0075430_100108667
2060 Ga0075431_100166112
2061 Ga0075431_100169366
2062 Ga0075433_10098207
2063 Ga0075433_10167470
2064 Ga0075433_10186499
2065 Ga0075434_100097928
2066 Ga0075434_100167829
2067 Ga0075434_100184059
2068 Ga0075434_100217533
2069 Ga0075434_100226849
2070 Ga0075434_100236016
2071 Ga0075434_100245585
2072 Ga0075434_100254344
2073 Ga0075434_100261227
2074 Ga0068865_100092021
2075 Ga0068865_100099083
2076 Ga0068865_100111496
2077 Ga0068865_100240391
2078 Ga0075436_100080103
2079 Ga0075436_100083782
2080 Ga0097620_100195769
2081 Ga0097620_100232990
2082 Ga0075435_100100197
2083 Ga0075435_100145204
2084 Ga0075435_100168819
2085 Ga0075435_100170048
2086 Ga0075435_100207168
2087 Ga0075435_100248981
2088 Ga0099795_10025187
2089 Ga0099795_10027906
2090 Ga0105251_10073241
2091 Ga0105240_10246158
2092 Ga0111539_10157373
2093 Ga0111539_10194587
2094 Ga0111539_10213376
2095 Ga0111539_10260072
2096 Ga0111539_10379671
2097 Ga0105245_10115794
2098 Ga0105245_10116031
2099 Ga0105247_10019146
2100 Ga0105247_10054498
2101 Ga0105247_10061858
2102 Ga0105247_10075826
2103 Ga0105247_10086359
2104 Ga0114129_10214800
2105 Ga0114129_10303264
2106 Ga0114129_10360832
2107 Ga0105243_10174977
2108 Ga0105243_10267779
2109 Ga0105241_10138150
2110 Ga0105241_10178062
2111 Ga0105242_10109037
2112 Ga0105242_10133770
2113 Ga0105242_10214288
2114 Ga0105242_10244898
2115 Ga0105242_10245433
2116 Ga0105248_10187030
2117 Ga0105248_10203259
2118 Ga0105248_10356655
2119 Ga0105237_10364086
2120 Ga0105238_10161381
2121 Ga0105238_10178299
2122 Ga0105249_10111800
2123 Ga0105249_10159978
2124 Ga0105249_10199796
2125 Ga0105249_10242695
2126 Ga0099796_10016496
2127 Ga0099796_10036954
2128 Ga0105239_10197836
2129 Ga0105239_10274749
2130 Ga0105246_10051787
2131 Ga0105246_10060309
2132 Ga0157329_1000722
2133 Ga0157339_1001501
2134 Ga0157371_10094289
2135 Ga0157371_10099508
2136 Ga0157370_10237980
2137 Ga0157369_10165763
2138 Ga0157374_10314873
2139 Ga0157378_10092630
2140 Ga0157378_10094718
2141 Ga0157378_10098004
2142 Ga0163162_10431924
2143 Ga0157375_10158487
2144 Ga0157375_10248901
2145 Ga0157375_10268965
2146 Ga0163163_10158463
2147 Ga0157380_10071568
2148 Ga0157380_10165488
2149 Ga0182008_10036739
2150 Ga0157377_10000080
2151 Ga0157379_10067755
2152 Ga0157379_10153307
2153 Ga0157379_10232685
2154 Ga0157376_10061616
2155 Ga0157376_10134277
2156 Ga0157376_10137641
2157 Ga0157376_10162089
2158 Ga0157376_10178629
2159 Ga0157376_10190126
2160 Ga0157376_10308218
2161 Ga0163161_10117052
2162 Ga0163161_10118653
2163 Ga0184602_121534
2164 Ga0213873_10000875
2165 Ga0213872_10020991
2166 Ga0213872_10051235
2167 Ga0213874_10011415
2168 Ga0213876_10059055
2169 Ga0224570_101704
2170 Ga0247551_100096
2171 Ga0247550_100048
2172 Ga0228600_1001536
2173 Ga0224572_1007934
2174 Ga0224572_1007992
2175 Ga0228598_1002583
2176 Ga0228598_1005183
2177 Ga0228598_1008875
2178 Ga0209759_1013527
2179 Ga0209051_1005278
2180 Ga0207697_10008948
2181 Ga0207697_10028389
2182 Ga0207697_10038129
2183 Ga0207713_1020043
2184 Ga0207692_10049268
2185 Ga0207692_10050782
2186 Ga0207692_10053785
2187 Ga0207692_10054721
2188 Ga0207692_10055787
2189 Ga0207692_10083458
2190 Ga0207642_10034813
2191 Ga0207642_10035574
2192 Ga0207642_10040934
2193 Ga0207642_10043355
2194 Ga0207642_10058109
2195 Ga0207710_10024444
2196 Ga0207710_10026108
2197 Ga0207710_10038893
2198 Ga0207688_10021442
2199 Ga0207688_10043468
2200 Ga0207688_10060308
2201 Ga0207688_10078293
2202 Ga0207680_10010514
2203 Ga0207680_10025747
2204 Ga0207647_10001640
2205 Ga0207647_10064697
2206 Ga0207685_10025291
2207 Ga0207685_10025827
2208 Ga0207699_10068315
2209 Ga0207699_10077102
2210 Ga0207699_10077674
2211 Ga0207699_10078249
2212 Ga0207699_10084483
2213 Ga0207699_10092182
2214 Ga0207643_10053535
2215 Ga0207643_10073050
2216 Ga0207643_10089674
2217 Ga0207705_10115699
2218 Ga0207684_10039964
2219 Ga0207684_10147851
2220 Ga0207684_10151815
2221 Ga0207684_10221647
2222 Ga0207654_10016416
2223 Ga0207654_10076549
2224 Ga0207654_10123075
2225 Ga0207707_10134235
2226 Ga0207707_10146561
2227 Ga0207695_10111573
2228 Ga0207695_10249725
2229 Ga0207671_10195376
2230 Ga0207693_10103936
2231 Ga0207693_10120699
2232 Ga0207663_10013149
2233 Ga0207663_10024929
2234 Ga0207663_10076671
2235 Ga0207663_10081324
2236 Ga0207663_10086419
2237 Ga0207663_10090789
2238 Ga0207663_10103566
2239 Ga0207663_10118526
2240 Ga0207663_10140603
2241 Ga0207663_10169762
2242 Ga0207663_10179351
2243 Ga0207663_10201753
2244 Ga0207660_10166207
2245 Ga0207657_10120075
2246 Ga0207652_10283120
2247 Ga0207652_10292687
2248 Ga0207646_10171009
2249 Ga0207681_10091025
2250 Ga0207694_10114462
2251 Ga0207694_10150664
2252 Ga0207650_10027168
2253 Ga0207650_10030800
2254 Ga0207659_10113592
2255 Ga0207659_10127470
2256 Ga0207687_10060974
2257 Ga0207687_10110126
2258 Ga0207700_10025509
2259 Ga0207700_10028818
2260 Ga0207700_10053130
2261 Ga0207700_10122323
2262 Ga0207700_10144416
2263 Ga0207700_10155152
2264 Ga0207700_10157136
2265 Ga0207700_10177655
2266 Ga0207700_10235798
2267 Ga0207664_10026373
2268 Ga0207664_10066158
2269 Ga0207664_10095710
2270 Ga0207664_10109833
2271 Ga0207664_10128610
2272 Ga0207664_10137192
2273 Ga0207644_10135513
2274 Ga0207644_10164098
2275 Ga0207690_10147595
2276 Ga0207706_10101197
2277 Ga0207706_10121870
2278 Ga0207706_10139809
2279 Ga0207706_10159787
2280 Ga0207686_10092140
2281 Ga0207686_10113912
2282 Ga0207686_10157390
2283 Ga0207686_10171030
2284 Ga0207709_10002054
2285 Ga0207709_10018016
2286 Ga0207709_10096643
2287 Ga0207709_10136562
2288 Ga0207709_10163753
2289 Ga0207670_10087130
2290 Ga0207670_10144003
2291 Ga0207669_10013077
2292 Ga0207669_10086231
2293 Ga0207669_10091441
2294 Ga0207669_10092571
2295 Ga0207669_10095754
2296 Ga0207669_10161169
2297 Ga0207704_10041408
2298 Ga0207704_10071290
2299 Ga0207704_10091267
2300 Ga0207704_10098245
2301 Ga0207665_10030968
2302 Ga0207665_10038767
2303 Ga0207665_10125508
2304 Ga0207665_10201050
2305 Ga0207691_10071251
2306 Ga0207691_10166443
2307 Ga0207691_10247672
2308 Ga0207691_10283038
2309 Ga0207711_10121333
2310 Ga0207711_10182370
2311 Ga0207711_10266520
2312 Ga0207689_10141624
2313 Ga0207689_10200912
2314 Ga0207679_10124852
2315 Ga0207679_10145269
2316 Ga0207667_10280797
2317 Ga0207667_10321923
2318 Ga0207651_10063040
2319 Ga0207651_10119659
2320 Ga0207651_10144860
2321 Ga0207712_10115145
2322 Ga0207712_10115278
2323 Ga0207712_10116479
2324 Ga0207712_10170288
2325 Ga0207668_10000119
2326 Ga0207668_10097230
2327 Ga0207668_10108196
2328 Ga0207668_10114556
2329 Ga0207640_10078926
2330 Ga0207640_10079266
2331 Ga0207658_10000347
2332 Ga0207658_10186684
2333 Ga0207677_10090393
2334 Ga0207677_10103935
2335 Ga0207703_10057586
2336 Ga0207703_10116296
2337 Ga0207703_10136429
2338 Ga0207703_10179601
2339 Ga0207639_10088768
2340 Ga0207678_10043629
2341 Ga0207678_10052514
2342 Ga0207678_10072082
2343 Ga0207678_10140520
2344 Ga0207678_10223047
2345 Ga0207708_10021338
2346 Ga0207708_10114963
2347 Ga0207708_10115901
2348 Ga0207702_10113880
2349 Ga0207702_10166230
2350 Ga0207702_10265246
2351 Ga0207641_10001333
2352 Ga0207641_10166400
2353 Ga0207648_10004849
2354 Ga0207648_10039981
2355 Ga0207648_10057334
2356 Ga0207648_10077576
2357 Ga0207648_10237828
2358 Ga0207676_10157008
2359 Ga0207676_10186691
2360 Ga0207675_100097550
2361 Ga0207675_100098959
2362 Ga0207675_100121127
2363 Ga0207675_100145037
2364 Ga0207675_100224673
2365 Ga0207675_100308456
2366 Ga0207683_10025310
2367 Ga0207683_10055568
2368 Ga0207683_10127085
2369 Ga0207683_10145603
2370 Ga0207683_10150692
2371 Ga0207698_10141670
2372 Ga0207698_10180795
2373 Ga0209489_120183
2374 Ga0209179_1005488
2375 Ga0209179_1005541
2376 Ga0209179_1005904
2377 Ga0209588_1022308
2378 Ga0209588_1028465
2379 Ga0209998_10009772
2380 Ga0207428_10088428
2381 Ga0207428_10103419
2382 Ga0207428_10119816
2383 Ga0207428_10140768
2384 Ga0265358_100065
2385 Ga0268266_10137271
2386 Ga0268266_10210322
2387 Ga0268265_10151381
2388 Ga0268265_10220359
2389 Ga0268265_10236418
2390 Ga0268264_10142849
2391 Ga0268264_10157528
2392 Ga0268264_10168443
2393 Ga0268264_10181814
2394 Ga0268264_10275185
2395 Ga0265334_10033696
2396 Ga0265323_10021400
2397 Ga0307517_10000970
2398 Ga0307515_10132139
2399 Ga0307515_10203441
2400 Ga0307515_10242633
2401 Ga0307515_10245417
2402 Ga0265338_10110805
2403 Ga0265324_10000366
2404 Ga0307512_10021953
2405 Ga0265769_100271
2406 Ga0265760_10024581
2407 Ga0265330_10016360
2408 Ga0265330_10032230
2409 Ga0265332_10034970
2410 Ga0265328_10033570
2411 Ga0265320_10027217
2412 Ga0265325_10029379
2413 Ga0265340_10036886
2414 Ga0265331_10034908
2415 Ga0265331_10047843
2416 Ga0265316_10071769
2417 Ga0265316_10093854
2418 Ga0307513_10186603
2419 Ga0307509_10053465
2420 Ga0307509_10156853
2421 Ga0265313_10003842
2422 Ga0307508_10112232
2423 Ga0307514_10089125
2424 Ga0265314_10038445
2425 Ga0265314_10105935
2426 Ga0265342_10008005
2427 Ga0316576_10060506
2428 Ga0316578_10065563
2429 Ga0307516_10150346
2430 Ga0307516_10245789
2431 Ga0316577_10067535
2432 Ga0247548_100136
2433 Ga0307510_10057847
2434 Ga0373930_0002644
2435 Ga0373930_0004626
2436 Ga0373948_0004183
2437 Ga0373948_0004293
2438 Ga0373948_0005540
2439 Ga0373950_0000581
2440 Ga0373950_0004905
2441 Ga0373950_0005622
2442 Ga0373950_0005701
2443 Ga0373958_0000620
2444 Ga0373958_0003223
2445 Ga0373959_0001167
2446 Ga0373959_0006673
2447 Ga0373959_0009224
2448 Ga0373938_0001296
2449 Ga0373938_0006526
2450 Ga0373938_0007560
2451 Ga0373938_0013661
2452 Ga0373926_0006995
2453 Ga0373926_0022456
2454 Ga0373926_0026624
2455 Ga0373926_0028835
2456 Ga0373926_0029075
2457 Ga0373926_0032719
2458 Ga0373926_0043432
2459 Ga0373926_0047324
2460 Ga0373928_0000946
2461 Ga0373928_0006891
2462 Ga0373928_0007300
2463 Ga0373928_0012096
2464 Ga0373929_0001929
2465 Ga0373929_0006669
2466 Ga0373929_0007206
2467 Ga0373929_0009835
2468 Ga0373934_0013577
2469 Ga0373934_0019405
2470 Ga0373934_0032039
2471 Ga0373934_0035872
2472 Ga0373934_0046783
2473 Ga0373940_0010842
2474 Ga0373940_0011128
2475 Ga0373940_0018103
2476 Ga0373944_0014855
2477 Ga0373944_0016429
2478 Ga0373944_0021383
2479 Ga0373944_0024960
2480 Ga0373944_0034650
2481 Ga0373944_0043614
2482 Ga0373949_0001694
2483 Ga0373949_0011756
2484 Ga0373949_0012743
2485 Ga0373949_0013882
2486 Ga0373949_0015030
2487 Ga0373949_0015471
2488 Ga0373951_0009019
2489 Ga0373951_0009934
2490 Ga0373952_0003657
2491 Ga0373952_0006744
2492 Ga0373952_0007845
2493 Ga0373952_0008810
2494 Ga0373952_0010261
2495 Ga0373952_0010284
2496 Ga0373923_0018483
2497 Ga0373923_0019969
2498 Ga0373923_0025648
2499 Ga0373923_0035979
2500 Ga0373923_0053186
2501 Ga0373932_0011001
2502 Ga0373932_0015965
2503 Ga0373932_0017556
2504 Ga0373932_0019952
2505 Ga0373932_0020402
2506 Ga0373936_0018499
2507 Ga0373936_0022073
2508 Ga0373936_0029203
2509 Ga0373936_0034041
2510 Ga0373936_0034852
2511 Ga0373936_0041728
2512 Ga0373936_0048543
2513 Ga0373936_0049141
2514 Ga0373939_0000507
2515 Ga0373939_0013571
2516 Ga0373939_0014089
2517 Ga0373939_0014583
2518 Ga0373939_0017108
2519 Ga0373939_0021455
2520 Ga0373939_0025090
2521 Ga0373941_0001278
2522 Ga0373941_0002870
2523 Ga0373941_0015100
2524 Ga0373941_0016533
2525 Ga0373941_0017809
2526 Ga0373941_0041112
2527 Ga0373945_0009851
2528 Ga0373945_0017013
2529 Ga0373945_0020459
2530 Ga0373945_0022026
2531 Ga0373945_0024237
2532 Ga0373945_0024265
2533 Ga0373945_0041168
2534 Ga0373945_0041335
2535 Ga0373945_0043898
2536 Ga0373953_0012133
2537 Ga0373953_0027360
2538 Ga0373953_0028221
2539 Ga0373953_0033980
2540 Ga0373953_0039261
2541 Ga0373953_0052928
2542 Ga0373954_0035637
2543 Ga0373954_0050070
2544 Ga0373954_0052661
2545 Ga0373954_0107734
2546 Ga0373956_0013609
2547 Ga0373956_0031977
2548 Ga0373956_0032118
2549 Ga0373956_0042988
2550 Ga0373956_0046191
2551 Ga0373956_0046381
2552 Ga0373956_0056176
2553 Ga0373957_0022818
2554 Ga0373957_0027498
2555 Ga0373957_0037771
2556 Ga0373960_0002145
2557 Ga0373960_0006003
2558 Ga0373960_0012402
2559 Ga0373960_0013073
2560 Ga0373960_0014294
2561 Ga0373960_0015841
2562 Ga0373943_0022194
2563 Ga0373943_0042122
2564 Ga0373943_0045956
2565 Ga0373943_0046084
2566 Ga0373943_0046303
2567 Ga0373943_0047595
2568 Ga0373943_0052071
2569 Ga0373943_0054791
2570 Ga0373943_0055165
2571 Ga0373943_0061960
2572 Ga0373943_0074271
2573 Ga0373943_0087541
2574 Ga0373946_0023384
2575 Ga0373946_0025465
2576 Ga0373946_0027639
2577 Ga0373946_0031856
2578 Ga0373946_0047257
2579 Ga0373946_0062722
2580 Ga0373946_0075821
2581 Ga0373955_0038184
2582 Ga0373955_0050316
2583 Ga0373955_0067671
2584 Ga0373955_0084848
2585 Ga0373955_0112589
2586 Ga0373955_0114714
2587 Ga0373942_0007684
2588 Ga0373942_0008614
2589 Ga0373942_0015948
2590 Ga0373942_0019623
2591 Ga0373961_0009229
2592 Ga0373961_0012145
2593 Ga0373961_0014244
2594 Ga0373961_0021166
2595 Ga0373962_0001001
2596 Ga0373962_0012988
2597 Ga0373962_0013251
2598 Ga0373962_0014584
2599 Ga0373962_0014884
2600 Ga0373962_0026227
2601 Ga0316574_0024526
2602 Ga0316574_0077602
2603 Ga0373924_0023989
2604 Ga0373924_0025605
2605 Ga0373924_0033533
2606 Ga0373924_0038516
2607 Ga0373931_0005795
2608 Ga0373931_0011895
2609 Ga0373931_0041301
2610 Ga0373931_0041780
2611 Ga0373931_0048262
2612 Ga0373931_0055425
2613 Ga0373931_0061126
2614 Ga0373931_0063323
2615 Ga0373931_0108319
2616 Ga0373931_0110886
2617 Ga0373935_0047080
2618 Ga0373935_0073803
2619 Ga0373935_0077338
2620 Ga0373935_0086766
2621 Ga0373935_0087760
2622 Ga0373935_0088573
2623 Ga0373935_0092325
2624 Ga0373935_0100090
2625 Ga0373935_0126734
2626 Ga0373935_0127803
2627 Ga0373935_0137298
2628 Ga0373927_0007068
2629 Ga0373927_0014831
2630 Ga0373927_0057521
2631 Ga0373927_0065844
2632 Ga0373927_0073016
2633 Ga0373927_0083316
2634 Ga0373927_0086758
2635 Ga0373927_0088128
2636 Ga0373927_0091587
2637 Ga0373927_0091884
2638 Ga0373927_0104679
2639 Ga0373927_0119149
2640 Ga0373927_0124794
2641 Ga0373927_0176869
2642 Ga0373933_0027794
2643 Ga0373933_0057552
2644 Ga0373933_0067829
2645 Ga0373933_0070012
2646 Ga0373933_0086353
2647 Ga0373933_0097530
2648 Ga0373933_0141414
2649 Ga0373933_0153653
2650 Ga0373947_0025663
2651 Ga0373947_0036040
2652 Ga0373947_0072958
2653 Ga0373947_0074042
2654 Ga0373947_0075735
2655 Ga0373947_0078723
2656 Ga0373947_0087998
2657 Ga0373947_0093467
2658 Ga0373947_0127573
2659 Ga0373947_0132125
2660 Ga0373947_0163066
2661 Ga0373937_0007313
2662 Ga0373937_0019580
2663 Ga0373937_0078280
2664 Ga0373937_0119884
2665 Ga0373937_0126289
2666 Ga0373937_0134547
2667 Ga0373937_0156136
2668 Ga0373937_0166916
2669 Ga0373937_0176371
2670 Ga0373937_0176532
2671 Ga0373937_0187234
2672 Ga0373937_0239078
2673 Ga0316582_0066463
2674 Ga0316584_0089511
2675 Ga0373925_0060284
2676 Ga0373925_0078393
2677 Ga0373925_0087543
2678 Ga0373925_0089419
2679 Ga0373925_0098733
2680 Ga0373925_0109080
2681 Ga0373925_0112429
2682 Ga0373925_0118313
2683 Ga0373925_0126950
2684 Ga0373925_0161988
2685 Ga0373925_0163238
2686 Ga0373925_0176561
2687 Ga0373925_0203343
2688 Ga0395900_0103240
2689 Ga0400487_34578
2690 Ga0436365_0312816
2691 Ga0436365_0382575
2692 Ga0436360_0942193
2693 Ga0436360_1200571
2694 Ga0436361_0246471
2695 Ga0436361_0473542
2696 Ga0436361_0636700
2697 Ga0436361_0670461
2698 Ga0436361_0698129
2699 Ga0436361_0718864
2700 Ga0436363_0131824
2701 Ga0436363_0158283
2702 Ga0436362_0106990
2703 Ga0436362_0261345
2704 Ga0436362_0534509
2705 Ga0439453_0003922
2706 Ga0439441_001846
2707 Ga0439448_0007438
2708 Ga0439450_000217
2709 Ga0439455_0008214
2710 Ga0450923_005932
2711 Ga0439458_0007191
2712 Ga0439444_0004221
2713 Ga0439459_0002947
2714 Ga0439464_0000038
2715 Ga0439460_0027438
2716 Ga0466972_0048971
2717 Ga0466972_0051164
2718 Ga0466965_0040755
2719 Ga0466964_0010858
2720 Ga0453684_0003111
2721 Ga0466968_0001716
2722 Ga0466960_0029442
2723 Ga0451576_0263042
2724 Ga0466967_0246701
2725 Ga0495617_008605
2726 Ga0495617_020509
2727 Ga0495617_023689
2728 Ga0495617_025672
2729 Ga0495617_030838
2730 Ga0495617_038542
2731 Ga0495627_019853
2732 Ga0495627_026179
2733 Ga0495592_0011412
2734 Ga0495592_0040501
2735 Ga0495592_0043444
2736 Ga0495592_0050071
2737 Ga0495592_0056195
2738 Ga0495592_0069982
2739 Ga0495592_0081367
2740 Ga0495592_0094297
2741 Ga0495592_0102495
2742 Ga0495592_0138453
2743 Ga0495592_0150097
2744 Ga0495603_0018781
2745 Ga0495603_0063660
2746 Ga0495603_0070247
2747 Ga0495603_0071214
2748 Ga0495603_0075984
2749 Ga0495603_0076895
2750 Ga0495603_0078817
2751 Ga0495603_0086777
2752 Ga0495590_0002715
2753 Ga0495590_0027418
2754 Ga0495590_0037365
2755 Ga0495591_016384
2756 Ga0495629_0006149
2757 Ga0495629_0037338
2758 Ga0495629_0042309
2759 Ga0495629_0067262
2760 Ga0495629_0090664
2761 Ga0495629_0090856
2762 Ga0495629_0102877
2763 Ga0495629_0109757
2764 Ga0495629_0114280
2765 Ga0495629_0140062
2766 Ga0495629_0141265
2767 Ga0495638_0018463
2768 Ga0495638_0075879
2769 Ga0495638_0081079
2770 Ga0495638_0102866
2771 Ga0495641_0012648
2772 Ga0495641_0033106
2773 Ga0495641_0034995
2774 Ga0495641_0035897
2775 Ga0495641_0046260
2776 Ga0495641_0061712
2777 Ga0495651_0035973
2778 Ga0495651_0047705
2779 Ga0495651_0048217
2780 Ga0495651_0080442
2781 Ga0495651_0085280
2782 Ga0495651_0098957
2783 Ga0495651_0103181
2784 Ga0495651_0104839
2785 Ga0495651_0105388
2786 Ga0495651_0105553
2787 Ga0495651_0111624
2788 Ga0495653_0036782
2789 Ga0495653_0051123
2790 Ga0495653_0069246
2791 Ga0495653_0095913
2792 Ga0495653_0124359
2793 Ga0495653_0151367
2794 Ga0495653_0159121
2795 Ga0495650_0032615
2796 Ga0495650_0039373
2797 Ga0495650_0039980
2798 Ga0495650_0040413
2799 Ga0495650_0040515
2800 Ga0495650_0044241
2801 Ga0495580_0000880
2802 Ga0495580_0048764
2803 Ga0495580_0054131
2804 Ga0495580_0093419
2805 Ga0495580_0103160
2806 Ga0495580_0106586
2807 Ga0495580_0114240
2808 Ga0495580_0119052
2809 Ga0495580_0125337
2810 Ga0495580_0132887
2811 Ga0495580_0133443
2812 Ga0495582_0010960
2813 Ga0495582_0030790
2814 Ga0495582_0052335
2815 Ga0495582_0052831
2816 Ga0495582_0066369
2817 Ga0495582_0070271
2818 Ga0495582_0074957
2819 Ga0495582_0127235
2820 Ga0495605_0021678
2821 Ga0495605_0025911
2822 Ga0495605_0031097
2823 Ga0495605_0041011
2824 Ga0495605_0044532
2825 Ga0495605_0066557
2826 Ga0495639_0013188
2827 Ga0495639_0017612
2828 Ga0495639_0026386
2829 Ga0495639_0035445
2830 Ga0495639_0045413
2831 Ga0495639_0073528
2832 Ga0495662_0008404
2833 Ga0495662_0025773
2834 Ga0495662_0028706
2835 Ga0495662_0039611
2836 Ga0495662_0043105
2837 Ga0495662_0045297
2838 Ga0495662_0047303
2839 Ga0495662_0050709
2840 Ga0495662_0057550
2841 Ga0495662_0073563
2842 Ga0495664_0020362
2843 Ga0495664_0020432
2844 Ga0495664_0033433
2845 Ga0495664_0060965
2846 Ga0495664_0068180
2847 Ga0495664_0088641
2848 Ga0495664_0102074
2849 Ga0495664_0117936
2850 Ga0495664_0162135
2851 Ga0495584_0014579
2852 Ga0495584_0045356
2853 Ga0495584_0052355
2854 Ga0495584_0054238
2855 Ga0495585_0016070
2856 Ga0495585_0030086
2857 Ga0495585_0038965
2858 Ga0495585_0054498
2859 Ga0495585_0056407
2860 Ga0495585_0061064
2861 Ga0495585_0064709
2862 Ga0495594_0020857
2863 Ga0495594_0037871
2864 Ga0495594_0052904
2865 Ga0495594_0059598
2866 Ga0495594_0062521
2867 Ga0495594_0065479
2868 Ga0495594_0121191
2869 Ga0495596_0016574
2870 Ga0495596_0026630
2871 Ga0495596_0027666
2872 Ga0495596_0033435
2873 Ga0495596_0035538
2874 Ga0495596_0035974
2875 Ga0495596_0040697
2876 Ga0495596_0043665
2877 Ga0495596_0050725
2878 Ga0495607_0020383
2879 Ga0495607_0064600
2880 Ga0495607_0068901
2881 Ga0495607_0077116
2882 Ga0495583_0029046
2883 Ga0495583_0043912
2884 Ga0495606_0065670
2885 Ga0495606_0068819
2886 Ga0495606_0071302
2887 Ga0495606_0130195
2888 Ga0495608_0014629
2889 Ga0495608_0034014
2890 Ga0495608_0050596
2891 Ga0495608_0060196
2892 Ga0495608_0079876
2893 Ga0495608_0086848
2894 Ga0495608_0097009
2895 Ga0495608_0108826
2896 Ga0495610_0013838
2897 Ga0495610_0047181
2898 Ga0495610_0049342
2899 Ga0495616_0024318
2900 Ga0495616_0040654
2901 Ga0495616_0043367
2902 Ga0495616_0049485
2903 Ga0495618_0034860
2904 Ga0495618_0044246
2905 Ga0495618_0061014
2906 Ga0495618_0064599
2907 Ga0495618_0071592
2908 Ga0495620_0045055
2909 Ga0495628_0004856
2910 Ga0495628_0042604
2911 Ga0495628_0079254
2912 Ga0495628_0092681
2913 Ga0495628_0093770
2914 Ga0495628_0110516
2915 Ga0495628_0125313
2916 Ga0495628_0131756
2917 Ga0495630_0045276
2918 Ga0495630_0052557
2919 Ga0495630_0101079
2920 Ga0495630_0103202
2921 Ga0495630_0107175
2922 Ga0495630_0113875
2923 Ga0495631_0006458
2924 Ga0495631_0020194
2925 Ga0495631_0021815
2926 Ga0495631_0036836
2927 Ga0495631_0038131
2928 Ga0495631_0040872
2929 Ga0495631_0048622
2930 Ga0495631_0060397
2931 Ga0495632_0028974
2932 Ga0495632_0037177
2933 Ga0495632_0073629
2934 Ga0495637_0020653
2935 Ga0495637_0039829
2936 Ga0495637_0041797
2937 Ga0495643_0047491
2938 Ga0495644_0023582
2939 Ga0495644_0028617
2940 Ga0495644_0030987
2941 Ga0495644_0031018
2942 Ga0495644_0035425
2943 Ga0495644_0040698
2944 Ga0495644_0048045
2945 Ga0495648_0012902
2946 Ga0495648_0056926
2947 Ga0495648_0075440
2948 Ga0495648_0077293
2949 Ga0495648_0084760
2950 Ga0495663_0015446
2951 Ga0495663_0016062
2952 Ga0495663_0017858
2953 Ga0495663_0018904
2954 Ga0495663_0018947
2955 Ga0495666_0016750
2956 Ga0495666_0022058
2957 Ga0495666_0023259
2958 Ga0495666_0041216
2959 Ga0495666_0044454
2960 Ga0495666_0044584
2961 Ga0495666_0052870
2962 Ga0495666_0077042
2963 Ga0495666_0092897
2964 Ga0495642_0020825
2965 Ga0495642_0032613
2966 Ga0495642_0033883
2967 Ga0495642_0035371
2968 Ga0495642_0043162
2969 Ga0495642_0060192
2970 Ga0495652_0048344
2971 Ga0495652_0049250
2972 Ga0495652_0054943
2973 Ga0495652_0062851
2974 Ga0495652_0079071
2975 Ga0495652_0080947
2976 Ga0495652_0089016
2977 Ga0495652_0094216
2978 Ga0495652_0177482
2979 Ga0495654_0014800
2980 Ga0495654_0019427
2981 Ga0495654_0020068
2982 Ga0495654_0063469
2983 Ga0495654_0076339
2984 Ga0495665_0003029
2985 Ga0495665_0027501
2986 Ga0495665_0052306
2987 Ga0495665_0054511
2988 Ga0495665_0056543
2989 Ga0495665_0057527
2990 Ga0495665_0058208
2991 Ga0495665_0059320
2992 Ga0495665_0064412
2993 Ga0495665_0085517
2994 Ga0495665_0092561
2995 Ga0495640_0024783
2996 Ga0495640_0028141
2997 Ga0495640_0072256
2998 Ga0495640_0073346
2999 Ga0495640_0077616
3000 Ga0495640_0078047
3001 Ga0495640_0089823
3002 Ga0495640_0135955
3003 Ga0495640_0140880
3004 Ga0495586_0020384
3005 Ga0495586_0027514
3006 Ga0495586_0038083
3007 Ga0495586_0043125
3008 Ga0495586_0052389
3009 Ga0495586_0067346
3010 Ga0495586_0088717
3011 Ga0495587_0011536
3012 Ga0495587_0020418
3013 Ga0495587_0035885
3014 Ga0495587_0041088
3015 Ga0495587_0052910
3016 Ga0495587_0054912
3017 Ga0495587_0058230
3018 Ga0495587_0071458
3019 Ga0495587_0071907
3020 Ga0495587_0077330
3021 Ga0495587_0078300
3022 Ga0495587_0090596
3023 Ga0495587_0107585
3024 Ga0495598_0008844
3025 Ga0495598_0017112
3026 Ga0495598_0019449
3027 Ga0495609_0030368
3028 Ga0495609_0038789
3029 Ga0495609_0043373
3030 Ga0495609_0044208
3031 Ga0495609_0045169
3032 Ga0495621_0007581
3033 Ga0495621_0020080
3034 Ga0495621_0020565
3035 Ga0495621_0023642
3036 Ga0495621_0024274
3037 Ga0495621_0034668
3038 Ga0495621_0038333
3039 Ga0495621_0038904
3040 Ga0495621_0047343
3041 Ga0495597_0039555
3042 Ga0495597_0040728
3043 Ga0495597_0040785
3044 Ga0495645_0006552
3045 Ga0495645_0043096
3046 Ga0495645_0060671
3047 Ga0495645_0076582
3048 Ga0495645_0077563
3049 Ga0495645_0099966
3050 Ga0495645_0102976
3051 Ga0495645_0185116
3052 Ga0495645_0201764
3053 Ga0495622_0013934
3054 Ga0495622_0042867
3055 Ga0495622_0048450
3056 Ga0495622_0067333
3057 Ga0495622_0073962
3058 Ga0495633_0037709
3059 Ga0495633_0037713
3060 Ga0495633_0038281
3061 Ga0495633_0043974
3062 Ga0495633_0049606
3063 Ga0495633_0050373
3064 Ga0495633_0052718
3065 Ga0495633_0071103
3066 Ga0495633_0081410
3067 Ga0495667_0056626
3068 Ga0495667_0056661
3069 Ga0495667_0066155
3070 Ga0495667_0066894
3071 Ga0495667_0079781
3072 Ga0495667_0081374
3073 Ga0495667_0083563
3074 Ga0495667_0083780
3075 Ga0495667_0094245
3076 Ga0495667_0100051
3077 Ga0495667_0182454
3078 Ga0495656_0019432
3079 Ga0495656_0024257
3080 Ga0495656_0033132
3081 Ga0495656_0033950
3082 Ga0495656_0035583
3083 Ga0495656_0037253
3084 Ga0495656_0046150
3085 Ga0495668_0045799
3086 Ga0495668_0045859
3087 Ga0495668_0056678
3088 Ga0495668_0071304
3089 Ga0495634_0020538
3090 Ga0495634_0049509
3091 Ga0495634_0072191
3092 Ga0495634_0072813
3093 Ga0495634_0080011
3094 Ga0495634_0086066
3095 Ga0495634_0087992
3096 Ga0495634_0090058
3097 Ga0495634_0102889
3098 Ga0495634_0109724
3099 Ga0495634_0140364
3100 Ga0495611_0026294
3101 Ga0495611_0027575
3102 Ga0495611_0040329
3103 Ga0495611_0044614
3104 Ga0495625_0081765
3105 Ga0495625_0124665
3106 Ga0495625_0144949
3107 Ga0495635_0002979
3108 Ga0495635_0027913
3109 Ga0495635_0035500
3110 Ga0495635_0059712
3111 Ga0495635_0085309
3112 Ga0495635_0089635
3113 Ga0495635_0094472
3114 Ga0495635_0094808
3115 Ga0495635_0107936
3116 Ga0495635_0240344
3117 Ga0495659_0006430
3118 Ga0495659_0015791
3119 Ga0495659_0023853
3120 Ga0495659_0024405
3121 Ga0495659_0027133
3122 Ga0495661_0054055
3123 Ga0495661_0064668
3124 Ga0495661_0067868
3125 Ga0495661_0070877
3126 Ga0495661_0088218
3127 Ga0495588_0028149
3128 Ga0495588_0048702
3129 Ga0495588_0053996
3130 Ga0495588_0057846
3131 Ga0495588_0075131
3132 Ga0495588_0095669
3133 Ga0495657_0023797
3134 Ga0495657_0041514
3135 Ga0495657_0041696
3136 Ga0495657_0063083
3137 Ga0495657_0069497
3138 Ga0495657_0079730
3139 Ga0495657_0088575
3140 Ga0495657_0093043
3141 Ga0495657_0099063
3142 Ga0495657_0122957
3143 Ga0495657_0138232
3144 Ga0495657_0138522
3145 Ga0495599_0019366
3146 Ga0495599_0040766
3147 Ga0495599_0041173
3148 Ga0495599_0059385
3149 Ga0495599_0060938
3150 Ga0495599_0071195
3151 Ga0495599_0073672
3152 Ga0495599_0078119
3153 Ga0495599_0078633
3154 Ga0495599_0079350
3155 Ga0495599_0134255
3156 Ga0495623_0031253
3157 Ga0495623_0042678
3158 Ga0495623_0045734
3159 Ga0495623_0067241
3160 Ga0495623_0069670
3161 Ga0495623_0071450
3162 Ga0495623_0073924
3163 Ga0495623_0073982
3164 Ga0495623_0118561
3165 Ga0495646_0010082
3166 Ga0495646_0026121
3167 Ga0495646_0035044
3168 Ga0495646_0050763
3169 Ga0495646_0052661
3170 Ga0495646_0069763
3171 Ga0495646_0070946
3172 Ga0495646_0120882
3173 Ga0495647_0008647
3174 Ga0495647_0025989
3175 Ga0495647_0028325
3176 Ga0495647_0028396
3177 Ga0495647_0031429
3178 Ga0495647_0035710
3179 Ga0495647_0042211
3180 Ga0495658_0032854
3181 Ga0495658_0046233
3182 Ga0495658_0048064
3183 Ga0495658_0055193
3184 Ga0495658_0055508
3185 Ga0495658_0076021
3186 Ga0495658_0077784
3187 Ga0495658_0097561
3188 Ga0495658_0144772
3189 Ga0495669_0008081
3190 Ga0495669_0016951
3191 Ga0495669_0039704
3192 Ga0495669_0041491
3193 Ga0495669_0042757
3194 Ga0495669_0043272
3195 Ga0495669_0043740
3196 Ga0495669_0045601
3197 Ga0495613_0027564
3198 Ga0495613_0054710
3199 Ga0495613_0054744
3200 Ga0495613_0087754
3201 Ga0495613_0093289
3202 Ga0495613_0101882
3203 Ga0495613_0102320
3204 Ga0495613_0107574
3205 Ga0495613_0109965
3206 Ga0495613_0114537
3207 Ga0495613_0120899
3208 Ga0495624_0007398
3209 Ga0495624_0053248
3210 Ga0495624_0067784
3211 Ga0495624_0074050
3212 Ga0495624_0074973
3213 Ga0495624_0076382
3214 Ga0495624_0080252
3215 Ga0495624_0081275
3216 Ga0495624_0086146
3217 Ga0495624_0089820
3218 Ga0495624_0137289
3219 Ga0495670_0047099
3220 Ga0495670_0051352
3221 Ga0495670_0053877
3222 Ga0495670_0058467
3223 Ga0495670_0058627
3224 Ga0495671_0023097
3225 Ga0495671_0034217
3226 Ga0495671_0046966
3227 Ga0495671_0052703
3228 Ga0495671_0054883
3229 Ga0495671_0057348
3230 Ga0495671_0059373
3231 Ga0495671_0079382
3232 Ga0495649_0009131
3233 Ga0495649_0043306
3234 Ga0495649_0059104
3235 Ga0495649_0072737
3236 Ga0495649_0075377
3237 Ga0495589_0038649
3238 Ga0495589_0049000
3239 Ga0495589_0053758
3240 Ga0495589_0054364
3241 Ga0495589_0054523
3242 Ga0495589_0057791
3243 Ga0495589_0073731
3244 Ga0495600_0034021
3245 Ga0495600_0077153
3246 Ga0495600_0084620
3247 Ga0495600_0085222
3248 Ga0495600_0087976
3249 Ga0495600_0089214
3250 Ga0495600_0094170
3251 Ga0495600_0103283
3252 Ga0495600_0126453
3253 Ga0495600_0148531
3254 Ga0495660_0033908
3255 Ga0495660_0052081
3256 Ga0495660_0064625
3257 Ga0495660_0081745
3258 Ga0495581_0016597
3259 Ga0495581_0021001
3260 Ga0495581_0048598
3261 Ga0495581_0060942
3262 Ga0495581_0062156
3263 Ga0495581_0062262
3264 Ga0495581_0067589
3265 Ga0495581_0125343
3266 Ga0495604_0049482
3267 Ga0495604_0058038
3268 Ga0495604_0071204
3269 Ga0495604_0082997
3270 Ga0495604_0105918
3271 Ga0495604_0106005
3272 Ga0495604_0106802
3273 Ga0495604_0108362
3274 Ga0495604_0109646
3275 Ga0495604_0172127
3276 Ga0495636_0026435
3277 Ga0495636_0028033
3278 Ga0495636_0055681
3279 Ga0495674_0005170
3280 Ga0495674_0046151
3281 Ga0495674_0047017
3282 Ga0495674_0056352
3283 Ga0495674_0088888
3284 Ga0495674_0100796
3285 Ga0495674_0105279
3286 Ga0495674_0126068
3287 Ga0495674_0154825
3288 Ga0495674_0162572
3289 Ga0495674_0175923
3290 Ga0495674_0188826
3291 Ga0495674_0240333
3292 Ga0495674_0251156
3293 Ga0495672_0037745
3294 Ga0495672_0093999
3295 Ga0495676_0053403
3296 Ga0495676_0062588
3297 Ga0495676_0082137
3298 Ga0495676_0086275
3299 Ga0495676_0089962
3300 Ga0495676_0090875
3301 Ga0495676_0127198
3302 Ga0495676_0138754
3303 Ga0495676_0139572
3304 Ga0495680_0004184
3305 Ga0495680_0047477
3306 Ga0495680_0066829
3307 Ga0495680_0095413
3308 Ga0495680_0102361
3309 Ga0495680_0103209
3310 Ga0495680_0109829
3311 Ga0495683_0018610
3312 Ga0495683_0021599
3313 Ga0495683_0032950
3314 Ga0495683_0040651
3315 Ga0495683_0055276
3316 Ga0495683_0055517
3317 Ga0495687_014824
3318 Ga0495675_0026516
3319 Ga0495675_0029225
3320 Ga0495675_0048693
3321 Ga0495675_0070619
3322 Ga0495675_0078317
3323 Ga0495675_0082631
3324 Ga0495675_0083874
3325 Ga0495677_0021279
3326 Ga0495677_0027133
3327 Ga0495677_0029995
3328 Ga0495677_0031250
3329 Ga0495677_0044238
3330 Ga0495679_015342
3331 Ga0495679_019576
3332 Ga0495679_022585
3333 Ga0495685_016625
3334 Ga0495685_027332
3335 Ga0495685_027828
3336 Ga0495673_0028659
3337 Ga0495673_0041736
3338 Ga0495673_0045736
3339 Ga0495681_0036277
3340 Ga0495681_0053784
3341 Ga0495681_0061792
3342 Ga0495684_0034067
3343 Ga0495684_0089247
3344 Ga0495684_0096866
3345 Ga0495684_0098660
3346 Ga0495684_0099181
3347 Ga0495684_0100644
3348 Ga0495684_0101819
3349 Ga0495684_0111466
3350 Ga0495684_0112114
3351 Ga0495684_0116989
3352 Ga0495684_0177899
3353 Ga0495684_0232871
3354 Ga0495686_0073301
3355 Ga0495593_0015021
3356 Ga0495593_0032514
3357 Ga0495593_0035357
3358 Ga0495593_0037000
3359 Ga0495593_0058103
3360 Ga0495593_0059259
3361 Ga0495593_0059320
3362 Ga0495593_0062483
3363 Ga0495593_0071394
3364 Ga0495602_0035035
3365 Ga0495602_0049663
3366 Ga0495602_0080881
3367 Ga0495602_0106288
3368 Ga0495602_0109229
3369 Ga0495602_0119989
3370 Ga0495602_0125551
3371 Ga0495602_0129255
3372 Ga0495614_0017237
3373 Ga0495614_0032792
3374 Ga0495614_0033990
3375 Ga0495614_0036862
3376 Ga0495614_0043029
3377 Ga0495614_0050148
3378 Ga0495614_0060350
3379 Ga0495615_0004037
3380 Ga0495615_0007383
3381 Ga0495626_0032603
3382 Ga0495626_0034139
3383 Ga0495626_0043559
3384 Ga0495626_0050534
3385 Ga0496100_0000672
3386 Ga0496100_0045295
3387 Ga0496100_0050208
3388 Ga0496100_0062798
3389 Ga0496100_0089641
3390 Ga0496100_0090793
3391 Ga0496100_0104957
3392 Ga0496100_0108567
3393 Ga0496100_0189760
3394 Ga0496101_0004114
3395 Ga0496101_0016725
3396 Ga0496101_0051876
3397 Ga0496101_0112529
3398 Ga0496101_0114723
3399 Ga0496101_0115866
3400 Ga0496101_0141701
3401 Ga0496101_0169078
3402 Ga0496101_0248186
3403 Ga0496102_0015290
3404 Ga0496102_0055795
3405 Ga0496102_0075273
3406 Ga0496102_0145727
3407 Ga0496102_0154835
3408 Ga0496102_0168697
3409 Ga0496102_0215990
3410 Ga0496102_0219369
3411 Ga0496102_0219398
3412 Ga0496102_0284186
3413 Ga0496103_0007026
3414 Ga0496103_0058312
3415 Ga0496103_0076928
3416 Ga0496103_0077199
3417 Ga0496103_0082231
3418 Ga0496103_0082512
3419 Ga0496103_0086282
3420 Ga0496103_0086437
3421 Ga0496104_0001705
3422 Ga0496104_0019385
3423 Ga0496104_0039985
3424 Ga0496104_0040528
3425 Ga0496104_0063093
3426 Ga0496104_0117848
3427 Ga0496104_0146435
3428 Ga0496104_0153844
3429 Ga0496104_0163919
3430 Ga0496104_0228416
3431 Ga0496105_0001112
3432 Ga0496105_0009874
3433 Ga0496105_0053167
3434 Ga0496105_0124764
3435 Ga0496105_0131478
3436 Ga0496105_0152000
3437 Ga0496106_0017946
3438 Ga0496106_0040006
3439 Ga0496106_0054310
3440 Ga0496106_0110099
3441 Ga0496106_0112788
3442 Ga0496106_0116571
3443 Ga0496106_0122434
3444 Ga0496106_0141401
3445 Ga0496107_0052726
3446 Ga0496107_0060295
3447 Ga0496107_0090811
3448 Ga0496107_0093281
3449 Ga0496107_0101544
3450 Ga0496107_0105318
3451 Ga0496107_0113571
3452 Ga0496108_0073540
3453 Ga0496108_0098873
3454 Ga0496108_0132589
3455 Ga0496108_0153287
3456 Ga0496108_0186375
3457 Ga0496109_0078418
3458 Ga0496109_0162847
3459 Ga0496109_0183184
3460 Ga0496109_0185076
3461 Ga0496109_0204293
3462 Ga0496109_0266637
3463 Ga0496110_0109441
3464 Ga0496110_0113851
3465 Ga0496110_0130306
3466 Ga0496110_0151610
3467 Ga0496110_0234769
3468 Ga0496111_0034746
3469 Ga0496111_0104413
3470 Ga0496111_0106237
3471 Ga0496111_0108966
3472 Ga0496111_0175170
3473 Ga0496112_0161202
3474 Ga0496112_0190419
3475 Ga0496112_0192106
3476 Ga0496112_0244510
3477 Ga0496113_0115226
3478 Ga0496113_0125925
3479 Ga0496114_0040626
3480 Ga0496114_0067168
3481 Ga0496114_0137843
3482 Ga0496114_0139163
3483 Ga0496114_0147849
3484 Ga0496114_0170685
3485 Ga0496114_0178141
3486 Ga0496114_0182784
3487 Ga0496114_0194513
3488 Ga0496115_0039711
3489 Ga0496115_0051785
3490 Ga0496115_0060487
3491 Ga0496115_0092717
3492 Ga0496115_0106251
3493 Ga0496115_0116289
3494 Ga0496115_0141182
3495 Ga0496115_0145860
3496 Ga0496115_0202770
3497 Ga0496115_0207041
3498 Ga0496116_0023238
3499 Ga0496117_0006792
3500 Ga0496117_0039313
3501 Ga0496117_0073620
3502 Ga0496117_0083921
3503 Ga0496117_0124415
3504 Ga0496118_0055678
3505 Ga0496118_0058201
3506 Ga0496118_0099648
3507 Ga0496118_0101503
3508 Ga0496119_0008659
3509 Ga0496119_0066048
3510 Ga0496119_0072207
3511 Ga0496119_0078005
3512 Ga0496119_0079277
3513 Ga0496120_0048391
3514 Ga0496120_0052999
3515 Ga0496120_0085661
3516 Ga0496120_0095242
3517 Ga0496121_0041096
3518 Ga0496121_0078624
3519 Ga0496121_0113113
3520 Ga0496121_0133479
3521 Ga0496122_0038660
3522 Ga0496122_0126306
3523 Ga0496123_0092929
3524 Ga0496124_0119134
3525 Ga0496124_0120854
3526 Ga0496124_0126759
3527 Ga0496125_0049739
3528 Ga0496125_0054915
3529 Ga0496125_0147995
3530 Ga0496126_0094618
3531 Ga0496126_0107470
3532 Ga0496126_0107711
3533 Ga0496126_0210040
3534 Ga0495678_019042
3535 Ga0495682_0013874
3536 Ga0495682_0030442
3537 Ga0495682_0062518
3538 Ga0501291_000951
3539 Ga0501067_0022408
3540 Ga0501067_0081267
3541 Ga0501069_0067551
3542 Ga0501069_0084232
3543 Ga0501070_0115317
3544 Ga0501076_0178655
3545 Ga0501235_001462
3546 Ga0501250_000659
3547 Ga0501251_001617
3548 Ga0501252_000606
3549 Ga0501225_0010575
3550 Ga0501079_0213954
3551 Ga0501081_0081363
3552 Ga0501241_007521
3553 nmdc:mga06z11_25769_c1
3554 nmdc:mga04h51_31326_c1
3555 nmdc:mga07m45_53547_c1
3556 nmdc:mga07m45_68669_c1
3557 nmdc:mga05p37_223130_c1
3558 nmdc:mga05p37_279433_c1
3559 nmdc:mga05p37_347935_c1
3560 nmdc:mga0qj67_101206_c1
3561 nmdc:mga0qj67_132787_c1
3562 nmdc:mga06r32_145914_c1
3563 nmdc:mga06r32_180946_c1
3564 nmdc:mga06r32_25133_c1
3565 nmdc:mga06r32_252095_c1
3566 nmdc:mga08y16_155948_c1
3567 nmdc:mga08y16_193525_c1
3568 nmdc:mga08y16_211858_c1
3569 nmdc:mga08y16_232732_c1
3570 nmdc:mga08y16_234901_c1
3571 nmdc:mga08y16_253344_c1
3572 nmdc:mga08y16_95583_c1
3573 nmdc:mga0n895_160517_c1
3574 nmdc:mga0n895_200852_c1
3575 nmdc:mga0n895_216713_c1
3576 nmdc:mga0n895_223204_c1
3577 nmdc:mga0n895_229910_c1
3578 nmdc:mga0n895_236300_c1
3579 nmdc:mga0n895_279247_c1
3580 nmdc:mga0rr50_123157_c1
3581 nmdc:mga0rr50_137056_c1
3582 nmdc:mga0rr50_205996_c1
3583 nmdc:mga0rr50_228092_c1
3584 nmdc:mga0rr50_233160_c1
3585 nmdc:mga0rr50_71232_c1
3586 nmdc:mga08x19_125136_c1
3587 nmdc:mga0a205_150320_c1
3588 nmdc:mga0a205_153471_c1
3589 nmdc:mga0a205_170169_c1
3590 nmdc:mga0a205_171628_c1
3591 nmdc:mga0a205_6547_c2
3592 Ga0495601_0033150
3593 Ga0495601_0044902
3594 Ga0495601_0062551
3595 Ga0495601_0066615
3596 Ga0495601_0100646
3597 Ga0495612_0013907
3598 Ga0495612_0016415
3599 Ga0495612_0018459
3600 Ga0495612_0025642
3601 Ga0495612_0029145
3602 Ga0495612_0030929
3603 Ga0495612_0047582
3604 Ga0495595_0007104
3605 Ga0495595_0013654
3606 Ga0495595_0014010
3607 Ga0495595_0021234
3608 Ga0495595_0036714
3609 Ga0495595_0039832
3610 Ga0495595_0044492
3611 Ga0495619_0036729
3612 Ga0495619_0068635
3613 Ga0495619_0080615
3614 Ga0495619_0080727
3615 Ga0495619_0082379
3616 Ga0495619_0092316
3617 Ga0495619_0092691
3618 Ga0495619_0104272
3619 Ga0500578_0075563
3620 Ga0500643_012830
3621 Ga0500651_0000666
3622 Ga0500651_0084164
3623 Ga0500641_0008723
3624 Ga0500641_0067478
3625 Ga0500650_0043581
3626 Ga0500562_016489
3627 Ga0500582_018410
3628 Ga0500592_003775
3629 Ga0500595_000309
3630 Ga0500642_0060990
3631 Ga0500658_0035903
3632 Ga0500559_0008740
3633 Ga0500577_0023178
3634 Ga0500579_071191
3635 Ga0500588_0012604
3636 Ga0500589_008456
3637 Ga0500604_0015925
3638 Ga0500622_0014532
3639 Ga0500627_0009532
3640 Ga0500627_0069718
3641 Ga0500634_0009635
3642 Ga0500634_0080746
3643 Ga0500636_0044694
3644 Ga0500645_026521
3645 Ga0587077_002586
3646 Ga0587082_002402
3647 Ga0587085_001833
3648 Ga0587062_003294
3649 Ga0587072_003897
3650 Ga0530510_0199987
3651 2512348742
3652 2512351805
3653 2512351965
3654 2513558040
3655 2513720832
3656 2513723419
3657 2513723448
3658 2513723775
3659 2513723950
3660 2558860608
3661 2558862065
3662 2558862441
3663 2558865755
3664 2585264054
3665 2644027856
3666 2745075108
3667 2776257752
3668 2776260100
3669 2776263843
3670 2776264600
3671 2776264778
3672 2776264893
3673 2776265028
3674 2776266631
3675 2776266847
3676 2842329858
3677 2842354676
3678 2842460125
3679 2874130496
3680 2876763805
3681 2876763981
3682 2876767391
3683 2881671454
3684 2885383402
3685 2885414001
3686 2889791694
3687 2900642728
3688 2903778253
3689 2922363016
3690 2935769730
3691 2941538491
3692 8006985137
3693 8019649190
3694 8019657173

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00078

RVT_1

Reverse transcriptase (RNA-dependent DNA polymerase)

83

305

0.95

PF08388

GIIM

Group II intron, maturase-specific domain

313

390

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bgj-assembly2.cif.gz_B crystal structure of reverse transcriptase domain from caloramator australicus cart-capp 0.8755 91 304
8bgj-assembly2.cif.gz_B crystal structure of reverse transcriptase domain from caloramator australicus cart-capp 0.8502 91 304
5irg-assembly2.cif.gz_C reverse transcriptase domain of group ii intron maturase from roseburia intestinalis in p212121 space group 0.8441 15 323
8bgj-assembly3.cif.gz_C crystal structure of reverse transcriptase domain from caloramator australicus cart-capp 0.8427 80 304
5irg-assembly1.cif.gz_D reverse transcriptase domain of group ii intron maturase from roseburia intestinalis in p212121 space group 0.8425 15 323
ID Description Score Start End Superfamily
af_P05511_299_561_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8757 83 300 3.20.20.210
af_Q47688_90_332_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.8522 83 300 3.30.70.270
af_A0A1D6JF34_14_351_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.8351 24 292 3.30.70.270
af_A0A368UH40_1657_1911_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.8336 83 290 3.30.70.270
af_Q54BA4_491_738_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.8313 91 300 3.30.70.270
ID Description Score Start End GO Terms
AF-A0A7X7II12-F1-model_v4 deleted 0.9852 41 145
AF-A0A6N0ZEU8-F1-model_v4 Reverse transcriptase domain-containing protein 0.9818 1 229
AF-A0A176ZEU8-F1-model_v4 Group II intron reverse transcriptase/maturase 0.9808 2 361 GO:0003964
AF-A0A2C9CGG6-F1-model_v4 Strong similarity to group II intron-encoded protein LtrA (EC 2.7.7.49) 0.9765 29 145 GO:0003720
AF-A0A517YK91-F1-model_v4 Group II intron-encoded protein LtrA 0.9707 2 120

Map