F495884
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1847 | 529 | 3694 | 438 |
Family's Representative Sequence
| Representative Sequence | 3300042139|Ga0450904_002772|Ga0450904_002772_146_1435 |
| Length | 416 |
| Sequence | MALHAKAKAEAGYRFYALYDKISRDDVLAHAWVQCRSNKGAPGADGQDFADVEAYGVQRWLGELALALREETYRPGPIRRVFIPKANGKLRPLGISSLRDRVCMTAAMLVLEPIFEADLPPEQYAYRPGRNAQQAVIAVQETLFGGHPEVVDADLADYFGSIPHAELMLSLARRIVDARVLHLLRMWLECPVEETDDRGQRTRTTEAKEQRRGIPQGSPMSPLLASLYMRRFVLGWKKLGLEEGLGSRIVSYADDLVILCRRGKAQEALAHMRELMERLKLSVNEEKTRICKVPEGQFDFLGYTFGQMYSKTTGKARLAMWPSKKSIRRMVEKVHDLTAVQTGWQEITANYFQVGTVNQAYRALDNYTAPRLRRWLRHKHKVRQRKGGSYPLSHLYGHFWLVRLTARGRNESWVKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 4 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 10 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 11 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 15 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 16 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 17 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 18 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 20 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 22 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 89 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 106 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 123 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 140 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 141 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 144 | 3300023552 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300023660 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300024123 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 | Metagenome | Unclassified |
| 147 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 148 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 149 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 213 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300028010 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 223 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 224 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 225 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 228 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 233 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 234 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 235 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 236 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 238 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 239 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 240 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 241 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 242 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 243 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 245 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 246 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 247 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 248 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 249 | 3300031814 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 251 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 252 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 253 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 254 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 255 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 256 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 257 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 258 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 259 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 260 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 263 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 264 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 266 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 269 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 270 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 272 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 273 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 274 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 276 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 277 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 278 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 279 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 283 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 284 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 285 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 286 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 287 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 288 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 289 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 290 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 292 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 293 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 295 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 296 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 297 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 298 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 299 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 300 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 301 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 302 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 303 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 304 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 305 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 306 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 307 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 308 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 309 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 310 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 311 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 312 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 313 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 314 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 315 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 316 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 317 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 318 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 319 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 320 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 423 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 424 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 425 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 426 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 427 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 428 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 429 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 430 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 431 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 432 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 433 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 434 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 435 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 436 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 437 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 438 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 439 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 440 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 441 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 442 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 443 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 444 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 445 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 446 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 447 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 448 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 451 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 456 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 457 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 458 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 459 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 460 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 463 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 464 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 465 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 466 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 479 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 480 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 481 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 482 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 483 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 484 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 485 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 486 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 487 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 488 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 489 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 490 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 491 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 492 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 493 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 494 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 495 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 496 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 497 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 498 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 499 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 500 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 502 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 503 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 504 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 505 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 506 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 507 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 508 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 509 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 510 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 511 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 512 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 513 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 514 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 515 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 516 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 517 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 518 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 519 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 520 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 521 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 522 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 523 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 524 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 525 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 526 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 527 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 528 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 529 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.81 |
| Metatranscriptomes | 0.81 |
| Isolates | 2.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.89 |
| Nodule | 1.41 |
| Rhizoplane | 6.12 |
| Rhizosphere | 86.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0450904_002772 | 3300042139 | Bacteria | 2004 |
| 2 | SwRhRL2b_contig_1818751 | 2162886007 | Bacteria | 1871 |
| 3 | SwRhRL2b_contig_2236331 | 2162886007 | Bacteria | 1968 |
| 4 | ARSoilOldRDRAFT_c002146 | 3300000044 | Bacteria | 1775 |
| 5 | JGI24747J21853_1000925 | 3300001978 | Bacteria | 2049 |
| 6 | JGI24740J21852_10025448 | 3300001979 | Bacteria | 1995 |
| 7 | JGI24739J22299_10025517 | 3300001989 | Bacteria | 2078 |
| 8 | JGI24739J22299_10027983 | 3300001989 | Bacteria | 1967 |
| 9 | JGI24739J22299_10028900 | 3300001989 | Bacteria | 1931 |
| 10 | JGI24743J22301_10006376 | 3300001991 | Bacteria | 2009 |
| 11 | JGI24743J22301_10007064 | 3300001991 | Bacteria | 1936 |
| 12 | JGI24735J21928_10015983 | 3300002067 | Bacteria | 2336 |
| 13 | JGI24735J21928_10018333 | 3300002067 | Bacteria | 2158 |
| 14 | JGI24735J21928_10019976 | 3300002067 | Bacteria | 2055 |
| 15 | JGI24735J21928_10020152 | 3300002067 | Bacteria | 2045 |
| 16 | JGI24735J21928_10022282 | 3300002067 | Bacteria | 1930 |
| 17 | JGI24750J21931_1003093 | 3300002070 | Bacteria | 1997 |
| 18 | JGI24750J21931_1003276 | 3300002070 | Bacteria | 1943 |
| 19 | JGI24745J21846_1002072 | 3300002073 | Bacteria | 2013 |
| 20 | JGI24748J21848_1003376 | 3300002074 | Bacteria | 1823 |
| 21 | JGI24749J21850_1005242 | 3300002076 | Bacteria | 1819 |
| 22 | JGI24744J21845_10009246 | 3300002077 | Bacteria | 2023 |
| 23 | JGI24744J21845_10010202 | 3300002077 | Bacteria | 1925 |
| 24 | JGI24035J26624_1001816 | 3300002126 | Bacteria | 1996 |
| 25 | JGI24033J26618_1002484 | 3300002155 | Bacteria | 1892 |
| 26 | JGI24033J26618_1002773 | 3300002155 | Bacteria | 1811 |
| 27 | JGI24034J26672_10004231 | 3300002239 | Bacteria | 2025 |
| 28 | JGI24742J22300_10006045 | 3300002244 | Bacteria | 1995 |
| 29 | JGI24742J22300_10006688 | 3300002244 | Bacteria | 1901 |
| 30 | JGI24742J22300_10007104 | 3300002244 | Bacteria | 1845 |
| 31 | JGI24742J22300_10007679 | 3300002244 | Bacteria | 1781 |
| 32 | JGI24742J22300_10008609 | 3300002244 | Bacteria | 1684 |
| 33 | Ga0007429J51699_1014162 | 3300003579 | Bacteria | 1990 |
| 34 | Ga0007429J51699_1089451 | 3300003579 | Bacteria | 1736 |
| 35 | JGI25404J52841_10008353 | 3300003659 | Bacteria | 2203 |
| 36 | JGI25404J52841_10012942 | 3300003659 | Bacteria | 1810 |
| 37 | Ga0032354_1096766 | 3300003693 | Bacteria | 1620 |
| 38 | JGI25405J52794_10014531 | 3300003911 | Bacteria | 1539 |
| 39 | Ga0058860_10059007 | 3300004801 | Bacteria | 1686 |
| 40 | Ga0065704_10116717 | 3300005289 | Bacteria | 1848 |
| 41 | Ga0065712_10089177 | 3300005290 | Bacteria | 2466 |
| 42 | Ga0065715_10015540 | 3300005293 | Bacteria | 2203 |
| 43 | Ga0065715_10023536 | 3300005293 | Bacteria | 1714 |
| 44 | Ga0065715_10109413 | 3300005293 | Bacteria | 2669 |
| 45 | Ga0065707_10126004 | 3300005295 | Bacteria | 2012 |
| 46 | Ga0065707_10168001 | 3300005295 | Bacteria | 1507 |
| 47 | Ga0070676_10059480 | 3300005328 | Bacteria | 2267 |
| 48 | Ga0070676_10083531 | 3300005328 | Bacteria | 1942 |
| 49 | Ga0070690_100013888 | 3300005330 | Bacteria | 4774 |
| 50 | Ga0070670_100242450 | 3300005331 | Bacteria | 1569 |
| 51 | Ga0068869_100160943 | 3300005334 | Bacteria | 1747 |
| 52 | Ga0068869_100178928 | 3300005334 | Bacteria | 1662 |
| 53 | Ga0070666_10060153 | 3300005335 | Bacteria | 2570 |
| 54 | Ga0070666_10077044 | 3300005335 | Bacteria | 2275 |
| 55 | Ga0070666_10106110 | 3300005335 | Bacteria | 1940 |
| 56 | Ga0070666_10120690 | 3300005335 | Bacteria | 1818 |
| 57 | Ga0070666_10159663 | 3300005335 | Bacteria | 1575 |
| 58 | Ga0070680_100120669 | 3300005336 | Bacteria | 2188 |
| 59 | Ga0070682_100079109 | 3300005337 | Bacteria | 2122 |
| 60 | Ga0068868_100102700 | 3300005338 | Bacteria | 2315 |
| 61 | Ga0070660_100092236 | 3300005339 | Bacteria | 2390 |
| 62 | Ga0070689_100167762 | 3300005340 | Bacteria | 1778 |
| 63 | Ga0070691_10042188 | 3300005341 | Bacteria | 2158 |
| 64 | Ga0070687_100045834 | 3300005343 | Bacteria | 2235 |
| 65 | Ga0070692_10035532 | 3300005345 | Bacteria | 2523 |
| 66 | Ga0070668_100160598 | 3300005347 | Bacteria | 1823 |
| 67 | Ga0070668_100168171 | 3300005347 | Bacteria | 1783 |
| 68 | Ga0070668_100200694 | 3300005347 | Bacteria | 1637 |
| 69 | Ga0070668_100257730 | 3300005347 | Bacteria | 1450 |
| 70 | Ga0070669_100108423 | 3300005353 | Bacteria | 2104 |
| 71 | Ga0070669_100138567 | 3300005353 | Bacteria | 1873 |
| 72 | Ga0070675_100097854 | 3300005354 | Bacteria | 2467 |
| 73 | Ga0070675_100126769 | 3300005354 | Bacteria | 2172 |
| 74 | Ga0070671_100112257 | 3300005355 | Bacteria | 2290 |
| 75 | Ga0070671_100175436 | 3300005355 | Bacteria | 1813 |
| 76 | Ga0070671_100201818 | 3300005355 | Bacteria | 1686 |
| 77 | Ga0070674_100067592 | 3300005356 | Bacteria | 2514 |
| 78 | Ga0070674_100089876 | 3300005356 | Bacteria | 2214 |
| 79 | Ga0070674_100172272 | 3300005356 | Bacteria | 1651 |
| 80 | Ga0070674_100189980 | 3300005356 | Bacteria | 1579 |
| 81 | Ga0070673_100036965 | 3300005364 | Bacteria | 3717 |
| 82 | Ga0070673_100051846 | 3300005364 | Bacteria | 3216 |
| 83 | Ga0070673_100092211 | 3300005364 | Bacteria | 2477 |
| 84 | Ga0070673_100286879 | 3300005364 | Bacteria | 1445 |
| 85 | Ga0070688_100083733 | 3300005365 | Bacteria | 2070 |
| 86 | Ga0070659_100146298 | 3300005366 | Bacteria | 1925 |
| 87 | Ga0070667_100140745 | 3300005367 | Bacteria | 2113 |
| 88 | Ga0070667_100168492 | 3300005367 | Bacteria | 1932 |
| 89 | Ga0070667_100195859 | 3300005367 | Bacteria | 1791 |
| 90 | Ga0070709_10092037 | 3300005434 | Bacteria | 2002 |
| 91 | Ga0070714_100104075 | 3300005435 | Bacteria | 2505 |
| 92 | Ga0070713_100114860 | 3300005436 | Bacteria | 2352 |
| 93 | Ga0070713_100152610 | 3300005436 | Bacteria | 2056 |
| 94 | Ga0070713_100166102 | 3300005436 | Bacteria | 1973 |
| 95 | Ga0070710_10035257 | 3300005437 | Bacteria | 2727 |
| 96 | Ga0070710_10066094 | 3300005437 | Bacteria | 2073 |
| 97 | Ga0070710_10073803 | 3300005437 | Bacteria | 1973 |
| 98 | Ga0070710_10149468 | 3300005437 | Bacteria | 1439 |
| 99 | Ga0070701_10048407 | 3300005438 | Bacteria | 2193 |
| 100 | Ga0070701_10061082 | 3300005438 | Bacteria | 1986 |
| 101 | Ga0070711_100091561 | 3300005439 | Bacteria | 2192 |
| 102 | Ga0070711_100113545 | 3300005439 | Bacteria | 1992 |
| 103 | Ga0070711_100116411 | 3300005439 | Bacteria | 1970 |
| 104 | Ga0070711_100152229 | 3300005439 | Bacteria | 1745 |
| 105 | Ga0070711_100154125 | 3300005439 | Bacteria | 1735 |
| 106 | Ga0070711_100201419 | 3300005439 | Bacteria | 1536 |
| 107 | Ga0070711_100249113 | 3300005439 | Bacteria | 1392 |
| 108 | Ga0070705_100102714 | 3300005440 | Bacteria | 1808 |
| 109 | Ga0070705_100131852 | 3300005440 | Bacteria | 1631 |
| 110 | Ga0070700_100101127 | 3300005441 | Bacteria | 1899 |
| 111 | Ga0070694_100090081 | 3300005444 | Bacteria | 2150 |
| 112 | Ga0070708_100147329 | 3300005445 | Bacteria | 2187 |
| 113 | Ga0070708_100266566 | 3300005445 | Bacteria | 1610 |
| 114 | Ga0070708_100271307 | 3300005445 | Bacteria | 1596 |
| 115 | Ga0070663_100089294 | 3300005455 | Bacteria | 2280 |
| 116 | Ga0070663_100217249 | 3300005455 | Bacteria | 1499 |
| 117 | Ga0070678_100083899 | 3300005456 | Bacteria | 2423 |
| 118 | Ga0070678_100107456 | 3300005456 | Bacteria | 2176 |
| 119 | Ga0070662_100065714 | 3300005457 | Bacteria | 2659 |
| 120 | Ga0070662_100089124 | 3300005457 | Bacteria | 2313 |
| 121 | Ga0070662_100098978 | 3300005457 | Bacteria | 2204 |
| 122 | Ga0070662_100133921 | 3300005457 | Bacteria | 1914 |
| 123 | Ga0070662_100193370 | 3300005457 | Bacteria | 1610 |
| 124 | Ga0070681_10124952 | 3300005458 | Bacteria | 2505 |
| 125 | Ga0068867_100039606 | 3300005459 | Bacteria | 3436 |
| 126 | Ga0068867_100103524 | 3300005459 | Bacteria | 2177 |
| 127 | Ga0068867_100142373 | 3300005459 | Bacteria | 1876 |
| 128 | Ga0068867_100203354 | 3300005459 | Bacteria | 1586 |
| 129 | Ga0070698_100351190 | 3300005471 | Bacteria | 1406 |
| 130 | Ga0070699_100094955 | 3300005518 | Bacteria | 2610 |
| 131 | Ga0070699_100198348 | 3300005518 | Bacteria | 1784 |
| 132 | Ga0070679_100272135 | 3300005530 | Bacteria | 1648 |
| 133 | Ga0070697_100118037 | 3300005536 | Bacteria | 2216 |
| 134 | Ga0070697_100244341 | 3300005536 | Bacteria | 1533 |
| 135 | Ga0068853_100141576 | 3300005539 | Bacteria | 2159 |
| 136 | Ga0068853_100201937 | 3300005539 | Bacteria | 1809 |
| 137 | Ga0070672_100085695 | 3300005543 | Bacteria | 2532 |
| 138 | Ga0070686_100082615 | 3300005544 | Bacteria | 2131 |
| 139 | Ga0070686_100090623 | 3300005544 | Bacteria | 2045 |
| 140 | Ga0070696_100057008 | 3300005546 | Bacteria | 2726 |
| 141 | Ga0070693_100031520 | 3300005547 | Bacteria | 2906 |
| 142 | Ga0070693_100052946 | 3300005547 | Bacteria | 2328 |
| 143 | Ga0070693_100141769 | 3300005547 | Bacteria | 1514 |
| 144 | Ga0070665_100145136 | 3300005548 | Bacteria | 2376 |
| 145 | Ga0070665_100158810 | 3300005548 | Bacteria | 2262 |
| 146 | Ga0070665_100217162 | 3300005548 | Bacteria | 1913 |
| 147 | Ga0068855_100189125 | 3300005563 | Bacteria | 2323 |
| 148 | Ga0068856_100200794 | 3300005614 | Bacteria | 2008 |
| 149 | Ga0070702_100029407 | 3300005615 | Bacteria | 2987 |
| 150 | Ga0070702_100058493 | 3300005615 | Bacteria | 2233 |
| 151 | Ga0070702_100096244 | 3300005615 | Bacteria | 1806 |
| 152 | Ga0068859_100195774 | 3300005617 | Bacteria | 2105 |
| 153 | Ga0068859_100232988 | 3300005617 | Bacteria | 1930 |
| 154 | Ga0068864_100156037 | 3300005618 | Bacteria | 2072 |
| 155 | Ga0068864_100182270 | 3300005618 | Bacteria | 1920 |
| 156 | Ga0068866_10036796 | 3300005718 | Bacteria | 2399 |
| 157 | Ga0068866_10049292 | 3300005718 | Bacteria | 2133 |
| 158 | Ga0068866_10062740 | 3300005718 | Bacteria | 1934 |
| 159 | Ga0068866_10138346 | 3300005718 | Bacteria | 1394 |
| 160 | Ga0068861_100097458 | 3300005719 | Bacteria | 2332 |
| 161 | Ga0068861_100131413 | 3300005719 | Bacteria | 2032 |
| 162 | Ga0068861_100189914 | 3300005719 | Bacteria | 1716 |
| 163 | Ga0068861_100234008 | 3300005719 | Bacteria | 1559 |
| 164 | Ga0068863_100190138 | 3300005841 | Bacteria | 1973 |
| 165 | Ga0068863_100222830 | 3300005841 | Bacteria | 1817 |
| 166 | Ga0068863_100287572 | 3300005841 | Bacteria | 1593 |
| 167 | Ga0068858_100119981 | 3300005842 | Bacteria | 2458 |
| 168 | Ga0068858_100135764 | 3300005842 | Bacteria | 2308 |
| 169 | Ga0068860_100191276 | 3300005843 | Bacteria | 1980 |
| 170 | Ga0068860_100210802 | 3300005843 | Bacteria | 1885 |
| 171 | Ga0068862_100135518 | 3300005844 | Bacteria | 2182 |
| 172 | Ga0068862_100144061 | 3300005844 | Bacteria | 2116 |
| 173 | Ga0068862_100182407 | 3300005844 | Bacteria | 1885 |
| 174 | Ga0068862_100218061 | 3300005844 | Bacteria | 1726 |
| 175 | Ga0081455_10048300 | 3300005937 | Bacteria | 3679 |
| 176 | Ga0081455_10048429 | 3300005937 | Bacteria | 3673 |
| 177 | Ga0081455_10176784 | 3300005937 | Bacteria | 1620 |
| 178 | Ga0081540_1018457 | 3300005983 | Bacteria | 4277 |
| 179 | Ga0081540_1049607 | 3300005983 | Bacteria | 2093 |
| 180 | Ga0070717_10103610 | 3300006028 | Bacteria | 2419 |
| 181 | Ga0070717_10117214 | 3300006028 | Bacteria | 2277 |
| 182 | Ga0070717_10141225 | 3300006028 | Bacteria | 2077 |
| 183 | Ga0070717_10203599 | 3300006028 | Bacteria | 1734 |
| 184 | Ga0070717_10206803 | 3300006028 | Bacteria | 1721 |
| 185 | Ga0075432_10029878 | 3300006058 | Bacteria | 1882 |
| 186 | Ga0075432_10029908 | 3300006058 | Bacteria | 1882 |
| 187 | Ga0070715_10018084 | 3300006163 | Bacteria | 2680 |
| 188 | Ga0070716_100017253 | 3300006173 | Bacteria | 3739 |
| 189 | Ga0070712_100076616 | 3300006175 | Bacteria | 2408 |
| 190 | Ga0070712_100083289 | 3300006175 | Bacteria | 2322 |
| 191 | Ga0070712_100085816 | 3300006175 | Bacteria | 2293 |
| 192 | Ga0075367_10066085 | 3300006178 | Bacteria | 2166 |
| 193 | Ga0075367_10070539 | 3300006178 | Bacteria | 2100 |
| 194 | Ga0097621_100075112 | 3300006237 | Bacteria | 2800 |
| 195 | Ga0097621_100081983 | 3300006237 | Bacteria | 2685 |
| 196 | Ga0097621_100124602 | 3300006237 | Bacteria | 2188 |
| 197 | Ga0097621_100132074 | 3300006237 | Bacteria | 2126 |
| 198 | Ga0097621_100211245 | 3300006237 | Bacteria | 1688 |
| 199 | Ga0075370_10030816 | 3300006353 | Bacteria | 2993 |
| 200 | Ga0075370_10088763 | 3300006353 | Bacteria | 1782 |
| 201 | Ga0068871_100077330 | 3300006358 | Bacteria | 2750 |
| 202 | Ga0068871_100090289 | 3300006358 | Bacteria | 2551 |
| 203 | Ga0068871_100101588 | 3300006358 | Bacteria | 2410 |
| 204 | Ga0068871_100156098 | 3300006358 | Bacteria | 1949 |
| 205 | Ga0068871_100170857 | 3300006358 | Bacteria | 1863 |
| 206 | Ga0075428_100126163 | 3300006844 | Bacteria | 2785 |
| 207 | Ga0075428_100156511 | 3300006844 | Bacteria | 2475 |
| 208 | Ga0075428_100160693 | 3300006844 | Bacteria | 2439 |
| 209 | Ga0075428_100180867 | 3300006844 | Bacteria | 2282 |
| 210 | Ga0075428_100272944 | 3300006844 | Bacteria | 1819 |
| 211 | Ga0075428_100305665 | 3300006844 | Bacteria | 1710 |
| 212 | Ga0075430_100108667 | 3300006846 | Bacteria | 2314 |
| 213 | Ga0075431_100166112 | 3300006847 | Bacteria | 2269 |
| 214 | Ga0075431_100169366 | 3300006847 | Bacteria | 2245 |
| 215 | Ga0075433_10098207 | 3300006852 | Bacteria | 2592 |
| 216 | Ga0075433_10167470 | 3300006852 | Bacteria | 1955 |
| 217 | Ga0075433_10186499 | 3300006852 | Bacteria | 1845 |
| 218 | Ga0075434_100097928 | 3300006871 | Bacteria | 2938 |
| 219 | Ga0075434_100167829 | 3300006871 | Bacteria | 2215 |
| 220 | Ga0075434_100184059 | 3300006871 | Bacteria | 2109 |
| 221 | Ga0075434_100217533 | 3300006871 | Bacteria | 1930 |
| 222 | Ga0075434_100226849 | 3300006871 | Bacteria | 1887 |
| 223 | Ga0075434_100236016 | 3300006871 | Bacteria | 1848 |
| 224 | Ga0075434_100245585 | 3300006871 | Bacteria | 1810 |
| 225 | Ga0075434_100254344 | 3300006871 | Bacteria | 1776 |
| 226 | Ga0075434_100261227 | 3300006871 | Bacteria | 1750 |
| 227 | Ga0068865_100092021 | 3300006881 | Bacteria | 2202 |
| 228 | Ga0068865_100099083 | 3300006881 | Bacteria | 2130 |
| 229 | Ga0068865_100111496 | 3300006881 | Bacteria | 2019 |
| 230 | Ga0068865_100240391 | 3300006881 | Bacteria | 1424 |
| 231 | Ga0075436_100080103 | 3300006914 | Bacteria | 2262 |
| 232 | Ga0075436_100083782 | 3300006914 | Bacteria | 2213 |
| 233 | Ga0097620_100195769 | 3300006931 | Bacteria | 2105 |
| 234 | Ga0097620_100232990 | 3300006931 | Bacteria | 1930 |
| 235 | Ga0075435_100100197 | 3300007076 | Bacteria | 2400 |
| 236 | Ga0075435_100145204 | 3300007076 | Bacteria | 1993 |
| 237 | Ga0075435_100168819 | 3300007076 | Bacteria | 1845 |
| 238 | Ga0075435_100170048 | 3300007076 | Bacteria | 1838 |
| 239 | Ga0075435_100207168 | 3300007076 | Bacteria | 1662 |
| 240 | Ga0075435_100248981 | 3300007076 | Bacteria | 1512 |
| 241 | Ga0099795_10025187 | 3300007788 | Bacteria | 1993 |
| 242 | Ga0099795_10027906 | 3300007788 | Bacteria | 1914 |
| 243 | Ga0105251_10073241 | 3300009011 | Bacteria | 1592 |
| 244 | Ga0105240_10246158 | 3300009093 | Bacteria | 2070 |
| 245 | Ga0111539_10157373 | 3300009094 | Bacteria | 2658 |
| 246 | Ga0111539_10194587 | 3300009094 | Bacteria | 2365 |
| 247 | Ga0111539_10213376 | 3300009094 | Bacteria | 2249 |
| 248 | Ga0111539_10260072 | 3300009094 | Bacteria | 2020 |
| 249 | Ga0111539_10379671 | 3300009094 | Bacteria | 1645 |
| 250 | Ga0105245_10115794 | 3300009098 | Bacteria | 2498 |
| 251 | Ga0105245_10116031 | 3300009098 | Bacteria | 2496 |
| 252 | Ga0105247_10019146 | 3300009101 | Bacteria | 4110 |
| 253 | Ga0105247_10054498 | 3300009101 | Bacteria | 2467 |
| 254 | Ga0105247_10061858 | 3300009101 | Bacteria | 2322 |
| 255 | Ga0105247_10075826 | 3300009101 | Bacteria | 2111 |
| 256 | Ga0105247_10086359 | 3300009101 | Bacteria | 1985 |
| 257 | Ga0114129_10214800 | 3300009147 | Bacteria | 2597 |
| 258 | Ga0114129_10303264 | 3300009147 | Bacteria | 2128 |
| 259 | Ga0114129_10360832 | 3300009147 | Bacteria | 1923 |
| 260 | Ga0105243_10174977 | 3300009148 | Bacteria | 1862 |
| 261 | Ga0105243_10267779 | 3300009148 | Bacteria | 1533 |
| 262 | Ga0105241_10138150 | 3300009174 | Bacteria | 1981 |
| 263 | Ga0105241_10178062 | 3300009174 | Bacteria | 1761 |
| 264 | Ga0105242_10109037 | 3300009176 | Bacteria | 2357 |
| 265 | Ga0105242_10133770 | 3300009176 | Bacteria | 2144 |
| 266 | Ga0105242_10214288 | 3300009176 | Bacteria | 1718 |
| 267 | Ga0105242_10244898 | 3300009176 | Bacteria | 1613 |
| 268 | Ga0105242_10245433 | 3300009176 | Bacteria | 1611 |
| 269 | Ga0105248_10187030 | 3300009177 | Bacteria | 2334 |
| 270 | Ga0105248_10203259 | 3300009177 | Bacteria | 2232 |
| 271 | Ga0105248_10356655 | 3300009177 | Bacteria | 1646 |
| 272 | Ga0105237_10364086 | 3300009545 | Bacteria | 1450 |
| 273 | Ga0105238_10161381 | 3300009551 | Bacteria | 2217 |
| 274 | Ga0105238_10178299 | 3300009551 | Bacteria | 2101 |
| 275 | Ga0105249_10111800 | 3300009553 | Bacteria | 2583 |
| 276 | Ga0105249_10159978 | 3300009553 | Bacteria | 2175 |
| 277 | Ga0105249_10199796 | 3300009553 | Bacteria | 1956 |
| 278 | Ga0105249_10242695 | 3300009553 | Bacteria | 1782 |
| 279 | Ga0099796_10016496 | 3300010159 | Bacteria | 2182 |
| 280 | Ga0099796_10036954 | 3300010159 | Bacteria | 1629 |
| 281 | Ga0105239_10197836 | 3300010375 | Bacteria | 2251 |
| 282 | Ga0105239_10274749 | 3300010375 | Bacteria | 1896 |
| 283 | Ga0105246_10051787 | 3300011119 | Bacteria | 2820 |
| 284 | Ga0105246_10060309 | 3300011119 | Bacteria | 2635 |
| 285 | Ga0157329_1000722 | 3300012491 | Bacteria | 1436 |
| 286 | Ga0157339_1001501 | 3300012505 | Bacteria | 1438 |
| 287 | Ga0157371_10094289 | 3300013102 | Bacteria | 2121 |
| 288 | Ga0157371_10099508 | 3300013102 | Bacteria | 2062 |
| 289 | Ga0157370_10237980 | 3300013104 | Bacteria | 1685 |
| 290 | Ga0157369_10165763 | 3300013105 | Bacteria | 2330 |
| 291 | Ga0157374_10314873 | 3300013296 | Bacteria | 1550 |
| 292 | Ga0157378_10092630 | 3300013297 | Bacteria | 2749 |
| 293 | Ga0157378_10094718 | 3300013297 | Bacteria | 2719 |
| 294 | Ga0157378_10098004 | 3300013297 | Bacteria | 2673 |
| 295 | Ga0163162_10431924 | 3300013306 | Bacteria | 1449 |
| 296 | Ga0157375_10158487 | 3300013308 | Bacteria | 2404 |
| 297 | Ga0157375_10248901 | 3300013308 | Bacteria | 1938 |
| 298 | Ga0157375_10268965 | 3300013308 | Bacteria | 1866 |
| 299 | Ga0163163_10158463 | 3300014325 | Bacteria | 2308 |
| 300 | Ga0157380_10071568 | 3300014326 | Bacteria | 2805 |
| 301 | Ga0157380_10165488 | 3300014326 | Bacteria | 1926 |
| 302 | Ga0182008_10036739 | 3300014497 | Bacteria | 2451 |
| 303 | Ga0157377_10000080 | 3300014745 | Bacteria | 74445 |
| 304 | Ga0157379_10067755 | 3300014968 | Bacteria | 3190 |
| 305 | Ga0157379_10153307 | 3300014968 | Bacteria | 2078 |
| 306 | Ga0157379_10232685 | 3300014968 | Bacteria | 1671 |
| 307 | Ga0157376_10061616 | 3300014969 | Bacteria | 3154 |
| 308 | Ga0157376_10134277 | 3300014969 | Bacteria | 2212 |
| 309 | Ga0157376_10137641 | 3300014969 | Bacteria | 2187 |
| 310 | Ga0157376_10162089 | 3300014969 | Bacteria | 2028 |
| 311 | Ga0157376_10178629 | 3300014969 | Bacteria | 1938 |
| 312 | Ga0157376_10190126 | 3300014969 | Bacteria | 1882 |
| 313 | Ga0157376_10308218 | 3300014969 | Bacteria | 1501 |
| 314 | Ga0163161_10117052 | 3300017792 | Bacteria | 1998 |
| 315 | Ga0163161_10118653 | 3300017792 | Bacteria | 1986 |
| 316 | Ga0184602_121534 | 3300019161 | Bacteria | 1957 |
| 317 | Ga0213873_10000875 | 3300021358 | Bacteria | 4859 |
| 318 | Ga0213872_10020991 | 3300021361 | Bacteria | 3007 |
| 319 | Ga0213872_10051235 | 3300021361 | Bacteria | 1873 |
| 320 | Ga0213874_10011415 | 3300021377 | Bacteria | 2249 |
| 321 | Ga0213876_10059055 | 3300021384 | Bacteria | 2024 |
| 322 | Ga0224570_101704 | 3300022730 | Bacteria | 1578 |
| 323 | Ga0247551_100096 | 3300023552 | Bacteria | 1937 |
| 324 | Ga0247550_100048 | 3300023660 | Bacteria | 2066 |
| 325 | Ga0228600_1001536 | 3300024123 | Bacteria | 1874 |
| 326 | Ga0224572_1007934 | 3300024225 | Bacteria | 1955 |
| 327 | Ga0224572_1007992 | 3300024225 | Bacteria | 1949 |
| 328 | Ga0228598_1002583 | 3300024227 | Bacteria | 3933 |
| 329 | Ga0228598_1005183 | 3300024227 | Bacteria | 2738 |
| 330 | Ga0228598_1008875 | 3300024227 | Bacteria | 2021 |
| 331 | Ga0209759_1013527 | 3300025256 | Bacteria | 2203 |
| 332 | Ga0209051_1005278 | 3300025303 | Bacteria | 7614 |
| 333 | Ga0207697_10008948 | 3300025315 | Bacteria | 4349 |
| 334 | Ga0207697_10028389 | 3300025315 | Bacteria | 2289 |
| 335 | Ga0207697_10038129 | 3300025315 | Bacteria | 1970 |
| 336 | Ga0207713_1020043 | 3300025735 | Bacteria | 3253 |
| 337 | Ga0207692_10049268 | 3300025898 | Bacteria | 2125 |
| 338 | Ga0207692_10050782 | 3300025898 | Bacteria | 2099 |
| 339 | Ga0207692_10053785 | 3300025898 | Bacteria | 2052 |
| 340 | Ga0207692_10054721 | 3300025898 | Bacteria | 2039 |
| 341 | Ga0207692_10055787 | 3300025898 | Bacteria | 2024 |
| 342 | Ga0207692_10083458 | 3300025898 | Bacteria | 1714 |
| 343 | Ga0207642_10034813 | 3300025899 | Bacteria | 2145 |
| 344 | Ga0207642_10035574 | 3300025899 | Bacteria | 2129 |
| 345 | Ga0207642_10040934 | 3300025899 | Bacteria | 2025 |
| 346 | Ga0207642_10043355 | 3300025899 | Bacteria | 1984 |
| 347 | Ga0207642_10058109 | 3300025899 | Bacteria | 1783 |
| 348 | Ga0207710_10024444 | 3300025900 | Bacteria | 2602 |
| 349 | Ga0207710_10026108 | 3300025900 | Bacteria | 2522 |
| 350 | Ga0207710_10038893 | 3300025900 | Bacteria | 2104 |
| 351 | Ga0207688_10021442 | 3300025901 | Bacteria | 3530 |
| 352 | Ga0207688_10043468 | 3300025901 | Bacteria | 2502 |
| 353 | Ga0207688_10060308 | 3300025901 | Bacteria | 2137 |
| 354 | Ga0207688_10078293 | 3300025901 | Bacteria | 1884 |
| 355 | Ga0207680_10010514 | 3300025903 | Bacteria | 4631 |
| 356 | Ga0207680_10025747 | 3300025903 | Bacteria | 3249 |
| 357 | Ga0207647_10001640 | 3300025904 | Bacteria | 17218 |
| 358 | Ga0207647_10064697 | 3300025904 | Bacteria | 2222 |
| 359 | Ga0207685_10025291 | 3300025905 | Bacteria | 2048 |
| 360 | Ga0207685_10025827 | 3300025905 | Bacteria | 2034 |
| 361 | Ga0207699_10068315 | 3300025906 | Bacteria | 2164 |
| 362 | Ga0207699_10077102 | 3300025906 | Bacteria | 2055 |
| 363 | Ga0207699_10077674 | 3300025906 | Bacteria | 2049 |
| 364 | Ga0207699_10078249 | 3300025906 | Bacteria | 2042 |
| 365 | Ga0207699_10084483 | 3300025906 | Bacteria | 1977 |
| 366 | Ga0207699_10092182 | 3300025906 | Bacteria | 1904 |
| 367 | Ga0207643_10053535 | 3300025908 | Bacteria | 2293 |
| 368 | Ga0207643_10073050 | 3300025908 | Bacteria | 1977 |
| 369 | Ga0207643_10089674 | 3300025908 | Bacteria | 1791 |
| 370 | Ga0207705_10115699 | 3300025909 | Bacteria | 1985 |
| 371 | Ga0207684_10039964 | 3300025910 | Bacteria | 3977 |
| 372 | Ga0207684_10147851 | 3300025910 | Bacteria | 2021 |
| 373 | Ga0207684_10151815 | 3300025910 | Bacteria | 1993 |
| 374 | Ga0207684_10221647 | 3300025910 | Bacteria | 1632 |
| 375 | Ga0207654_10016416 | 3300025911 | Bacteria | 3856 |
| 376 | Ga0207654_10076549 | 3300025911 | Bacteria | 2003 |
| 377 | Ga0207654_10123075 | 3300025911 | Bacteria | 1632 |
| 378 | Ga0207707_10134235 | 3300025912 | Bacteria | 2164 |
| 379 | Ga0207707_10146561 | 3300025912 | Bacteria | 2064 |
| 380 | Ga0207695_10111573 | 3300025913 | Bacteria | 2714 |
| 381 | Ga0207695_10249725 | 3300025913 | Bacteria | 1674 |
| 382 | Ga0207671_10195376 | 3300025914 | Bacteria | 1579 |
| 383 | Ga0207693_10103936 | 3300025915 | Bacteria | 2228 |
| 384 | Ga0207693_10120699 | 3300025915 | Bacteria | 2058 |
| 385 | Ga0207663_10013149 | 3300025916 | Bacteria | 4493 |
| 386 | Ga0207663_10024929 | 3300025916 | Bacteria | 3450 |
| 387 | Ga0207663_10076671 | 3300025916 | Bacteria | 2173 |
| 388 | Ga0207663_10081324 | 3300025916 | Bacteria | 2121 |
| 389 | Ga0207663_10086419 | 3300025916 | Bacteria | 2068 |
| 390 | Ga0207663_10090789 | 3300025916 | Bacteria | 2026 |
| 391 | Ga0207663_10103566 | 3300025916 | Bacteria | 1917 |
| 392 | Ga0207663_10118526 | 3300025916 | Bacteria | 1808 |
| 393 | Ga0207663_10140603 | 3300025916 | Bacteria | 1681 |
| 394 | Ga0207663_10169762 | 3300025916 | Bacteria | 1548 |
| 395 | Ga0207663_10179351 | 3300025916 | Bacteria | 1511 |
| 396 | Ga0207663_10201753 | 3300025916 | Bacteria | 1435 |
| 397 | Ga0207660_10166207 | 3300025917 | Bacteria | 1705 |
| 398 | Ga0207657_10120075 | 3300025919 | Bacteria | 2163 |
| 399 | Ga0207652_10283120 | 3300025921 | Bacteria | 1496 |
| 400 | Ga0207652_10292687 | 3300025921 | Bacteria | 1469 |
| 401 | Ga0207646_10171009 | 3300025922 | Bacteria | 1962 |
| 402 | Ga0207681_10091025 | 3300025923 | Bacteria | 2178 |
| 403 | Ga0207694_10114462 | 3300025924 | Bacteria | 2148 |
| 404 | Ga0207694_10150664 | 3300025924 | Bacteria | 1873 |
| 405 | Ga0207650_10027168 | 3300025925 | Bacteria | 4093 |
| 406 | Ga0207650_10030800 | 3300025925 | Bacteria | 3869 |
| 407 | Ga0207659_10113592 | 3300025926 | Bacteria | 2063 |
| 408 | Ga0207659_10127470 | 3300025926 | Bacteria | 1959 |
| 409 | Ga0207687_10060974 | 3300025927 | Bacteria | 2663 |
| 410 | Ga0207687_10110126 | 3300025927 | Bacteria | 2042 |
| 411 | Ga0207700_10025509 | 3300025928 | Bacteria | 4106 |
| 412 | Ga0207700_10028818 | 3300025928 | Bacteria | 3911 |
| 413 | Ga0207700_10053130 | 3300025928 | Bacteria | 3033 |
| 414 | Ga0207700_10122323 | 3300025928 | Bacteria | 2112 |
| 415 | Ga0207700_10144416 | 3300025928 | Bacteria | 1959 |
| 416 | Ga0207700_10155152 | 3300025928 | Bacteria | 1896 |
| 417 | Ga0207700_10157136 | 3300025928 | Bacteria | 1885 |
| 418 | Ga0207700_10177655 | 3300025928 | Bacteria | 1780 |
| 419 | Ga0207700_10235798 | 3300025928 | Bacteria | 1558 |
| 420 | Ga0207664_10026373 | 3300025929 | Bacteria | 4391 |
| 421 | Ga0207664_10066158 | 3300025929 | Bacteria | 2896 |
| 422 | Ga0207664_10095710 | 3300025929 | Bacteria | 2443 |
| 423 | Ga0207664_10109833 | 3300025929 | Bacteria | 2292 |
| 424 | Ga0207664_10128610 | 3300025929 | Bacteria | 2129 |
| 425 | Ga0207664_10137192 | 3300025929 | Bacteria | 2065 |
| 426 | Ga0207644_10135513 | 3300025931 | Bacteria | 1890 |
| 427 | Ga0207644_10164098 | 3300025931 | Bacteria | 1729 |
| 428 | Ga0207690_10147595 | 3300025932 | Bacteria | 1740 |
| 429 | Ga0207706_10101197 | 3300025933 | Bacteria | 2535 |
| 430 | Ga0207706_10121870 | 3300025933 | Bacteria | 2293 |
| 431 | Ga0207706_10139809 | 3300025933 | Bacteria | 2130 |
| 432 | Ga0207706_10159787 | 3300025933 | Bacteria | 1981 |
| 433 | Ga0207686_10092140 | 3300025934 | Bacteria | 2003 |
| 434 | Ga0207686_10113912 | 3300025934 | Bacteria | 1829 |
| 435 | Ga0207686_10157390 | 3300025934 | Bacteria | 1589 |
| 436 | Ga0207686_10171030 | 3300025934 | Bacteria | 1532 |
| 437 | Ga0207709_10002054 | 3300025935 | Bacteria | 13015 |
| 438 | Ga0207709_10018016 | 3300025935 | Bacteria | 3950 |
| 439 | Ga0207709_10096643 | 3300025935 | Bacteria | 1944 |
| 440 | Ga0207709_10136562 | 3300025935 | Bacteria | 1680 |
| 441 | Ga0207709_10163753 | 3300025935 | Bacteria | 1554 |
| 442 | Ga0207670_10087130 | 3300025936 | Bacteria | 2199 |
| 443 | Ga0207670_10144003 | 3300025936 | Bacteria | 1760 |
| 444 | Ga0207669_10013077 | 3300025937 | Bacteria | 4107 |
| 445 | Ga0207669_10086231 | 3300025937 | Bacteria | 2029 |
| 446 | Ga0207669_10091441 | 3300025937 | Bacteria | 1982 |
| 447 | Ga0207669_10092571 | 3300025937 | Bacteria | 1972 |
| 448 | Ga0207669_10095754 | 3300025937 | Bacteria | 1946 |
| 449 | Ga0207669_10161169 | 3300025937 | Bacteria | 1584 |
| 450 | Ga0207704_10041408 | 3300025938 | Bacteria | 2701 |
| 451 | Ga0207704_10071290 | 3300025938 | Bacteria | 2204 |
| 452 | Ga0207704_10091267 | 3300025938 | Bacteria | 2001 |
| 453 | Ga0207704_10098245 | 3300025938 | Bacteria | 1944 |
| 454 | Ga0207665_10030968 | 3300025939 | Bacteria | 3539 |
| 455 | Ga0207665_10038767 | 3300025939 | Bacteria | 3175 |
| 456 | Ga0207665_10125508 | 3300025939 | Bacteria | 1817 |
| 457 | Ga0207665_10201050 | 3300025939 | Bacteria | 1452 |
| 458 | Ga0207691_10071251 | 3300025940 | Bacteria | 3137 |
| 459 | Ga0207691_10166443 | 3300025940 | Bacteria | 1932 |
| 460 | Ga0207691_10247672 | 3300025940 | Bacteria | 1539 |
| 461 | Ga0207691_10283038 | 3300025940 | Bacteria | 1427 |
| 462 | Ga0207711_10121333 | 3300025941 | Bacteria | 2334 |
| 463 | Ga0207711_10182370 | 3300025941 | Bacteria | 1910 |
| 464 | Ga0207711_10266520 | 3300025941 | Bacteria | 1575 |
| 465 | Ga0207689_10141624 | 3300025942 | Bacteria | 1981 |
| 466 | Ga0207689_10200912 | 3300025942 | Bacteria | 1645 |
| 467 | Ga0207679_10124852 | 3300025945 | Bacteria | 2055 |
| 468 | Ga0207679_10145269 | 3300025945 | Bacteria | 1923 |
| 469 | Ga0207667_10280797 | 3300025949 | Bacteria | 1701 |
| 470 | Ga0207667_10321923 | 3300025949 | Bacteria | 1579 |
| 471 | Ga0207651_10063040 | 3300025960 | Bacteria | 2586 |
| 472 | Ga0207651_10119659 | 3300025960 | Bacteria | 1994 |
| 473 | Ga0207651_10144860 | 3300025960 | Bacteria | 1840 |
| 474 | Ga0207712_10115145 | 3300025961 | Bacteria | 2024 |
| 475 | Ga0207712_10115278 | 3300025961 | Bacteria | 2023 |
| 476 | Ga0207712_10116479 | 3300025961 | Bacteria | 2014 |
| 477 | Ga0207712_10170288 | 3300025961 | Bacteria | 1702 |
| 478 | Ga0207668_10000119 | 3300025972 | Bacteria | 55547 |
| 479 | Ga0207668_10097230 | 3300025972 | Bacteria | 2178 |
| 480 | Ga0207668_10108196 | 3300025972 | Bacteria | 2080 |
| 481 | Ga0207668_10114556 | 3300025972 | Bacteria | 2029 |
| 482 | Ga0207640_10078926 | 3300025981 | Bacteria | 2242 |
| 483 | Ga0207640_10079266 | 3300025981 | Bacteria | 2238 |
| 484 | Ga0207658_10000347 | 3300025986 | Bacteria | 45971 |
| 485 | Ga0207658_10186684 | 3300025986 | Bacteria | 1720 |
| 486 | Ga0207677_10090393 | 3300026023 | Bacteria | 2225 |
| 487 | Ga0207677_10103935 | 3300026023 | Bacteria | 2098 |
| 488 | Ga0207703_10057586 | 3300026035 | Bacteria | 3170 |
| 489 | Ga0207703_10116296 | 3300026035 | Bacteria | 2289 |
| 490 | Ga0207703_10136429 | 3300026035 | Bacteria | 2124 |
| 491 | Ga0207703_10179601 | 3300026035 | Bacteria | 1867 |
| 492 | Ga0207639_10088768 | 3300026041 | Bacteria | 2468 |
| 493 | Ga0207678_10043629 | 3300026067 | Bacteria | 3880 |
| 494 | Ga0207678_10052514 | 3300026067 | Bacteria | 3516 |
| 495 | Ga0207678_10072082 | 3300026067 | Bacteria | 2960 |
| 496 | Ga0207678_10140520 | 3300026067 | Bacteria | 2061 |
| 497 | Ga0207678_10223047 | 3300026067 | Bacteria | 1614 |
| 498 | Ga0207708_10021338 | 3300026075 | Bacteria | 4883 |
| 499 | Ga0207708_10114963 | 3300026075 | Bacteria | 2092 |
| 500 | Ga0207708_10115901 | 3300026075 | Bacteria | 2084 |
| 501 | Ga0207702_10113880 | 3300026078 | Bacteria | 2410 |
| 502 | Ga0207702_10166230 | 3300026078 | Bacteria | 2018 |
| 503 | Ga0207702_10265246 | 3300026078 | Bacteria | 1618 |
| 504 | Ga0207641_10001333 | 3300026088 | Bacteria | 24434 |
| 505 | Ga0207641_10166400 | 3300026088 | Bacteria | 2008 |
| 506 | Ga0207648_10004849 | 3300026089 | Bacteria | 13717 |
| 507 | Ga0207648_10039981 | 3300026089 | Bacteria | 4122 |
| 508 | Ga0207648_10057334 | 3300026089 | Bacteria | 3398 |
| 509 | Ga0207648_10077576 | 3300026089 | Bacteria | 2896 |
| 510 | Ga0207648_10237828 | 3300026089 | Bacteria | 1621 |
| 511 | Ga0207676_10157008 | 3300026095 | Bacteria | 1966 |
| 512 | Ga0207676_10186691 | 3300026095 | Bacteria | 1820 |
| 513 | Ga0207675_100097550 | 3300026118 | Bacteria | 2768 |
| 514 | Ga0207675_100098959 | 3300026118 | Bacteria | 2747 |
| 515 | Ga0207675_100121127 | 3300026118 | Bacteria | 2475 |
| 516 | Ga0207675_100145037 | 3300026118 | Bacteria | 2257 |
| 517 | Ga0207675_100224673 | 3300026118 | Bacteria | 1810 |
| 518 | Ga0207675_100308456 | 3300026118 | Bacteria | 1543 |
| 519 | Ga0207683_10025310 | 3300026121 | Bacteria | 5119 |
| 520 | Ga0207683_10055568 | 3300026121 | Bacteria | 3472 |
| 521 | Ga0207683_10127085 | 3300026121 | Bacteria | 2291 |
| 522 | Ga0207683_10145603 | 3300026121 | Bacteria | 2136 |
| 523 | Ga0207683_10150692 | 3300026121 | Bacteria | 2099 |
| 524 | Ga0207698_10141670 | 3300026142 | Bacteria | 2073 |
| 525 | Ga0207698_10180795 | 3300026142 | Bacteria | 1868 |
| 526 | Ga0209489_120183 | 3300027361 | Bacteria | 1989 |
| 527 | Ga0209179_1005488 | 3300027512 | Bacteria | 1989 |
| 528 | Ga0209179_1005541 | 3300027512 | Bacteria | 1983 |
| 529 | Ga0209179_1005904 | 3300027512 | Bacteria | 1943 |
| 530 | Ga0209588_1022308 | 3300027671 | Bacteria | 1992 |
| 531 | Ga0209588_1028465 | 3300027671 | Bacteria | 1778 |
| 532 | Ga0209998_10009772 | 3300027717 | Bacteria | 1991 |
| 533 | Ga0207428_10088428 | 3300027907 | Bacteria | 2409 |
| 534 | Ga0207428_10103419 | 3300027907 | Bacteria | 2199 |
| 535 | Ga0207428_10119816 | 3300027907 | Bacteria | 2019 |
| 536 | Ga0207428_10140768 | 3300027907 | Bacteria | 1841 |
| 537 | Ga0265358_100065 | 3300028010 | Bacteria | 1689 |
| 538 | Ga0268266_10137271 | 3300028379 | Bacteria | 2191 |
| 539 | Ga0268266_10210322 | 3300028379 | Bacteria | 1783 |
| 540 | Ga0268265_10151381 | 3300028380 | Bacteria | 1957 |
| 541 | Ga0268265_10220359 | 3300028380 | Bacteria | 1659 |
| 542 | Ga0268265_10236418 | 3300028380 | Bacteria | 1609 |
| 543 | Ga0268264_10142849 | 3300028381 | Bacteria | 2137 |
| 544 | Ga0268264_10157528 | 3300028381 | Bacteria | 2042 |
| 545 | Ga0268264_10168443 | 3300028381 | Bacteria | 1979 |
| 546 | Ga0268264_10181814 | 3300028381 | Bacteria | 1910 |
| 547 | Ga0268264_10275185 | 3300028381 | Bacteria | 1574 |
| 548 | Ga0265334_10033696 | 3300028573 | Bacteria | 2036 |
| 549 | Ga0265323_10021400 | 3300028653 | Bacteria | 2477 |
| 550 | Ga0307517_10000970 | 3300028786 | Bacteria | 48633 |
| 551 | Ga0307515_10132139 | 3300028794 | Bacteria | 2740 |
| 552 | Ga0307515_10203441 | 3300028794 | Bacteria | 1848 |
| 553 | Ga0307515_10242633 | 3300028794 | Bacteria | 1569 |
| 554 | Ga0307515_10245417 | 3300028794 | Bacteria | 1553 |
| 555 | Ga0265338_10110805 | 3300028800 | Bacteria | 2211 |
| 556 | Ga0265324_10000366 | 3300029957 | Bacteria | 32818 |
| 557 | Ga0307512_10021953 | 3300030522 | Bacteria | 5747 |
| 558 | Ga0265769_100271 | 3300030888 | Bacteria | 1975 |
| 559 | Ga0265760_10024581 | 3300031090 | Bacteria | 1755 |
| 560 | Ga0265330_10016360 | 3300031235 | Bacteria | 3424 |
| 561 | Ga0265330_10032230 | 3300031235 | Bacteria | 2348 |
| 562 | Ga0265332_10034970 | 3300031238 | Bacteria | 2182 |
| 563 | Ga0265328_10033570 | 3300031239 | Bacteria | 1902 |
| 564 | Ga0265320_10027217 | 3300031240 | Bacteria | 2984 |
| 565 | Ga0265325_10029379 | 3300031241 | Bacteria | 2955 |
| 566 | Ga0265340_10036886 | 3300031247 | Bacteria | 2421 |
| 567 | Ga0265331_10034908 | 3300031250 | Bacteria | 2477 |
| 568 | Ga0265331_10047843 | 3300031250 | Bacteria | 2058 |
| 569 | Ga0265316_10071769 | 3300031344 | Bacteria | 2668 |
| 570 | Ga0265316_10093854 | 3300031344 | Bacteria | 2286 |
| 571 | Ga0307513_10186603 | 3300031456 | Bacteria | 1930 |
| 572 | Ga0307509_10053465 | 3300031507 | Bacteria | 4307 |
| 573 | Ga0307509_10156853 | 3300031507 | Bacteria | 2180 |
| 574 | Ga0265313_10003842 | 3300031595 | Bacteria | 11852 |
| 575 | Ga0307508_10112232 | 3300031616 | Bacteria | 2326 |
| 576 | Ga0307514_10089125 | 3300031649 | Bacteria | 2255 |
| 577 | Ga0265314_10038445 | 3300031711 | Bacteria | 3456 |
| 578 | Ga0265314_10105935 | 3300031711 | Bacteria | 1797 |
| 579 | Ga0265342_10008005 | 3300031712 | Bacteria | 7654 |
| 580 | Ga0316576_10060506 | 3300031727 | Bacteria | 2774 |
| 581 | Ga0316578_10065563 | 3300031728 | Bacteria | 2144 |
| 582 | Ga0307516_10150346 | 3300031730 | Bacteria | 2089 |
| 583 | Ga0307516_10245789 | 3300031730 | Bacteria | 1486 |
| 584 | Ga0316577_10067535 | 3300031733 | Bacteria | 1995 |
| 585 | Ga0247548_100136 | 3300031814 | Bacteria | 2112 |
| 586 | Ga0307510_10057847 | 3300033180 | Bacteria | 4019 |
| 587 | Ga0373930_0002644 | 3300034816 | Bacteria | 2786 |
| 588 | Ga0373930_0004626 | 3300034816 | Bacteria | 2249 |
| 589 | Ga0373948_0004183 | 3300034817 | Bacteria | 2267 |
| 590 | Ga0373948_0004293 | 3300034817 | Bacteria | 2246 |
| 591 | Ga0373948_0005540 | 3300034817 | Bacteria | 2052 |
| 592 | Ga0373950_0000581 | 3300034818 | Bacteria | 4496 |
| 593 | Ga0373950_0004905 | 3300034818 | Bacteria | 1979 |
| 594 | Ga0373950_0005622 | 3300034818 | Bacteria | 1879 |
| 595 | Ga0373950_0005701 | 3300034818 | Bacteria | 1868 |
| 596 | Ga0373958_0000620 | 3300034819 | Bacteria | 4429 |
| 597 | Ga0373958_0003223 | 3300034819 | Bacteria | 2340 |
| 598 | Ga0373959_0001167 | 3300034820 | Bacteria | 4244 |
| 599 | Ga0373959_0006673 | 3300034820 | Bacteria | 1924 |
| 600 | Ga0373959_0009224 | 3300034820 | Bacteria | 1696 |
| 601 | Ga0373938_0001296 | 3300034957 | Bacteria | 4014 |
| 602 | Ga0373938_0006526 | 3300034957 | Bacteria | 2019 |
| 603 | Ga0373938_0007560 | 3300034957 | Bacteria | 1915 |
| 604 | Ga0373938_0013661 | 3300034957 | Bacteria | 1544 |
| 605 | Ga0373926_0006995 | 3300035083 | Bacteria | 3752 |
| 606 | Ga0373926_0022456 | 3300035083 | Bacteria | 2189 |
| 607 | Ga0373926_0026624 | 3300035083 | Bacteria | 2023 |
| 608 | Ga0373926_0028835 | 3300035083 | Bacteria | 1949 |
| 609 | Ga0373926_0029075 | 3300035083 | Bacteria | 1941 |
| 610 | Ga0373926_0032719 | 3300035083 | Bacteria | 1835 |
| 611 | Ga0373926_0043432 | 3300035083 | Bacteria | 1608 |
| 612 | Ga0373926_0047324 | 3300035083 | Bacteria | 1545 |
| 613 | Ga0373928_0000946 | 3300035084 | Bacteria | 5703 |
| 614 | Ga0373928_0006891 | 3300035084 | Bacteria | 2189 |
| 615 | Ga0373928_0007300 | 3300035084 | Bacteria | 2130 |
| 616 | Ga0373928_0012096 | 3300035084 | Bacteria | 1717 |
| 617 | Ga0373929_0001929 | 3300035085 | Bacteria | 3878 |
| 618 | Ga0373929_0006669 | 3300035085 | Bacteria | 2090 |
| 619 | Ga0373929_0007206 | 3300035085 | Bacteria | 2026 |
| 620 | Ga0373929_0009835 | 3300035085 | Bacteria | 1778 |
| 621 | Ga0373934_0013577 | 3300035086 | Bacteria | 3081 |
| 622 | Ga0373934_0019405 | 3300035086 | Bacteria | 2609 |
| 623 | Ga0373934_0032039 | 3300035086 | Bacteria | 2060 |
| 624 | Ga0373934_0035872 | 3300035086 | Bacteria | 1952 |
| 625 | Ga0373934_0046783 | 3300035086 | Bacteria | 1711 |
| 626 | Ga0373940_0010842 | 3300035088 | Bacteria | 2152 |
| 627 | Ga0373940_0011128 | 3300035088 | Bacteria | 2130 |
| 628 | Ga0373940_0018103 | 3300035088 | Bacteria | 1763 |
| 629 | Ga0373944_0014855 | 3300035089 | Bacteria | 2178 |
| 630 | Ga0373944_0016429 | 3300035089 | Bacteria | 2087 |
| 631 | Ga0373944_0021383 | 3300035089 | Bacteria | 1872 |
| 632 | Ga0373944_0024960 | 3300035089 | Bacteria | 1756 |
| 633 | Ga0373944_0034650 | 3300035089 | Bacteria | 1535 |
| 634 | Ga0373944_0043614 | 3300035089 | Bacteria | 1394 |
| 635 | Ga0373949_0001694 | 3300035090 | Bacteria | 6130 |
| 636 | Ga0373949_0011756 | 3300035090 | Bacteria | 1931 |
| 637 | Ga0373949_0012743 | 3300035090 | Bacteria | 1861 |
| 638 | Ga0373949_0013882 | 3300035090 | Bacteria | 1790 |
| 639 | Ga0373949_0015030 | 3300035090 | Bacteria | 1726 |
| 640 | Ga0373949_0015471 | 3300035090 | Bacteria | 1704 |
| 641 | Ga0373951_0009019 | 3300035091 | Bacteria | 2249 |
| 642 | Ga0373951_0009934 | 3300035091 | Bacteria | 2138 |
| 643 | Ga0373952_0003657 | 3300035092 | Bacteria | 2773 |
| 644 | Ga0373952_0006744 | 3300035092 | Bacteria | 2132 |
| 645 | Ga0373952_0007845 | 3300035092 | Bacteria | 2010 |
| 646 | Ga0373952_0008810 | 3300035092 | Bacteria | 1919 |
| 647 | Ga0373952_0010261 | 3300035092 | Bacteria | 1807 |
| 648 | Ga0373952_0010284 | 3300035092 | Bacteria | 1805 |
| 649 | Ga0373923_0018483 | 3300035111 | Bacteria | 2683 |
| 650 | Ga0373923_0019969 | 3300035111 | Bacteria | 2598 |
| 651 | Ga0373923_0025648 | 3300035111 | Bacteria | 2338 |
| 652 | Ga0373923_0035979 | 3300035111 | Bacteria | 2018 |
| 653 | Ga0373923_0053186 | 3300035111 | Bacteria | 1702 |
| 654 | Ga0373932_0011001 | 3300035112 | Bacteria | 2202 |
| 655 | Ga0373932_0015965 | 3300035112 | Bacteria | 1911 |
| 656 | Ga0373932_0017556 | 3300035112 | Bacteria | 1838 |
| 657 | Ga0373932_0019952 | 3300035112 | Bacteria | 1752 |
| 658 | Ga0373932_0020402 | 3300035112 | Bacteria | 1737 |
| 659 | Ga0373936_0018499 | 3300035113 | Bacteria | 2691 |
| 660 | Ga0373936_0022073 | 3300035113 | Bacteria | 2478 |
| 661 | Ga0373936_0029203 | 3300035113 | Bacteria | 2169 |
| 662 | Ga0373936_0034041 | 3300035113 | Bacteria | 2022 |
| 663 | Ga0373936_0034852 | 3300035113 | Bacteria | 2001 |
| 664 | Ga0373936_0041728 | 3300035113 | Bacteria | 1840 |
| 665 | Ga0373936_0048543 | 3300035113 | Bacteria | 1713 |
| 666 | Ga0373936_0049141 | 3300035113 | Bacteria | 1703 |
| 667 | Ga0373939_0000507 | 3300035114 | Bacteria | 9762 |
| 668 | Ga0373939_0013571 | 3300035114 | Bacteria | 2099 |
| 669 | Ga0373939_0014089 | 3300035114 | Bacteria | 2069 |
| 670 | Ga0373939_0014583 | 3300035114 | Bacteria | 2042 |
| 671 | Ga0373939_0017108 | 3300035114 | Bacteria | 1921 |
| 672 | Ga0373939_0021455 | 3300035114 | Bacteria | 1768 |
| 673 | Ga0373939_0025090 | 3300035114 | Bacteria | 1667 |
| 674 | Ga0373941_0001278 | 3300035115 | Bacteria | 5292 |
| 675 | Ga0373941_0002870 | 3300035115 | Bacteria | 3842 |
| 676 | Ga0373941_0015100 | 3300035115 | Bacteria | 2075 |
| 677 | Ga0373941_0016533 | 3300035115 | Bacteria | 2007 |
| 678 | Ga0373941_0017809 | 3300035115 | Bacteria | 1953 |
| 679 | Ga0373941_0041112 | 3300035115 | Bacteria | 1429 |
| 680 | Ga0373945_0009851 | 3300035116 | Bacteria | 3135 |
| 681 | Ga0373945_0017013 | 3300035116 | Bacteria | 2460 |
| 682 | Ga0373945_0020459 | 3300035116 | Bacteria | 2265 |
| 683 | Ga0373945_0022026 | 3300035116 | Bacteria | 2192 |
| 684 | Ga0373945_0024237 | 3300035116 | Bacteria | 2101 |
| 685 | Ga0373945_0024265 | 3300035116 | Bacteria | 2100 |
| 686 | Ga0373945_0041168 | 3300035116 | Bacteria | 1669 |
| 687 | Ga0373945_0041335 | 3300035116 | Bacteria | 1666 |
| 688 | Ga0373945_0043898 | 3300035116 | Bacteria | 1623 |
| 689 | Ga0373953_0012133 | 3300035117 | Bacteria | 3044 |
| 690 | Ga0373953_0027360 | 3300035117 | Bacteria | 2191 |
| 691 | Ga0373953_0028221 | 3300035117 | Bacteria | 2162 |
| 692 | Ga0373953_0033980 | 3300035117 | Bacteria | 1997 |
| 693 | Ga0373953_0039261 | 3300035117 | Bacteria | 1875 |
| 694 | Ga0373953_0052928 | 3300035117 | Bacteria | 1644 |
| 695 | Ga0373954_0035637 | 3300035118 | Bacteria | 2308 |
| 696 | Ga0373954_0050070 | 3300035118 | Bacteria | 1959 |
| 697 | Ga0373954_0052661 | 3300035118 | Bacteria | 1912 |
| 698 | Ga0373954_0107734 | 3300035118 | Bacteria | 1346 |
| 699 | Ga0373956_0013609 | 3300035119 | Bacteria | 3386 |
| 700 | Ga0373956_0031977 | 3300035119 | Bacteria | 2307 |
| 701 | Ga0373956_0032118 | 3300035119 | Bacteria | 2302 |
| 702 | Ga0373956_0042988 | 3300035119 | Bacteria | 2010 |
| 703 | Ga0373956_0046191 | 3300035119 | Bacteria | 1944 |
| 704 | Ga0373956_0046381 | 3300035119 | Bacteria | 1941 |
| 705 | Ga0373956_0056176 | 3300035119 | Bacteria | 1776 |
| 706 | Ga0373957_0022818 | 3300035120 | Bacteria | 2232 |
| 707 | Ga0373957_0027498 | 3300035120 | Bacteria | 2066 |
| 708 | Ga0373957_0037771 | 3300035120 | Bacteria | 1805 |
| 709 | Ga0373960_0002145 | 3300035121 | Bacteria | 4444 |
| 710 | Ga0373960_0006003 | 3300035121 | Bacteria | 2831 |
| 711 | Ga0373960_0012402 | 3300035121 | Bacteria | 2117 |
| 712 | Ga0373960_0013073 | 3300035121 | Bacteria | 2074 |
| 713 | Ga0373960_0014294 | 3300035121 | Bacteria | 2008 |
| 714 | Ga0373960_0015841 | 3300035121 | Bacteria | 1930 |
| 715 | Ga0373943_0022194 | 3300035170 | Bacteria | 2938 |
| 716 | Ga0373943_0042122 | 3300035170 | Bacteria | 2211 |
| 717 | Ga0373943_0045956 | 3300035170 | Bacteria | 2129 |
| 718 | Ga0373943_0046084 | 3300035170 | Bacteria | 2126 |
| 719 | Ga0373943_0046303 | 3300035170 | Bacteria | 2122 |
| 720 | Ga0373943_0047595 | 3300035170 | Bacteria | 2097 |
| 721 | Ga0373943_0052071 | 3300035170 | Bacteria | 2017 |
| 722 | Ga0373943_0054791 | 3300035170 | Bacteria | 1973 |
| 723 | Ga0373943_0055165 | 3300035170 | Bacteria | 1967 |
| 724 | Ga0373943_0061960 | 3300035170 | Bacteria | 1871 |
| 725 | Ga0373943_0074271 | 3300035170 | Bacteria | 1728 |
| 726 | Ga0373943_0087541 | 3300035170 | Bacteria | 1607 |
| 727 | Ga0373946_0023384 | 3300035171 | Bacteria | 2413 |
| 728 | Ga0373946_0025465 | 3300035171 | Bacteria | 2326 |
| 729 | Ga0373946_0027639 | 3300035171 | Bacteria | 2245 |
| 730 | Ga0373946_0031856 | 3300035171 | Bacteria | 2114 |
| 731 | Ga0373946_0047257 | 3300035171 | Bacteria | 1787 |
| 732 | Ga0373946_0062722 | 3300035171 | Bacteria | 1585 |
| 733 | Ga0373946_0075821 | 3300035171 | Bacteria | 1462 |
| 734 | Ga0373955_0038184 | 3300035172 | Bacteria | 2557 |
| 735 | Ga0373955_0050316 | 3300035172 | Bacteria | 2265 |
| 736 | Ga0373955_0067671 | 3300035172 | Bacteria | 1988 |
| 737 | Ga0373955_0084848 | 3300035172 | Bacteria | 1796 |
| 738 | Ga0373955_0112589 | 3300035172 | Bacteria | 1574 |
| 739 | Ga0373955_0114714 | 3300035172 | Bacteria | 1560 |
| 740 | Ga0373942_0007684 | 3300035207 | Bacteria | 2506 |
| 741 | Ga0373942_0008614 | 3300035207 | Bacteria | 2380 |
| 742 | Ga0373942_0015948 | 3300035207 | Bacteria | 1837 |
| 743 | Ga0373942_0019623 | 3300035207 | Bacteria | 1689 |
| 744 | Ga0373961_0009229 | 3300035241 | Bacteria | 2410 |
| 745 | Ga0373961_0012145 | 3300035241 | Bacteria | 2150 |
| 746 | Ga0373961_0014244 | 3300035241 | Bacteria | 2017 |
| 747 | Ga0373961_0021166 | 3300035241 | Bacteria | 1727 |
| 748 | Ga0373962_0001001 | 3300035242 | Bacteria | 6532 |
| 749 | Ga0373962_0012988 | 3300035242 | Bacteria | 2103 |
| 750 | Ga0373962_0013251 | 3300035242 | Bacteria | 2084 |
| 751 | Ga0373962_0014584 | 3300035242 | Bacteria | 2004 |
| 752 | Ga0373962_0014884 | 3300035242 | Bacteria | 1987 |
| 753 | Ga0373962_0026227 | 3300035242 | Bacteria | 1569 |
| 754 | Ga0316574_0024526 | 3300035398 | Bacteria | 3610 |
| 755 | Ga0316574_0077602 | 3300035398 | Bacteria | 2105 |
| 756 | Ga0373924_0023989 | 3300035410 | Bacteria | 2399 |
| 757 | Ga0373924_0025605 | 3300035410 | Bacteria | 2333 |
| 758 | Ga0373924_0033533 | 3300035410 | Bacteria | 2073 |
| 759 | Ga0373924_0038516 | 3300035410 | Bacteria | 1950 |
| 760 | Ga0373931_0005795 | 3300035691 | Bacteria | 5742 |
| 761 | Ga0373931_0011895 | 3300035691 | Bacteria | 4209 |
| 762 | Ga0373931_0041301 | 3300035691 | Bacteria | 2422 |
| 763 | Ga0373931_0041780 | 3300035691 | Bacteria | 2409 |
| 764 | Ga0373931_0048262 | 3300035691 | Bacteria | 2256 |
| 765 | Ga0373931_0055425 | 3300035691 | Bacteria | 2121 |
| 766 | Ga0373931_0061126 | 3300035691 | Bacteria | 2030 |
| 767 | Ga0373931_0063323 | 3300035691 | Bacteria | 1998 |
| 768 | Ga0373931_0108319 | 3300035691 | Bacteria | 1572 |
| 769 | Ga0373931_0110886 | 3300035691 | Bacteria | 1556 |
| 770 | Ga0373935_0047080 | 3300035692 | Bacteria | 2725 |
| 771 | Ga0373935_0073803 | 3300035692 | Bacteria | 2204 |
| 772 | Ga0373935_0077338 | 3300035692 | Bacteria | 2156 |
| 773 | Ga0373935_0086766 | 3300035692 | Bacteria | 2042 |
| 774 | Ga0373935_0087760 | 3300035692 | Bacteria | 2031 |
| 775 | Ga0373935_0088573 | 3300035692 | Bacteria | 2022 |
| 776 | Ga0373935_0092325 | 3300035692 | Bacteria | 1983 |
| 777 | Ga0373935_0100090 | 3300035692 | Bacteria | 1909 |
| 778 | Ga0373935_0126734 | 3300035692 | Bacteria | 1711 |
| 779 | Ga0373935_0127803 | 3300035692 | Bacteria | 1704 |
| 780 | Ga0373935_0137298 | 3300035692 | Bacteria | 1648 |
| 781 | Ga0373927_0007068 | 3300035695 | Bacteria | 7612 |
| 782 | Ga0373927_0014831 | 3300035695 | Bacteria | 5153 |
| 783 | Ga0373927_0057521 | 3300035695 | Bacteria | 2514 |
| 784 | Ga0373927_0065844 | 3300035695 | Bacteria | 2343 |
| 785 | Ga0373927_0073016 | 3300035695 | Bacteria | 2221 |
| 786 | Ga0373927_0083316 | 3300035695 | Bacteria | 2073 |
| 787 | Ga0373927_0086758 | 3300035695 | Bacteria | 2031 |
| 788 | Ga0373927_0088128 | 3300035695 | Bacteria | 2014 |
| 789 | Ga0373927_0091587 | 3300035695 | Bacteria | 1974 |
| 790 | Ga0373927_0091884 | 3300035695 | Bacteria | 1971 |
| 791 | Ga0373927_0104679 | 3300035695 | Bacteria | 1842 |
| 792 | Ga0373927_0119149 | 3300035695 | Bacteria | 1722 |
| 793 | Ga0373927_0124794 | 3300035695 | Bacteria | 1680 |
| 794 | Ga0373927_0176869 | 3300035695 | Bacteria | 1399 |
| 795 | Ga0373933_0027794 | 3300035724 | Bacteria | 3260 |
| 796 | Ga0373933_0057552 | 3300035724 | Bacteria | 2336 |
| 797 | Ga0373933_0067829 | 3300035724 | Bacteria | 2165 |
| 798 | Ga0373933_0070012 | 3300035724 | Bacteria | 2133 |
| 799 | Ga0373933_0086353 | 3300035724 | Bacteria | 1930 |
| 800 | Ga0373933_0097530 | 3300035724 | Bacteria | 1820 |
| 801 | Ga0373933_0141414 | 3300035724 | Bacteria | 1519 |
| 802 | Ga0373933_0153653 | 3300035724 | Bacteria | 1458 |
| 803 | Ga0373947_0025663 | 3300035725 | Bacteria | 3436 |
| 804 | Ga0373947_0036040 | 3300035725 | Bacteria | 2931 |
| 805 | Ga0373947_0072958 | 3300035725 | Bacteria | 2108 |
| 806 | Ga0373947_0074042 | 3300035725 | Bacteria | 2094 |
| 807 | Ga0373947_0075735 | 3300035725 | Bacteria | 2072 |
| 808 | Ga0373947_0078723 | 3300035725 | Bacteria | 2035 |
| 809 | Ga0373947_0087998 | 3300035725 | Bacteria | 1932 |
| 810 | Ga0373947_0093467 | 3300035725 | Bacteria | 1879 |
| 811 | Ga0373947_0127573 | 3300035725 | Bacteria | 1621 |
| 812 | Ga0373947_0132125 | 3300035725 | Bacteria | 1594 |
| 813 | Ga0373947_0163066 | 3300035725 | Bacteria | 1442 |
| 814 | Ga0373937_0007313 | 3300036401 | Bacteria | 9557 |
| 815 | Ga0373937_0019580 | 3300036401 | Bacteria | 6057 |
| 816 | Ga0373937_0078280 | 3300036401 | Bacteria | 3055 |
| 817 | Ga0373937_0119884 | 3300036401 | Bacteria | 2451 |
| 818 | Ga0373937_0126289 | 3300036401 | Bacteria | 2386 |
| 819 | Ga0373937_0134547 | 3300036401 | Bacteria | 2310 |
| 820 | Ga0373937_0156136 | 3300036401 | Bacteria | 2138 |
| 821 | Ga0373937_0166916 | 3300036401 | Bacteria | 2064 |
| 822 | Ga0373937_0176371 | 3300036401 | Bacteria | 2006 |
| 823 | Ga0373937_0176532 | 3300036401 | Bacteria | 2005 |
| 824 | Ga0373937_0187234 | 3300036401 | Bacteria | 1944 |
| 825 | Ga0373937_0239078 | 3300036401 | Bacteria | 1711 |
| 826 | Ga0316582_0066463 | 3300036647 | Bacteria | 2324 |
| 827 | Ga0316584_0089511 | 3300036712 | Bacteria | 2304 |
| 828 | Ga0373925_0060284 | 3300037068 | Bacteria | 2849 |
| 829 | Ga0373925_0078393 | 3300037068 | Bacteria | 2508 |
| 830 | Ga0373925_0087543 | 3300037068 | Bacteria | 2377 |
| 831 | Ga0373925_0089419 | 3300037068 | Bacteria | 2352 |
| 832 | Ga0373925_0098733 | 3300037068 | Bacteria | 2241 |
| 833 | Ga0373925_0109080 | 3300037068 | Bacteria | 2136 |
| 834 | Ga0373925_0112429 | 3300037068 | Bacteria | 2105 |
| 835 | Ga0373925_0118313 | 3300037068 | Bacteria | 2054 |
| 836 | Ga0373925_0126950 | 3300037068 | Bacteria | 1985 |
| 837 | Ga0373925_0161988 | 3300037068 | Bacteria | 1762 |
| 838 | Ga0373925_0163238 | 3300037068 | Bacteria | 1755 |
| 839 | Ga0373925_0176561 | 3300037068 | Bacteria | 1688 |
| 840 | Ga0373925_0203343 | 3300037068 | Bacteria | 1575 |
| 841 | Ga0395900_0103240 | 3300037418 | Bacteria | 2928 |
| 842 | Ga0400487_34578 | 3300039110 | Bacteria | 1893 |
| 843 | Ga0436365_0312816 | 3300039437 | Bacteria | 3221 |
| 844 | Ga0436365_0382575 | 3300039437 | Bacteria | 2749 |
| 845 | Ga0436360_0942193 | 3300039438 | Bacteria | 1630 |
| 846 | Ga0436360_1200571 | 3300039438 | Bacteria | 2163 |
| 847 | Ga0436361_0246471 | 3300039447 | Bacteria | 2252 |
| 848 | Ga0436361_0473542 | 3300039447 | Bacteria | 2478 |
| 849 | Ga0436361_0636700 | 3300039447 | Bacteria | 4079 |
| 850 | Ga0436361_0670461 | 3300039447 | Bacteria | 3483 |
| 851 | Ga0436361_0698129 | 3300039447 | Bacteria | 2209 |
| 852 | Ga0436361_0718864 | 3300039447 | Bacteria | 1619 |
| 853 | Ga0436363_0131824 | 3300039450 | Bacteria | 5098 |
| 854 | Ga0436363_0158283 | 3300039450 | Bacteria | 3095 |
| 855 | Ga0436362_0106990 | 3300039453 | Bacteria | 2275 |
| 856 | Ga0436362_0261345 | 3300039453 | Bacteria | 2851 |
| 857 | Ga0436362_0534509 | 3300039453 | Bacteria | 1673 |
| 858 | Ga0439453_0003922 | 3300041408 | Bacteria | 2179 |
| 859 | Ga0439441_001846 | 3300042001 | Bacteria | 2881 |
| 860 | Ga0439448_0007438 | 3300042005 | Bacteria | 3175 |
| 861 | Ga0439450_000217 | 3300042008 | Bacteria | 6866 |
| 862 | Ga0439455_0008214 | 3300042012 | Bacteria | 2232 |
| 863 | Ga0450923_005932 | 3300042125 | Bacteria | 1995 |
| 864 | Ga0439458_0007191 | 3300042157 | Bacteria | 2477 |
| 865 | Ga0439444_0004221 | 3300042437 | Bacteria | 2077 |
| 866 | Ga0439459_0002947 | 3300042438 | Bacteria | 2665 |
| 867 | Ga0439464_0000038 | 3300042439 | Bacteria | 16614 |
| 868 | Ga0439460_0027438 | 3300042461 | Bacteria | 1599 |
| 869 | Ga0466972_0048971 | 3300044658 | Bacteria | 2041 |
| 870 | Ga0466972_0051164 | 3300044658 | Bacteria | 1993 |
| 871 | Ga0466965_0040755 | 3300044683 | Bacteria | 2287 |
| 872 | Ga0466964_0010858 | 3300044706 | Bacteria | 3440 |
| 873 | Ga0453684_0003111 | 3300044712 | Bacteria | 38224 |
| 874 | Ga0466968_0001716 | 3300044735 | Bacteria | 7903 |
| 875 | Ga0466960_0029442 | 3300044901 | Bacteria | 2520 |
| 876 | Ga0451576_0263042 | 3300045051 | Bacteria | 1803 |
| 877 | Ga0466967_0246701 | 3300045976 | Bacteria | 1704 |
| 878 | Ga0495617_008605 | 3300046452 | Bacteria | 3513 |
| 879 | Ga0495617_020509 | 3300046452 | Bacteria | 2233 |
| 880 | Ga0495617_023689 | 3300046452 | Bacteria | 2073 |
| 881 | Ga0495617_025672 | 3300046452 | Bacteria | 1985 |
| 882 | Ga0495617_030838 | 3300046452 | Bacteria | 1801 |
| 883 | Ga0495617_038542 | 3300046452 | Bacteria | 1598 |
| 884 | Ga0495627_019853 | 3300046453 | Bacteria | 2247 |
| 885 | Ga0495627_026179 | 3300046453 | Bacteria | 1883 |
| 886 | Ga0495592_0011412 | 3300046454 | Bacteria | 6723 |
| 887 | Ga0495592_0040501 | 3300046454 | Bacteria | 3496 |
| 888 | Ga0495592_0043444 | 3300046454 | Bacteria | 3362 |
| 889 | Ga0495592_0050071 | 3300046454 | Bacteria | 3104 |
| 890 | Ga0495592_0056195 | 3300046454 | Bacteria | 2909 |
| 891 | Ga0495592_0069982 | 3300046454 | Bacteria | 2557 |
| 892 | Ga0495592_0081367 | 3300046454 | Bacteria | 2341 |
| 893 | Ga0495592_0094297 | 3300046454 | Bacteria | 2142 |
| 894 | Ga0495592_0102495 | 3300046454 | Bacteria | 2037 |
| 895 | Ga0495592_0138453 | 3300046454 | Bacteria | 1695 |
| 896 | Ga0495592_0150097 | 3300046454 | Bacteria | 1612 |
| 897 | Ga0495603_0018781 | 3300046455 | Bacteria | 4184 |
| 898 | Ga0495603_0063660 | 3300046455 | Bacteria | 2175 |
| 899 | Ga0495603_0070247 | 3300046455 | Bacteria | 2058 |
| 900 | Ga0495603_0071214 | 3300046455 | Bacteria | 2043 |
| 901 | Ga0495603_0075984 | 3300046455 | Bacteria | 1971 |
| 902 | Ga0495603_0076895 | 3300046455 | Bacteria | 1958 |
| 903 | Ga0495603_0078817 | 3300046455 | Bacteria | 1931 |
| 904 | Ga0495603_0086777 | 3300046455 | Bacteria | 1831 |
| 905 | Ga0495590_0002715 | 3300046457 | Bacteria | 7313 |
| 906 | Ga0495590_0027418 | 3300046457 | Bacteria | 1998 |
| 907 | Ga0495590_0037365 | 3300046457 | Bacteria | 1693 |
| 908 | Ga0495591_016384 | 3300046458 | Bacteria | 2582 |
| 909 | Ga0495629_0006149 | 3300046459 | Bacteria | 8916 |
| 910 | Ga0495629_0037338 | 3300046459 | Bacteria | 3424 |
| 911 | Ga0495629_0042309 | 3300046459 | Bacteria | 3202 |
| 912 | Ga0495629_0067262 | 3300046459 | Bacteria | 2500 |
| 913 | Ga0495629_0090664 | 3300046459 | Bacteria | 2133 |
| 914 | Ga0495629_0090856 | 3300046459 | Bacteria | 2130 |
| 915 | Ga0495629_0102877 | 3300046459 | Bacteria | 1992 |
| 916 | Ga0495629_0109757 | 3300046459 | Bacteria | 1923 |
| 917 | Ga0495629_0114280 | 3300046459 | Bacteria | 1881 |
| 918 | Ga0495629_0140062 | 3300046459 | Bacteria | 1683 |
| 919 | Ga0495629_0141265 | 3300046459 | Bacteria | 1675 |
| 920 | Ga0495638_0018463 | 3300046460 | Bacteria | 4631 |
| 921 | Ga0495638_0075879 | 3300046460 | Bacteria | 2048 |
| 922 | Ga0495638_0081079 | 3300046460 | Bacteria | 1970 |
| 923 | Ga0495638_0102866 | 3300046460 | Bacteria | 1706 |
| 924 | Ga0495641_0012648 | 3300046461 | Bacteria | 4702 |
| 925 | Ga0495641_0033106 | 3300046461 | Bacteria | 2455 |
| 926 | Ga0495641_0034995 | 3300046461 | Bacteria | 2370 |
| 927 | Ga0495641_0035897 | 3300046461 | Bacteria | 2332 |
| 928 | Ga0495641_0046260 | 3300046461 | Bacteria | 2001 |
| 929 | Ga0495641_0061712 | 3300046461 | Bacteria | 1691 |
| 930 | Ga0495651_0035973 | 3300046462 | Bacteria | 3854 |
| 931 | Ga0495651_0047705 | 3300046462 | Bacteria | 3309 |
| 932 | Ga0495651_0048217 | 3300046462 | Bacteria | 3290 |
| 933 | Ga0495651_0080442 | 3300046462 | Bacteria | 2461 |
| 934 | Ga0495651_0085280 | 3300046462 | Bacteria | 2378 |
| 935 | Ga0495651_0098957 | 3300046462 | Bacteria | 2175 |
| 936 | Ga0495651_0103181 | 3300046462 | Bacteria | 2119 |
| 937 | Ga0495651_0104839 | 3300046462 | Bacteria | 2098 |
| 938 | Ga0495651_0105388 | 3300046462 | Bacteria | 2091 |
| 939 | Ga0495651_0105553 | 3300046462 | Bacteria | 2089 |
| 940 | Ga0495651_0111624 | 3300046462 | Bacteria | 2020 |
| 941 | Ga0495653_0036782 | 3300046463 | Bacteria | 3853 |
| 942 | Ga0495653_0051123 | 3300046463 | Bacteria | 3174 |
| 943 | Ga0495653_0069246 | 3300046463 | Bacteria | 2644 |
| 944 | Ga0495653_0095913 | 3300046463 | Bacteria | 2157 |
| 945 | Ga0495653_0124359 | 3300046463 | Bacteria | 1833 |
| 946 | Ga0495653_0151367 | 3300046463 | Bacteria | 1620 |
| 947 | Ga0495653_0159121 | 3300046463 | Bacteria | 1569 |
| 948 | Ga0495650_0032615 | 3300046471 | Bacteria | 2327 |
| 949 | Ga0495650_0039373 | 3300046471 | Bacteria | 2040 |
| 950 | Ga0495650_0039980 | 3300046471 | Bacteria | 2018 |
| 951 | Ga0495650_0040413 | 3300046471 | Bacteria | 2002 |
| 952 | Ga0495650_0040515 | 3300046471 | Bacteria | 1998 |
| 953 | Ga0495650_0044241 | 3300046471 | Bacteria | 1883 |
| 954 | Ga0495580_0000880 | 3300046472 | Bacteria | 26042 |
| 955 | Ga0495580_0048764 | 3300046472 | Bacteria | 2996 |
| 956 | Ga0495580_0054131 | 3300046472 | Bacteria | 2831 |
| 957 | Ga0495580_0093419 | 3300046472 | Bacteria | 2093 |
| 958 | Ga0495580_0103160 | 3300046472 | Bacteria | 1982 |
| 959 | Ga0495580_0106586 | 3300046472 | Bacteria | 1946 |
| 960 | Ga0495580_0114240 | 3300046472 | Bacteria | 1875 |
| 961 | Ga0495580_0119052 | 3300046472 | Bacteria | 1833 |
| 962 | Ga0495580_0125337 | 3300046472 | Bacteria | 1782 |
| 963 | Ga0495580_0132887 | 3300046472 | Bacteria | 1725 |
| 964 | Ga0495580_0133443 | 3300046472 | Bacteria | 1721 |
| 965 | Ga0495582_0010960 | 3300046473 | Bacteria | 4989 |
| 966 | Ga0495582_0030790 | 3300046473 | Bacteria | 2947 |
| 967 | Ga0495582_0052335 | 3300046473 | Bacteria | 2251 |
| 968 | Ga0495582_0052831 | 3300046473 | Bacteria | 2240 |
| 969 | Ga0495582_0066369 | 3300046473 | Bacteria | 1993 |
| 970 | Ga0495582_0070271 | 3300046473 | Bacteria | 1936 |
| 971 | Ga0495582_0074957 | 3300046473 | Bacteria | 1873 |
| 972 | Ga0495582_0127235 | 3300046473 | Bacteria | 1438 |
| 973 | Ga0495605_0021678 | 3300046474 | Bacteria | 3400 |
| 974 | Ga0495605_0025911 | 3300046474 | Bacteria | 3051 |
| 975 | Ga0495605_0031097 | 3300046474 | Bacteria | 2729 |
| 976 | Ga0495605_0041011 | 3300046474 | Bacteria | 2307 |
| 977 | Ga0495605_0044532 | 3300046474 | Bacteria | 2193 |
| 978 | Ga0495605_0066557 | 3300046474 | Bacteria | 1711 |
| 979 | Ga0495639_0013188 | 3300046475 | Bacteria | 3566 |
| 980 | Ga0495639_0017612 | 3300046475 | Bacteria | 3104 |
| 981 | Ga0495639_0026386 | 3300046475 | Bacteria | 2567 |
| 982 | Ga0495639_0035445 | 3300046475 | Bacteria | 2232 |
| 983 | Ga0495639_0045413 | 3300046475 | Bacteria | 1987 |
| 984 | Ga0495639_0073528 | 3300046475 | Bacteria | 1582 |
| 985 | Ga0495662_0008404 | 3300046476 | Bacteria | 5077 |
| 986 | Ga0495662_0025773 | 3300046476 | Bacteria | 2839 |
| 987 | Ga0495662_0028706 | 3300046476 | Bacteria | 2685 |
| 988 | Ga0495662_0039611 | 3300046476 | Bacteria | 2276 |
| 989 | Ga0495662_0043105 | 3300046476 | Bacteria | 2178 |
| 990 | Ga0495662_0045297 | 3300046476 | Bacteria | 2123 |
| 991 | Ga0495662_0047303 | 3300046476 | Bacteria | 2076 |
| 992 | Ga0495662_0050709 | 3300046476 | Bacteria | 2003 |
| 993 | Ga0495662_0057550 | 3300046476 | Bacteria | 1877 |
| 994 | Ga0495662_0073563 | 3300046476 | Bacteria | 1657 |
| 995 | Ga0495664_0020362 | 3300046477 | Bacteria | 3825 |
| 996 | Ga0495664_0020432 | 3300046477 | Bacteria | 3819 |
| 997 | Ga0495664_0033433 | 3300046477 | Bacteria | 3021 |
| 998 | Ga0495664_0060965 | 3300046477 | Bacteria | 2246 |
| 999 | Ga0495664_0068180 | 3300046477 | Bacteria | 2122 |
| 1000 | Ga0495664_0088641 | 3300046477 | Bacteria | 1859 |
| 1001 | Ga0495664_0102074 | 3300046477 | Bacteria | 1728 |
| 1002 | Ga0495664_0117936 | 3300046477 | Bacteria | 1604 |
| 1003 | Ga0495664_0162135 | 3300046477 | Bacteria | 1356 |
| 1004 | Ga0495584_0014579 | 3300046491 | Bacteria | 4006 |
| 1005 | Ga0495584_0045356 | 3300046491 | Bacteria | 2217 |
| 1006 | Ga0495584_0052355 | 3300046491 | Bacteria | 2054 |
| 1007 | Ga0495584_0054238 | 3300046491 | Bacteria | 2017 |
| 1008 | Ga0495585_0016070 | 3300046492 | Bacteria | 4339 |
| 1009 | Ga0495585_0030086 | 3300046492 | Bacteria | 3089 |
| 1010 | Ga0495585_0038965 | 3300046492 | Bacteria | 2673 |
| 1011 | Ga0495585_0054498 | 3300046492 | Bacteria | 2210 |
| 1012 | Ga0495585_0056407 | 3300046492 | Bacteria | 2169 |
| 1013 | Ga0495585_0061064 | 3300046492 | Bacteria | 2073 |
| 1014 | Ga0495585_0064709 | 3300046492 | Bacteria | 2004 |
| 1015 | Ga0495594_0020857 | 3300046499 | Bacteria | 3493 |
| 1016 | Ga0495594_0037871 | 3300046499 | Bacteria | 2632 |
| 1017 | Ga0495594_0052904 | 3300046499 | Bacteria | 2235 |
| 1018 | Ga0495594_0059598 | 3300046499 | Bacteria | 2111 |
| 1019 | Ga0495594_0062521 | 3300046499 | Bacteria | 2061 |
| 1020 | Ga0495594_0065479 | 3300046499 | Bacteria | 2015 |
| 1021 | Ga0495594_0121191 | 3300046499 | Bacteria | 1478 |
| 1022 | Ga0495596_0016574 | 3300046500 | Bacteria | 3059 |
| 1023 | Ga0495596_0026630 | 3300046500 | Bacteria | 2328 |
| 1024 | Ga0495596_0027666 | 3300046500 | Bacteria | 2278 |
| 1025 | Ga0495596_0033435 | 3300046500 | Bacteria | 2046 |
| 1026 | Ga0495596_0035538 | 3300046500 | Bacteria | 1975 |
| 1027 | Ga0495596_0035974 | 3300046500 | Bacteria | 1962 |
| 1028 | Ga0495596_0040697 | 3300046500 | Bacteria | 1834 |
| 1029 | Ga0495596_0043665 | 3300046500 | Bacteria | 1766 |
| 1030 | Ga0495596_0050725 | 3300046500 | Bacteria | 1626 |
| 1031 | Ga0495607_0020383 | 3300046501 | Bacteria | 4192 |
| 1032 | Ga0495607_0064600 | 3300046501 | Bacteria | 2066 |
| 1033 | Ga0495607_0068901 | 3300046501 | Bacteria | 1982 |
| 1034 | Ga0495607_0077116 | 3300046501 | Bacteria | 1841 |
| 1035 | Ga0495583_0029046 | 3300046506 | Bacteria | 2709 |
| 1036 | Ga0495583_0043912 | 3300046506 | Bacteria | 2078 |
| 1037 | Ga0495606_0065670 | 3300046507 | Bacteria | 2304 |
| 1038 | Ga0495606_0068819 | 3300046507 | Bacteria | 2238 |
| 1039 | Ga0495606_0071302 | 3300046507 | Bacteria | 2188 |
| 1040 | Ga0495606_0130195 | 3300046507 | Bacteria | 1496 |
| 1041 | Ga0495608_0014629 | 3300046511 | Bacteria | 5443 |
| 1042 | Ga0495608_0034014 | 3300046511 | Bacteria | 3441 |
| 1043 | Ga0495608_0050596 | 3300046511 | Bacteria | 2756 |
| 1044 | Ga0495608_0060196 | 3300046511 | Bacteria | 2499 |
| 1045 | Ga0495608_0079876 | 3300046511 | Bacteria | 2126 |
| 1046 | Ga0495608_0086848 | 3300046511 | Bacteria | 2026 |
| 1047 | Ga0495608_0097009 | 3300046511 | Bacteria | 1903 |
| 1048 | Ga0495608_0108826 | 3300046511 | Bacteria | 1782 |
| 1049 | Ga0495610_0013838 | 3300046512 | Bacteria | 4770 |
| 1050 | Ga0495610_0047181 | 3300046512 | Bacteria | 2120 |
| 1051 | Ga0495610_0049342 | 3300046512 | Bacteria | 2061 |
| 1052 | Ga0495616_0024318 | 3300046513 | Bacteria | 3249 |
| 1053 | Ga0495616_0040654 | 3300046513 | Bacteria | 2374 |
| 1054 | Ga0495616_0043367 | 3300046513 | Bacteria | 2285 |
| 1055 | Ga0495616_0049485 | 3300046513 | Bacteria | 2106 |
| 1056 | Ga0495618_0034860 | 3300046514 | Bacteria | 3158 |
| 1057 | Ga0495618_0044246 | 3300046514 | Bacteria | 2808 |
| 1058 | Ga0495618_0061014 | 3300046514 | Bacteria | 2391 |
| 1059 | Ga0495618_0064599 | 3300046514 | Bacteria | 2325 |
| 1060 | Ga0495618_0071592 | 3300046514 | Bacteria | 2205 |
| 1061 | Ga0495620_0045055 | 3300046515 | Bacteria | 1913 |
| 1062 | Ga0495628_0004856 | 3300046516 | Bacteria | 11833 |
| 1063 | Ga0495628_0042604 | 3300046516 | Bacteria | 3620 |
| 1064 | Ga0495628_0079254 | 3300046516 | Bacteria | 2553 |
| 1065 | Ga0495628_0092681 | 3300046516 | Bacteria | 2336 |
| 1066 | Ga0495628_0093770 | 3300046516 | Bacteria | 2321 |
| 1067 | Ga0495628_0110516 | 3300046516 | Bacteria | 2114 |
| 1068 | Ga0495628_0125313 | 3300046516 | Bacteria | 1968 |
| 1069 | Ga0495628_0131756 | 3300046516 | Bacteria | 1911 |
| 1070 | Ga0495630_0045276 | 3300046517 | Bacteria | 3287 |
| 1071 | Ga0495630_0052557 | 3300046517 | Bacteria | 3050 |
| 1072 | Ga0495630_0101079 | 3300046517 | Bacteria | 2181 |
| 1073 | Ga0495630_0103202 | 3300046517 | Bacteria | 2157 |
| 1074 | Ga0495630_0107175 | 3300046517 | Bacteria | 2116 |
| 1075 | Ga0495630_0113875 | 3300046517 | Bacteria | 2049 |
| 1076 | Ga0495631_0006458 | 3300046518 | Bacteria | 6051 |
| 1077 | Ga0495631_0020194 | 3300046518 | Bacteria | 3115 |
| 1078 | Ga0495631_0021815 | 3300046518 | Bacteria | 2980 |
| 1079 | Ga0495631_0036836 | 3300046518 | Bacteria | 2182 |
| 1080 | Ga0495631_0038131 | 3300046518 | Bacteria | 2137 |
| 1081 | Ga0495631_0040872 | 3300046518 | Bacteria | 2053 |
| 1082 | Ga0495631_0048622 | 3300046518 | Bacteria | 1859 |
| 1083 | Ga0495631_0060397 | 3300046518 | Bacteria | 1644 |
| 1084 | Ga0495632_0028974 | 3300046519 | Bacteria | 2886 |
| 1085 | Ga0495632_0037177 | 3300046519 | Bacteria | 2472 |
| 1086 | Ga0495632_0073629 | 3300046519 | Bacteria | 1637 |
| 1087 | Ga0495637_0020653 | 3300046520 | Bacteria | 3027 |
| 1088 | Ga0495637_0039829 | 3300046520 | Bacteria | 2025 |
| 1089 | Ga0495637_0041797 | 3300046520 | Bacteria | 1964 |
| 1090 | Ga0495643_0047491 | 3300046522 | Bacteria | 2324 |
| 1091 | Ga0495644_0023582 | 3300046523 | Bacteria | 2342 |
| 1092 | Ga0495644_0028617 | 3300046523 | Bacteria | 2108 |
| 1093 | Ga0495644_0030987 | 3300046523 | Bacteria | 2019 |
| 1094 | Ga0495644_0031018 | 3300046523 | Bacteria | 2018 |
| 1095 | Ga0495644_0035425 | 3300046523 | Bacteria | 1884 |
| 1096 | Ga0495644_0040698 | 3300046523 | Bacteria | 1751 |
| 1097 | Ga0495644_0048045 | 3300046523 | Bacteria | 1602 |
| 1098 | Ga0495648_0012902 | 3300046524 | Bacteria | 6206 |
| 1099 | Ga0495648_0056926 | 3300046524 | Bacteria | 2348 |
| 1100 | Ga0495648_0075440 | 3300046524 | Bacteria | 1939 |
| 1101 | Ga0495648_0077293 | 3300046524 | Bacteria | 1908 |
| 1102 | Ga0495648_0084760 | 3300046524 | Bacteria | 1792 |
| 1103 | Ga0495663_0015446 | 3300046525 | Bacteria | 2151 |
| 1104 | Ga0495663_0016062 | 3300046525 | Bacteria | 2114 |
| 1105 | Ga0495663_0017858 | 3300046525 | Bacteria | 2016 |
| 1106 | Ga0495663_0018904 | 3300046525 | Bacteria | 1965 |
| 1107 | Ga0495663_0018947 | 3300046525 | Bacteria | 1963 |
| 1108 | Ga0495666_0016750 | 3300046526 | Bacteria | 3649 |
| 1109 | Ga0495666_0022058 | 3300046526 | Bacteria | 3153 |
| 1110 | Ga0495666_0023259 | 3300046526 | Bacteria | 3064 |
| 1111 | Ga0495666_0041216 | 3300046526 | Bacteria | 2236 |
| 1112 | Ga0495666_0044454 | 3300046526 | Bacteria | 2144 |
| 1113 | Ga0495666_0044584 | 3300046526 | Bacteria | 2140 |
| 1114 | Ga0495666_0052870 | 3300046526 | Bacteria | 1950 |
| 1115 | Ga0495666_0077042 | 3300046526 | Bacteria | 1580 |
| 1116 | Ga0495666_0092897 | 3300046526 | Bacteria | 1423 |
| 1117 | Ga0495642_0020825 | 3300046528 | Bacteria | 2578 |
| 1118 | Ga0495642_0032613 | 3300046528 | Bacteria | 2090 |
| 1119 | Ga0495642_0033883 | 3300046528 | Bacteria | 2054 |
| 1120 | Ga0495642_0035371 | 3300046528 | Bacteria | 2015 |
| 1121 | Ga0495642_0043162 | 3300046528 | Bacteria | 1838 |
| 1122 | Ga0495642_0060192 | 3300046528 | Bacteria | 1574 |
| 1123 | Ga0495652_0048344 | 3300046529 | Bacteria | 3645 |
| 1124 | Ga0495652_0049250 | 3300046529 | Bacteria | 3607 |
| 1125 | Ga0495652_0054943 | 3300046529 | Bacteria | 3388 |
| 1126 | Ga0495652_0062851 | 3300046529 | Bacteria | 3128 |
| 1127 | Ga0495652_0079071 | 3300046529 | Bacteria | 2720 |
| 1128 | Ga0495652_0080947 | 3300046529 | Bacteria | 2680 |
| 1129 | Ga0495652_0089016 | 3300046529 | Bacteria | 2528 |
| 1130 | Ga0495652_0094216 | 3300046529 | Bacteria | 2442 |
| 1131 | Ga0495652_0177482 | 3300046529 | Bacteria | 1638 |
| 1132 | Ga0495654_0014800 | 3300046530 | Bacteria | 4148 |
| 1133 | Ga0495654_0019427 | 3300046530 | Bacteria | 3553 |
| 1134 | Ga0495654_0020068 | 3300046530 | Bacteria | 3488 |
| 1135 | Ga0495654_0063469 | 3300046530 | Bacteria | 1768 |
| 1136 | Ga0495654_0076339 | 3300046530 | Bacteria | 1579 |
| 1137 | Ga0495665_0003029 | 3300046531 | Bacteria | 9077 |
| 1138 | Ga0495665_0027501 | 3300046531 | Bacteria | 3052 |
| 1139 | Ga0495665_0052306 | 3300046531 | Bacteria | 2162 |
| 1140 | Ga0495665_0054511 | 3300046531 | Bacteria | 2112 |
| 1141 | Ga0495665_0056543 | 3300046531 | Bacteria | 2071 |
| 1142 | Ga0495665_0057527 | 3300046531 | Bacteria | 2052 |
| 1143 | Ga0495665_0058208 | 3300046531 | Bacteria | 2040 |
| 1144 | Ga0495665_0059320 | 3300046531 | Bacteria | 2019 |
| 1145 | Ga0495665_0064412 | 3300046531 | Bacteria | 1934 |
| 1146 | Ga0495665_0085517 | 3300046531 | Bacteria | 1657 |
| 1147 | Ga0495665_0092561 | 3300046531 | Bacteria | 1588 |
| 1148 | Ga0495640_0024783 | 3300046533 | Bacteria | 4359 |
| 1149 | Ga0495640_0028141 | 3300046533 | Bacteria | 4048 |
| 1150 | Ga0495640_0072256 | 3300046533 | Bacteria | 2312 |
| 1151 | Ga0495640_0073346 | 3300046533 | Bacteria | 2291 |
| 1152 | Ga0495640_0077616 | 3300046533 | Bacteria | 2213 |
| 1153 | Ga0495640_0078047 | 3300046533 | Bacteria | 2206 |
| 1154 | Ga0495640_0089823 | 3300046533 | Bacteria | 2028 |
| 1155 | Ga0495640_0135955 | 3300046533 | Bacteria | 1587 |
| 1156 | Ga0495640_0140880 | 3300046533 | Bacteria | 1554 |
| 1157 | Ga0495586_0020384 | 3300046535 | Bacteria | 3531 |
| 1158 | Ga0495586_0027514 | 3300046535 | Bacteria | 3042 |
| 1159 | Ga0495586_0038083 | 3300046535 | Bacteria | 2581 |
| 1160 | Ga0495586_0043125 | 3300046535 | Bacteria | 2430 |
| 1161 | Ga0495586_0052389 | 3300046535 | Bacteria | 2209 |
| 1162 | Ga0495586_0067346 | 3300046535 | Bacteria | 1952 |
| 1163 | Ga0495586_0088717 | 3300046535 | Bacteria | 1706 |
| 1164 | Ga0495587_0011536 | 3300046536 | Bacteria | 5594 |
| 1165 | Ga0495587_0020418 | 3300046536 | Bacteria | 4090 |
| 1166 | Ga0495587_0035885 | 3300046536 | Bacteria | 2985 |
| 1167 | Ga0495587_0041088 | 3300046536 | Bacteria | 2760 |
| 1168 | Ga0495587_0052910 | 3300046536 | Bacteria | 2394 |
| 1169 | Ga0495587_0054912 | 3300046536 | Bacteria | 2346 |
| 1170 | Ga0495587_0058230 | 3300046536 | Bacteria | 2270 |
| 1171 | Ga0495587_0071458 | 3300046536 | Bacteria | 2018 |
| 1172 | Ga0495587_0071907 | 3300046536 | Bacteria | 2011 |
| 1173 | Ga0495587_0077330 | 3300046536 | Bacteria | 1932 |
| 1174 | Ga0495587_0078300 | 3300046536 | Bacteria | 1918 |
| 1175 | Ga0495587_0090596 | 3300046536 | Bacteria | 1766 |
| 1176 | Ga0495587_0107585 | 3300046536 | Bacteria | 1603 |
| 1177 | Ga0495598_0008844 | 3300046537 | Bacteria | 2357 |
| 1178 | Ga0495598_0017112 | 3300046537 | Bacteria | 1863 |
| 1179 | Ga0495598_0019449 | 3300046537 | Bacteria | 1781 |
| 1180 | Ga0495609_0030368 | 3300046538 | Bacteria | 2459 |
| 1181 | Ga0495609_0038789 | 3300046538 | Bacteria | 2146 |
| 1182 | Ga0495609_0043373 | 3300046538 | Bacteria | 2019 |
| 1183 | Ga0495609_0044208 | 3300046538 | Bacteria | 1998 |
| 1184 | Ga0495609_0045169 | 3300046538 | Bacteria | 1974 |
| 1185 | Ga0495621_0007581 | 3300046539 | Bacteria | 3221 |
| 1186 | Ga0495621_0020080 | 3300046539 | Bacteria | 2188 |
| 1187 | Ga0495621_0020565 | 3300046539 | Bacteria | 2167 |
| 1188 | Ga0495621_0023642 | 3300046539 | Bacteria | 2045 |
| 1189 | Ga0495621_0024274 | 3300046539 | Bacteria | 2024 |
| 1190 | Ga0495621_0034668 | 3300046539 | Bacteria | 1744 |
| 1191 | Ga0495621_0038333 | 3300046539 | Bacteria | 1671 |
| 1192 | Ga0495621_0038904 | 3300046539 | Bacteria | 1661 |
| 1193 | Ga0495621_0047343 | 3300046539 | Bacteria | 1528 |
| 1194 | Ga0495597_0039555 | 3300046542 | Bacteria | 2111 |
| 1195 | Ga0495597_0040728 | 3300046542 | Bacteria | 2076 |
| 1196 | Ga0495597_0040785 | 3300046542 | Bacteria | 2074 |
| 1197 | Ga0495645_0006552 | 3300046543 | Bacteria | 8087 |
| 1198 | Ga0495645_0043096 | 3300046543 | Bacteria | 3291 |
| 1199 | Ga0495645_0060671 | 3300046543 | Bacteria | 2741 |
| 1200 | Ga0495645_0076582 | 3300046543 | Bacteria | 2407 |
| 1201 | Ga0495645_0077563 | 3300046543 | Bacteria | 2388 |
| 1202 | Ga0495645_0099966 | 3300046543 | Bacteria | 2063 |
| 1203 | Ga0495645_0102976 | 3300046543 | Bacteria | 2028 |
| 1204 | Ga0495645_0185116 | 3300046543 | Bacteria | 1423 |
| 1205 | Ga0495645_0201764 | 3300046543 | Bacteria | 1348 |
| 1206 | Ga0495622_0013934 | 3300046557 | Bacteria | 3731 |
| 1207 | Ga0495622_0042867 | 3300046557 | Bacteria | 2103 |
| 1208 | Ga0495622_0048450 | 3300046557 | Bacteria | 1974 |
| 1209 | Ga0495622_0067333 | 3300046557 | Bacteria | 1654 |
| 1210 | Ga0495622_0073962 | 3300046557 | Bacteria | 1571 |
| 1211 | Ga0495633_0037709 | 3300046558 | Bacteria | 2311 |
| 1212 | Ga0495633_0037713 | 3300046558 | Bacteria | 2311 |
| 1213 | Ga0495633_0038281 | 3300046558 | Bacteria | 2291 |
| 1214 | Ga0495633_0043974 | 3300046558 | Bacteria | 2117 |
| 1215 | Ga0495633_0049606 | 3300046558 | Bacteria | 1980 |
| 1216 | Ga0495633_0050373 | 3300046558 | Bacteria | 1963 |
| 1217 | Ga0495633_0052718 | 3300046558 | Bacteria | 1915 |
| 1218 | Ga0495633_0071103 | 3300046558 | Bacteria | 1623 |
| 1219 | Ga0495633_0081410 | 3300046558 | Bacteria | 1506 |
| 1220 | Ga0495667_0056626 | 3300046559 | Bacteria | 2577 |
| 1221 | Ga0495667_0056661 | 3300046559 | Bacteria | 2576 |
| 1222 | Ga0495667_0066155 | 3300046559 | Bacteria | 2363 |
| 1223 | Ga0495667_0066894 | 3300046559 | Bacteria | 2348 |
| 1224 | Ga0495667_0079781 | 3300046559 | Bacteria | 2127 |
| 1225 | Ga0495667_0081374 | 3300046559 | Bacteria | 2105 |
| 1226 | Ga0495667_0083563 | 3300046559 | Bacteria | 2073 |
| 1227 | Ga0495667_0083780 | 3300046559 | Bacteria | 2070 |
| 1228 | Ga0495667_0094245 | 3300046559 | Bacteria | 1938 |
| 1229 | Ga0495667_0100051 | 3300046559 | Bacteria | 1876 |
| 1230 | Ga0495667_0182454 | 3300046559 | Bacteria | 1346 |
| 1231 | Ga0495656_0019432 | 3300046615 | Bacteria | 2622 |
| 1232 | Ga0495656_0024257 | 3300046615 | Bacteria | 2393 |
| 1233 | Ga0495656_0033132 | 3300046615 | Bacteria | 2106 |
| 1234 | Ga0495656_0033950 | 3300046615 | Bacteria | 2085 |
| 1235 | Ga0495656_0035583 | 3300046615 | Bacteria | 2046 |
| 1236 | Ga0495656_0037253 | 3300046615 | Bacteria | 2007 |
| 1237 | Ga0495656_0046150 | 3300046615 | Bacteria | 1842 |
| 1238 | Ga0495668_0045799 | 3300046616 | Bacteria | 2431 |
| 1239 | Ga0495668_0045859 | 3300046616 | Bacteria | 2429 |
| 1240 | Ga0495668_0056678 | 3300046616 | Bacteria | 2162 |
| 1241 | Ga0495668_0071304 | 3300046616 | Bacteria | 1909 |
| 1242 | Ga0495634_0020538 | 3300046642 | Bacteria | 4682 |
| 1243 | Ga0495634_0049509 | 3300046642 | Bacteria | 2825 |
| 1244 | Ga0495634_0072191 | 3300046642 | Bacteria | 2270 |
| 1245 | Ga0495634_0072813 | 3300046642 | Bacteria | 2260 |
| 1246 | Ga0495634_0080011 | 3300046642 | Bacteria | 2139 |
| 1247 | Ga0495634_0086066 | 3300046642 | Bacteria | 2047 |
| 1248 | Ga0495634_0087992 | 3300046642 | Bacteria | 2020 |
| 1249 | Ga0495634_0090058 | 3300046642 | Bacteria | 1993 |
| 1250 | Ga0495634_0102889 | 3300046642 | Bacteria | 1844 |
| 1251 | Ga0495634_0109724 | 3300046642 | Bacteria | 1775 |
| 1252 | Ga0495634_0140364 | 3300046642 | Bacteria | 1534 |
| 1253 | Ga0495611_0026294 | 3300046648 | Bacteria | 2538 |
| 1254 | Ga0495611_0027575 | 3300046648 | Bacteria | 2483 |
| 1255 | Ga0495611_0040329 | 3300046648 | Bacteria | 2081 |
| 1256 | Ga0495611_0044614 | 3300046648 | Bacteria | 1983 |
| 1257 | Ga0495625_0081765 | 3300046660 | Bacteria | 2247 |
| 1258 | Ga0495625_0124665 | 3300046660 | Bacteria | 1749 |
| 1259 | Ga0495625_0144949 | 3300046660 | Bacteria | 1599 |
| 1260 | Ga0495635_0002979 | 3300046663 | Bacteria | 11620 |
| 1261 | Ga0495635_0027913 | 3300046663 | Bacteria | 3925 |
| 1262 | Ga0495635_0035500 | 3300046663 | Bacteria | 3456 |
| 1263 | Ga0495635_0059712 | 3300046663 | Bacteria | 2622 |
| 1264 | Ga0495635_0085309 | 3300046663 | Bacteria | 2160 |
| 1265 | Ga0495635_0089635 | 3300046663 | Bacteria | 2104 |
| 1266 | Ga0495635_0094472 | 3300046663 | Bacteria | 2044 |
| 1267 | Ga0495635_0094808 | 3300046663 | Bacteria | 2040 |
| 1268 | Ga0495635_0107936 | 3300046663 | Bacteria | 1901 |
| 1269 | Ga0495635_0240344 | 3300046663 | Bacteria | 1222 |
| 1270 | Ga0495659_0006430 | 3300046664 | Bacteria | 3707 |
| 1271 | Ga0495659_0015791 | 3300046664 | Bacteria | 2485 |
| 1272 | Ga0495659_0023853 | 3300046664 | Bacteria | 2081 |
| 1273 | Ga0495659_0024405 | 3300046664 | Bacteria | 2062 |
| 1274 | Ga0495659_0027133 | 3300046664 | Bacteria | 1973 |
| 1275 | Ga0495661_0054055 | 3300046665 | Bacteria | 2412 |
| 1276 | Ga0495661_0064668 | 3300046665 | Bacteria | 2157 |
| 1277 | Ga0495661_0067868 | 3300046665 | Bacteria | 2093 |
| 1278 | Ga0495661_0070877 | 3300046665 | Bacteria | 2038 |
| 1279 | Ga0495661_0088218 | 3300046665 | Bacteria | 1771 |
| 1280 | Ga0495588_0028149 | 3300046674 | Bacteria | 2811 |
| 1281 | Ga0495588_0048702 | 3300046674 | Bacteria | 2177 |
| 1282 | Ga0495588_0053996 | 3300046674 | Bacteria | 2072 |
| 1283 | Ga0495588_0057846 | 3300046674 | Bacteria | 2003 |
| 1284 | Ga0495588_0075131 | 3300046674 | Bacteria | 1760 |
| 1285 | Ga0495588_0095669 | 3300046674 | Bacteria | 1557 |
| 1286 | Ga0495657_0023797 | 3300046675 | Bacteria | 4372 |
| 1287 | Ga0495657_0041514 | 3300046675 | Bacteria | 3146 |
| 1288 | Ga0495657_0041696 | 3300046675 | Bacteria | 3139 |
| 1289 | Ga0495657_0063083 | 3300046675 | Bacteria | 2445 |
| 1290 | Ga0495657_0069497 | 3300046675 | Bacteria | 2304 |
| 1291 | Ga0495657_0079730 | 3300046675 | Bacteria | 2120 |
| 1292 | Ga0495657_0088575 | 3300046675 | Bacteria | 1989 |
| 1293 | Ga0495657_0093043 | 3300046675 | Bacteria | 1930 |
| 1294 | Ga0495657_0099063 | 3300046675 | Bacteria | 1859 |
| 1295 | Ga0495657_0122957 | 3300046675 | Bacteria | 1633 |
| 1296 | Ga0495657_0138232 | 3300046675 | Bacteria | 1520 |
| 1297 | Ga0495657_0138522 | 3300046675 | Bacteria | 1518 |
| 1298 | Ga0495599_0019366 | 3300046678 | Bacteria | 4242 |
| 1299 | Ga0495599_0040766 | 3300046678 | Bacteria | 2915 |
| 1300 | Ga0495599_0041173 | 3300046678 | Bacteria | 2901 |
| 1301 | Ga0495599_0059385 | 3300046678 | Bacteria | 2392 |
| 1302 | Ga0495599_0060938 | 3300046678 | Bacteria | 2358 |
| 1303 | Ga0495599_0071195 | 3300046678 | Bacteria | 2170 |
| 1304 | Ga0495599_0073672 | 3300046678 | Bacteria | 2131 |
| 1305 | Ga0495599_0078119 | 3300046678 | Bacteria | 2066 |
| 1306 | Ga0495599_0078633 | 3300046678 | Bacteria | 2059 |
| 1307 | Ga0495599_0079350 | 3300046678 | Bacteria | 2049 |
| 1308 | Ga0495599_0134255 | 3300046678 | Bacteria | 1536 |
| 1309 | Ga0495623_0031253 | 3300046679 | Bacteria | 3423 |
| 1310 | Ga0495623_0042678 | 3300046679 | Bacteria | 2888 |
| 1311 | Ga0495623_0045734 | 3300046679 | Bacteria | 2780 |
| 1312 | Ga0495623_0067241 | 3300046679 | Bacteria | 2237 |
| 1313 | Ga0495623_0069670 | 3300046679 | Bacteria | 2191 |
| 1314 | Ga0495623_0071450 | 3300046679 | Bacteria | 2159 |
| 1315 | Ga0495623_0073924 | 3300046679 | Bacteria | 2118 |
| 1316 | Ga0495623_0073982 | 3300046679 | Bacteria | 2117 |
| 1317 | Ga0495623_0118561 | 3300046679 | Bacteria | 1596 |
| 1318 | Ga0495646_0010082 | 3300046680 | Bacteria | 6008 |
| 1319 | Ga0495646_0026121 | 3300046680 | Bacteria | 3668 |
| 1320 | Ga0495646_0035044 | 3300046680 | Bacteria | 3114 |
| 1321 | Ga0495646_0050763 | 3300046680 | Bacteria | 2512 |
| 1322 | Ga0495646_0052661 | 3300046680 | Bacteria | 2457 |
| 1323 | Ga0495646_0069763 | 3300046680 | Bacteria | 2072 |
| 1324 | Ga0495646_0070946 | 3300046680 | Bacteria | 2050 |
| 1325 | Ga0495646_0120882 | 3300046680 | Bacteria | 1482 |
| 1326 | Ga0495647_0008647 | 3300046681 | Bacteria | 3426 |
| 1327 | Ga0495647_0025989 | 3300046681 | Bacteria | 2142 |
| 1328 | Ga0495647_0028325 | 3300046681 | Bacteria | 2064 |
| 1329 | Ga0495647_0028396 | 3300046681 | Bacteria | 2062 |
| 1330 | Ga0495647_0031429 | 3300046681 | Bacteria | 1974 |
| 1331 | Ga0495647_0035710 | 3300046681 | Bacteria | 1867 |
| 1332 | Ga0495647_0042211 | 3300046681 | Bacteria | 1740 |
| 1333 | Ga0495658_0032854 | 3300046683 | Bacteria | 2836 |
| 1334 | Ga0495658_0046233 | 3300046683 | Bacteria | 2446 |
| 1335 | Ga0495658_0048064 | 3300046683 | Bacteria | 2404 |
| 1336 | Ga0495658_0055193 | 3300046683 | Bacteria | 2262 |
| 1337 | Ga0495658_0055508 | 3300046683 | Bacteria | 2256 |
| 1338 | Ga0495658_0076021 | 3300046683 | Bacteria | 1961 |
| 1339 | Ga0495658_0077784 | 3300046683 | Bacteria | 1940 |
| 1340 | Ga0495658_0097561 | 3300046683 | Bacteria | 1749 |
| 1341 | Ga0495658_0144772 | 3300046683 | Bacteria | 1455 |
| 1342 | Ga0495669_0008081 | 3300046684 | Bacteria | 4415 |
| 1343 | Ga0495669_0016951 | 3300046684 | Bacteria | 3124 |
| 1344 | Ga0495669_0039704 | 3300046684 | Bacteria | 2084 |
| 1345 | Ga0495669_0041491 | 3300046684 | Bacteria | 2043 |
| 1346 | Ga0495669_0042757 | 3300046684 | Bacteria | 2015 |
| 1347 | Ga0495669_0043272 | 3300046684 | Bacteria | 2004 |
| 1348 | Ga0495669_0043740 | 3300046684 | Bacteria | 1994 |
| 1349 | Ga0495669_0045601 | 3300046684 | Bacteria | 1955 |
| 1350 | Ga0495613_0027564 | 3300046689 | Bacteria | 4228 |
| 1351 | Ga0495613_0054710 | 3300046689 | Bacteria | 2933 |
| 1352 | Ga0495613_0054744 | 3300046689 | Bacteria | 2932 |
| 1353 | Ga0495613_0087754 | 3300046689 | Bacteria | 2254 |
| 1354 | Ga0495613_0093289 | 3300046689 | Bacteria | 2179 |
| 1355 | Ga0495613_0101882 | 3300046689 | Bacteria | 2073 |
| 1356 | Ga0495613_0102320 | 3300046689 | Bacteria | 2068 |
| 1357 | Ga0495613_0107574 | 3300046689 | Bacteria | 2011 |
| 1358 | Ga0495613_0109965 | 3300046689 | Bacteria | 1986 |
| 1359 | Ga0495613_0114537 | 3300046689 | Bacteria | 1940 |
| 1360 | Ga0495613_0120899 | 3300046689 | Bacteria | 1880 |
| 1361 | Ga0495624_0007398 | 3300046690 | Bacteria | 7707 |
| 1362 | Ga0495624_0053248 | 3300046690 | Bacteria | 2555 |
| 1363 | Ga0495624_0067784 | 3300046690 | Bacteria | 2225 |
| 1364 | Ga0495624_0074050 | 3300046690 | Bacteria | 2116 |
| 1365 | Ga0495624_0074973 | 3300046690 | Bacteria | 2101 |
| 1366 | Ga0495624_0076382 | 3300046690 | Bacteria | 2078 |
| 1367 | Ga0495624_0080252 | 3300046690 | Bacteria | 2021 |
| 1368 | Ga0495624_0081275 | 3300046690 | Bacteria | 2007 |
| 1369 | Ga0495624_0086146 | 3300046690 | Bacteria | 1940 |
| 1370 | Ga0495624_0089820 | 3300046690 | Bacteria | 1895 |
| 1371 | Ga0495624_0137289 | 3300046690 | Bacteria | 1498 |
| 1372 | Ga0495670_0047099 | 3300046691 | Bacteria | 2154 |
| 1373 | Ga0495670_0051352 | 3300046691 | Bacteria | 2063 |
| 1374 | Ga0495670_0053877 | 3300046691 | Bacteria | 2014 |
| 1375 | Ga0495670_0058467 | 3300046691 | Bacteria | 1935 |
| 1376 | Ga0495670_0058627 | 3300046691 | Bacteria | 1932 |
| 1377 | Ga0495671_0023097 | 3300046692 | Bacteria | 3251 |
| 1378 | Ga0495671_0034217 | 3300046692 | Bacteria | 2584 |
| 1379 | Ga0495671_0046966 | 3300046692 | Bacteria | 2158 |
| 1380 | Ga0495671_0052703 | 3300046692 | Bacteria | 2021 |
| 1381 | Ga0495671_0054883 | 3300046692 | Bacteria | 1974 |
| 1382 | Ga0495671_0057348 | 3300046692 | Bacteria | 1927 |
| 1383 | Ga0495671_0059373 | 3300046692 | Bacteria | 1890 |
| 1384 | Ga0495671_0079382 | 3300046692 | Bacteria | 1608 |
| 1385 | Ga0495649_0009131 | 3300046694 | Bacteria | 5911 |
| 1386 | Ga0495649_0043306 | 3300046694 | Bacteria | 2457 |
| 1387 | Ga0495649_0059104 | 3300046694 | Bacteria | 2064 |
| 1388 | Ga0495649_0072737 | 3300046694 | Bacteria | 1842 |
| 1389 | Ga0495649_0075377 | 3300046694 | Bacteria | 1806 |
| 1390 | Ga0495589_0038649 | 3300046794 | Bacteria | 2387 |
| 1391 | Ga0495589_0049000 | 3300046794 | Bacteria | 2090 |
| 1392 | Ga0495589_0053758 | 3300046794 | Bacteria | 1986 |
| 1393 | Ga0495589_0054364 | 3300046794 | Bacteria | 1974 |
| 1394 | Ga0495589_0054523 | 3300046794 | Bacteria | 1971 |
| 1395 | Ga0495589_0057791 | 3300046794 | Bacteria | 1907 |
| 1396 | Ga0495589_0073731 | 3300046794 | Bacteria | 1665 |
| 1397 | Ga0495600_0034021 | 3300046809 | Bacteria | 3309 |
| 1398 | Ga0495600_0077153 | 3300046809 | Bacteria | 2175 |
| 1399 | Ga0495600_0084620 | 3300046809 | Bacteria | 2069 |
| 1400 | Ga0495600_0085222 | 3300046809 | Bacteria | 2061 |
| 1401 | Ga0495600_0087976 | 3300046809 | Bacteria | 2026 |
| 1402 | Ga0495600_0089214 | 3300046809 | Bacteria | 2011 |
| 1403 | Ga0495600_0094170 | 3300046809 | Bacteria | 1953 |
| 1404 | Ga0495600_0103283 | 3300046809 | Bacteria | 1857 |
| 1405 | Ga0495600_0126453 | 3300046809 | Bacteria | 1662 |
| 1406 | Ga0495600_0148531 | 3300046809 | Bacteria | 1518 |
| 1407 | Ga0495660_0033908 | 3300046810 | Bacteria | 2859 |
| 1408 | Ga0495660_0052081 | 3300046810 | Bacteria | 2225 |
| 1409 | Ga0495660_0064625 | 3300046810 | Bacteria | 1955 |
| 1410 | Ga0495660_0081745 | 3300046810 | Bacteria | 1693 |
| 1411 | Ga0495581_0016597 | 3300047315 | Bacteria | 4279 |
| 1412 | Ga0495581_0021001 | 3300047315 | Bacteria | 3787 |
| 1413 | Ga0495581_0048598 | 3300047315 | Bacteria | 2449 |
| 1414 | Ga0495581_0060942 | 3300047315 | Bacteria | 2180 |
| 1415 | Ga0495581_0062156 | 3300047315 | Bacteria | 2157 |
| 1416 | Ga0495581_0062262 | 3300047315 | Bacteria | 2155 |
| 1417 | Ga0495581_0067589 | 3300047315 | Bacteria | 2066 |
| 1418 | Ga0495581_0125343 | 3300047315 | Bacteria | 1495 |
| 1419 | Ga0495604_0049482 | 3300047317 | Bacteria | 3265 |
| 1420 | Ga0495604_0058038 | 3300047317 | Bacteria | 2973 |
| 1421 | Ga0495604_0071204 | 3300047317 | Bacteria | 2630 |
| 1422 | Ga0495604_0082997 | 3300047317 | Bacteria | 2395 |
| 1423 | Ga0495604_0105918 | 3300047317 | Bacteria | 2057 |
| 1424 | Ga0495604_0106005 | 3300047317 | Bacteria | 2056 |
| 1425 | Ga0495604_0106802 | 3300047317 | Bacteria | 2047 |
| 1426 | Ga0495604_0108362 | 3300047317 | Bacteria | 2029 |
| 1427 | Ga0495604_0109646 | 3300047317 | Bacteria | 2014 |
| 1428 | Ga0495604_0172127 | 3300047317 | Bacteria | 1521 |
| 1429 | Ga0495636_0026435 | 3300047318 | Bacteria | 2361 |
| 1430 | Ga0495636_0028033 | 3300047318 | Bacteria | 2294 |
| 1431 | Ga0495636_0055681 | 3300047318 | Bacteria | 1663 |
| 1432 | Ga0495674_0005170 | 3300047319 | Bacteria | 12532 |
| 1433 | Ga0495674_0046151 | 3300047319 | Bacteria | 3867 |
| 1434 | Ga0495674_0047017 | 3300047319 | Bacteria | 3828 |
| 1435 | Ga0495674_0056352 | 3300047319 | Bacteria | 3442 |
| 1436 | Ga0495674_0088888 | 3300047319 | Bacteria | 2641 |
| 1437 | Ga0495674_0100796 | 3300047319 | Bacteria | 2457 |
| 1438 | Ga0495674_0105279 | 3300047319 | Bacteria | 2397 |
| 1439 | Ga0495674_0126068 | 3300047319 | Bacteria | 2160 |
| 1440 | Ga0495674_0154825 | 3300047319 | Bacteria | 1920 |
| 1441 | Ga0495674_0162572 | 3300047319 | Bacteria | 1867 |
| 1442 | Ga0495674_0175923 | 3300047319 | Bacteria | 1783 |
| 1443 | Ga0495674_0188826 | 3300047319 | Bacteria | 1713 |
| 1444 | Ga0495674_0240333 | 3300047319 | Bacteria | 1492 |
| 1445 | Ga0495674_0251156 | 3300047319 | Bacteria | 1455 |
| 1446 | Ga0495672_0037745 | 3300047320 | Bacteria | 2953 |
| 1447 | Ga0495672_0093999 | 3300047320 | Bacteria | 1640 |
| 1448 | Ga0495676_0053403 | 3300047321 | Bacteria | 3220 |
| 1449 | Ga0495676_0062588 | 3300047321 | Bacteria | 2904 |
| 1450 | Ga0495676_0082137 | 3300047321 | Bacteria | 2439 |
| 1451 | Ga0495676_0086275 | 3300047321 | Bacteria | 2362 |
| 1452 | Ga0495676_0089962 | 3300047321 | Bacteria | 2298 |
| 1453 | Ga0495676_0090875 | 3300047321 | Bacteria | 2283 |
| 1454 | Ga0495676_0127198 | 3300047321 | Bacteria | 1845 |
| 1455 | Ga0495676_0138754 | 3300047321 | Bacteria | 1744 |
| 1456 | Ga0495676_0139572 | 3300047321 | Bacteria | 1738 |
| 1457 | Ga0495680_0004184 | 3300047322 | Bacteria | 13861 |
| 1458 | Ga0495680_0047477 | 3300047322 | Bacteria | 3377 |
| 1459 | Ga0495680_0066829 | 3300047322 | Bacteria | 2750 |
| 1460 | Ga0495680_0095413 | 3300047322 | Bacteria | 2223 |
| 1461 | Ga0495680_0102361 | 3300047322 | Bacteria | 2132 |
| 1462 | Ga0495680_0103209 | 3300047322 | Bacteria | 2122 |
| 1463 | Ga0495680_0109829 | 3300047322 | Bacteria | 2044 |
| 1464 | Ga0495683_0018610 | 3300047323 | Bacteria | 3588 |
| 1465 | Ga0495683_0021599 | 3300047323 | Bacteria | 3316 |
| 1466 | Ga0495683_0032950 | 3300047323 | Bacteria | 2638 |
| 1467 | Ga0495683_0040651 | 3300047323 | Bacteria | 2349 |
| 1468 | Ga0495683_0055276 | 3300047323 | Bacteria | 1976 |
| 1469 | Ga0495683_0055517 | 3300047323 | Bacteria | 1971 |
| 1470 | Ga0495687_014824 | 3300047443 | Bacteria | 3988 |
| 1471 | Ga0495675_0026516 | 3300047444 | Bacteria | 3695 |
| 1472 | Ga0495675_0029225 | 3300047444 | Bacteria | 3515 |
| 1473 | Ga0495675_0048693 | 3300047444 | Bacteria | 2695 |
| 1474 | Ga0495675_0070619 | 3300047444 | Bacteria | 2204 |
| 1475 | Ga0495675_0078317 | 3300047444 | Bacteria | 2081 |
| 1476 | Ga0495675_0082631 | 3300047444 | Bacteria | 2022 |
| 1477 | Ga0495675_0083874 | 3300047444 | Bacteria | 2005 |
| 1478 | Ga0495677_0021279 | 3300047445 | Bacteria | 2350 |
| 1479 | Ga0495677_0027133 | 3300047445 | Bacteria | 2077 |
| 1480 | Ga0495677_0029995 | 3300047445 | Bacteria | 1978 |
| 1481 | Ga0495677_0031250 | 3300047445 | Bacteria | 1938 |
| 1482 | Ga0495677_0044238 | 3300047445 | Bacteria | 1632 |
| 1483 | Ga0495679_015342 | 3300047446 | Bacteria | 2804 |
| 1484 | Ga0495679_019576 | 3300047446 | Bacteria | 2374 |
| 1485 | Ga0495679_022585 | 3300047446 | Bacteria | 2150 |
| 1486 | Ga0495685_016625 | 3300047447 | Bacteria | 2514 |
| 1487 | Ga0495685_027332 | 3300047447 | Bacteria | 1962 |
| 1488 | Ga0495685_027828 | 3300047447 | Bacteria | 1944 |
| 1489 | Ga0495673_0028659 | 3300047469 | Bacteria | 2635 |
| 1490 | Ga0495673_0041736 | 3300047469 | Bacteria | 2063 |
| 1491 | Ga0495673_0045736 | 3300047469 | Bacteria | 1943 |
| 1492 | Ga0495681_0036277 | 3300047470 | Bacteria | 2439 |
| 1493 | Ga0495681_0053784 | 3300047470 | Bacteria | 1883 |
| 1494 | Ga0495681_0061792 | 3300047470 | Bacteria | 1724 |
| 1495 | Ga0495684_0034067 | 3300047471 | Bacteria | 3907 |
| 1496 | Ga0495684_0089247 | 3300047471 | Bacteria | 2336 |
| 1497 | Ga0495684_0096866 | 3300047471 | Bacteria | 2232 |
| 1498 | Ga0495684_0098660 | 3300047471 | Bacteria | 2208 |
| 1499 | Ga0495684_0099181 | 3300047471 | Bacteria | 2202 |
| 1500 | Ga0495684_0100644 | 3300047471 | Bacteria | 2185 |
| 1501 | Ga0495684_0101819 | 3300047471 | Bacteria | 2171 |
| 1502 | Ga0495684_0111466 | 3300047471 | Bacteria | 2064 |
| 1503 | Ga0495684_0112114 | 3300047471 | Bacteria | 2057 |
| 1504 | Ga0495684_0116989 | 3300047471 | Bacteria | 2009 |
| 1505 | Ga0495684_0177899 | 3300047471 | Bacteria | 1578 |
| 1506 | Ga0495684_0232871 | 3300047471 | Bacteria | 1346 |
| 1507 | Ga0495686_0073301 | 3300047472 | Bacteria | 2103 |
| 1508 | Ga0495593_0015021 | 3300047673 | Bacteria | 4397 |
| 1509 | Ga0495593_0032514 | 3300047673 | Bacteria | 2843 |
| 1510 | Ga0495593_0035357 | 3300047673 | Bacteria | 2713 |
| 1511 | Ga0495593_0037000 | 3300047673 | Bacteria | 2643 |
| 1512 | Ga0495593_0058103 | 3300047673 | Bacteria | 2030 |
| 1513 | Ga0495593_0059259 | 3300047673 | Bacteria | 2006 |
| 1514 | Ga0495593_0059320 | 3300047673 | Bacteria | 2005 |
| 1515 | Ga0495593_0062483 | 3300047673 | Bacteria | 1946 |
| 1516 | Ga0495593_0071394 | 3300047673 | Bacteria | 1803 |
| 1517 | Ga0495602_0035035 | 3300048088 | Bacteria | 4685 |
| 1518 | Ga0495602_0049663 | 3300048088 | Bacteria | 3755 |
| 1519 | Ga0495602_0080881 | 3300048088 | Bacteria | 2734 |
| 1520 | Ga0495602_0106288 | 3300048088 | Bacteria | 2291 |
| 1521 | Ga0495602_0109229 | 3300048088 | Bacteria | 2250 |
| 1522 | Ga0495602_0119989 | 3300048088 | Bacteria | 2117 |
| 1523 | Ga0495602_0125551 | 3300048088 | Bacteria | 2056 |
| 1524 | Ga0495602_0129255 | 3300048088 | Bacteria | 2017 |
| 1525 | Ga0495614_0017237 | 3300048089 | Bacteria | 3138 |
| 1526 | Ga0495614_0032792 | 3300048089 | Bacteria | 2234 |
| 1527 | Ga0495614_0033990 | 3300048089 | Bacteria | 2192 |
| 1528 | Ga0495614_0036862 | 3300048089 | Bacteria | 2098 |
| 1529 | Ga0495614_0043029 | 3300048089 | Bacteria | 1936 |
| 1530 | Ga0495614_0050148 | 3300048089 | Bacteria | 1789 |
| 1531 | Ga0495614_0060350 | 3300048089 | Bacteria | 1629 |
| 1532 | Ga0495615_0004037 | 3300048090 | Bacteria | 2522 |
| 1533 | Ga0495615_0007383 | 3300048090 | Bacteria | 2084 |
| 1534 | Ga0495626_0032603 | 3300048091 | Bacteria | 2501 |
| 1535 | Ga0495626_0034139 | 3300048091 | Bacteria | 2435 |
| 1536 | Ga0495626_0043559 | 3300048091 | Bacteria | 2104 |
| 1537 | Ga0495626_0050534 | 3300048091 | Bacteria | 1920 |
| 1538 | Ga0496100_0000672 | 3300048903 | Bacteria | 16276 |
| 1539 | Ga0496100_0045295 | 3300048903 | Bacteria | 2822 |
| 1540 | Ga0496100_0050208 | 3300048903 | Bacteria | 2701 |
| 1541 | Ga0496100_0062798 | 3300048903 | Bacteria | 2452 |
| 1542 | Ga0496100_0089641 | 3300048903 | Bacteria | 2095 |
| 1543 | Ga0496100_0090793 | 3300048903 | Bacteria | 2083 |
| 1544 | Ga0496100_0104957 | 3300048903 | Bacteria | 1953 |
| 1545 | Ga0496100_0108567 | 3300048903 | Bacteria | 1924 |
| 1546 | Ga0496100_0189760 | 3300048903 | Bacteria | 1491 |
| 1547 | Ga0496101_0004114 | 3300048904 | Bacteria | 9105 |
| 1548 | Ga0496101_0016725 | 3300048904 | Bacteria | 4963 |
| 1549 | Ga0496101_0051876 | 3300048904 | Bacteria | 2956 |
| 1550 | Ga0496101_0112529 | 3300048904 | Bacteria | 2050 |
| 1551 | Ga0496101_0114723 | 3300048904 | Bacteria | 2031 |
| 1552 | Ga0496101_0115866 | 3300048904 | Bacteria | 2021 |
| 1553 | Ga0496101_0141701 | 3300048904 | Bacteria | 1832 |
| 1554 | Ga0496101_0169078 | 3300048904 | Bacteria | 1679 |
| 1555 | Ga0496101_0248186 | 3300048904 | Bacteria | 1386 |
| 1556 | Ga0496102_0015290 | 3300048905 | Bacteria | 6682 |
| 1557 | Ga0496102_0055795 | 3300048905 | Bacteria | 3602 |
| 1558 | Ga0496102_0075273 | 3300048905 | Bacteria | 3103 |
| 1559 | Ga0496102_0145727 | 3300048905 | Bacteria | 2222 |
| 1560 | Ga0496102_0154835 | 3300048905 | Bacteria | 2154 |
| 1561 | Ga0496102_0168697 | 3300048905 | Bacteria | 2060 |
| 1562 | Ga0496102_0215990 | 3300048905 | Bacteria | 1807 |
| 1563 | Ga0496102_0219369 | 3300048905 | Bacteria | 1792 |
| 1564 | Ga0496102_0219398 | 3300048905 | Bacteria | 1792 |
| 1565 | Ga0496102_0284186 | 3300048905 | Bacteria | 1559 |
| 1566 | Ga0496103_0007026 | 3300048906 | Bacteria | 6719 |
| 1567 | Ga0496103_0058312 | 3300048906 | Bacteria | 2398 |
| 1568 | Ga0496103_0076928 | 3300048906 | Bacteria | 2094 |
| 1569 | Ga0496103_0077199 | 3300048906 | Bacteria | 2090 |
| 1570 | Ga0496103_0082231 | 3300048906 | Bacteria | 2026 |
| 1571 | Ga0496103_0082512 | 3300048906 | Bacteria | 2023 |
| 1572 | Ga0496103_0086282 | 3300048906 | Bacteria | 1978 |
| 1573 | Ga0496103_0086437 | 3300048906 | Bacteria | 1976 |
| 1574 | Ga0496104_0001705 | 3300048907 | Bacteria | 18970 |
| 1575 | Ga0496104_0019385 | 3300048907 | Bacteria | 6222 |
| 1576 | Ga0496104_0039985 | 3300048907 | Bacteria | 4393 |
| 1577 | Ga0496104_0040528 | 3300048907 | Bacteria | 4365 |
| 1578 | Ga0496104_0063093 | 3300048907 | Bacteria | 3514 |
| 1579 | Ga0496104_0117848 | 3300048907 | Bacteria | 2548 |
| 1580 | Ga0496104_0146435 | 3300048907 | Bacteria | 2268 |
| 1581 | Ga0496104_0153844 | 3300048907 | Bacteria | 2207 |
| 1582 | Ga0496104_0163919 | 3300048907 | Bacteria | 2131 |
| 1583 | Ga0496104_0228416 | 3300048907 | Bacteria | 1773 |
| 1584 | Ga0496105_0001112 | 3300048908 | Bacteria | 18704 |
| 1585 | Ga0496105_0009874 | 3300048908 | Bacteria | 7485 |
| 1586 | Ga0496105_0053167 | 3300048908 | Bacteria | 3344 |
| 1587 | Ga0496105_0124764 | 3300048908 | Bacteria | 2122 |
| 1588 | Ga0496105_0131478 | 3300048908 | Bacteria | 2063 |
| 1589 | Ga0496105_0152000 | 3300048908 | Bacteria | 1902 |
| 1590 | Ga0496106_0017946 | 3300048909 | Bacteria | 5233 |
| 1591 | Ga0496106_0040006 | 3300048909 | Bacteria | 3510 |
| 1592 | Ga0496106_0054310 | 3300048909 | Bacteria | 3026 |
| 1593 | Ga0496106_0110099 | 3300048909 | Bacteria | 2143 |
| 1594 | Ga0496106_0112788 | 3300048909 | Bacteria | 2118 |
| 1595 | Ga0496106_0116571 | 3300048909 | Bacteria | 2083 |
| 1596 | Ga0496106_0122434 | 3300048909 | Bacteria | 2034 |
| 1597 | Ga0496106_0141401 | 3300048909 | Bacteria | 1893 |
| 1598 | Ga0496107_0052726 | 3300048910 | Bacteria | 2933 |
| 1599 | Ga0496107_0060295 | 3300048910 | Bacteria | 2746 |
| 1600 | Ga0496107_0090811 | 3300048910 | Bacteria | 2231 |
| 1601 | Ga0496107_0093281 | 3300048910 | Bacteria | 2201 |
| 1602 | Ga0496107_0101544 | 3300048910 | Bacteria | 2109 |
| 1603 | Ga0496107_0105318 | 3300048910 | Bacteria | 2070 |
| 1604 | Ga0496107_0113571 | 3300048910 | Bacteria | 1992 |
| 1605 | Ga0496108_0073540 | 3300048911 | Bacteria | 2885 |
| 1606 | Ga0496108_0098873 | 3300048911 | Bacteria | 2486 |
| 1607 | Ga0496108_0132589 | 3300048911 | Bacteria | 2141 |
| 1608 | Ga0496108_0153287 | 3300048911 | Bacteria | 1989 |
| 1609 | Ga0496108_0186375 | 3300048911 | Bacteria | 1797 |
| 1610 | Ga0496109_0078418 | 3300048912 | Bacteria | 3041 |
| 1611 | Ga0496109_0162847 | 3300048912 | Bacteria | 2090 |
| 1612 | Ga0496109_0183184 | 3300048912 | Bacteria | 1967 |
| 1613 | Ga0496109_0185076 | 3300048912 | Bacteria | 1957 |
| 1614 | Ga0496109_0204293 | 3300048912 | Bacteria | 1857 |
| 1615 | Ga0496109_0266637 | 3300048912 | Bacteria | 1613 |
| 1616 | Ga0496110_0109441 | 3300048913 | Bacteria | 2481 |
| 1617 | Ga0496110_0113851 | 3300048913 | Bacteria | 2433 |
| 1618 | Ga0496110_0130306 | 3300048913 | Bacteria | 2270 |
| 1619 | Ga0496110_0151610 | 3300048913 | Bacteria | 2099 |
| 1620 | Ga0496110_0234769 | 3300048913 | Bacteria | 1668 |
| 1621 | Ga0496111_0034746 | 3300048914 | Bacteria | 3600 |
| 1622 | Ga0496111_0104413 | 3300048914 | Bacteria | 2084 |
| 1623 | Ga0496111_0106237 | 3300048914 | Bacteria | 2066 |
| 1624 | Ga0496111_0108966 | 3300048914 | Bacteria | 2039 |
| 1625 | Ga0496111_0175170 | 3300048914 | Bacteria | 1594 |
| 1626 | Ga0496112_0161202 | 3300048915 | Bacteria | 2209 |
| 1627 | Ga0496112_0190419 | 3300048915 | Bacteria | 2013 |
| 1628 | Ga0496112_0192106 | 3300048915 | Bacteria | 2003 |
| 1629 | Ga0496112_0244510 | 3300048915 | Bacteria | 1746 |
| 1630 | Ga0496113_0115226 | 3300048916 | Bacteria | 2096 |
| 1631 | Ga0496113_0125925 | 3300048916 | Bacteria | 2006 |
| 1632 | Ga0496114_0040626 | 3300048917 | Bacteria | 3851 |
| 1633 | Ga0496114_0067168 | 3300048917 | Bacteria | 3007 |
| 1634 | Ga0496114_0137843 | 3300048917 | Bacteria | 2110 |
| 1635 | Ga0496114_0139163 | 3300048917 | Bacteria | 2100 |
| 1636 | Ga0496114_0147849 | 3300048917 | Bacteria | 2037 |
| 1637 | Ga0496114_0170685 | 3300048917 | Bacteria | 1895 |
| 1638 | Ga0496114_0178141 | 3300048917 | Bacteria | 1855 |
| 1639 | Ga0496114_0182784 | 3300048917 | Bacteria | 1831 |
| 1640 | Ga0496114_0194513 | 3300048917 | Bacteria | 1775 |
| 1641 | Ga0496115_0039711 | 3300048918 | Bacteria | 3738 |
| 1642 | Ga0496115_0051785 | 3300048918 | Bacteria | 3291 |
| 1643 | Ga0496115_0060487 | 3300048918 | Bacteria | 3052 |
| 1644 | Ga0496115_0092717 | 3300048918 | Bacteria | 2469 |
| 1645 | Ga0496115_0106251 | 3300048918 | Bacteria | 2304 |
| 1646 | Ga0496115_0116289 | 3300048918 | Bacteria | 2199 |
| 1647 | Ga0496115_0141182 | 3300048918 | Bacteria | 1987 |
| 1648 | Ga0496115_0145860 | 3300048918 | Bacteria | 1953 |
| 1649 | Ga0496115_0202770 | 3300048918 | Bacteria | 1638 |
| 1650 | Ga0496115_0207041 | 3300048918 | Bacteria | 1620 |
| 1651 | Ga0496116_0023238 | 3300048919 | Bacteria | 4622 |
| 1652 | Ga0496117_0006792 | 3300048920 | Bacteria | 11409 |
| 1653 | Ga0496117_0039313 | 3300048920 | Bacteria | 3493 |
| 1654 | Ga0496117_0073620 | 3300048920 | Bacteria | 2278 |
| 1655 | Ga0496117_0083921 | 3300048920 | Bacteria | 2080 |
| 1656 | Ga0496117_0124415 | 3300048920 | Bacteria | 1577 |
| 1657 | Ga0496118_0055678 | 3300048921 | Bacteria | 2981 |
| 1658 | Ga0496118_0058201 | 3300048921 | Bacteria | 2890 |
| 1659 | Ga0496118_0099648 | 3300048921 | Bacteria | 1968 |
| 1660 | Ga0496118_0101503 | 3300048921 | Bacteria | 1942 |
| 1661 | Ga0496119_0008659 | 3300048922 | Bacteria | 8902 |
| 1662 | Ga0496119_0066048 | 3300048922 | Bacteria | 2139 |
| 1663 | Ga0496119_0072207 | 3300048922 | Bacteria | 2017 |
| 1664 | Ga0496119_0078005 | 3300048922 | Bacteria | 1917 |
| 1665 | Ga0496119_0079277 | 3300048922 | Bacteria | 1897 |
| 1666 | Ga0496120_0048391 | 3300048923 | Bacteria | 2447 |
| 1667 | Ga0496120_0052999 | 3300048923 | Bacteria | 2306 |
| 1668 | Ga0496120_0085661 | 3300048923 | Bacteria | 1695 |
| 1669 | Ga0496120_0095242 | 3300048923 | Bacteria | 1583 |
| 1670 | Ga0496121_0041096 | 3300048924 | Bacteria | 4047 |
| 1671 | Ga0496121_0078624 | 3300048924 | Bacteria | 2621 |
| 1672 | Ga0496121_0113113 | 3300048924 | Bacteria | 2066 |
| 1673 | Ga0496121_0133479 | 3300048924 | Bacteria | 1853 |
| 1674 | Ga0496122_0038660 | 3300048925 | Bacteria | 3817 |
| 1675 | Ga0496122_0126306 | 3300048925 | Bacteria | 1636 |
| 1676 | Ga0496123_0092929 | 3300048926 | Bacteria | 1783 |
| 1677 | Ga0496124_0119134 | 3300048927 | Bacteria | 2112 |
| 1678 | Ga0496124_0120854 | 3300048927 | Bacteria | 2093 |
| 1679 | Ga0496124_0126759 | 3300048927 | Bacteria | 2032 |
| 1680 | Ga0496125_0049739 | 3300048928 | Bacteria | 3479 |
| 1681 | Ga0496125_0054915 | 3300048928 | Bacteria | 3251 |
| 1682 | Ga0496125_0147995 | 3300048928 | Bacteria | 1619 |
| 1683 | Ga0496126_0094618 | 3300048929 | Bacteria | 2622 |
| 1684 | Ga0496126_0107470 | 3300048929 | Bacteria | 2433 |
| 1685 | Ga0496126_0107711 | 3300048929 | Bacteria | 2430 |
| 1686 | Ga0496126_0210040 | 3300048929 | Bacteria | 1639 |
| 1687 | Ga0495678_019042 | 3300049459 | Bacteria | 3073 |
| 1688 | Ga0495682_0013874 | 3300049460 | Bacteria | 3059 |
| 1689 | Ga0495682_0030442 | 3300049460 | Bacteria | 1996 |
| 1690 | Ga0495682_0062518 | 3300049460 | Bacteria | 1343 |
| 1691 | Ga0501291_000951 | 3300049514 | Bacteria | 3327 |
| 1692 | Ga0501067_0022408 | 3300049583 | Bacteria | 3496 |
| 1693 | Ga0501067_0081267 | 3300049583 | Bacteria | 1796 |
| 1694 | Ga0501069_0067551 | 3300049585 | Bacteria | 2000 |
| 1695 | Ga0501069_0084232 | 3300049585 | Bacteria | 1793 |
| 1696 | Ga0501070_0115317 | 3300049586 | Bacteria | 2219 |
| 1697 | Ga0501076_0178655 | 3300049592 | Bacteria | 1730 |
| 1698 | Ga0501235_001462 | 3300049669 | Bacteria | 5048 |
| 1699 | Ga0501250_000659 | 3300049680 | Bacteria | 2468 |
| 1700 | Ga0501251_001617 | 3300049681 | Bacteria | 2126 |
| 1701 | Ga0501252_000606 | 3300049682 | Bacteria | 2858 |
| 1702 | Ga0501225_0010575 | 3300049705 | Bacteria | 2613 |
| 1703 | Ga0501079_0213954 | 3300049741 | Bacteria | 1505 |
| 1704 | Ga0501081_0081363 | 3300049743 | Bacteria | 2268 |
| 1705 | Ga0501241_007521 | 3300049758 | Bacteria | 1994 |
| 1706 | nmdc:mga06z11_25769_c1 | 3300050494 | Bacteria | 2791 |
| 1707 | nmdc:mga04h51_31326_c1 | 3300050495 | Bacteria | 1680 |
| 1708 | nmdc:mga07m45_53547_c1 | 3300050496 | Bacteria | 2280 |
| 1709 | nmdc:mga07m45_68669_c1 | 3300050496 | Bacteria | 2015 |
| 1710 | nmdc:mga05p37_223130_c1 | 3300050507 | Bacteria | 2274 |
| 1711 | nmdc:mga05p37_279433_c1 | 3300050507 | Bacteria | 1992 |
| 1712 | nmdc:mga05p37_347935_c1 | 3300050507 | Bacteria | 1746 |
| 1713 | nmdc:mga0qj67_101206_c1 | 3300050509 | Bacteria | 2323 |
| 1714 | nmdc:mga0qj67_132787_c1 | 3300050509 | Bacteria | 2017 |
| 1715 | nmdc:mga06r32_145914_c1 | 3300050510 | Bacteria | 2344 |
| 1716 | nmdc:mga06r32_180946_c1 | 3300050510 | Bacteria | 2094 |
| 1717 | nmdc:mga06r32_25133_c1 | 3300050510 | Bacteria | 5536 |
| 1718 | nmdc:mga06r32_252095_c1 | 3300050510 | Bacteria | 1753 |
| 1719 | nmdc:mga08y16_155948_c1 | 3300050511 | Bacteria | 2373 |
| 1720 | nmdc:mga08y16_193525_c1 | 3300050511 | Bacteria | 2109 |
| 1721 | nmdc:mga08y16_211858_c1 | 3300050511 | Bacteria | 2007 |
| 1722 | nmdc:mga08y16_232732_c1 | 3300050511 | Bacteria | 1906 |
| 1723 | nmdc:mga08y16_234901_c1 | 3300050511 | Bacteria | 1896 |
| 1724 | nmdc:mga08y16_253344_c1 | 3300050511 | Bacteria | 1819 |
| 1725 | nmdc:mga08y16_95583_c1 | 3300050511 | Bacteria | 3095 |
| 1726 | nmdc:mga0n895_160517_c1 | 3300050512 | Bacteria | 2280 |
| 1727 | nmdc:mga0n895_200852_c1 | 3300050512 | Bacteria | 2025 |
| 1728 | nmdc:mga0n895_216713_c1 | 3300050512 | Bacteria | 1944 |
| 1729 | nmdc:mga0n895_223204_c1 | 3300050512 | Bacteria | 1913 |
| 1730 | nmdc:mga0n895_229910_c1 | 3300050512 | Bacteria | 1883 |
| 1731 | nmdc:mga0n895_236300_c1 | 3300050512 | Bacteria | 1855 |
| 1732 | nmdc:mga0n895_279247_c1 | 3300050512 | Bacteria | 1694 |
| 1733 | nmdc:mga0rr50_123157_c1 | 3300050513 | Bacteria | 2067 |
| 1734 | nmdc:mga0rr50_137056_c1 | 3300050513 | Bacteria | 1966 |
| 1735 | nmdc:mga0rr50_205996_c1 | 3300050513 | Bacteria | 1619 |
| 1736 | nmdc:mga0rr50_228092_c1 | 3300050513 | Bacteria | 1540 |
| 1737 | nmdc:mga0rr50_233160_c1 | 3300050513 | Bacteria | 1524 |
| 1738 | nmdc:mga0rr50_71232_c1 | 3300050513 | Bacteria | 2652 |
| 1739 | nmdc:mga08x19_125136_c1 | 3300050514 | Bacteria | 1726 |
| 1740 | nmdc:mga0a205_150320_c1 | 3300050515 | Bacteria | 2229 |
| 1741 | nmdc:mga0a205_153471_c1 | 3300050515 | Bacteria | 2202 |
| 1742 | nmdc:mga0a205_170169_c1 | 3300050515 | Bacteria | 2075 |
| 1743 | nmdc:mga0a205_171628_c1 | 3300050515 | Bacteria | 2065 |
| 1744 | nmdc:mga0a205_6547_c2 | 3300050515 | Bacteria | 2538 |
| 1745 | Ga0495601_0033150 | 3300053077 | Bacteria | 3217 |
| 1746 | Ga0495601_0044902 | 3300053077 | Bacteria | 2777 |
| 1747 | Ga0495601_0062551 | 3300053077 | Bacteria | 2364 |
| 1748 | Ga0495601_0066615 | 3300053077 | Bacteria | 2292 |
| 1749 | Ga0495601_0100646 | 3300053077 | Bacteria | 1866 |
| 1750 | Ga0495612_0013907 | 3300053078 | Bacteria | 3242 |
| 1751 | Ga0495612_0016415 | 3300053078 | Bacteria | 2967 |
| 1752 | Ga0495612_0018459 | 3300053078 | Bacteria | 2793 |
| 1753 | Ga0495612_0025642 | 3300053078 | Bacteria | 2367 |
| 1754 | Ga0495612_0029145 | 3300053078 | Bacteria | 2222 |
| 1755 | Ga0495612_0030929 | 3300053078 | Bacteria | 2157 |
| 1756 | Ga0495612_0047582 | 3300053078 | Bacteria | 1757 |
| 1757 | Ga0495595_0007104 | 3300053084 | Bacteria | 4576 |
| 1758 | Ga0495595_0013654 | 3300053084 | Bacteria | 3433 |
| 1759 | Ga0495595_0014010 | 3300053084 | Bacteria | 3394 |
| 1760 | Ga0495595_0021234 | 3300053084 | Bacteria | 2834 |
| 1761 | Ga0495595_0036714 | 3300053084 | Bacteria | 2224 |
| 1762 | Ga0495595_0039832 | 3300053084 | Bacteria | 2145 |
| 1763 | Ga0495595_0044492 | 3300053084 | Bacteria | 2039 |
| 1764 | Ga0495619_0036729 | 3300053085 | Bacteria | 3191 |
| 1765 | Ga0495619_0068635 | 3300053085 | Bacteria | 2368 |
| 1766 | Ga0495619_0080615 | 3300053085 | Bacteria | 2190 |
| 1767 | Ga0495619_0080727 | 3300053085 | Bacteria | 2189 |
| 1768 | Ga0495619_0082379 | 3300053085 | Bacteria | 2168 |
| 1769 | Ga0495619_0092316 | 3300053085 | Bacteria | 2050 |
| 1770 | Ga0495619_0092691 | 3300053085 | Bacteria | 2046 |
| 1771 | Ga0495619_0104272 | 3300053085 | Bacteria | 1932 |
| 1772 | Ga0500578_0075563 | 3300053086 | Bacteria | 2146 |
| 1773 | Ga0500643_012830 | 3300053087 | Bacteria | 2987 |
| 1774 | Ga0500651_0000666 | 3300053093 | Bacteria | 17091 |
| 1775 | Ga0500651_0084164 | 3300053093 | Bacteria | 1967 |
| 1776 | Ga0500641_0008723 | 3300053096 | Bacteria | 3627 |
| 1777 | Ga0500641_0067478 | 3300053096 | Bacteria | 1499 |
| 1778 | Ga0500650_0043581 | 3300053098 | Bacteria | 2075 |
| 1779 | Ga0500562_016489 | 3300053108 | Bacteria | 1900 |
| 1780 | Ga0500582_018410 | 3300053114 | Bacteria | 1934 |
| 1781 | Ga0500592_003775 | 3300053116 | Bacteria | 2415 |
| 1782 | Ga0500595_000309 | 3300053119 | Bacteria | 32082 |
| 1783 | Ga0500642_0060990 | 3300053130 | Bacteria | 1693 |
| 1784 | Ga0500658_0035903 | 3300053134 | Bacteria | 1964 |
| 1785 | Ga0500559_0008740 | 3300053136 | Bacteria | 4418 |
| 1786 | Ga0500577_0023178 | 3300053142 | Bacteria | 2070 |
| 1787 | Ga0500579_071191 | 3300053143 | Bacteria | 2005 |
| 1788 | Ga0500588_0012604 | 3300053146 | Bacteria | 2101 |
| 1789 | Ga0500589_008456 | 3300053147 | Bacteria | 4291 |
| 1790 | Ga0500604_0015925 | 3300053151 | Bacteria | 2065 |
| 1791 | Ga0500622_0014532 | 3300053156 | Bacteria | 4226 |
| 1792 | Ga0500627_0009532 | 3300053158 | Bacteria | 3500 |
| 1793 | Ga0500627_0069718 | 3300053158 | Bacteria | 1556 |
| 1794 | Ga0500634_0009635 | 3300053161 | Bacteria | 4904 |
| 1795 | Ga0500634_0080746 | 3300053161 | Bacteria | 1677 |
| 1796 | Ga0500636_0044694 | 3300053177 | Bacteria | 2612 |
| 1797 | Ga0500645_026521 | 3300053730 | Bacteria | 1762 |
| 1798 | Ga0587077_002586 | 3300059493 | Bacteria | 2168 |
| 1799 | Ga0587082_002402 | 3300059504 | Bacteria | 2111 |
| 1800 | Ga0587085_001833 | 3300059506 | Bacteria | 2064 |
| 1801 | Ga0587062_003294 | 3300059639 | Bacteria | 1620 |
| 1802 | Ga0587072_003897 | 3300059643 | Bacteria | 2131 |
| 1803 | Ga0530510_0199987 | 3300061734 | Bacteria | 1484 |
| 1804 | 2512348742 | 2512047030 | Bacteria | 9031815 |
| 1805 | 2512351805 | 2512047030 | Bacteria | 9031815 |
| 1806 | 2512351965 | 2512047030 | Bacteria | 9031815 |
| 1807 | 2513558040 | 2513237082 | Bacteria | 8640282 |
| 1808 | 2513720832 | 2513237104 | Bacteria | 10034502 |
| 1809 | 2513723419 | 2513237104 | Bacteria | 10034502 |
| 1810 | 2513723448 | 2513237104 | Bacteria | 10034502 |
| 1811 | 2513723775 | 2513237104 | Bacteria | 10034502 |
| 1812 | 2513723950 | 2513237104 | Bacteria | 10034502 |
| 1813 | 2558860608 | 2558860100 | Bacteria | 8458965 |
| 1814 | 2558862065 | 2558860100 | Bacteria | 8458965 |
| 1815 | 2558862441 | 2558860100 | Bacteria | 8458965 |
| 1816 | 2558865755 | 2558860100 | Bacteria | 8458965 |
| 1817 | 2585264054 | 2582581305 | Bacteria | 4895574 |
| 1818 | 2644027856 | 2643221603 | Bacteria | 6147767 |
| 1819 | 2745075108 | 2744054633 | Bacteria | 8678936 |
| 1820 | 2776257752 | 2775506901 | Bacteria | 9631051 |
| 1821 | 2776260100 | 2775506901 | Bacteria | 9631051 |
| 1822 | 2776263843 | 2775506901 | Bacteria | 9631051 |
| 1823 | 2776264600 | 2775506901 | Bacteria | 9631051 |
| 1824 | 2776264778 | 2775506901 | Bacteria | 9631051 |
| 1825 | 2776264893 | 2775506901 | Bacteria | 9631051 |
| 1826 | 2776265028 | 2775506901 | Bacteria | 9631051 |
| 1827 | 2776266631 | 2775506901 | Bacteria | 9631051 |
| 1828 | 2776266847 | 2775506901 | Bacteria | 9631051 |
| 1829 | 2842329858 | 2842324504 | Bacteria | 9364110 |
| 1830 | 2842354676 | 2842348783 | Bacteria | 9002918 |
| 1831 | 2842460125 | 2842454564 | Bacteria | 8730687 |
| 1832 | 2874130496 | 2874123672 | Bacteria | 7238285 |
| 1833 | 2876763805 | 2876761206 | Bacteria | 10111113 |
| 1834 | 2876763981 | 2876761206 | Bacteria | 10111113 |
| 1835 | 2876767391 | 2876761206 | Bacteria | 10111113 |
| 1836 | 2881671454 | 2881665667 | Bacteria | 8175609 |
| 1837 | 2885383402 | 2885374607 | Bacteria | 8927485 |
| 1838 | 2885414001 | 2885409591 | Bacteria | 9235467 |
| 1839 | 2889791694 | 2889790730 | Bacteria | 5689708 |
| 1840 | 2900642728 | 2900634093 | Bacteria | 10263517 |
| 1841 | 2903778253 | 2903768456 | Bacteria | 9749579 |
| 1842 | 2922363016 | 2922361189 | Bacteria | 7436256 |
| 1843 | 2935769730 | 2935760218 | Bacteria | 9817913 |
| 1844 | 2941538491 | 2941531003 | Bacteria | 7653939 |
| 1845 | 8006985137 | 8006984368 | Bacteria | 9651211 |
| 1846 | 8019649190 | 8019648815 | Bacteria | 10014479 |
| 1847 | 8019657173 | 8019648815 | Bacteria | 10014479 |
| 1848 | Ga0450904_002772 | |||
| 1849 | SwRhRL2b_contig_1818751 | |||
| 1850 | SwRhRL2b_contig_2236331 | |||
| 1851 | ARSoilOldRDRAFT_c002146 | |||
| 1852 | JGI24747J21853_1000925 | |||
| 1853 | JGI24740J21852_10025448 | |||
| 1854 | JGI24739J22299_10025517 | |||
| 1855 | JGI24739J22299_10027983 | |||
| 1856 | JGI24739J22299_10028900 | |||
| 1857 | JGI24743J22301_10006376 | |||
| 1858 | JGI24743J22301_10007064 | |||
| 1859 | JGI24735J21928_10015983 | |||
| 1860 | JGI24735J21928_10018333 | |||
| 1861 | JGI24735J21928_10019976 | |||
| 1862 | JGI24735J21928_10020152 | |||
| 1863 | JGI24735J21928_10022282 | |||
| 1864 | JGI24750J21931_1003093 | |||
| 1865 | JGI24750J21931_1003276 | |||
| 1866 | JGI24745J21846_1002072 | |||
| 1867 | JGI24748J21848_1003376 | |||
| 1868 | JGI24749J21850_1005242 | |||
| 1869 | JGI24744J21845_10009246 | |||
| 1870 | JGI24744J21845_10010202 | |||
| 1871 | JGI24035J26624_1001816 | |||
| 1872 | JGI24033J26618_1002484 | |||
| 1873 | JGI24033J26618_1002773 | |||
| 1874 | JGI24034J26672_10004231 | |||
| 1875 | JGI24742J22300_10006045 | |||
| 1876 | JGI24742J22300_10006688 | |||
| 1877 | JGI24742J22300_10007104 | |||
| 1878 | JGI24742J22300_10007679 | |||
| 1879 | JGI24742J22300_10008609 | |||
| 1880 | Ga0007429J51699_1014162 | |||
| 1881 | Ga0007429J51699_1089451 | |||
| 1882 | JGI25404J52841_10008353 | |||
| 1883 | JGI25404J52841_10012942 | |||
| 1884 | Ga0032354_1096766 | |||
| 1885 | JGI25405J52794_10014531 | |||
| 1886 | Ga0058860_10059007 | |||
| 1887 | Ga0065704_10116717 | |||
| 1888 | Ga0065712_10089177 | |||
| 1889 | Ga0065715_10015540 | |||
| 1890 | Ga0065715_10023536 | |||
| 1891 | Ga0065715_10109413 | |||
| 1892 | Ga0065707_10126004 | |||
| 1893 | Ga0065707_10168001 | |||
| 1894 | Ga0070676_10059480 | |||
| 1895 | Ga0070676_10083531 | |||
| 1896 | Ga0070690_100013888 | |||
| 1897 | Ga0070670_100242450 | |||
| 1898 | Ga0068869_100160943 | |||
| 1899 | Ga0068869_100178928 | |||
| 1900 | Ga0070666_10060153 | |||
| 1901 | Ga0070666_10077044 | |||
| 1902 | Ga0070666_10106110 | |||
| 1903 | Ga0070666_10120690 | |||
| 1904 | Ga0070666_10159663 | |||
| 1905 | Ga0070680_100120669 | |||
| 1906 | Ga0070682_100079109 | |||
| 1907 | Ga0068868_100102700 | |||
| 1908 | Ga0070660_100092236 | |||
| 1909 | Ga0070689_100167762 | |||
| 1910 | Ga0070691_10042188 | |||
| 1911 | Ga0070687_100045834 | |||
| 1912 | Ga0070692_10035532 | |||
| 1913 | Ga0070668_100160598 | |||
| 1914 | Ga0070668_100168171 | |||
| 1915 | Ga0070668_100200694 | |||
| 1916 | Ga0070668_100257730 | |||
| 1917 | Ga0070669_100108423 | |||
| 1918 | Ga0070669_100138567 | |||
| 1919 | Ga0070675_100097854 | |||
| 1920 | Ga0070675_100126769 | |||
| 1921 | Ga0070671_100112257 | |||
| 1922 | Ga0070671_100175436 | |||
| 1923 | Ga0070671_100201818 | |||
| 1924 | Ga0070674_100067592 | |||
| 1925 | Ga0070674_100089876 | |||
| 1926 | Ga0070674_100172272 | |||
| 1927 | Ga0070674_100189980 | |||
| 1928 | Ga0070673_100036965 | |||
| 1929 | Ga0070673_100051846 | |||
| 1930 | Ga0070673_100092211 | |||
| 1931 | Ga0070673_100286879 | |||
| 1932 | Ga0070688_100083733 | |||
| 1933 | Ga0070659_100146298 | |||
| 1934 | Ga0070667_100140745 | |||
| 1935 | Ga0070667_100168492 | |||
| 1936 | Ga0070667_100195859 | |||
| 1937 | Ga0070709_10092037 | |||
| 1938 | Ga0070714_100104075 | |||
| 1939 | Ga0070713_100114860 | |||
| 1940 | Ga0070713_100152610 | |||
| 1941 | Ga0070713_100166102 | |||
| 1942 | Ga0070710_10035257 | |||
| 1943 | Ga0070710_10066094 | |||
| 1944 | Ga0070710_10073803 | |||
| 1945 | Ga0070710_10149468 | |||
| 1946 | Ga0070701_10048407 | |||
| 1947 | Ga0070701_10061082 | |||
| 1948 | Ga0070711_100091561 | |||
| 1949 | Ga0070711_100113545 | |||
| 1950 | Ga0070711_100116411 | |||
| 1951 | Ga0070711_100152229 | |||
| 1952 | Ga0070711_100154125 | |||
| 1953 | Ga0070711_100201419 | |||
| 1954 | Ga0070711_100249113 | |||
| 1955 | Ga0070705_100102714 | |||
| 1956 | Ga0070705_100131852 | |||
| 1957 | Ga0070700_100101127 | |||
| 1958 | Ga0070694_100090081 | |||
| 1959 | Ga0070708_100147329 | |||
| 1960 | Ga0070708_100266566 | |||
| 1961 | Ga0070708_100271307 | |||
| 1962 | Ga0070663_100089294 | |||
| 1963 | Ga0070663_100217249 | |||
| 1964 | Ga0070678_100083899 | |||
| 1965 | Ga0070678_100107456 | |||
| 1966 | Ga0070662_100065714 | |||
| 1967 | Ga0070662_100089124 | |||
| 1968 | Ga0070662_100098978 | |||
| 1969 | Ga0070662_100133921 | |||
| 1970 | Ga0070662_100193370 | |||
| 1971 | Ga0070681_10124952 | |||
| 1972 | Ga0068867_100039606 | |||
| 1973 | Ga0068867_100103524 | |||
| 1974 | Ga0068867_100142373 | |||
| 1975 | Ga0068867_100203354 | |||
| 1976 | Ga0070698_100351190 | |||
| 1977 | Ga0070699_100094955 | |||
| 1978 | Ga0070699_100198348 | |||
| 1979 | Ga0070679_100272135 | |||
| 1980 | Ga0070697_100118037 | |||
| 1981 | Ga0070697_100244341 | |||
| 1982 | Ga0068853_100141576 | |||
| 1983 | Ga0068853_100201937 | |||
| 1984 | Ga0070672_100085695 | |||
| 1985 | Ga0070686_100082615 | |||
| 1986 | Ga0070686_100090623 | |||
| 1987 | Ga0070696_100057008 | |||
| 1988 | Ga0070693_100031520 | |||
| 1989 | Ga0070693_100052946 | |||
| 1990 | Ga0070693_100141769 | |||
| 1991 | Ga0070665_100145136 | |||
| 1992 | Ga0070665_100158810 | |||
| 1993 | Ga0070665_100217162 | |||
| 1994 | Ga0068855_100189125 | |||
| 1995 | Ga0068856_100200794 | |||
| 1996 | Ga0070702_100029407 | |||
| 1997 | Ga0070702_100058493 | |||
| 1998 | Ga0070702_100096244 | |||
| 1999 | Ga0068859_100195774 | |||
| 2000 | Ga0068859_100232988 | |||
| 2001 | Ga0068864_100156037 | |||
| 2002 | Ga0068864_100182270 | |||
| 2003 | Ga0068866_10036796 | |||
| 2004 | Ga0068866_10049292 | |||
| 2005 | Ga0068866_10062740 | |||
| 2006 | Ga0068866_10138346 | |||
| 2007 | Ga0068861_100097458 | |||
| 2008 | Ga0068861_100131413 | |||
| 2009 | Ga0068861_100189914 | |||
| 2010 | Ga0068861_100234008 | |||
| 2011 | Ga0068863_100190138 | |||
| 2012 | Ga0068863_100222830 | |||
| 2013 | Ga0068863_100287572 | |||
| 2014 | Ga0068858_100119981 | |||
| 2015 | Ga0068858_100135764 | |||
| 2016 | Ga0068860_100191276 | |||
| 2017 | Ga0068860_100210802 | |||
| 2018 | Ga0068862_100135518 | |||
| 2019 | Ga0068862_100144061 | |||
| 2020 | Ga0068862_100182407 | |||
| 2021 | Ga0068862_100218061 | |||
| 2022 | Ga0081455_10048300 | |||
| 2023 | Ga0081455_10048429 | |||
| 2024 | Ga0081455_10176784 | |||
| 2025 | Ga0081540_1018457 | |||
| 2026 | Ga0081540_1049607 | |||
| 2027 | Ga0070717_10103610 | |||
| 2028 | Ga0070717_10117214 | |||
| 2029 | Ga0070717_10141225 | |||
| 2030 | Ga0070717_10203599 | |||
| 2031 | Ga0070717_10206803 | |||
| 2032 | Ga0075432_10029878 | |||
| 2033 | Ga0075432_10029908 | |||
| 2034 | Ga0070715_10018084 | |||
| 2035 | Ga0070716_100017253 | |||
| 2036 | Ga0070712_100076616 | |||
| 2037 | Ga0070712_100083289 | |||
| 2038 | Ga0070712_100085816 | |||
| 2039 | Ga0075367_10066085 | |||
| 2040 | Ga0075367_10070539 | |||
| 2041 | Ga0097621_100075112 | |||
| 2042 | Ga0097621_100081983 | |||
| 2043 | Ga0097621_100124602 | |||
| 2044 | Ga0097621_100132074 | |||
| 2045 | Ga0097621_100211245 | |||
| 2046 | Ga0075370_10030816 | |||
| 2047 | Ga0075370_10088763 | |||
| 2048 | Ga0068871_100077330 | |||
| 2049 | Ga0068871_100090289 | |||
| 2050 | Ga0068871_100101588 | |||
| 2051 | Ga0068871_100156098 | |||
| 2052 | Ga0068871_100170857 | |||
| 2053 | Ga0075428_100126163 | |||
| 2054 | Ga0075428_100156511 | |||
| 2055 | Ga0075428_100160693 | |||
| 2056 | Ga0075428_100180867 | |||
| 2057 | Ga0075428_100272944 | |||
| 2058 | Ga0075428_100305665 | |||
| 2059 | Ga0075430_100108667 | |||
| 2060 | Ga0075431_100166112 | |||
| 2061 | Ga0075431_100169366 | |||
| 2062 | Ga0075433_10098207 | |||
| 2063 | Ga0075433_10167470 | |||
| 2064 | Ga0075433_10186499 | |||
| 2065 | Ga0075434_100097928 | |||
| 2066 | Ga0075434_100167829 | |||
| 2067 | Ga0075434_100184059 | |||
| 2068 | Ga0075434_100217533 | |||
| 2069 | Ga0075434_100226849 | |||
| 2070 | Ga0075434_100236016 | |||
| 2071 | Ga0075434_100245585 | |||
| 2072 | Ga0075434_100254344 | |||
| 2073 | Ga0075434_100261227 | |||
| 2074 | Ga0068865_100092021 | |||
| 2075 | Ga0068865_100099083 | |||
| 2076 | Ga0068865_100111496 | |||
| 2077 | Ga0068865_100240391 | |||
| 2078 | Ga0075436_100080103 | |||
| 2079 | Ga0075436_100083782 | |||
| 2080 | Ga0097620_100195769 | |||
| 2081 | Ga0097620_100232990 | |||
| 2082 | Ga0075435_100100197 | |||
| 2083 | Ga0075435_100145204 | |||
| 2084 | Ga0075435_100168819 | |||
| 2085 | Ga0075435_100170048 | |||
| 2086 | Ga0075435_100207168 | |||
| 2087 | Ga0075435_100248981 | |||
| 2088 | Ga0099795_10025187 | |||
| 2089 | Ga0099795_10027906 | |||
| 2090 | Ga0105251_10073241 | |||
| 2091 | Ga0105240_10246158 | |||
| 2092 | Ga0111539_10157373 | |||
| 2093 | Ga0111539_10194587 | |||
| 2094 | Ga0111539_10213376 | |||
| 2095 | Ga0111539_10260072 | |||
| 2096 | Ga0111539_10379671 | |||
| 2097 | Ga0105245_10115794 | |||
| 2098 | Ga0105245_10116031 | |||
| 2099 | Ga0105247_10019146 | |||
| 2100 | Ga0105247_10054498 | |||
| 2101 | Ga0105247_10061858 | |||
| 2102 | Ga0105247_10075826 | |||
| 2103 | Ga0105247_10086359 | |||
| 2104 | Ga0114129_10214800 | |||
| 2105 | Ga0114129_10303264 | |||
| 2106 | Ga0114129_10360832 | |||
| 2107 | Ga0105243_10174977 | |||
| 2108 | Ga0105243_10267779 | |||
| 2109 | Ga0105241_10138150 | |||
| 2110 | Ga0105241_10178062 | |||
| 2111 | Ga0105242_10109037 | |||
| 2112 | Ga0105242_10133770 | |||
| 2113 | Ga0105242_10214288 | |||
| 2114 | Ga0105242_10244898 | |||
| 2115 | Ga0105242_10245433 | |||
| 2116 | Ga0105248_10187030 | |||
| 2117 | Ga0105248_10203259 | |||
| 2118 | Ga0105248_10356655 | |||
| 2119 | Ga0105237_10364086 | |||
| 2120 | Ga0105238_10161381 | |||
| 2121 | Ga0105238_10178299 | |||
| 2122 | Ga0105249_10111800 | |||
| 2123 | Ga0105249_10159978 | |||
| 2124 | Ga0105249_10199796 | |||
| 2125 | Ga0105249_10242695 | |||
| 2126 | Ga0099796_10016496 | |||
| 2127 | Ga0099796_10036954 | |||
| 2128 | Ga0105239_10197836 | |||
| 2129 | Ga0105239_10274749 | |||
| 2130 | Ga0105246_10051787 | |||
| 2131 | Ga0105246_10060309 | |||
| 2132 | Ga0157329_1000722 | |||
| 2133 | Ga0157339_1001501 | |||
| 2134 | Ga0157371_10094289 | |||
| 2135 | Ga0157371_10099508 | |||
| 2136 | Ga0157370_10237980 | |||
| 2137 | Ga0157369_10165763 | |||
| 2138 | Ga0157374_10314873 | |||
| 2139 | Ga0157378_10092630 | |||
| 2140 | Ga0157378_10094718 | |||
| 2141 | Ga0157378_10098004 | |||
| 2142 | Ga0163162_10431924 | |||
| 2143 | Ga0157375_10158487 | |||
| 2144 | Ga0157375_10248901 | |||
| 2145 | Ga0157375_10268965 | |||
| 2146 | Ga0163163_10158463 | |||
| 2147 | Ga0157380_10071568 | |||
| 2148 | Ga0157380_10165488 | |||
| 2149 | Ga0182008_10036739 | |||
| 2150 | Ga0157377_10000080 | |||
| 2151 | Ga0157379_10067755 | |||
| 2152 | Ga0157379_10153307 | |||
| 2153 | Ga0157379_10232685 | |||
| 2154 | Ga0157376_10061616 | |||
| 2155 | Ga0157376_10134277 | |||
| 2156 | Ga0157376_10137641 | |||
| 2157 | Ga0157376_10162089 | |||
| 2158 | Ga0157376_10178629 | |||
| 2159 | Ga0157376_10190126 | |||
| 2160 | Ga0157376_10308218 | |||
| 2161 | Ga0163161_10117052 | |||
| 2162 | Ga0163161_10118653 | |||
| 2163 | Ga0184602_121534 | |||
| 2164 | Ga0213873_10000875 | |||
| 2165 | Ga0213872_10020991 | |||
| 2166 | Ga0213872_10051235 | |||
| 2167 | Ga0213874_10011415 | |||
| 2168 | Ga0213876_10059055 | |||
| 2169 | Ga0224570_101704 | |||
| 2170 | Ga0247551_100096 | |||
| 2171 | Ga0247550_100048 | |||
| 2172 | Ga0228600_1001536 | |||
| 2173 | Ga0224572_1007934 | |||
| 2174 | Ga0224572_1007992 | |||
| 2175 | Ga0228598_1002583 | |||
| 2176 | Ga0228598_1005183 | |||
| 2177 | Ga0228598_1008875 | |||
| 2178 | Ga0209759_1013527 | |||
| 2179 | Ga0209051_1005278 | |||
| 2180 | Ga0207697_10008948 | |||
| 2181 | Ga0207697_10028389 | |||
| 2182 | Ga0207697_10038129 | |||
| 2183 | Ga0207713_1020043 | |||
| 2184 | Ga0207692_10049268 | |||
| 2185 | Ga0207692_10050782 | |||
| 2186 | Ga0207692_10053785 | |||
| 2187 | Ga0207692_10054721 | |||
| 2188 | Ga0207692_10055787 | |||
| 2189 | Ga0207692_10083458 | |||
| 2190 | Ga0207642_10034813 | |||
| 2191 | Ga0207642_10035574 | |||
| 2192 | Ga0207642_10040934 | |||
| 2193 | Ga0207642_10043355 | |||
| 2194 | Ga0207642_10058109 | |||
| 2195 | Ga0207710_10024444 | |||
| 2196 | Ga0207710_10026108 | |||
| 2197 | Ga0207710_10038893 | |||
| 2198 | Ga0207688_10021442 | |||
| 2199 | Ga0207688_10043468 | |||
| 2200 | Ga0207688_10060308 | |||
| 2201 | Ga0207688_10078293 | |||
| 2202 | Ga0207680_10010514 | |||
| 2203 | Ga0207680_10025747 | |||
| 2204 | Ga0207647_10001640 | |||
| 2205 | Ga0207647_10064697 | |||
| 2206 | Ga0207685_10025291 | |||
| 2207 | Ga0207685_10025827 | |||
| 2208 | Ga0207699_10068315 | |||
| 2209 | Ga0207699_10077102 | |||
| 2210 | Ga0207699_10077674 | |||
| 2211 | Ga0207699_10078249 | |||
| 2212 | Ga0207699_10084483 | |||
| 2213 | Ga0207699_10092182 | |||
| 2214 | Ga0207643_10053535 | |||
| 2215 | Ga0207643_10073050 | |||
| 2216 | Ga0207643_10089674 | |||
| 2217 | Ga0207705_10115699 | |||
| 2218 | Ga0207684_10039964 | |||
| 2219 | Ga0207684_10147851 | |||
| 2220 | Ga0207684_10151815 | |||
| 2221 | Ga0207684_10221647 | |||
| 2222 | Ga0207654_10016416 | |||
| 2223 | Ga0207654_10076549 | |||
| 2224 | Ga0207654_10123075 | |||
| 2225 | Ga0207707_10134235 | |||
| 2226 | Ga0207707_10146561 | |||
| 2227 | Ga0207695_10111573 | |||
| 2228 | Ga0207695_10249725 | |||
| 2229 | Ga0207671_10195376 | |||
| 2230 | Ga0207693_10103936 | |||
| 2231 | Ga0207693_10120699 | |||
| 2232 | Ga0207663_10013149 | |||
| 2233 | Ga0207663_10024929 | |||
| 2234 | Ga0207663_10076671 | |||
| 2235 | Ga0207663_10081324 | |||
| 2236 | Ga0207663_10086419 | |||
| 2237 | Ga0207663_10090789 | |||
| 2238 | Ga0207663_10103566 | |||
| 2239 | Ga0207663_10118526 | |||
| 2240 | Ga0207663_10140603 | |||
| 2241 | Ga0207663_10169762 | |||
| 2242 | Ga0207663_10179351 | |||
| 2243 | Ga0207663_10201753 | |||
| 2244 | Ga0207660_10166207 | |||
| 2245 | Ga0207657_10120075 | |||
| 2246 | Ga0207652_10283120 | |||
| 2247 | Ga0207652_10292687 | |||
| 2248 | Ga0207646_10171009 | |||
| 2249 | Ga0207681_10091025 | |||
| 2250 | Ga0207694_10114462 | |||
| 2251 | Ga0207694_10150664 | |||
| 2252 | Ga0207650_10027168 | |||
| 2253 | Ga0207650_10030800 | |||
| 2254 | Ga0207659_10113592 | |||
| 2255 | Ga0207659_10127470 | |||
| 2256 | Ga0207687_10060974 | |||
| 2257 | Ga0207687_10110126 | |||
| 2258 | Ga0207700_10025509 | |||
| 2259 | Ga0207700_10028818 | |||
| 2260 | Ga0207700_10053130 | |||
| 2261 | Ga0207700_10122323 | |||
| 2262 | Ga0207700_10144416 | |||
| 2263 | Ga0207700_10155152 | |||
| 2264 | Ga0207700_10157136 | |||
| 2265 | Ga0207700_10177655 | |||
| 2266 | Ga0207700_10235798 | |||
| 2267 | Ga0207664_10026373 | |||
| 2268 | Ga0207664_10066158 | |||
| 2269 | Ga0207664_10095710 | |||
| 2270 | Ga0207664_10109833 | |||
| 2271 | Ga0207664_10128610 | |||
| 2272 | Ga0207664_10137192 | |||
| 2273 | Ga0207644_10135513 | |||
| 2274 | Ga0207644_10164098 | |||
| 2275 | Ga0207690_10147595 | |||
| 2276 | Ga0207706_10101197 | |||
| 2277 | Ga0207706_10121870 | |||
| 2278 | Ga0207706_10139809 | |||
| 2279 | Ga0207706_10159787 | |||
| 2280 | Ga0207686_10092140 | |||
| 2281 | Ga0207686_10113912 | |||
| 2282 | Ga0207686_10157390 | |||
| 2283 | Ga0207686_10171030 | |||
| 2284 | Ga0207709_10002054 | |||
| 2285 | Ga0207709_10018016 | |||
| 2286 | Ga0207709_10096643 | |||
| 2287 | Ga0207709_10136562 | |||
| 2288 | Ga0207709_10163753 | |||
| 2289 | Ga0207670_10087130 | |||
| 2290 | Ga0207670_10144003 | |||
| 2291 | Ga0207669_10013077 | |||
| 2292 | Ga0207669_10086231 | |||
| 2293 | Ga0207669_10091441 | |||
| 2294 | Ga0207669_10092571 | |||
| 2295 | Ga0207669_10095754 | |||
| 2296 | Ga0207669_10161169 | |||
| 2297 | Ga0207704_10041408 | |||
| 2298 | Ga0207704_10071290 | |||
| 2299 | Ga0207704_10091267 | |||
| 2300 | Ga0207704_10098245 | |||
| 2301 | Ga0207665_10030968 | |||
| 2302 | Ga0207665_10038767 | |||
| 2303 | Ga0207665_10125508 | |||
| 2304 | Ga0207665_10201050 | |||
| 2305 | Ga0207691_10071251 | |||
| 2306 | Ga0207691_10166443 | |||
| 2307 | Ga0207691_10247672 | |||
| 2308 | Ga0207691_10283038 | |||
| 2309 | Ga0207711_10121333 | |||
| 2310 | Ga0207711_10182370 | |||
| 2311 | Ga0207711_10266520 | |||
| 2312 | Ga0207689_10141624 | |||
| 2313 | Ga0207689_10200912 | |||
| 2314 | Ga0207679_10124852 | |||
| 2315 | Ga0207679_10145269 | |||
| 2316 | Ga0207667_10280797 | |||
| 2317 | Ga0207667_10321923 | |||
| 2318 | Ga0207651_10063040 | |||
| 2319 | Ga0207651_10119659 | |||
| 2320 | Ga0207651_10144860 | |||
| 2321 | Ga0207712_10115145 | |||
| 2322 | Ga0207712_10115278 | |||
| 2323 | Ga0207712_10116479 | |||
| 2324 | Ga0207712_10170288 | |||
| 2325 | Ga0207668_10000119 | |||
| 2326 | Ga0207668_10097230 | |||
| 2327 | Ga0207668_10108196 | |||
| 2328 | Ga0207668_10114556 | |||
| 2329 | Ga0207640_10078926 | |||
| 2330 | Ga0207640_10079266 | |||
| 2331 | Ga0207658_10000347 | |||
| 2332 | Ga0207658_10186684 | |||
| 2333 | Ga0207677_10090393 | |||
| 2334 | Ga0207677_10103935 | |||
| 2335 | Ga0207703_10057586 | |||
| 2336 | Ga0207703_10116296 | |||
| 2337 | Ga0207703_10136429 | |||
| 2338 | Ga0207703_10179601 | |||
| 2339 | Ga0207639_10088768 | |||
| 2340 | Ga0207678_10043629 | |||
| 2341 | Ga0207678_10052514 | |||
| 2342 | Ga0207678_10072082 | |||
| 2343 | Ga0207678_10140520 | |||
| 2344 | Ga0207678_10223047 | |||
| 2345 | Ga0207708_10021338 | |||
| 2346 | Ga0207708_10114963 | |||
| 2347 | Ga0207708_10115901 | |||
| 2348 | Ga0207702_10113880 | |||
| 2349 | Ga0207702_10166230 | |||
| 2350 | Ga0207702_10265246 | |||
| 2351 | Ga0207641_10001333 | |||
| 2352 | Ga0207641_10166400 | |||
| 2353 | Ga0207648_10004849 | |||
| 2354 | Ga0207648_10039981 | |||
| 2355 | Ga0207648_10057334 | |||
| 2356 | Ga0207648_10077576 | |||
| 2357 | Ga0207648_10237828 | |||
| 2358 | Ga0207676_10157008 | |||
| 2359 | Ga0207676_10186691 | |||
| 2360 | Ga0207675_100097550 | |||
| 2361 | Ga0207675_100098959 | |||
| 2362 | Ga0207675_100121127 | |||
| 2363 | Ga0207675_100145037 | |||
| 2364 | Ga0207675_100224673 | |||
| 2365 | Ga0207675_100308456 | |||
| 2366 | Ga0207683_10025310 | |||
| 2367 | Ga0207683_10055568 | |||
| 2368 | Ga0207683_10127085 | |||
| 2369 | Ga0207683_10145603 | |||
| 2370 | Ga0207683_10150692 | |||
| 2371 | Ga0207698_10141670 | |||
| 2372 | Ga0207698_10180795 | |||
| 2373 | Ga0209489_120183 | |||
| 2374 | Ga0209179_1005488 | |||
| 2375 | Ga0209179_1005541 | |||
| 2376 | Ga0209179_1005904 | |||
| 2377 | Ga0209588_1022308 | |||
| 2378 | Ga0209588_1028465 | |||
| 2379 | Ga0209998_10009772 | |||
| 2380 | Ga0207428_10088428 | |||
| 2381 | Ga0207428_10103419 | |||
| 2382 | Ga0207428_10119816 | |||
| 2383 | Ga0207428_10140768 | |||
| 2384 | Ga0265358_100065 | |||
| 2385 | Ga0268266_10137271 | |||
| 2386 | Ga0268266_10210322 | |||
| 2387 | Ga0268265_10151381 | |||
| 2388 | Ga0268265_10220359 | |||
| 2389 | Ga0268265_10236418 | |||
| 2390 | Ga0268264_10142849 | |||
| 2391 | Ga0268264_10157528 | |||
| 2392 | Ga0268264_10168443 | |||
| 2393 | Ga0268264_10181814 | |||
| 2394 | Ga0268264_10275185 | |||
| 2395 | Ga0265334_10033696 | |||
| 2396 | Ga0265323_10021400 | |||
| 2397 | Ga0307517_10000970 | |||
| 2398 | Ga0307515_10132139 | |||
| 2399 | Ga0307515_10203441 | |||
| 2400 | Ga0307515_10242633 | |||
| 2401 | Ga0307515_10245417 | |||
| 2402 | Ga0265338_10110805 | |||
| 2403 | Ga0265324_10000366 | |||
| 2404 | Ga0307512_10021953 | |||
| 2405 | Ga0265769_100271 | |||
| 2406 | Ga0265760_10024581 | |||
| 2407 | Ga0265330_10016360 | |||
| 2408 | Ga0265330_10032230 | |||
| 2409 | Ga0265332_10034970 | |||
| 2410 | Ga0265328_10033570 | |||
| 2411 | Ga0265320_10027217 | |||
| 2412 | Ga0265325_10029379 | |||
| 2413 | Ga0265340_10036886 | |||
| 2414 | Ga0265331_10034908 | |||
| 2415 | Ga0265331_10047843 | |||
| 2416 | Ga0265316_10071769 | |||
| 2417 | Ga0265316_10093854 | |||
| 2418 | Ga0307513_10186603 | |||
| 2419 | Ga0307509_10053465 | |||
| 2420 | Ga0307509_10156853 | |||
| 2421 | Ga0265313_10003842 | |||
| 2422 | Ga0307508_10112232 | |||
| 2423 | Ga0307514_10089125 | |||
| 2424 | Ga0265314_10038445 | |||
| 2425 | Ga0265314_10105935 | |||
| 2426 | Ga0265342_10008005 | |||
| 2427 | Ga0316576_10060506 | |||
| 2428 | Ga0316578_10065563 | |||
| 2429 | Ga0307516_10150346 | |||
| 2430 | Ga0307516_10245789 | |||
| 2431 | Ga0316577_10067535 | |||
| 2432 | Ga0247548_100136 | |||
| 2433 | Ga0307510_10057847 | |||
| 2434 | Ga0373930_0002644 | |||
| 2435 | Ga0373930_0004626 | |||
| 2436 | Ga0373948_0004183 | |||
| 2437 | Ga0373948_0004293 | |||
| 2438 | Ga0373948_0005540 | |||
| 2439 | Ga0373950_0000581 | |||
| 2440 | Ga0373950_0004905 | |||
| 2441 | Ga0373950_0005622 | |||
| 2442 | Ga0373950_0005701 | |||
| 2443 | Ga0373958_0000620 | |||
| 2444 | Ga0373958_0003223 | |||
| 2445 | Ga0373959_0001167 | |||
| 2446 | Ga0373959_0006673 | |||
| 2447 | Ga0373959_0009224 | |||
| 2448 | Ga0373938_0001296 | |||
| 2449 | Ga0373938_0006526 | |||
| 2450 | Ga0373938_0007560 | |||
| 2451 | Ga0373938_0013661 | |||
| 2452 | Ga0373926_0006995 | |||
| 2453 | Ga0373926_0022456 | |||
| 2454 | Ga0373926_0026624 | |||
| 2455 | Ga0373926_0028835 | |||
| 2456 | Ga0373926_0029075 | |||
| 2457 | Ga0373926_0032719 | |||
| 2458 | Ga0373926_0043432 | |||
| 2459 | Ga0373926_0047324 | |||
| 2460 | Ga0373928_0000946 | |||
| 2461 | Ga0373928_0006891 | |||
| 2462 | Ga0373928_0007300 | |||
| 2463 | Ga0373928_0012096 | |||
| 2464 | Ga0373929_0001929 | |||
| 2465 | Ga0373929_0006669 | |||
| 2466 | Ga0373929_0007206 | |||
| 2467 | Ga0373929_0009835 | |||
| 2468 | Ga0373934_0013577 | |||
| 2469 | Ga0373934_0019405 | |||
| 2470 | Ga0373934_0032039 | |||
| 2471 | Ga0373934_0035872 | |||
| 2472 | Ga0373934_0046783 | |||
| 2473 | Ga0373940_0010842 | |||
| 2474 | Ga0373940_0011128 | |||
| 2475 | Ga0373940_0018103 | |||
| 2476 | Ga0373944_0014855 | |||
| 2477 | Ga0373944_0016429 | |||
| 2478 | Ga0373944_0021383 | |||
| 2479 | Ga0373944_0024960 | |||
| 2480 | Ga0373944_0034650 | |||
| 2481 | Ga0373944_0043614 | |||
| 2482 | Ga0373949_0001694 | |||
| 2483 | Ga0373949_0011756 | |||
| 2484 | Ga0373949_0012743 | |||
| 2485 | Ga0373949_0013882 | |||
| 2486 | Ga0373949_0015030 | |||
| 2487 | Ga0373949_0015471 | |||
| 2488 | Ga0373951_0009019 | |||
| 2489 | Ga0373951_0009934 | |||
| 2490 | Ga0373952_0003657 | |||
| 2491 | Ga0373952_0006744 | |||
| 2492 | Ga0373952_0007845 | |||
| 2493 | Ga0373952_0008810 | |||
| 2494 | Ga0373952_0010261 | |||
| 2495 | Ga0373952_0010284 | |||
| 2496 | Ga0373923_0018483 | |||
| 2497 | Ga0373923_0019969 | |||
| 2498 | Ga0373923_0025648 | |||
| 2499 | Ga0373923_0035979 | |||
| 2500 | Ga0373923_0053186 | |||
| 2501 | Ga0373932_0011001 | |||
| 2502 | Ga0373932_0015965 | |||
| 2503 | Ga0373932_0017556 | |||
| 2504 | Ga0373932_0019952 | |||
| 2505 | Ga0373932_0020402 | |||
| 2506 | Ga0373936_0018499 | |||
| 2507 | Ga0373936_0022073 | |||
| 2508 | Ga0373936_0029203 | |||
| 2509 | Ga0373936_0034041 | |||
| 2510 | Ga0373936_0034852 | |||
| 2511 | Ga0373936_0041728 | |||
| 2512 | Ga0373936_0048543 | |||
| 2513 | Ga0373936_0049141 | |||
| 2514 | Ga0373939_0000507 | |||
| 2515 | Ga0373939_0013571 | |||
| 2516 | Ga0373939_0014089 | |||
| 2517 | Ga0373939_0014583 | |||
| 2518 | Ga0373939_0017108 | |||
| 2519 | Ga0373939_0021455 | |||
| 2520 | Ga0373939_0025090 | |||
| 2521 | Ga0373941_0001278 | |||
| 2522 | Ga0373941_0002870 | |||
| 2523 | Ga0373941_0015100 | |||
| 2524 | Ga0373941_0016533 | |||
| 2525 | Ga0373941_0017809 | |||
| 2526 | Ga0373941_0041112 | |||
| 2527 | Ga0373945_0009851 | |||
| 2528 | Ga0373945_0017013 | |||
| 2529 | Ga0373945_0020459 | |||
| 2530 | Ga0373945_0022026 | |||
| 2531 | Ga0373945_0024237 | |||
| 2532 | Ga0373945_0024265 | |||
| 2533 | Ga0373945_0041168 | |||
| 2534 | Ga0373945_0041335 | |||
| 2535 | Ga0373945_0043898 | |||
| 2536 | Ga0373953_0012133 | |||
| 2537 | Ga0373953_0027360 | |||
| 2538 | Ga0373953_0028221 | |||
| 2539 | Ga0373953_0033980 | |||
| 2540 | Ga0373953_0039261 | |||
| 2541 | Ga0373953_0052928 | |||
| 2542 | Ga0373954_0035637 | |||
| 2543 | Ga0373954_0050070 | |||
| 2544 | Ga0373954_0052661 | |||
| 2545 | Ga0373954_0107734 | |||
| 2546 | Ga0373956_0013609 | |||
| 2547 | Ga0373956_0031977 | |||
| 2548 | Ga0373956_0032118 | |||
| 2549 | Ga0373956_0042988 | |||
| 2550 | Ga0373956_0046191 | |||
| 2551 | Ga0373956_0046381 | |||
| 2552 | Ga0373956_0056176 | |||
| 2553 | Ga0373957_0022818 | |||
| 2554 | Ga0373957_0027498 | |||
| 2555 | Ga0373957_0037771 | |||
| 2556 | Ga0373960_0002145 | |||
| 2557 | Ga0373960_0006003 | |||
| 2558 | Ga0373960_0012402 | |||
| 2559 | Ga0373960_0013073 | |||
| 2560 | Ga0373960_0014294 | |||
| 2561 | Ga0373960_0015841 | |||
| 2562 | Ga0373943_0022194 | |||
| 2563 | Ga0373943_0042122 | |||
| 2564 | Ga0373943_0045956 | |||
| 2565 | Ga0373943_0046084 | |||
| 2566 | Ga0373943_0046303 | |||
| 2567 | Ga0373943_0047595 | |||
| 2568 | Ga0373943_0052071 | |||
| 2569 | Ga0373943_0054791 | |||
| 2570 | Ga0373943_0055165 | |||
| 2571 | Ga0373943_0061960 | |||
| 2572 | Ga0373943_0074271 | |||
| 2573 | Ga0373943_0087541 | |||
| 2574 | Ga0373946_0023384 | |||
| 2575 | Ga0373946_0025465 | |||
| 2576 | Ga0373946_0027639 | |||
| 2577 | Ga0373946_0031856 | |||
| 2578 | Ga0373946_0047257 | |||
| 2579 | Ga0373946_0062722 | |||
| 2580 | Ga0373946_0075821 | |||
| 2581 | Ga0373955_0038184 | |||
| 2582 | Ga0373955_0050316 | |||
| 2583 | Ga0373955_0067671 | |||
| 2584 | Ga0373955_0084848 | |||
| 2585 | Ga0373955_0112589 | |||
| 2586 | Ga0373955_0114714 | |||
| 2587 | Ga0373942_0007684 | |||
| 2588 | Ga0373942_0008614 | |||
| 2589 | Ga0373942_0015948 | |||
| 2590 | Ga0373942_0019623 | |||
| 2591 | Ga0373961_0009229 | |||
| 2592 | Ga0373961_0012145 | |||
| 2593 | Ga0373961_0014244 | |||
| 2594 | Ga0373961_0021166 | |||
| 2595 | Ga0373962_0001001 | |||
| 2596 | Ga0373962_0012988 | |||
| 2597 | Ga0373962_0013251 | |||
| 2598 | Ga0373962_0014584 | |||
| 2599 | Ga0373962_0014884 | |||
| 2600 | Ga0373962_0026227 | |||
| 2601 | Ga0316574_0024526 | |||
| 2602 | Ga0316574_0077602 | |||
| 2603 | Ga0373924_0023989 | |||
| 2604 | Ga0373924_0025605 | |||
| 2605 | Ga0373924_0033533 | |||
| 2606 | Ga0373924_0038516 | |||
| 2607 | Ga0373931_0005795 | |||
| 2608 | Ga0373931_0011895 | |||
| 2609 | Ga0373931_0041301 | |||
| 2610 | Ga0373931_0041780 | |||
| 2611 | Ga0373931_0048262 | |||
| 2612 | Ga0373931_0055425 | |||
| 2613 | Ga0373931_0061126 | |||
| 2614 | Ga0373931_0063323 | |||
| 2615 | Ga0373931_0108319 | |||
| 2616 | Ga0373931_0110886 | |||
| 2617 | Ga0373935_0047080 | |||
| 2618 | Ga0373935_0073803 | |||
| 2619 | Ga0373935_0077338 | |||
| 2620 | Ga0373935_0086766 | |||
| 2621 | Ga0373935_0087760 | |||
| 2622 | Ga0373935_0088573 | |||
| 2623 | Ga0373935_0092325 | |||
| 2624 | Ga0373935_0100090 | |||
| 2625 | Ga0373935_0126734 | |||
| 2626 | Ga0373935_0127803 | |||
| 2627 | Ga0373935_0137298 | |||
| 2628 | Ga0373927_0007068 | |||
| 2629 | Ga0373927_0014831 | |||
| 2630 | Ga0373927_0057521 | |||
| 2631 | Ga0373927_0065844 | |||
| 2632 | Ga0373927_0073016 | |||
| 2633 | Ga0373927_0083316 | |||
| 2634 | Ga0373927_0086758 | |||
| 2635 | Ga0373927_0088128 | |||
| 2636 | Ga0373927_0091587 | |||
| 2637 | Ga0373927_0091884 | |||
| 2638 | Ga0373927_0104679 | |||
| 2639 | Ga0373927_0119149 | |||
| 2640 | Ga0373927_0124794 | |||
| 2641 | Ga0373927_0176869 | |||
| 2642 | Ga0373933_0027794 | |||
| 2643 | Ga0373933_0057552 | |||
| 2644 | Ga0373933_0067829 | |||
| 2645 | Ga0373933_0070012 | |||
| 2646 | Ga0373933_0086353 | |||
| 2647 | Ga0373933_0097530 | |||
| 2648 | Ga0373933_0141414 | |||
| 2649 | Ga0373933_0153653 | |||
| 2650 | Ga0373947_0025663 | |||
| 2651 | Ga0373947_0036040 | |||
| 2652 | Ga0373947_0072958 | |||
| 2653 | Ga0373947_0074042 | |||
| 2654 | Ga0373947_0075735 | |||
| 2655 | Ga0373947_0078723 | |||
| 2656 | Ga0373947_0087998 | |||
| 2657 | Ga0373947_0093467 | |||
| 2658 | Ga0373947_0127573 | |||
| 2659 | Ga0373947_0132125 | |||
| 2660 | Ga0373947_0163066 | |||
| 2661 | Ga0373937_0007313 | |||
| 2662 | Ga0373937_0019580 | |||
| 2663 | Ga0373937_0078280 | |||
| 2664 | Ga0373937_0119884 | |||
| 2665 | Ga0373937_0126289 | |||
| 2666 | Ga0373937_0134547 | |||
| 2667 | Ga0373937_0156136 | |||
| 2668 | Ga0373937_0166916 | |||
| 2669 | Ga0373937_0176371 | |||
| 2670 | Ga0373937_0176532 | |||
| 2671 | Ga0373937_0187234 | |||
| 2672 | Ga0373937_0239078 | |||
| 2673 | Ga0316582_0066463 | |||
| 2674 | Ga0316584_0089511 | |||
| 2675 | Ga0373925_0060284 | |||
| 2676 | Ga0373925_0078393 | |||
| 2677 | Ga0373925_0087543 | |||
| 2678 | Ga0373925_0089419 | |||
| 2679 | Ga0373925_0098733 | |||
| 2680 | Ga0373925_0109080 | |||
| 2681 | Ga0373925_0112429 | |||
| 2682 | Ga0373925_0118313 | |||
| 2683 | Ga0373925_0126950 | |||
| 2684 | Ga0373925_0161988 | |||
| 2685 | Ga0373925_0163238 | |||
| 2686 | Ga0373925_0176561 | |||
| 2687 | Ga0373925_0203343 | |||
| 2688 | Ga0395900_0103240 | |||
| 2689 | Ga0400487_34578 | |||
| 2690 | Ga0436365_0312816 | |||
| 2691 | Ga0436365_0382575 | |||
| 2692 | Ga0436360_0942193 | |||
| 2693 | Ga0436360_1200571 | |||
| 2694 | Ga0436361_0246471 | |||
| 2695 | Ga0436361_0473542 | |||
| 2696 | Ga0436361_0636700 | |||
| 2697 | Ga0436361_0670461 | |||
| 2698 | Ga0436361_0698129 | |||
| 2699 | Ga0436361_0718864 | |||
| 2700 | Ga0436363_0131824 | |||
| 2701 | Ga0436363_0158283 | |||
| 2702 | Ga0436362_0106990 | |||
| 2703 | Ga0436362_0261345 | |||
| 2704 | Ga0436362_0534509 | |||
| 2705 | Ga0439453_0003922 | |||
| 2706 | Ga0439441_001846 | |||
| 2707 | Ga0439448_0007438 | |||
| 2708 | Ga0439450_000217 | |||
| 2709 | Ga0439455_0008214 | |||
| 2710 | Ga0450923_005932 | |||
| 2711 | Ga0439458_0007191 | |||
| 2712 | Ga0439444_0004221 | |||
| 2713 | Ga0439459_0002947 | |||
| 2714 | Ga0439464_0000038 | |||
| 2715 | Ga0439460_0027438 | |||
| 2716 | Ga0466972_0048971 | |||
| 2717 | Ga0466972_0051164 | |||
| 2718 | Ga0466965_0040755 | |||
| 2719 | Ga0466964_0010858 | |||
| 2720 | Ga0453684_0003111 | |||
| 2721 | Ga0466968_0001716 | |||
| 2722 | Ga0466960_0029442 | |||
| 2723 | Ga0451576_0263042 | |||
| 2724 | Ga0466967_0246701 | |||
| 2725 | Ga0495617_008605 | |||
| 2726 | Ga0495617_020509 | |||
| 2727 | Ga0495617_023689 | |||
| 2728 | Ga0495617_025672 | |||
| 2729 | Ga0495617_030838 | |||
| 2730 | Ga0495617_038542 | |||
| 2731 | Ga0495627_019853 | |||
| 2732 | Ga0495627_026179 | |||
| 2733 | Ga0495592_0011412 | |||
| 2734 | Ga0495592_0040501 | |||
| 2735 | Ga0495592_0043444 | |||
| 2736 | Ga0495592_0050071 | |||
| 2737 | Ga0495592_0056195 | |||
| 2738 | Ga0495592_0069982 | |||
| 2739 | Ga0495592_0081367 | |||
| 2740 | Ga0495592_0094297 | |||
| 2741 | Ga0495592_0102495 | |||
| 2742 | Ga0495592_0138453 | |||
| 2743 | Ga0495592_0150097 | |||
| 2744 | Ga0495603_0018781 | |||
| 2745 | Ga0495603_0063660 | |||
| 2746 | Ga0495603_0070247 | |||
| 2747 | Ga0495603_0071214 | |||
| 2748 | Ga0495603_0075984 | |||
| 2749 | Ga0495603_0076895 | |||
| 2750 | Ga0495603_0078817 | |||
| 2751 | Ga0495603_0086777 | |||
| 2752 | Ga0495590_0002715 | |||
| 2753 | Ga0495590_0027418 | |||
| 2754 | Ga0495590_0037365 | |||
| 2755 | Ga0495591_016384 | |||
| 2756 | Ga0495629_0006149 | |||
| 2757 | Ga0495629_0037338 | |||
| 2758 | Ga0495629_0042309 | |||
| 2759 | Ga0495629_0067262 | |||
| 2760 | Ga0495629_0090664 | |||
| 2761 | Ga0495629_0090856 | |||
| 2762 | Ga0495629_0102877 | |||
| 2763 | Ga0495629_0109757 | |||
| 2764 | Ga0495629_0114280 | |||
| 2765 | Ga0495629_0140062 | |||
| 2766 | Ga0495629_0141265 | |||
| 2767 | Ga0495638_0018463 | |||
| 2768 | Ga0495638_0075879 | |||
| 2769 | Ga0495638_0081079 | |||
| 2770 | Ga0495638_0102866 | |||
| 2771 | Ga0495641_0012648 | |||
| 2772 | Ga0495641_0033106 | |||
| 2773 | Ga0495641_0034995 | |||
| 2774 | Ga0495641_0035897 | |||
| 2775 | Ga0495641_0046260 | |||
| 2776 | Ga0495641_0061712 | |||
| 2777 | Ga0495651_0035973 | |||
| 2778 | Ga0495651_0047705 | |||
| 2779 | Ga0495651_0048217 | |||
| 2780 | Ga0495651_0080442 | |||
| 2781 | Ga0495651_0085280 | |||
| 2782 | Ga0495651_0098957 | |||
| 2783 | Ga0495651_0103181 | |||
| 2784 | Ga0495651_0104839 | |||
| 2785 | Ga0495651_0105388 | |||
| 2786 | Ga0495651_0105553 | |||
| 2787 | Ga0495651_0111624 | |||
| 2788 | Ga0495653_0036782 | |||
| 2789 | Ga0495653_0051123 | |||
| 2790 | Ga0495653_0069246 | |||
| 2791 | Ga0495653_0095913 | |||
| 2792 | Ga0495653_0124359 | |||
| 2793 | Ga0495653_0151367 | |||
| 2794 | Ga0495653_0159121 | |||
| 2795 | Ga0495650_0032615 | |||
| 2796 | Ga0495650_0039373 | |||
| 2797 | Ga0495650_0039980 | |||
| 2798 | Ga0495650_0040413 | |||
| 2799 | Ga0495650_0040515 | |||
| 2800 | Ga0495650_0044241 | |||
| 2801 | Ga0495580_0000880 | |||
| 2802 | Ga0495580_0048764 | |||
| 2803 | Ga0495580_0054131 | |||
| 2804 | Ga0495580_0093419 | |||
| 2805 | Ga0495580_0103160 | |||
| 2806 | Ga0495580_0106586 | |||
| 2807 | Ga0495580_0114240 | |||
| 2808 | Ga0495580_0119052 | |||
| 2809 | Ga0495580_0125337 | |||
| 2810 | Ga0495580_0132887 | |||
| 2811 | Ga0495580_0133443 | |||
| 2812 | Ga0495582_0010960 | |||
| 2813 | Ga0495582_0030790 | |||
| 2814 | Ga0495582_0052335 | |||
| 2815 | Ga0495582_0052831 | |||
| 2816 | Ga0495582_0066369 | |||
| 2817 | Ga0495582_0070271 | |||
| 2818 | Ga0495582_0074957 | |||
| 2819 | Ga0495582_0127235 | |||
| 2820 | Ga0495605_0021678 | |||
| 2821 | Ga0495605_0025911 | |||
| 2822 | Ga0495605_0031097 | |||
| 2823 | Ga0495605_0041011 | |||
| 2824 | Ga0495605_0044532 | |||
| 2825 | Ga0495605_0066557 | |||
| 2826 | Ga0495639_0013188 | |||
| 2827 | Ga0495639_0017612 | |||
| 2828 | Ga0495639_0026386 | |||
| 2829 | Ga0495639_0035445 | |||
| 2830 | Ga0495639_0045413 | |||
| 2831 | Ga0495639_0073528 | |||
| 2832 | Ga0495662_0008404 | |||
| 2833 | Ga0495662_0025773 | |||
| 2834 | Ga0495662_0028706 | |||
| 2835 | Ga0495662_0039611 | |||
| 2836 | Ga0495662_0043105 | |||
| 2837 | Ga0495662_0045297 | |||
| 2838 | Ga0495662_0047303 | |||
| 2839 | Ga0495662_0050709 | |||
| 2840 | Ga0495662_0057550 | |||
| 2841 | Ga0495662_0073563 | |||
| 2842 | Ga0495664_0020362 | |||
| 2843 | Ga0495664_0020432 | |||
| 2844 | Ga0495664_0033433 | |||
| 2845 | Ga0495664_0060965 | |||
| 2846 | Ga0495664_0068180 | |||
| 2847 | Ga0495664_0088641 | |||
| 2848 | Ga0495664_0102074 | |||
| 2849 | Ga0495664_0117936 | |||
| 2850 | Ga0495664_0162135 | |||
| 2851 | Ga0495584_0014579 | |||
| 2852 | Ga0495584_0045356 | |||
| 2853 | Ga0495584_0052355 | |||
| 2854 | Ga0495584_0054238 | |||
| 2855 | Ga0495585_0016070 | |||
| 2856 | Ga0495585_0030086 | |||
| 2857 | Ga0495585_0038965 | |||
| 2858 | Ga0495585_0054498 | |||
| 2859 | Ga0495585_0056407 | |||
| 2860 | Ga0495585_0061064 | |||
| 2861 | Ga0495585_0064709 | |||
| 2862 | Ga0495594_0020857 | |||
| 2863 | Ga0495594_0037871 | |||
| 2864 | Ga0495594_0052904 | |||
| 2865 | Ga0495594_0059598 | |||
| 2866 | Ga0495594_0062521 | |||
| 2867 | Ga0495594_0065479 | |||
| 2868 | Ga0495594_0121191 | |||
| 2869 | Ga0495596_0016574 | |||
| 2870 | Ga0495596_0026630 | |||
| 2871 | Ga0495596_0027666 | |||
| 2872 | Ga0495596_0033435 | |||
| 2873 | Ga0495596_0035538 | |||
| 2874 | Ga0495596_0035974 | |||
| 2875 | Ga0495596_0040697 | |||
| 2876 | Ga0495596_0043665 | |||
| 2877 | Ga0495596_0050725 | |||
| 2878 | Ga0495607_0020383 | |||
| 2879 | Ga0495607_0064600 | |||
| 2880 | Ga0495607_0068901 | |||
| 2881 | Ga0495607_0077116 | |||
| 2882 | Ga0495583_0029046 | |||
| 2883 | Ga0495583_0043912 | |||
| 2884 | Ga0495606_0065670 | |||
| 2885 | Ga0495606_0068819 | |||
| 2886 | Ga0495606_0071302 | |||
| 2887 | Ga0495606_0130195 | |||
| 2888 | Ga0495608_0014629 | |||
| 2889 | Ga0495608_0034014 | |||
| 2890 | Ga0495608_0050596 | |||
| 2891 | Ga0495608_0060196 | |||
| 2892 | Ga0495608_0079876 | |||
| 2893 | Ga0495608_0086848 | |||
| 2894 | Ga0495608_0097009 | |||
| 2895 | Ga0495608_0108826 | |||
| 2896 | Ga0495610_0013838 | |||
| 2897 | Ga0495610_0047181 | |||
| 2898 | Ga0495610_0049342 | |||
| 2899 | Ga0495616_0024318 | |||
| 2900 | Ga0495616_0040654 | |||
| 2901 | Ga0495616_0043367 | |||
| 2902 | Ga0495616_0049485 | |||
| 2903 | Ga0495618_0034860 | |||
| 2904 | Ga0495618_0044246 | |||
| 2905 | Ga0495618_0061014 | |||
| 2906 | Ga0495618_0064599 | |||
| 2907 | Ga0495618_0071592 | |||
| 2908 | Ga0495620_0045055 | |||
| 2909 | Ga0495628_0004856 | |||
| 2910 | Ga0495628_0042604 | |||
| 2911 | Ga0495628_0079254 | |||
| 2912 | Ga0495628_0092681 | |||
| 2913 | Ga0495628_0093770 | |||
| 2914 | Ga0495628_0110516 | |||
| 2915 | Ga0495628_0125313 | |||
| 2916 | Ga0495628_0131756 | |||
| 2917 | Ga0495630_0045276 | |||
| 2918 | Ga0495630_0052557 | |||
| 2919 | Ga0495630_0101079 | |||
| 2920 | Ga0495630_0103202 | |||
| 2921 | Ga0495630_0107175 | |||
| 2922 | Ga0495630_0113875 | |||
| 2923 | Ga0495631_0006458 | |||
| 2924 | Ga0495631_0020194 | |||
| 2925 | Ga0495631_0021815 | |||
| 2926 | Ga0495631_0036836 | |||
| 2927 | Ga0495631_0038131 | |||
| 2928 | Ga0495631_0040872 | |||
| 2929 | Ga0495631_0048622 | |||
| 2930 | Ga0495631_0060397 | |||
| 2931 | Ga0495632_0028974 | |||
| 2932 | Ga0495632_0037177 | |||
| 2933 | Ga0495632_0073629 | |||
| 2934 | Ga0495637_0020653 | |||
| 2935 | Ga0495637_0039829 | |||
| 2936 | Ga0495637_0041797 | |||
| 2937 | Ga0495643_0047491 | |||
| 2938 | Ga0495644_0023582 | |||
| 2939 | Ga0495644_0028617 | |||
| 2940 | Ga0495644_0030987 | |||
| 2941 | Ga0495644_0031018 | |||
| 2942 | Ga0495644_0035425 | |||
| 2943 | Ga0495644_0040698 | |||
| 2944 | Ga0495644_0048045 | |||
| 2945 | Ga0495648_0012902 | |||
| 2946 | Ga0495648_0056926 | |||
| 2947 | Ga0495648_0075440 | |||
| 2948 | Ga0495648_0077293 | |||
| 2949 | Ga0495648_0084760 | |||
| 2950 | Ga0495663_0015446 | |||
| 2951 | Ga0495663_0016062 | |||
| 2952 | Ga0495663_0017858 | |||
| 2953 | Ga0495663_0018904 | |||
| 2954 | Ga0495663_0018947 | |||
| 2955 | Ga0495666_0016750 | |||
| 2956 | Ga0495666_0022058 | |||
| 2957 | Ga0495666_0023259 | |||
| 2958 | Ga0495666_0041216 | |||
| 2959 | Ga0495666_0044454 | |||
| 2960 | Ga0495666_0044584 | |||
| 2961 | Ga0495666_0052870 | |||
| 2962 | Ga0495666_0077042 | |||
| 2963 | Ga0495666_0092897 | |||
| 2964 | Ga0495642_0020825 | |||
| 2965 | Ga0495642_0032613 | |||
| 2966 | Ga0495642_0033883 | |||
| 2967 | Ga0495642_0035371 | |||
| 2968 | Ga0495642_0043162 | |||
| 2969 | Ga0495642_0060192 | |||
| 2970 | Ga0495652_0048344 | |||
| 2971 | Ga0495652_0049250 | |||
| 2972 | Ga0495652_0054943 | |||
| 2973 | Ga0495652_0062851 | |||
| 2974 | Ga0495652_0079071 | |||
| 2975 | Ga0495652_0080947 | |||
| 2976 | Ga0495652_0089016 | |||
| 2977 | Ga0495652_0094216 | |||
| 2978 | Ga0495652_0177482 | |||
| 2979 | Ga0495654_0014800 | |||
| 2980 | Ga0495654_0019427 | |||
| 2981 | Ga0495654_0020068 | |||
| 2982 | Ga0495654_0063469 | |||
| 2983 | Ga0495654_0076339 | |||
| 2984 | Ga0495665_0003029 | |||
| 2985 | Ga0495665_0027501 | |||
| 2986 | Ga0495665_0052306 | |||
| 2987 | Ga0495665_0054511 | |||
| 2988 | Ga0495665_0056543 | |||
| 2989 | Ga0495665_0057527 | |||
| 2990 | Ga0495665_0058208 | |||
| 2991 | Ga0495665_0059320 | |||
| 2992 | Ga0495665_0064412 | |||
| 2993 | Ga0495665_0085517 | |||
| 2994 | Ga0495665_0092561 | |||
| 2995 | Ga0495640_0024783 | |||
| 2996 | Ga0495640_0028141 | |||
| 2997 | Ga0495640_0072256 | |||
| 2998 | Ga0495640_0073346 | |||
| 2999 | Ga0495640_0077616 | |||
| 3000 | Ga0495640_0078047 | |||
| 3001 | Ga0495640_0089823 | |||
| 3002 | Ga0495640_0135955 | |||
| 3003 | Ga0495640_0140880 | |||
| 3004 | Ga0495586_0020384 | |||
| 3005 | Ga0495586_0027514 | |||
| 3006 | Ga0495586_0038083 | |||
| 3007 | Ga0495586_0043125 | |||
| 3008 | Ga0495586_0052389 | |||
| 3009 | Ga0495586_0067346 | |||
| 3010 | Ga0495586_0088717 | |||
| 3011 | Ga0495587_0011536 | |||
| 3012 | Ga0495587_0020418 | |||
| 3013 | Ga0495587_0035885 | |||
| 3014 | Ga0495587_0041088 | |||
| 3015 | Ga0495587_0052910 | |||
| 3016 | Ga0495587_0054912 | |||
| 3017 | Ga0495587_0058230 | |||
| 3018 | Ga0495587_0071458 | |||
| 3019 | Ga0495587_0071907 | |||
| 3020 | Ga0495587_0077330 | |||
| 3021 | Ga0495587_0078300 | |||
| 3022 | Ga0495587_0090596 | |||
| 3023 | Ga0495587_0107585 | |||
| 3024 | Ga0495598_0008844 | |||
| 3025 | Ga0495598_0017112 | |||
| 3026 | Ga0495598_0019449 | |||
| 3027 | Ga0495609_0030368 | |||
| 3028 | Ga0495609_0038789 | |||
| 3029 | Ga0495609_0043373 | |||
| 3030 | Ga0495609_0044208 | |||
| 3031 | Ga0495609_0045169 | |||
| 3032 | Ga0495621_0007581 | |||
| 3033 | Ga0495621_0020080 | |||
| 3034 | Ga0495621_0020565 | |||
| 3035 | Ga0495621_0023642 | |||
| 3036 | Ga0495621_0024274 | |||
| 3037 | Ga0495621_0034668 | |||
| 3038 | Ga0495621_0038333 | |||
| 3039 | Ga0495621_0038904 | |||
| 3040 | Ga0495621_0047343 | |||
| 3041 | Ga0495597_0039555 | |||
| 3042 | Ga0495597_0040728 | |||
| 3043 | Ga0495597_0040785 | |||
| 3044 | Ga0495645_0006552 | |||
| 3045 | Ga0495645_0043096 | |||
| 3046 | Ga0495645_0060671 | |||
| 3047 | Ga0495645_0076582 | |||
| 3048 | Ga0495645_0077563 | |||
| 3049 | Ga0495645_0099966 | |||
| 3050 | Ga0495645_0102976 | |||
| 3051 | Ga0495645_0185116 | |||
| 3052 | Ga0495645_0201764 | |||
| 3053 | Ga0495622_0013934 | |||
| 3054 | Ga0495622_0042867 | |||
| 3055 | Ga0495622_0048450 | |||
| 3056 | Ga0495622_0067333 | |||
| 3057 | Ga0495622_0073962 | |||
| 3058 | Ga0495633_0037709 | |||
| 3059 | Ga0495633_0037713 | |||
| 3060 | Ga0495633_0038281 | |||
| 3061 | Ga0495633_0043974 | |||
| 3062 | Ga0495633_0049606 | |||
| 3063 | Ga0495633_0050373 | |||
| 3064 | Ga0495633_0052718 | |||
| 3065 | Ga0495633_0071103 | |||
| 3066 | Ga0495633_0081410 | |||
| 3067 | Ga0495667_0056626 | |||
| 3068 | Ga0495667_0056661 | |||
| 3069 | Ga0495667_0066155 | |||
| 3070 | Ga0495667_0066894 | |||
| 3071 | Ga0495667_0079781 | |||
| 3072 | Ga0495667_0081374 | |||
| 3073 | Ga0495667_0083563 | |||
| 3074 | Ga0495667_0083780 | |||
| 3075 | Ga0495667_0094245 | |||
| 3076 | Ga0495667_0100051 | |||
| 3077 | Ga0495667_0182454 | |||
| 3078 | Ga0495656_0019432 | |||
| 3079 | Ga0495656_0024257 | |||
| 3080 | Ga0495656_0033132 | |||
| 3081 | Ga0495656_0033950 | |||
| 3082 | Ga0495656_0035583 | |||
| 3083 | Ga0495656_0037253 | |||
| 3084 | Ga0495656_0046150 | |||
| 3085 | Ga0495668_0045799 | |||
| 3086 | Ga0495668_0045859 | |||
| 3087 | Ga0495668_0056678 | |||
| 3088 | Ga0495668_0071304 | |||
| 3089 | Ga0495634_0020538 | |||
| 3090 | Ga0495634_0049509 | |||
| 3091 | Ga0495634_0072191 | |||
| 3092 | Ga0495634_0072813 | |||
| 3093 | Ga0495634_0080011 | |||
| 3094 | Ga0495634_0086066 | |||
| 3095 | Ga0495634_0087992 | |||
| 3096 | Ga0495634_0090058 | |||
| 3097 | Ga0495634_0102889 | |||
| 3098 | Ga0495634_0109724 | |||
| 3099 | Ga0495634_0140364 | |||
| 3100 | Ga0495611_0026294 | |||
| 3101 | Ga0495611_0027575 | |||
| 3102 | Ga0495611_0040329 | |||
| 3103 | Ga0495611_0044614 | |||
| 3104 | Ga0495625_0081765 | |||
| 3105 | Ga0495625_0124665 | |||
| 3106 | Ga0495625_0144949 | |||
| 3107 | Ga0495635_0002979 | |||
| 3108 | Ga0495635_0027913 | |||
| 3109 | Ga0495635_0035500 | |||
| 3110 | Ga0495635_0059712 | |||
| 3111 | Ga0495635_0085309 | |||
| 3112 | Ga0495635_0089635 | |||
| 3113 | Ga0495635_0094472 | |||
| 3114 | Ga0495635_0094808 | |||
| 3115 | Ga0495635_0107936 | |||
| 3116 | Ga0495635_0240344 | |||
| 3117 | Ga0495659_0006430 | |||
| 3118 | Ga0495659_0015791 | |||
| 3119 | Ga0495659_0023853 | |||
| 3120 | Ga0495659_0024405 | |||
| 3121 | Ga0495659_0027133 | |||
| 3122 | Ga0495661_0054055 | |||
| 3123 | Ga0495661_0064668 | |||
| 3124 | Ga0495661_0067868 | |||
| 3125 | Ga0495661_0070877 | |||
| 3126 | Ga0495661_0088218 | |||
| 3127 | Ga0495588_0028149 | |||
| 3128 | Ga0495588_0048702 | |||
| 3129 | Ga0495588_0053996 | |||
| 3130 | Ga0495588_0057846 | |||
| 3131 | Ga0495588_0075131 | |||
| 3132 | Ga0495588_0095669 | |||
| 3133 | Ga0495657_0023797 | |||
| 3134 | Ga0495657_0041514 | |||
| 3135 | Ga0495657_0041696 | |||
| 3136 | Ga0495657_0063083 | |||
| 3137 | Ga0495657_0069497 | |||
| 3138 | Ga0495657_0079730 | |||
| 3139 | Ga0495657_0088575 | |||
| 3140 | Ga0495657_0093043 | |||
| 3141 | Ga0495657_0099063 | |||
| 3142 | Ga0495657_0122957 | |||
| 3143 | Ga0495657_0138232 | |||
| 3144 | Ga0495657_0138522 | |||
| 3145 | Ga0495599_0019366 | |||
| 3146 | Ga0495599_0040766 | |||
| 3147 | Ga0495599_0041173 | |||
| 3148 | Ga0495599_0059385 | |||
| 3149 | Ga0495599_0060938 | |||
| 3150 | Ga0495599_0071195 | |||
| 3151 | Ga0495599_0073672 | |||
| 3152 | Ga0495599_0078119 | |||
| 3153 | Ga0495599_0078633 | |||
| 3154 | Ga0495599_0079350 | |||
| 3155 | Ga0495599_0134255 | |||
| 3156 | Ga0495623_0031253 | |||
| 3157 | Ga0495623_0042678 | |||
| 3158 | Ga0495623_0045734 | |||
| 3159 | Ga0495623_0067241 | |||
| 3160 | Ga0495623_0069670 | |||
| 3161 | Ga0495623_0071450 | |||
| 3162 | Ga0495623_0073924 | |||
| 3163 | Ga0495623_0073982 | |||
| 3164 | Ga0495623_0118561 | |||
| 3165 | Ga0495646_0010082 | |||
| 3166 | Ga0495646_0026121 | |||
| 3167 | Ga0495646_0035044 | |||
| 3168 | Ga0495646_0050763 | |||
| 3169 | Ga0495646_0052661 | |||
| 3170 | Ga0495646_0069763 | |||
| 3171 | Ga0495646_0070946 | |||
| 3172 | Ga0495646_0120882 | |||
| 3173 | Ga0495647_0008647 | |||
| 3174 | Ga0495647_0025989 | |||
| 3175 | Ga0495647_0028325 | |||
| 3176 | Ga0495647_0028396 | |||
| 3177 | Ga0495647_0031429 | |||
| 3178 | Ga0495647_0035710 | |||
| 3179 | Ga0495647_0042211 | |||
| 3180 | Ga0495658_0032854 | |||
| 3181 | Ga0495658_0046233 | |||
| 3182 | Ga0495658_0048064 | |||
| 3183 | Ga0495658_0055193 | |||
| 3184 | Ga0495658_0055508 | |||
| 3185 | Ga0495658_0076021 | |||
| 3186 | Ga0495658_0077784 | |||
| 3187 | Ga0495658_0097561 | |||
| 3188 | Ga0495658_0144772 | |||
| 3189 | Ga0495669_0008081 | |||
| 3190 | Ga0495669_0016951 | |||
| 3191 | Ga0495669_0039704 | |||
| 3192 | Ga0495669_0041491 | |||
| 3193 | Ga0495669_0042757 | |||
| 3194 | Ga0495669_0043272 | |||
| 3195 | Ga0495669_0043740 | |||
| 3196 | Ga0495669_0045601 | |||
| 3197 | Ga0495613_0027564 | |||
| 3198 | Ga0495613_0054710 | |||
| 3199 | Ga0495613_0054744 | |||
| 3200 | Ga0495613_0087754 | |||
| 3201 | Ga0495613_0093289 | |||
| 3202 | Ga0495613_0101882 | |||
| 3203 | Ga0495613_0102320 | |||
| 3204 | Ga0495613_0107574 | |||
| 3205 | Ga0495613_0109965 | |||
| 3206 | Ga0495613_0114537 | |||
| 3207 | Ga0495613_0120899 | |||
| 3208 | Ga0495624_0007398 | |||
| 3209 | Ga0495624_0053248 | |||
| 3210 | Ga0495624_0067784 | |||
| 3211 | Ga0495624_0074050 | |||
| 3212 | Ga0495624_0074973 | |||
| 3213 | Ga0495624_0076382 | |||
| 3214 | Ga0495624_0080252 | |||
| 3215 | Ga0495624_0081275 | |||
| 3216 | Ga0495624_0086146 | |||
| 3217 | Ga0495624_0089820 | |||
| 3218 | Ga0495624_0137289 | |||
| 3219 | Ga0495670_0047099 | |||
| 3220 | Ga0495670_0051352 | |||
| 3221 | Ga0495670_0053877 | |||
| 3222 | Ga0495670_0058467 | |||
| 3223 | Ga0495670_0058627 | |||
| 3224 | Ga0495671_0023097 | |||
| 3225 | Ga0495671_0034217 | |||
| 3226 | Ga0495671_0046966 | |||
| 3227 | Ga0495671_0052703 | |||
| 3228 | Ga0495671_0054883 | |||
| 3229 | Ga0495671_0057348 | |||
| 3230 | Ga0495671_0059373 | |||
| 3231 | Ga0495671_0079382 | |||
| 3232 | Ga0495649_0009131 | |||
| 3233 | Ga0495649_0043306 | |||
| 3234 | Ga0495649_0059104 | |||
| 3235 | Ga0495649_0072737 | |||
| 3236 | Ga0495649_0075377 | |||
| 3237 | Ga0495589_0038649 | |||
| 3238 | Ga0495589_0049000 | |||
| 3239 | Ga0495589_0053758 | |||
| 3240 | Ga0495589_0054364 | |||
| 3241 | Ga0495589_0054523 | |||
| 3242 | Ga0495589_0057791 | |||
| 3243 | Ga0495589_0073731 | |||
| 3244 | Ga0495600_0034021 | |||
| 3245 | Ga0495600_0077153 | |||
| 3246 | Ga0495600_0084620 | |||
| 3247 | Ga0495600_0085222 | |||
| 3248 | Ga0495600_0087976 | |||
| 3249 | Ga0495600_0089214 | |||
| 3250 | Ga0495600_0094170 | |||
| 3251 | Ga0495600_0103283 | |||
| 3252 | Ga0495600_0126453 | |||
| 3253 | Ga0495600_0148531 | |||
| 3254 | Ga0495660_0033908 | |||
| 3255 | Ga0495660_0052081 | |||
| 3256 | Ga0495660_0064625 | |||
| 3257 | Ga0495660_0081745 | |||
| 3258 | Ga0495581_0016597 | |||
| 3259 | Ga0495581_0021001 | |||
| 3260 | Ga0495581_0048598 | |||
| 3261 | Ga0495581_0060942 | |||
| 3262 | Ga0495581_0062156 | |||
| 3263 | Ga0495581_0062262 | |||
| 3264 | Ga0495581_0067589 | |||
| 3265 | Ga0495581_0125343 | |||
| 3266 | Ga0495604_0049482 | |||
| 3267 | Ga0495604_0058038 | |||
| 3268 | Ga0495604_0071204 | |||
| 3269 | Ga0495604_0082997 | |||
| 3270 | Ga0495604_0105918 | |||
| 3271 | Ga0495604_0106005 | |||
| 3272 | Ga0495604_0106802 | |||
| 3273 | Ga0495604_0108362 | |||
| 3274 | Ga0495604_0109646 | |||
| 3275 | Ga0495604_0172127 | |||
| 3276 | Ga0495636_0026435 | |||
| 3277 | Ga0495636_0028033 | |||
| 3278 | Ga0495636_0055681 | |||
| 3279 | Ga0495674_0005170 | |||
| 3280 | Ga0495674_0046151 | |||
| 3281 | Ga0495674_0047017 | |||
| 3282 | Ga0495674_0056352 | |||
| 3283 | Ga0495674_0088888 | |||
| 3284 | Ga0495674_0100796 | |||
| 3285 | Ga0495674_0105279 | |||
| 3286 | Ga0495674_0126068 | |||
| 3287 | Ga0495674_0154825 | |||
| 3288 | Ga0495674_0162572 | |||
| 3289 | Ga0495674_0175923 | |||
| 3290 | Ga0495674_0188826 | |||
| 3291 | Ga0495674_0240333 | |||
| 3292 | Ga0495674_0251156 | |||
| 3293 | Ga0495672_0037745 | |||
| 3294 | Ga0495672_0093999 | |||
| 3295 | Ga0495676_0053403 | |||
| 3296 | Ga0495676_0062588 | |||
| 3297 | Ga0495676_0082137 | |||
| 3298 | Ga0495676_0086275 | |||
| 3299 | Ga0495676_0089962 | |||
| 3300 | Ga0495676_0090875 | |||
| 3301 | Ga0495676_0127198 | |||
| 3302 | Ga0495676_0138754 | |||
| 3303 | Ga0495676_0139572 | |||
| 3304 | Ga0495680_0004184 | |||
| 3305 | Ga0495680_0047477 | |||
| 3306 | Ga0495680_0066829 | |||
| 3307 | Ga0495680_0095413 | |||
| 3308 | Ga0495680_0102361 | |||
| 3309 | Ga0495680_0103209 | |||
| 3310 | Ga0495680_0109829 | |||
| 3311 | Ga0495683_0018610 | |||
| 3312 | Ga0495683_0021599 | |||
| 3313 | Ga0495683_0032950 | |||
| 3314 | Ga0495683_0040651 | |||
| 3315 | Ga0495683_0055276 | |||
| 3316 | Ga0495683_0055517 | |||
| 3317 | Ga0495687_014824 | |||
| 3318 | Ga0495675_0026516 | |||
| 3319 | Ga0495675_0029225 | |||
| 3320 | Ga0495675_0048693 | |||
| 3321 | Ga0495675_0070619 | |||
| 3322 | Ga0495675_0078317 | |||
| 3323 | Ga0495675_0082631 | |||
| 3324 | Ga0495675_0083874 | |||
| 3325 | Ga0495677_0021279 | |||
| 3326 | Ga0495677_0027133 | |||
| 3327 | Ga0495677_0029995 | |||
| 3328 | Ga0495677_0031250 | |||
| 3329 | Ga0495677_0044238 | |||
| 3330 | Ga0495679_015342 | |||
| 3331 | Ga0495679_019576 | |||
| 3332 | Ga0495679_022585 | |||
| 3333 | Ga0495685_016625 | |||
| 3334 | Ga0495685_027332 | |||
| 3335 | Ga0495685_027828 | |||
| 3336 | Ga0495673_0028659 | |||
| 3337 | Ga0495673_0041736 | |||
| 3338 | Ga0495673_0045736 | |||
| 3339 | Ga0495681_0036277 | |||
| 3340 | Ga0495681_0053784 | |||
| 3341 | Ga0495681_0061792 | |||
| 3342 | Ga0495684_0034067 | |||
| 3343 | Ga0495684_0089247 | |||
| 3344 | Ga0495684_0096866 | |||
| 3345 | Ga0495684_0098660 | |||
| 3346 | Ga0495684_0099181 | |||
| 3347 | Ga0495684_0100644 | |||
| 3348 | Ga0495684_0101819 | |||
| 3349 | Ga0495684_0111466 | |||
| 3350 | Ga0495684_0112114 | |||
| 3351 | Ga0495684_0116989 | |||
| 3352 | Ga0495684_0177899 | |||
| 3353 | Ga0495684_0232871 | |||
| 3354 | Ga0495686_0073301 | |||
| 3355 | Ga0495593_0015021 | |||
| 3356 | Ga0495593_0032514 | |||
| 3357 | Ga0495593_0035357 | |||
| 3358 | Ga0495593_0037000 | |||
| 3359 | Ga0495593_0058103 | |||
| 3360 | Ga0495593_0059259 | |||
| 3361 | Ga0495593_0059320 | |||
| 3362 | Ga0495593_0062483 | |||
| 3363 | Ga0495593_0071394 | |||
| 3364 | Ga0495602_0035035 | |||
| 3365 | Ga0495602_0049663 | |||
| 3366 | Ga0495602_0080881 | |||
| 3367 | Ga0495602_0106288 | |||
| 3368 | Ga0495602_0109229 | |||
| 3369 | Ga0495602_0119989 | |||
| 3370 | Ga0495602_0125551 | |||
| 3371 | Ga0495602_0129255 | |||
| 3372 | Ga0495614_0017237 | |||
| 3373 | Ga0495614_0032792 | |||
| 3374 | Ga0495614_0033990 | |||
| 3375 | Ga0495614_0036862 | |||
| 3376 | Ga0495614_0043029 | |||
| 3377 | Ga0495614_0050148 | |||
| 3378 | Ga0495614_0060350 | |||
| 3379 | Ga0495615_0004037 | |||
| 3380 | Ga0495615_0007383 | |||
| 3381 | Ga0495626_0032603 | |||
| 3382 | Ga0495626_0034139 | |||
| 3383 | Ga0495626_0043559 | |||
| 3384 | Ga0495626_0050534 | |||
| 3385 | Ga0496100_0000672 | |||
| 3386 | Ga0496100_0045295 | |||
| 3387 | Ga0496100_0050208 | |||
| 3388 | Ga0496100_0062798 | |||
| 3389 | Ga0496100_0089641 | |||
| 3390 | Ga0496100_0090793 | |||
| 3391 | Ga0496100_0104957 | |||
| 3392 | Ga0496100_0108567 | |||
| 3393 | Ga0496100_0189760 | |||
| 3394 | Ga0496101_0004114 | |||
| 3395 | Ga0496101_0016725 | |||
| 3396 | Ga0496101_0051876 | |||
| 3397 | Ga0496101_0112529 | |||
| 3398 | Ga0496101_0114723 | |||
| 3399 | Ga0496101_0115866 | |||
| 3400 | Ga0496101_0141701 | |||
| 3401 | Ga0496101_0169078 | |||
| 3402 | Ga0496101_0248186 | |||
| 3403 | Ga0496102_0015290 | |||
| 3404 | Ga0496102_0055795 | |||
| 3405 | Ga0496102_0075273 | |||
| 3406 | Ga0496102_0145727 | |||
| 3407 | Ga0496102_0154835 | |||
| 3408 | Ga0496102_0168697 | |||
| 3409 | Ga0496102_0215990 | |||
| 3410 | Ga0496102_0219369 | |||
| 3411 | Ga0496102_0219398 | |||
| 3412 | Ga0496102_0284186 | |||
| 3413 | Ga0496103_0007026 | |||
| 3414 | Ga0496103_0058312 | |||
| 3415 | Ga0496103_0076928 | |||
| 3416 | Ga0496103_0077199 | |||
| 3417 | Ga0496103_0082231 | |||
| 3418 | Ga0496103_0082512 | |||
| 3419 | Ga0496103_0086282 | |||
| 3420 | Ga0496103_0086437 | |||
| 3421 | Ga0496104_0001705 | |||
| 3422 | Ga0496104_0019385 | |||
| 3423 | Ga0496104_0039985 | |||
| 3424 | Ga0496104_0040528 | |||
| 3425 | Ga0496104_0063093 | |||
| 3426 | Ga0496104_0117848 | |||
| 3427 | Ga0496104_0146435 | |||
| 3428 | Ga0496104_0153844 | |||
| 3429 | Ga0496104_0163919 | |||
| 3430 | Ga0496104_0228416 | |||
| 3431 | Ga0496105_0001112 | |||
| 3432 | Ga0496105_0009874 | |||
| 3433 | Ga0496105_0053167 | |||
| 3434 | Ga0496105_0124764 | |||
| 3435 | Ga0496105_0131478 | |||
| 3436 | Ga0496105_0152000 | |||
| 3437 | Ga0496106_0017946 | |||
| 3438 | Ga0496106_0040006 | |||
| 3439 | Ga0496106_0054310 | |||
| 3440 | Ga0496106_0110099 | |||
| 3441 | Ga0496106_0112788 | |||
| 3442 | Ga0496106_0116571 | |||
| 3443 | Ga0496106_0122434 | |||
| 3444 | Ga0496106_0141401 | |||
| 3445 | Ga0496107_0052726 | |||
| 3446 | Ga0496107_0060295 | |||
| 3447 | Ga0496107_0090811 | |||
| 3448 | Ga0496107_0093281 | |||
| 3449 | Ga0496107_0101544 | |||
| 3450 | Ga0496107_0105318 | |||
| 3451 | Ga0496107_0113571 | |||
| 3452 | Ga0496108_0073540 | |||
| 3453 | Ga0496108_0098873 | |||
| 3454 | Ga0496108_0132589 | |||
| 3455 | Ga0496108_0153287 | |||
| 3456 | Ga0496108_0186375 | |||
| 3457 | Ga0496109_0078418 | |||
| 3458 | Ga0496109_0162847 | |||
| 3459 | Ga0496109_0183184 | |||
| 3460 | Ga0496109_0185076 | |||
| 3461 | Ga0496109_0204293 | |||
| 3462 | Ga0496109_0266637 | |||
| 3463 | Ga0496110_0109441 | |||
| 3464 | Ga0496110_0113851 | |||
| 3465 | Ga0496110_0130306 | |||
| 3466 | Ga0496110_0151610 | |||
| 3467 | Ga0496110_0234769 | |||
| 3468 | Ga0496111_0034746 | |||
| 3469 | Ga0496111_0104413 | |||
| 3470 | Ga0496111_0106237 | |||
| 3471 | Ga0496111_0108966 | |||
| 3472 | Ga0496111_0175170 | |||
| 3473 | Ga0496112_0161202 | |||
| 3474 | Ga0496112_0190419 | |||
| 3475 | Ga0496112_0192106 | |||
| 3476 | Ga0496112_0244510 | |||
| 3477 | Ga0496113_0115226 | |||
| 3478 | Ga0496113_0125925 | |||
| 3479 | Ga0496114_0040626 | |||
| 3480 | Ga0496114_0067168 | |||
| 3481 | Ga0496114_0137843 | |||
| 3482 | Ga0496114_0139163 | |||
| 3483 | Ga0496114_0147849 | |||
| 3484 | Ga0496114_0170685 | |||
| 3485 | Ga0496114_0178141 | |||
| 3486 | Ga0496114_0182784 | |||
| 3487 | Ga0496114_0194513 | |||
| 3488 | Ga0496115_0039711 | |||
| 3489 | Ga0496115_0051785 | |||
| 3490 | Ga0496115_0060487 | |||
| 3491 | Ga0496115_0092717 | |||
| 3492 | Ga0496115_0106251 | |||
| 3493 | Ga0496115_0116289 | |||
| 3494 | Ga0496115_0141182 | |||
| 3495 | Ga0496115_0145860 | |||
| 3496 | Ga0496115_0202770 | |||
| 3497 | Ga0496115_0207041 | |||
| 3498 | Ga0496116_0023238 | |||
| 3499 | Ga0496117_0006792 | |||
| 3500 | Ga0496117_0039313 | |||
| 3501 | Ga0496117_0073620 | |||
| 3502 | Ga0496117_0083921 | |||
| 3503 | Ga0496117_0124415 | |||
| 3504 | Ga0496118_0055678 | |||
| 3505 | Ga0496118_0058201 | |||
| 3506 | Ga0496118_0099648 | |||
| 3507 | Ga0496118_0101503 | |||
| 3508 | Ga0496119_0008659 | |||
| 3509 | Ga0496119_0066048 | |||
| 3510 | Ga0496119_0072207 | |||
| 3511 | Ga0496119_0078005 | |||
| 3512 | Ga0496119_0079277 | |||
| 3513 | Ga0496120_0048391 | |||
| 3514 | Ga0496120_0052999 | |||
| 3515 | Ga0496120_0085661 | |||
| 3516 | Ga0496120_0095242 | |||
| 3517 | Ga0496121_0041096 | |||
| 3518 | Ga0496121_0078624 | |||
| 3519 | Ga0496121_0113113 | |||
| 3520 | Ga0496121_0133479 | |||
| 3521 | Ga0496122_0038660 | |||
| 3522 | Ga0496122_0126306 | |||
| 3523 | Ga0496123_0092929 | |||
| 3524 | Ga0496124_0119134 | |||
| 3525 | Ga0496124_0120854 | |||
| 3526 | Ga0496124_0126759 | |||
| 3527 | Ga0496125_0049739 | |||
| 3528 | Ga0496125_0054915 | |||
| 3529 | Ga0496125_0147995 | |||
| 3530 | Ga0496126_0094618 | |||
| 3531 | Ga0496126_0107470 | |||
| 3532 | Ga0496126_0107711 | |||
| 3533 | Ga0496126_0210040 | |||
| 3534 | Ga0495678_019042 | |||
| 3535 | Ga0495682_0013874 | |||
| 3536 | Ga0495682_0030442 | |||
| 3537 | Ga0495682_0062518 | |||
| 3538 | Ga0501291_000951 | |||
| 3539 | Ga0501067_0022408 | |||
| 3540 | Ga0501067_0081267 | |||
| 3541 | Ga0501069_0067551 | |||
| 3542 | Ga0501069_0084232 | |||
| 3543 | Ga0501070_0115317 | |||
| 3544 | Ga0501076_0178655 | |||
| 3545 | Ga0501235_001462 | |||
| 3546 | Ga0501250_000659 | |||
| 3547 | Ga0501251_001617 | |||
| 3548 | Ga0501252_000606 | |||
| 3549 | Ga0501225_0010575 | |||
| 3550 | Ga0501079_0213954 | |||
| 3551 | Ga0501081_0081363 | |||
| 3552 | Ga0501241_007521 | |||
| 3553 | nmdc:mga06z11_25769_c1 | |||
| 3554 | nmdc:mga04h51_31326_c1 | |||
| 3555 | nmdc:mga07m45_53547_c1 | |||
| 3556 | nmdc:mga07m45_68669_c1 | |||
| 3557 | nmdc:mga05p37_223130_c1 | |||
| 3558 | nmdc:mga05p37_279433_c1 | |||
| 3559 | nmdc:mga05p37_347935_c1 | |||
| 3560 | nmdc:mga0qj67_101206_c1 | |||
| 3561 | nmdc:mga0qj67_132787_c1 | |||
| 3562 | nmdc:mga06r32_145914_c1 | |||
| 3563 | nmdc:mga06r32_180946_c1 | |||
| 3564 | nmdc:mga06r32_25133_c1 | |||
| 3565 | nmdc:mga06r32_252095_c1 | |||
| 3566 | nmdc:mga08y16_155948_c1 | |||
| 3567 | nmdc:mga08y16_193525_c1 | |||
| 3568 | nmdc:mga08y16_211858_c1 | |||
| 3569 | nmdc:mga08y16_232732_c1 | |||
| 3570 | nmdc:mga08y16_234901_c1 | |||
| 3571 | nmdc:mga08y16_253344_c1 | |||
| 3572 | nmdc:mga08y16_95583_c1 | |||
| 3573 | nmdc:mga0n895_160517_c1 | |||
| 3574 | nmdc:mga0n895_200852_c1 | |||
| 3575 | nmdc:mga0n895_216713_c1 | |||
| 3576 | nmdc:mga0n895_223204_c1 | |||
| 3577 | nmdc:mga0n895_229910_c1 | |||
| 3578 | nmdc:mga0n895_236300_c1 | |||
| 3579 | nmdc:mga0n895_279247_c1 | |||
| 3580 | nmdc:mga0rr50_123157_c1 | |||
| 3581 | nmdc:mga0rr50_137056_c1 | |||
| 3582 | nmdc:mga0rr50_205996_c1 | |||
| 3583 | nmdc:mga0rr50_228092_c1 | |||
| 3584 | nmdc:mga0rr50_233160_c1 | |||
| 3585 | nmdc:mga0rr50_71232_c1 | |||
| 3586 | nmdc:mga08x19_125136_c1 | |||
| 3587 | nmdc:mga0a205_150320_c1 | |||
| 3588 | nmdc:mga0a205_153471_c1 | |||
| 3589 | nmdc:mga0a205_170169_c1 | |||
| 3590 | nmdc:mga0a205_171628_c1 | |||
| 3591 | nmdc:mga0a205_6547_c2 | |||
| 3592 | Ga0495601_0033150 | |||
| 3593 | Ga0495601_0044902 | |||
| 3594 | Ga0495601_0062551 | |||
| 3595 | Ga0495601_0066615 | |||
| 3596 | Ga0495601_0100646 | |||
| 3597 | Ga0495612_0013907 | |||
| 3598 | Ga0495612_0016415 | |||
| 3599 | Ga0495612_0018459 | |||
| 3600 | Ga0495612_0025642 | |||
| 3601 | Ga0495612_0029145 | |||
| 3602 | Ga0495612_0030929 | |||
| 3603 | Ga0495612_0047582 | |||
| 3604 | Ga0495595_0007104 | |||
| 3605 | Ga0495595_0013654 | |||
| 3606 | Ga0495595_0014010 | |||
| 3607 | Ga0495595_0021234 | |||
| 3608 | Ga0495595_0036714 | |||
| 3609 | Ga0495595_0039832 | |||
| 3610 | Ga0495595_0044492 | |||
| 3611 | Ga0495619_0036729 | |||
| 3612 | Ga0495619_0068635 | |||
| 3613 | Ga0495619_0080615 | |||
| 3614 | Ga0495619_0080727 | |||
| 3615 | Ga0495619_0082379 | |||
| 3616 | Ga0495619_0092316 | |||
| 3617 | Ga0495619_0092691 | |||
| 3618 | Ga0495619_0104272 | |||
| 3619 | Ga0500578_0075563 | |||
| 3620 | Ga0500643_012830 | |||
| 3621 | Ga0500651_0000666 | |||
| 3622 | Ga0500651_0084164 | |||
| 3623 | Ga0500641_0008723 | |||
| 3624 | Ga0500641_0067478 | |||
| 3625 | Ga0500650_0043581 | |||
| 3626 | Ga0500562_016489 | |||
| 3627 | Ga0500582_018410 | |||
| 3628 | Ga0500592_003775 | |||
| 3629 | Ga0500595_000309 | |||
| 3630 | Ga0500642_0060990 | |||
| 3631 | Ga0500658_0035903 | |||
| 3632 | Ga0500559_0008740 | |||
| 3633 | Ga0500577_0023178 | |||
| 3634 | Ga0500579_071191 | |||
| 3635 | Ga0500588_0012604 | |||
| 3636 | Ga0500589_008456 | |||
| 3637 | Ga0500604_0015925 | |||
| 3638 | Ga0500622_0014532 | |||
| 3639 | Ga0500627_0009532 | |||
| 3640 | Ga0500627_0069718 | |||
| 3641 | Ga0500634_0009635 | |||
| 3642 | Ga0500634_0080746 | |||
| 3643 | Ga0500636_0044694 | |||
| 3644 | Ga0500645_026521 | |||
| 3645 | Ga0587077_002586 | |||
| 3646 | Ga0587082_002402 | |||
| 3647 | Ga0587085_001833 | |||
| 3648 | Ga0587062_003294 | |||
| 3649 | Ga0587072_003897 | |||
| 3650 | Ga0530510_0199987 | |||
| 3651 | 2512348742 | |||
| 3652 | 2512351805 | |||
| 3653 | 2512351965 | |||
| 3654 | 2513558040 | |||
| 3655 | 2513720832 | |||
| 3656 | 2513723419 | |||
| 3657 | 2513723448 | |||
| 3658 | 2513723775 | |||
| 3659 | 2513723950 | |||
| 3660 | 2558860608 | |||
| 3661 | 2558862065 | |||
| 3662 | 2558862441 | |||
| 3663 | 2558865755 | |||
| 3664 | 2585264054 | |||
| 3665 | 2644027856 | |||
| 3666 | 2745075108 | |||
| 3667 | 2776257752 | |||
| 3668 | 2776260100 | |||
| 3669 | 2776263843 | |||
| 3670 | 2776264600 | |||
| 3671 | 2776264778 | |||
| 3672 | 2776264893 | |||
| 3673 | 2776265028 | |||
| 3674 | 2776266631 | |||
| 3675 | 2776266847 | |||
| 3676 | 2842329858 | |||
| 3677 | 2842354676 | |||
| 3678 | 2842460125 | |||
| 3679 | 2874130496 | |||
| 3680 | 2876763805 | |||
| 3681 | 2876763981 | |||
| 3682 | 2876767391 | |||
| 3683 | 2881671454 | |||
| 3684 | 2885383402 | |||
| 3685 | 2885414001 | |||
| 3686 | 2889791694 | |||
| 3687 | 2900642728 | |||
| 3688 | 2903778253 | |||
| 3689 | 2922363016 | |||
| 3690 | 2935769730 | |||
| 3691 | 2941538491 | |||
| 3692 | 8006985137 | |||
| 3693 | 8019649190 | |||
| 3694 | 8019657173 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8bgj-assembly2.cif.gz_B | crystal structure of reverse transcriptase domain from caloramator australicus cart-capp | 0.8755 | 91 | 304 |
| 8bgj-assembly2.cif.gz_B | crystal structure of reverse transcriptase domain from caloramator australicus cart-capp | 0.8502 | 91 | 304 |
| 5irg-assembly2.cif.gz_C | reverse transcriptase domain of group ii intron maturase from roseburia intestinalis in p212121 space group | 0.8441 | 15 | 323 |
| 8bgj-assembly3.cif.gz_C | crystal structure of reverse transcriptase domain from caloramator australicus cart-capp | 0.8427 | 80 | 304 |
| 5irg-assembly1.cif.gz_D | reverse transcriptase domain of group ii intron maturase from roseburia intestinalis in p212121 space group | 0.8425 | 15 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P05511_299_561_3.20.20.210 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.8757 | 83 | 300 | 3.20.20.210 |
| af_Q47688_90_332_3.30.70.270 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain | 0.8522 | 83 | 300 | 3.30.70.270 |
| af_A0A1D6JF34_14_351_3.30.70.270 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain | 0.8351 | 24 | 292 | 3.30.70.270 |
| af_A0A368UH40_1657_1911_3.30.70.270 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain | 0.8336 | 83 | 290 | 3.30.70.270 |
| af_Q54BA4_491_738_3.30.70.270 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain | 0.8313 | 91 | 300 | 3.30.70.270 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X7II12-F1-model_v4 | deleted | 0.9852 | 41 | 145 |
|
| AF-A0A6N0ZEU8-F1-model_v4 | Reverse transcriptase domain-containing protein | 0.9818 | 1 | 229 |
|
| AF-A0A176ZEU8-F1-model_v4 | Group II intron reverse transcriptase/maturase | 0.9808 | 2 | 361 |
GO:0003964
|
| AF-A0A2C9CGG6-F1-model_v4 | Strong similarity to group II intron-encoded protein LtrA (EC 2.7.7.49) | 0.9765 | 29 | 145 |
GO:0003720
|
| AF-A0A517YK91-F1-model_v4 | Group II intron-encoded protein LtrA | 0.9707 | 2 | 120 |
|