F495877

General Info

Members Datasets Scaffolds Average Seq Length
1845 584 3690 223

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10474243|Ga0105243_104742432
Length 242
Sequence MDSRLRGNDGSGDNCKNGITMSASNSQLILALSKGRIFEDTLPLLEAAGITVTENPEKSRKLILPTNDPHVRVLIVRATDVPTYVQHGAADFGVAGKDVLFEHGGEGLYQPVDLEIAKCRMSVAVKAGFDYEAAVRQGKRLRVATKFTQMARQHFAKKGVHVDLIKLYGSMELAPLVGLSDAIVDLVSTGSTLRANNLVEVEEIMDISSRLVVNQAALKLKRARLQPIIEAFERASQAKAQS

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
16 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
17 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
21 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
23 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
24 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
25 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
26 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
27 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
28 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
29 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
30 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
31 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
36 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
37 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
38 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
39 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
42 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
43 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
46 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
83 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
109 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
114 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
116 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
118 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
126 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
128 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
129 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
130 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
133 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
134 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
135 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
184 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
191 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
192 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
193 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
194 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
195 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
196 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
197 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
198 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
199 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
200 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
201 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
206 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
207 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
222 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
223 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
224 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
225 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
226 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
227 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
228 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
229 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
230 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
231 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
232 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
233 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
236 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
237 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
238 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
239 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
240 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
241 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
242 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
243 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
244 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
245 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
246 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
247 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
248 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
249 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
250 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
251 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
252 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
253 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
254 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
255 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
256 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
257 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
258 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
259 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
262 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
263 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
264 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
265 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
266 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
267 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
268 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
269 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
270 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
273 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
274 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
275 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
276 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
277 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
278 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
279 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
285 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
286 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
287 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
288 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
289 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
290 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
291 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
292 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
293 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
294 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
295 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
296 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
297 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
298 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
299 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
300 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
301 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
302 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
303 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
304 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
305 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
306 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
307 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
308 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
309 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
310 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
311 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
312 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
313 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
314 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
315 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
316 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
317 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
318 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
319 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
320 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
323 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
324 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
325 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
326 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
327 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
328 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
329 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
330 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
331 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
332 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
333 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
336 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
337 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
338 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
339 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
340 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
341 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
342 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
343 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
344 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
345 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
346 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
347 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
348 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
349 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
350 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
351 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
352 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
353 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
354 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
355 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
356 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
357 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
358 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
359 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
360 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
361 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
362 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
363 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
364 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
365 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
366 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
367 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
368 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
369 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
370 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
371 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
372 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
373 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
374 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
375 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
376 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
380 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
381 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
394 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
395 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
396 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
397 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
398 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
399 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
400 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
401 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
402 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
403 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
404 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
405 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
406 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
407 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
408 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
409 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
410 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
412 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
413 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
414 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
415 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
416 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
417 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
418 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
419 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
420 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
421 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
422 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
423 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
424 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
425 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
426 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
427 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
428 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
438 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
439 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
440 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
441 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
442 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
443 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
444 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
445 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
446 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
447 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
448 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
449 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
450 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
451 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
452 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
453 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
454 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
455 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
456 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
457 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
458 2519103095 Burkholderia sp. KJ006 Isolate Nodule
459 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
460 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
461 2547132512 Azospira oryzae 6a3 Isolate Unclassified
462 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
463 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
464 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
465 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
466 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
467 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
468 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
469 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
470 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
471 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
472 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
473 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
474 2643221556 Massilia sp. Root1485 Isolate Unclassified
475 2643221570 Acidovorax sp. Root568 Isolate Unclassified
476 2643221596 Acidovorax sp. Root70 Isolate Unclassified
477 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
478 2643221638 Duganella sp. Root336D2 Isolate Unclassified
479 2643221645 Massilia sp. Root351 Isolate Unclassified
480 2643221652 Acidovorax sp. Root402 Isolate Unclassified
481 2643221664 Massilia sp. Root418 Isolate Unclassified
482 2643221684 Massilia sp. Root133 Isolate Unclassified
483 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
484 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
485 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
486 2721755523 Delftia sp. HK171 Isolate Unclassified
487 2738541280 Massilia sp. GV090 Isolate Unclassified
488 2738541297 Duganella sp. GV083 Isolate Unclassified
489 2738541300 Massilia sp. GV016 Isolate Unclassified
490 2738541357 Duganella sp. GV053 Isolate Unclassified
491 2738543003 Duganella sp. GV066 Isolate Unclassified
492 2738543018 Massilia sp. GV045 Isolate Unclassified
493 2738543026 Duganella sp. GV089 Isolate Unclassified
494 2738543029 Duganella sp. GV039 Isolate Unclassified
495 2738543030 Massilia sp. GV097 Isolate Unclassified
496 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
497 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
498 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
499 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
500 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
501 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
502 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
503 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
504 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
505 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
506 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
507 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
508 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
509 2818991436 Collimonas arenae 515 Isolate Unclassified
510 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
511 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
512 2818991452 Burkholderia cepacia 561 Isolate Unclassified
513 2821131069 Duganella sp. 1224 Isolate Unclassified
514 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
515 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
516 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
517 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
518 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
519 2842711865 Duganella sp. R-73148 Isolate Unclassified
520 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
521 2857553236 Duganella sp. R-74557 Isolate Unclassified
522 2857558681 Duganella sp. R-74565 Isolate Unclassified
523 2857564685 Duganella sp. R-74599 Isolate Unclassified
524 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
525 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
526 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
527 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
528 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
529 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
530 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
531 2885266251 Ralstonia sp. SET104 Isolate Nodule
532 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
533 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
534 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
535 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
536 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
537 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
538 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
539 2904424332 Duganella sp. 1411 Isolate Rhizosphere
540 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
541 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
542 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
543 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
544 2904564687 Burkholderia sp. 571 Isolate Unclassified
545 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
546 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
547 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
548 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
549 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
550 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
551 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
552 2919476304 Duganella sp. 3397 Isolate Unclassified
553 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
554 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
555 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
556 2928058823 Ralstonia sp. 1138 Isolate Unclassified
557 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
558 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
559 2928163908 Burkholderia sp. 567 Isolate Unclassified
560 2928170801 Burkholderia sp. 572 Isolate Unclassified
561 2928536128 Burkholderia sola 565 Isolate Unclassified
562 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
563 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
564 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
565 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
566 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
567 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
568 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
569 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
570 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
571 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
572 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
573 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
574 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
575 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
576 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
577 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
578 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
579 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
580 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
581 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
582 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
583 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
584 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91
Metatranscriptomes 1.08
Isolates 7.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.28
Nodule 1.95
Rhizoplane 3.79
Rhizosphere 71.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10474243 3300009148 Bacteria 1179
2 JGI24740J21852_10000135 3300001979 Bacteria 28041
3 JGI24740J21852_10001768 3300001979 Bacteria 9916
4 JGI24740J21852_10001853 3300001979 Bacteria 9683
5 JGI24740J21852_10005999 3300001979 Bacteria 5080
6 JGI24739J22299_10022915 3300001989 Bacteria 2211
7 JGI24737J22298_10022880 3300001990 Bacteria 1985
8 JGI24735J21928_10000235 3300002067 Bacteria 19503
9 JGI24735J21928_10001052 3300002067 Bacteria 9890
10 JGI24735J21928_10007731 3300002067 Bacteria 3495
11 JGI24735J21928_10013935 3300002067 Bacteria 2521
12 JGI25155J39150_1000252 3300002704 Bacteria 20486
13 JGI25155J39150_1000471 3300002704 Bacteria 10080
14 JGI25156J39149_1000288 3300002705 Bacteria 33984
15 JGI25156J39149_1002224 3300002705 Bacteria 7180
16 JGI25156J39149_1007840 3300002705 Bacteria 2756
17 JGI25156J39149_1008996 3300002705 Bacteria 2464
18 JGI25156J39149_1009715 3300002705 Bacteria 2316
19 JGI25156J39149_1009801 3300002705 Bacteria 2299
20 JGI25162J39368_1000040 3300002737 Bacteria 175938
21 JGI25154J39366_1000311 3300002738 Bacteria 28175
22 JGI25154J39366_1000313 3300002738 Bacteria 28101
23 JGI25154J39366_1000782 3300002738 Bacteria 14066
24 JGI25154J39366_1000843 3300002738 Bacteria 13310
25 JGI25158J39367_1001551 3300002739 Bacteria 3983
26 JGI25157J39369_1000171 3300002741 Bacteria 54600
27 JGI25157J39369_1017636 3300002741 Bacteria 865
28 JGI25163J39215_1002715 3300002771 Bacteria 1674
29 JGI25152J39213_1003291 3300002773 Bacteria 5586
30 JGI25150J39212_1002934 3300002774 Bacteria 4114
31 JGI25159J45721_1001892 3300002987 Bacteria 8366
32 JGI25159J45721_1003724 3300002987 Bacteria 5285
33 JGI25159J45721_1009166 3300002987 Bacteria 2636
34 JGI25151J46595_10004715 3300003187 Bacteria 7166
35 JGI25165J46597_1000051 3300003214 Bacteria 241012
36 JGI25165J46597_1000794 3300003214 Bacteria 23941
37 JGI25165J46597_1002173 3300003214 Bacteria 6998
38 JGI25153J46596_10009739 3300003215 Bacteria 4419
39 JGI25160J50197_1000146 3300003354 Bacteria 63378
40 JGI25160J50197_1010487 3300003354 Bacteria 3348
41 JGI25161J50226_1001522 3300003374 Bacteria 6845
42 JGI25161J50226_1011238 3300003374 Bacteria 1138
43 Ga0007409J51694_1025088 3300003575 Bacteria 3199
44 Ga0007409J51694_1048233 3300003575 Bacteria 4403
45 Ga0006562J51391_1104372 3300003578 Bacteria 2395
46 Ga0055538_1000025 3300003751 Bacteria 241012
47 Ga0055538_1000038 3300003751 Bacteria 186588
48 Ga0055538_1008095 3300003751 Bacteria 912
49 Ga0055539_1000032 3300003752 Bacteria 241012
50 Ga0055539_1000049 3300003752 Bacteria 186588
51 Ga0055539_1000218 3300003752 Bacteria 40999
52 Ga0055539_1009140 3300003752 Bacteria 1233
53 Ga0055533_1000042 3300003756 Bacteria 241012
54 Ga0055533_1000060 3300003756 Bacteria 186588
55 Ga0055533_1000476 3300003756 Bacteria 15060
56 Ga0055533_1002544 3300003756 Bacteria 4087
57 Ga0055532_1000044 3300003758 Bacteria 191110
58 Ga0055532_1000066 3300003758 Bacteria 139987
59 Ga0055532_1000092 3300003758 Bacteria 103243
60 Ga0055525_1000028 3300003759 Bacteria 331683
61 Ga0055525_1000050 3300003759 Bacteria 241012
62 Ga0055525_1000068 3300003759 Bacteria 186588
63 Ga0055527_1000035 3300003760 Bacteria 138481
64 Ga0055527_1000754 3300003760 Bacteria 9044
65 Ga0055527_1000965 3300003760 Bacteria 7064
66 Ga0055527_1001071 3300003760 Bacteria 6487
67 Ga0055535_1000046 3300003761 Bacteria 139987
68 Ga0055535_1000050 3300003761 Bacteria 138481
69 Ga0055535_1003356 3300003761 Bacteria 4596
70 Ga0055535_1003379 3300003761 Bacteria 4574
71 Ga0055542_1000120 3300003762 Bacteria 103243
72 Ga0055542_1000632 3300003762 Bacteria 29602
73 Ga0055542_1003203 3300003762 Bacteria 4596
74 Ga0055542_1003219 3300003762 Bacteria 4574
75 Ga0055529_1000015 3300003763 Bacteria 366950
76 Ga0055529_1000087 3300003763 Bacteria 139975
77 Ga0055529_1000089 3300003763 Bacteria 138481
78 Ga0055529_1001970 3300003763 Bacteria 4596
79 Ga0055529_1007909 3300003763 Bacteria 1428
80 Ga0055526_1000007 3300003771 Bacteria 321998
81 Ga0055526_1000037 3300003771 Bacteria 134834
82 Ga0055526_1000343 3300003771 Bacteria 38159
83 Ga0055526_1007575 3300003771 Bacteria 5607
84 Ga0055526_1009468 3300003771 Bacteria 4677
85 Ga0055526_1009857 3300003771 Bacteria 4532
86 Ga0055526_1011535 3300003771 Bacteria 3967
87 Ga0055526_1022838 3300003771 Bacteria 2110
88 Ga0055537_1000919 3300003773 Bacteria 13817
89 Ga0055537_1006082 3300003773 Bacteria 3124
90 Ga0055537_1007456 3300003773 Bacteria 2635
91 Ga0055537_1009989 3300003773 Bacteria 2039
92 Ga0055524_1000247 3300003775 Bacteria 56379
93 Ga0055524_1000274 3300003775 Bacteria 51286
94 Ga0055524_1000669 3300003775 Bacteria 24026
95 Ga0055524_1006368 3300003775 Bacteria 5124
96 Ga0055524_1007455 3300003775 Bacteria 4643
97 Ga0055524_1008701 3300003775 Bacteria 4196
98 Ga0055524_1012087 3300003775 Bacteria 3334
99 Ga0055536_1000176 3300003781 Bacteria 53490
100 Ga0055534_1000243 3300003784 Bacteria 38818
101 Ga0055534_1001271 3300003784 Bacteria 10271
102 Ga0055534_1004240 3300003784 Bacteria 4222
103 Ga0055528_1000136 3300003790 Bacteria 58873
104 Ga0055528_1003558 3300003790 Bacteria 7767
105 Ga0055528_1018811 3300003790 Bacteria 2324
106 Ga0055530_10012077 3300003791 Bacteria 3040
107 Ga0055530_10023764 3300003791 Bacteria 1754
108 Ga0055540_1000260 3300003792 Bacteria 47714
109 Ga0055531_10013625 3300003794 Bacteria 3732
110 Ga0055531_10016969 3300003794 Bacteria 3104
111 Ga0055531_10018308 3300003794 Bacteria 2899
112 Ga0055541_1000023 3300003841 Bacteria 241012
113 Ga0055541_1000036 3300003841 Bacteria 186588
114 Ga0055541_1000458 3300003841 Bacteria 11711
115 Ga0058692_1002468 3300003856 Bacteria 6173
116 Ga0055543_1001677 3300004625 Bacteria 8403
117 Ga0055543_1013860 3300004625 Bacteria 1582
118 Ga0065165_1000034 3300005262 Bacteria 214644
119 Ga0065165_1000648 3300005262 Bacteria 50260
120 Ga0065165_1002291 3300005262 Bacteria 16790
121 Ga0065165_1004802 3300005262 Bacteria 8063
122 Ga0065165_1019021 3300005262 Bacteria 2466
123 Ga0065704_10074875 3300005289 Bacteria 5943
124 Ga0065715_10031298 3300005293 Bacteria 2012
125 Ga0070658_10009738 3300005327 Bacteria 7717
126 Ga0070658_10252810 3300005327 Bacteria 1495
127 Ga0070658_10298740 3300005327 Bacteria 1373
128 Ga0070670_100051316 3300005331 Bacteria 3543
129 Ga0070670_100583848 3300005331 Bacteria 999
130 Ga0068869_100145809 3300005334 Bacteria 1832
131 Ga0068869_100374272 3300005334 Bacteria 1166
132 Ga0070680_100217122 3300005336 Bacteria 1614
133 Ga0070680_100400374 3300005336 Bacteria 1170
134 Ga0070680_100679046 3300005336 Bacteria 886
135 Ga0070682_100005659 3300005337 Bacteria 6969
136 Ga0070660_100000025 3300005339 Bacteria 90277
137 Ga0070660_100000555 3300005339 Bacteria 25061
138 Ga0070660_100010089 3300005339 Bacteria 6665
139 Ga0070660_100051976 3300005339 Bacteria 3157
140 Ga0070660_100058207 3300005339 Bacteria 2995
141 Ga0070660_100612637 3300005339 Bacteria 911
142 Ga0070661_100000262 3300005344 Bacteria 43135
143 Ga0070661_100022926 3300005344 Bacteria 4472
144 Ga0070661_100164696 3300005344 Bacteria 1681
145 Ga0070674_100040498 3300005356 Bacteria 3152
146 Ga0070659_100000264 3300005366 Bacteria 41481
147 Ga0070659_100005724 3300005366 Bacteria 8949
148 Ga0070659_100018272 3300005366 Bacteria 5292
149 Ga0070667_100010109 3300005367 Bacteria 7807
150 Ga0070663_100000023 3300005455 Bacteria 111250
151 Ga0070663_100000091 3300005455 Bacteria 40975
152 Ga0070663_100018911 3300005455 Bacteria 4528
153 Ga0070663_100091103 3300005455 Bacteria 2259
154 Ga0070678_100025024 3300005456 Bacteria 4007
155 Ga0070662_100095737 3300005457 Bacteria 2238
156 Ga0070662_100134647 3300005457 Bacteria 1909
157 Ga0070681_10722485 3300005458 Bacteria 912
158 Ga0070685_10221124 3300005466 Bacteria 1241
159 Ga0070679_100054548 3300005530 Bacteria 3979
160 Ga0070679_100128291 3300005530 Bacteria 2518
161 Ga0070679_100332861 3300005530 Bacteria 1467
162 Ga0068853_100700698 3300005539 Bacteria 966
163 Ga0068853_100737576 3300005539 Bacteria 941
164 Ga0070672_100548352 3300005543 Bacteria 1004
165 Ga0070665_100712212 3300005548 Bacteria 1017
166 Ga0068855_100001111 3300005563 Bacteria 33458
167 Ga0068855_100006806 3300005563 Bacteria 13869
168 Ga0068855_100008147 3300005563 Bacteria 12665
169 Ga0068855_100016221 3300005563 Bacteria 8958
170 Ga0068855_100059989 3300005563 Bacteria 4450
171 Ga0068855_100148173 3300005563 Bacteria 2670
172 Ga0068855_100299736 3300005563 Bacteria 1780
173 Ga0068855_100374634 3300005563 Bacteria 1564
174 Ga0068855_100491942 3300005563 Bacteria 1334
175 Ga0070664_100000018 3300005564 Bacteria 125281
176 Ga0070664_100026949 3300005564 Bacteria 4773
177 Ga0070664_100144131 3300005564 Bacteria 2099
178 Ga0070664_100401467 3300005564 Bacteria 1253
179 Ga0068857_100001732 3300005577 Bacteria 17547
180 Ga0068857_100225732 3300005577 Bacteria 1712
181 Ga0068857_100283044 3300005577 Bacteria 1525
182 Ga0068854_100000172 3300005578 Bacteria 43732
183 Ga0068854_100007750 3300005578 Bacteria 6865
184 Ga0068854_100104816 3300005578 Bacteria 2125
185 Ga0068856_100000070 3300005614 Bacteria 95320
186 Ga0068856_100199213 3300005614 Bacteria 2017
187 Ga0068856_100314369 3300005614 Bacteria 1584
188 Ga0068856_100367835 3300005614 Bacteria 1457
189 Ga0068856_100599143 3300005614 Bacteria 1123
190 Ga0068852_100010880 3300005616 Bacteria 6817
191 Ga0068852_100035944 3300005616 Bacteria 4140
192 Ga0068852_100518981 3300005616 Bacteria 1188
193 Ga0068852_100843943 3300005616 Bacteria 931
194 Ga0068863_100273120 3300005841 Bacteria 1637
195 Ga0068862_100023985 3300005844 Bacteria 5114
196 Ga0081539_10032489 3300005985 Bacteria 3196
197 Ga0075365_10171293 3300006038 Bacteria 1515
198 Ga0075368_10117034 3300006042 Bacteria 1102
199 Ga0070712_100149818 3300006175 Bacteria 1790
200 Ga0075362_10039286 3300006177 Bacteria 2080
201 Ga0068871_100077185 3300006358 Bacteria 2753
202 Ga0075430_100050939 3300006846 Bacteria 3491
203 Ga0068865_100497723 3300006881 Bacteria 1016
204 Ga0079104_1000016 3300006946 Bacteria 313865
205 Ga0079104_1000711 3300006946 Bacteria 30224
206 Ga0079104_1006155 3300006946 Bacteria 4615
207 Ga0099826_10000008 3300006948 Bacteria 380974
208 Ga0099826_10000024 3300006948 Bacteria 148974
209 Ga0105251_10004486 3300009011 Bacteria 9472
210 Ga0105251_10030439 3300009011 Bacteria 2711
211 Ga0105251_10051013 3300009011 Bacteria 1974
212 Ga0105251_10072269 3300009011 Bacteria 1604
213 Ga0105244_10000412 3300009036 Bacteria 39755
214 Ga0105244_10002472 3300009036 Bacteria 13911
215 Ga0105244_10085866 3300009036 Bacteria 1552
216 Ga0105244_10117988 3300009036 Bacteria 1286
217 Ga0105244_10121236 3300009036 Bacteria 1266
218 Ga0105244_10169461 3300009036 Bacteria 1039
219 Ga0105250_10009366 3300009092 Bacteria 4128
220 Ga0105250_10019362 3300009092 Bacteria 2752
221 Ga0105250_10110629 3300009092 Bacteria 1125
222 Ga0105240_10006365 3300009093 Bacteria 17386
223 Ga0105240_10006528 3300009093 Bacteria 17126
224 Ga0105240_10008072 3300009093 Bacteria 15128
225 Ga0105240_10026536 3300009093 Bacteria 7600
226 Ga0105240_10128381 3300009093 Bacteria 3044
227 Ga0105240_10300619 3300009093 Bacteria 1836
228 Ga0105240_10393484 3300009093 Bacteria 1562
229 Ga0105245_10169237 3300009098 Bacteria 2080
230 Ga0105245_10246184 3300009098 Bacteria 1735
231 Ga0105243_10009503 3300009148 Bacteria 7402
232 Ga0105243_10010684 3300009148 Bacteria 6959
233 Ga0105241_10021587 3300009174 Bacteria 4761
234 Ga0105241_10071497 3300009174 Bacteria 2694
235 Ga0105241_10232011 3300009174 Bacteria 1556
236 Ga0105241_10809255 3300009174 Bacteria 864
237 Ga0105242_10230046 3300009176 Bacteria 1661
238 Ga0105242_10295858 3300009176 Bacteria 1476
239 Ga0105242_10601415 3300009176 Bacteria 1062
240 Ga0105248_10022233 3300009177 Bacteria 7032
241 Ga0105237_10037418 3300009545 Bacteria 4905
242 Ga0105237_10063263 3300009545 Bacteria 3698
243 Ga0105237_10182266 3300009545 Bacteria 2100
244 Ga0105237_10313441 3300009545 Bacteria 1572
245 Ga0105238_10000037 3300009551 Bacteria 163954
246 Ga0105238_10004242 3300009551 Bacteria 14244
247 Ga0105238_10141596 3300009551 Bacteria 2381
248 Ga0105238_10155359 3300009551 Bacteria 2263
249 Ga0105238_10303145 3300009551 Bacteria 1581
250 Ga0105238_10800359 3300009551 Bacteria 958
251 Ga0105239_10013346 3300010375 Bacteria 9128
252 Ga0105239_10030147 3300010375 Bacteria 5964
253 Ga0105239_10598343 3300010375 Bacteria 1258
254 Ga0105239_11135403 3300010375 Bacteria 900
255 Ga0105246_10515812 3300011119 Bacteria 1018
256 Ga0105246_10922743 3300011119 Bacteria 785
257 Ga0157373_10010458 3300013100 Bacteria 6827
258 Ga0157373_10029055 3300013100 Bacteria 3986
259 Ga0157371_10000003 3300013102 Bacteria 543317
260 Ga0157371_10000275 3300013102 Bacteria 69649
261 Ga0157371_10194209 3300013102 Bacteria 1454
262 Ga0157370_10000237 3300013104 Bacteria 70247
263 Ga0157370_10000560 3300013104 Bacteria 46440
264 Ga0157370_10016731 3300013104 Bacteria 7420
265 Ga0157370_10222721 3300013104 Bacteria 1747
266 Ga0157369_10000147 3300013105 Bacteria 100084
267 Ga0157369_10000872 3300013105 Bacteria 38509
268 Ga0157369_10002777 3300013105 Bacteria 20906
269 Ga0157369_10015223 3300013105 Bacteria 8679
270 Ga0157369_10028956 3300013105 Bacteria 6126
271 Ga0157369_10140094 3300013105 Bacteria 2560
272 Ga0157369_10205442 3300013105 Bacteria 2066
273 Ga0157369_10505654 3300013105 Bacteria 1250
274 Ga0157374_10000251 3300013296 Bacteria 49614
275 Ga0157378_10272358 3300013297 Bacteria 1629
276 Ga0157378_10549407 3300013297 Bacteria 1160
277 Ga0157378_10696155 3300013297 Bacteria 1035
278 Ga0163162_10016362 3300013306 Bacteria 7249
279 Ga0163162_10191271 3300013306 Bacteria 2174
280 Ga0157372_10000307 3300013307 Bacteria 54398
281 Ga0157372_10000323 3300013307 Bacteria 52602
282 Ga0157372_11030646 3300013307 Bacteria 953
283 Ga0182008_10008961 3300014497 Bacteria 5424
284 Ga0182008_10099147 3300014497 Bacteria 1439
285 Ga0157379_10054648 3300014968 Bacteria 3568
286 Ga0157379_10292136 3300014968 Bacteria 1484
287 Ga0182006_1000023 3300015261 Bacteria 275031
288 Ga0182006_1000125 3300015261 Bacteria 82143
289 Ga0182006_1000649 3300015261 Bacteria 24690
290 Ga0182006_1050376 3300015261 Bacteria 1604
291 Ga0182007_10000082 3300015262 Bacteria 71660
292 Ga0182007_10000738 3300015262 Bacteria 18494
293 Ga0182007_10018446 3300015262 Bacteria 2527
294 Ga0182007_10031446 3300015262 Bacteria 1807
295 Ga0182007_10053762 3300015262 Bacteria 1325
296 Ga0182007_10083360 3300015262 Bacteria 1050
297 Ga0182005_1000006 3300015265 Bacteria 515188
298 Ga0182005_1000047 3300015265 Bacteria 126754
299 Ga0182005_1015068 3300015265 Bacteria 2158
300 Ga0183361_10015 3300016635 Bacteria 166772
301 Ga0206356_11205717 3300020070 Bacteria 3217
302 Ga0206351_10335588 3300020077 Bacteria 14215
303 Ga0154015_1261654 3300020610 Bacteria 5442
304 Ga0213872_10000024 3300021361 Bacteria 155437
305 Ga0213872_10000714 3300021361 Bacteria 24970
306 Ga0213872_10030904 3300021361 Bacteria 2455
307 Ga0213872_10034286 3300021361 Bacteria 2323
308 Ga0213872_10239475 3300021361 Bacteria 767
309 Ga0224712_10000002 3300022467 Bacteria 45137
310 Ga0209435_100004 3300025206 Bacteria 633417
311 Ga0209435_100168 3300025206 Bacteria 20495
312 Ga0209760_102818 3300025207 Bacteria 1595
313 Ga0209436_104927 3300025208 Bacteria 3196
314 Ga0209784_100010 3300025224 Bacteria 683664
315 Ga0209784_100021 3300025224 Bacteria 408534
316 Ga0209784_100052 3300025224 Bacteria 182783
317 Ga0209784_100807 3300025224 Bacteria 7281
318 Ga0209784_102019 3300025224 Bacteria 2253
319 Ga0209566_100008 3300025225 Bacteria 683664
320 Ga0209566_100039 3300025225 Bacteria 303368
321 Ga0209566_100068 3300025225 Bacteria 177484
322 Ga0209566_100235 3300025225 Bacteria 53611
323 Ga0209566_100312 3300025225 Bacteria 43942
324 Ga0209566_101794 3300025225 Bacteria 4993
325 Ga0209674_100019 3300025226 Bacteria 683664
326 Ga0209674_100036 3300025226 Bacteria 408534
327 Ga0209674_100087 3300025226 Bacteria 182783
328 Ga0209674_100153 3300025226 Bacteria 94333
329 Ga0209674_100296 3300025226 Bacteria 34844
330 Ga0209674_101200 3300025226 Bacteria 7400
331 Ga0209672_100054 3300025228 Bacteria 222217
332 Ga0209672_100072 3300025228 Bacteria 167942
333 Ga0209672_100073 3300025228 Bacteria 166621
334 Ga0209672_100214 3300025228 Bacteria 45404
335 Ga0209672_100308 3300025228 Bacteria 32831
336 Ga0209147_100011 3300025229 Bacteria 702140
337 Ga0209147_100085 3300025229 Bacteria 185813
338 Ga0209147_100090 3300025229 Bacteria 176176
339 Ga0209147_100093 3300025229 Bacteria 167196
340 Ga0209147_100100 3300025229 Bacteria 162747
341 Ga0209563_100011 3300025230 Bacteria 1187808
342 Ga0209563_100021 3300025230 Bacteria 683764
343 Ga0209563_100040 3300025230 Bacteria 408534
344 Ga0209563_100108 3300025230 Bacteria 143470
345 Ga0209563_102096 3300025230 Bacteria 4711
346 Ga0207427_100432 3300025231 Bacteria 23437
347 Ga0207427_101304 3300025231 Bacteria 9393
348 Ga0209437_100019 3300025233 Bacteria 683764
349 Ga0209437_100207 3300025233 Bacteria 112147
350 Ga0209258_100130 3300025242 Bacteria 176078
351 Ga0209258_100140 3300025242 Bacteria 167245
352 Ga0209258_100168 3300025242 Bacteria 145329
353 Ga0209258_100279 3300025242 Bacteria 86008
354 Ga0209258_100397 3300025242 Bacteria 54750
355 Ga0207425_1000009 3300025245 Bacteria 593135
356 Ga0207425_1000036 3300025245 Bacteria 225783
357 Ga0207425_1000176 3300025245 Bacteria 52680
358 Ga0207425_1014788 3300025245 Bacteria 1766
359 Ga0209646_1000119 3300025246 Bacteria 147427
360 Ga0209646_1000125 3300025246 Bacteria 135847
361 Ga0209646_1000140 3300025246 Bacteria 111155
362 Ga0209646_1000205 3300025246 Bacteria 69450
363 Ga0209646_1014119 3300025246 Bacteria 1205
364 Ga0209026_1000066 3300025250 Bacteria 207691
365 Ga0209026_1002319 3300025250 Bacteria 7236
366 Ga0209026_1002536 3300025250 Bacteria 6754
367 Ga0209026_1010192 3300025250 Bacteria 1774
368 Ga0209026_1024616 3300025250 Bacteria 911
369 Ga0209677_100011 3300025253 Bacteria 683664
370 Ga0209677_100023 3300025253 Bacteria 408534
371 Ga0209677_100043 3300025253 Bacteria 222331
372 Ga0209677_102613 3300025253 Bacteria 6566
373 Ga0209677_105141 3300025253 Bacteria 3512
374 Ga0209148_1000119 3300025254 Bacteria 188079
375 Ga0209148_1000140 3300025254 Bacteria 166819
376 Ga0209148_1000451 3300025254 Bacteria 45012
377 Ga0209148_1000470 3300025254 Bacteria 42979
378 Ga0209148_1005948 3300025254 Bacteria 2711
379 Ga0209759_1000114 3300025256 Bacteria 142233
380 Ga0209759_1000281 3300025256 Bacteria 71594
381 Ga0209759_1000329 3300025256 Bacteria 62253
382 Ga0209759_1000362 3300025256 Bacteria 58080
383 Ga0209759_1000961 3300025256 Bacteria 20401
384 Ga0209759_1001269 3300025256 Bacteria 15203
385 Ga0209759_1001696 3300025256 Bacteria 11450
386 Ga0209759_1004527 3300025256 Bacteria 5149
387 Ga0209759_1024031 3300025256 Bacteria 1328
388 Ga0209129_1000051 3300025258 Bacteria 267104
389 Ga0209129_1005038 3300025258 Bacteria 4855
390 Ga0209233_1000025 3300025261 Bacteria 683764
391 Ga0209233_1000173 3300025261 Bacteria 145995
392 Ga0209565_1000082 3300025263 Bacteria 154452
393 Ga0209565_1000727 3300025263 Bacteria 19804
394 Ga0209565_1001389 3300025263 Bacteria 10818
395 Ga0209565_1004441 3300025263 Bacteria 4262
396 Ga0209565_1012568 3300025263 Bacteria 2016
397 Ga0209565_1028887 3300025263 Bacteria 1092
398 Ga0209455_1000031 3300025272 Bacteria 519952
399 Ga0209455_1000119 3300025272 Bacteria 174994
400 Ga0209455_1000125 3300025272 Bacteria 166819
401 Ga0209455_1000217 3300025272 Bacteria 80610
402 Ga0209455_1002842 3300025272 Bacteria 6428
403 Ga0209455_1007044 3300025272 Bacteria 3229
404 Ga0209673_1000098 3300025273 Bacteria 193352
405 Ga0209673_1000381 3300025273 Bacteria 80068
406 Ga0209673_1016805 3300025273 Bacteria 2721
407 Ga0209673_1032983 3300025273 Bacteria 1586
408 Ga0209130_1000016 3300025284 Bacteria 395540
409 Ga0209130_1000834 3300025284 Bacteria 25777
410 Ga0209130_1002465 3300025284 Bacteria 9240
411 Ga0209130_1008973 3300025284 Bacteria 2895
412 Ga0209675_1000166 3300025291 Bacteria 80138
413 Ga0209675_1000684 3300025291 Bacteria 23603
414 Ga0209675_1001176 3300025291 Bacteria 15864
415 Ga0209675_1010828 3300025291 Bacteria 3076
416 Ga0209675_1018977 3300025291 Bacteria 1907
417 Ga0209675_1019471 3300025291 Bacteria 1868
418 Ga0209675_1020572 3300025291 Bacteria 1784
419 Ga0209676_1000331 3300025292 Bacteria 90857
420 Ga0209025_1000485 3300025294 Bacteria 76825
421 Ga0209025_1000823 3300025294 Bacteria 49464
422 Ga0209025_1000853 3300025294 Bacteria 48270
423 Ga0209025_1001173 3300025294 Bacteria 37118
424 Ga0209025_1003577 3300025294 Bacteria 14530
425 Ga0209564_1000010 3300025295 Bacteria 885399
426 Ga0209564_1000042 3300025295 Bacteria 392805
427 Ga0209564_1000710 3300025295 Bacteria 48541
428 Ga0209564_1000927 3300025295 Bacteria 38143
429 Ga0209564_1001559 3300025295 Bacteria 22537
430 Ga0209564_1003986 3300025295 Bacteria 9373
431 Ga0209564_1004745 3300025295 Bacteria 8132
432 Ga0209564_1004809 3300025295 Bacteria 8042
433 Ga0209564_1011217 3300025295 Bacteria 4038
434 Ga0209758_1000028 3300025297 Bacteria 530102
435 Ga0209758_1000054 3300025297 Bacteria 337655
436 Ga0209758_1000433 3300025297 Bacteria 70750
437 Ga0209758_1013994 3300025297 Bacteria 4312
438 Ga0209758_1027115 3300025297 Bacteria 2458
439 Ga0209050_1000086 3300025298 Bacteria 262009
440 Ga0209050_1000549 3300025298 Bacteria 62089
441 Ga0209050_1003829 3300025298 Bacteria 10730
442 Ga0209050_1011261 3300025298 Bacteria 4272
443 Ga0209256_1000018 3300025299 Bacteria 568467
444 Ga0209256_1000049 3300025299 Bacteria 310696
445 Ga0209256_1000380 3300025299 Bacteria 70995
446 Ga0209256_1000612 3300025299 Bacteria 49490
447 Ga0209256_1000802 3300025299 Bacteria 40206
448 Ga0209256_1002718 3300025299 Bacteria 13741
449 Ga0209256_1008331 3300025299 Bacteria 4834
450 Ga0209256_1009346 3300025299 Bacteria 4319
451 Ga0207426_1000199 3300025302 Bacteria 145826
452 Ga0207426_1005650 3300025302 Bacteria 5656
453 Ga0207426_1055235 3300025302 Bacteria 1164
454 Ga0207426_1072359 3300025302 Bacteria 957
455 Ga0209051_1000196 3300025303 Bacteria 107028
456 Ga0209051_1000247 3300025303 Bacteria 91122
457 Ga0209051_1007632 3300025303 Bacteria 5884
458 Ga0209257_1000087 3300025304 Bacteria 282503
459 Ga0209257_1000141 3300025304 Bacteria 201130
460 Ga0209257_1000305 3300025304 Bacteria 107001
461 Ga0209257_1000758 3300025304 Bacteria 48724
462 Ga0209257_1009026 3300025304 Bacteria 5466
463 Ga0209257_1037163 3300025304 Bacteria 1487
464 Ga0207696_1007984 3300025711 Bacteria 4089
465 Ga0207696_1014759 3300025711 Bacteria 2668
466 Ga0207655_1001385 3300025728 Bacteria 22650
467 Ga0207655_1001828 3300025728 Bacteria 18397
468 Ga0207655_1053955 3300025728 Bacteria 1602
469 Ga0207655_1057336 3300025728 Bacteria 1530
470 Ga0207655_1083082 3300025728 Bacteria 1149
471 Ga0207713_1002620 3300025735 Bacteria 12942
472 Ga0207713_1047112 3300025735 Bacteria 1747
473 Ga0207713_1072075 3300025735 Bacteria 1272
474 Ga0207647_10000126 3300025904 Bacteria 59628
475 Ga0207647_10002757 3300025904 Bacteria 13254
476 Ga0207647_10020622 3300025904 Bacteria 4416
477 Ga0207647_10062878 3300025904 Bacteria 2260
478 Ga0207643_10424232 3300025908 Bacteria 843
479 Ga0207705_10001027 3300025909 Bacteria 22683
480 Ga0207705_10014561 3300025909 Bacteria 5659
481 Ga0207654_10015780 3300025911 Bacteria 3926
482 Ga0207654_10101797 3300025911 Bacteria 1771
483 Ga0207654_10236979 3300025911 Bacteria 1217
484 Ga0207654_10386936 3300025911 Bacteria 970
485 Ga0207695_10004822 3300025913 Bacteria 18234
486 Ga0207695_10007348 3300025913 Bacteria 14059
487 Ga0207695_10016358 3300025913 Bacteria 8681
488 Ga0207695_10021117 3300025913 Bacteria 7436
489 Ga0207695_10060685 3300025913 Bacteria 3913
490 Ga0207695_10070563 3300025913 Bacteria 3571
491 Ga0207695_10123779 3300025913 Bacteria 2551
492 Ga0207695_10136490 3300025913 Bacteria 2406
493 Ga0207695_10241007 3300025913 Bacteria 1710
494 Ga0207695_10513073 3300025913 Bacteria 1080
495 Ga0207671_10015181 3300025914 Bacteria 6048
496 Ga0207671_10019071 3300025914 Bacteria 5254
497 Ga0207671_10020701 3300025914 Bacteria 5003
498 Ga0207671_10129901 3300025914 Bacteria 1933
499 Ga0207671_10371378 3300025914 Bacteria 1136
500 Ga0207693_10123859 3300025915 Bacteria 2031
501 Ga0207660_10108304 3300025917 Bacteria 2087
502 Ga0207660_10227973 3300025917 Bacteria 1464
503 Ga0207657_10000065 3300025919 Bacteria 98751
504 Ga0207657_10001751 3300025919 Bacteria 23419
505 Ga0207657_10002121 3300025919 Bacteria 21468
506 Ga0207657_10014060 3300025919 Bacteria 7832
507 Ga0207657_10090401 3300025919 Bacteria 2555
508 Ga0207657_10122346 3300025919 Bacteria 2140
509 Ga0207657_10395596 3300025919 Bacteria 1087
510 Ga0207657_10415552 3300025919 Bacteria 1057
511 Ga0207649_10000269 3300025920 Bacteria 41142
512 Ga0207649_10117243 3300025920 Bacteria 1789
513 Ga0207649_10269111 3300025920 Bacteria 1234
514 Ga0207652_10192631 3300025921 Bacteria 1834
515 Ga0207681_10200324 3300025923 Bacteria 1533
516 Ga0207694_10000054 3300025924 Bacteria 152124
517 Ga0207694_10022191 3300025924 Bacteria 4813
518 Ga0207694_10022934 3300025924 Bacteria 4736
519 Ga0207694_10069893 3300025924 Bacteria 2743
520 Ga0207694_10098892 3300025924 Bacteria 2311
521 Ga0207687_10015912 3300025927 Bacteria 4935
522 Ga0207687_10100224 3300025927 Bacteria 2130
523 Ga0207690_10000040 3300025932 Bacteria 130300
524 Ga0207690_10004347 3300025932 Bacteria 8372
525 Ga0207690_10027448 3300025932 Bacteria 3598
526 Ga0207690_10044794 3300025932 Bacteria 2919
527 Ga0207690_10092299 3300025932 Bacteria 2142
528 Ga0207690_10431939 3300025932 Bacteria 1055
529 Ga0207706_10171685 3300025933 Bacteria 1905
530 Ga0207706_10238320 3300025933 Bacteria 1590
531 Ga0207686_10160018 3300025934 Bacteria 1577
532 Ga0207686_10205281 3300025934 Bacteria 1414
533 Ga0207709_10000111 3300025935 Bacteria 127580
534 Ga0207711_10029680 3300025941 Bacteria 4613
535 Ga0207689_10217779 3300025942 Bacteria 1577
536 Ga0207689_10745558 3300025942 Bacteria 826
537 Ga0207689_10850361 3300025942 Bacteria 770
538 Ga0207679_10000032 3300025945 Bacteria 158845
539 Ga0207679_10002535 3300025945 Bacteria 11254
540 Ga0207667_10000043 3300025949 Bacteria 261426
541 Ga0207667_10018787 3300025949 Bacteria 7740
542 Ga0207667_10021851 3300025949 Bacteria 7081
543 Ga0207667_10022349 3300025949 Bacteria 6990
544 Ga0207667_10030719 3300025949 Bacteria 5807
545 Ga0207667_10040684 3300025949 Bacteria 4949
546 Ga0207668_10154526 3300025972 Bacteria 1781
547 Ga0207640_10000166 3300025981 Bacteria 47875
548 Ga0207640_10056874 3300025981 Bacteria 2570
549 Ga0207658_10010931 3300025986 Bacteria 6180
550 Ga0207639_10407769 3300026041 Bacteria 1226
551 Ga0207678_10000024 3300026067 Bacteria 125239
552 Ga0207678_10002149 3300026067 Bacteria 17846
553 Ga0207678_10110040 3300026067 Bacteria 2350
554 Ga0207678_10152975 3300026067 Bacteria 1970
555 Ga0207678_10300988 3300026067 Bacteria 1378
556 Ga0207702_10000615 3300026078 Bacteria 39296
557 Ga0207702_10292433 3300026078 Bacteria 1544
558 Ga0207702_10528459 3300026078 Bacteria 1152
559 Ga0207648_10010337 3300026089 Bacteria 8850
560 Ga0207648_10645126 3300026089 Bacteria 978
561 Ga0207674_10002639 3300026116 Bacteria 22407
562 Ga0207674_10105632 3300026116 Bacteria 2794
563 Ga0207674_10185832 3300026116 Bacteria 2029
564 Ga0207674_11174827 3300026116 Bacteria 737
565 Ga0207698_10021768 3300026142 Bacteria 4441
566 Ga0207698_10072384 3300026142 Bacteria 2740
567 Ga0207698_10107686 3300026142 Bacteria 2328
568 Ga0207698_10163139 3300026142 Bacteria 1952
569 Ga0209281_1000017 3300027111 Bacteria 583251
570 Ga0209281_1000395 3300027111 Bacteria 67983
571 Ga0209371_1000141 3300027312 Bacteria 118767
572 Ga0209282_1000005 3300027666 Bacteria 380858
573 Ga0209282_1000032 3300027666 Bacteria 149218
574 Ga0268265_10031277 3300028380 Bacteria 3842
575 Ga0268264_10460383 3300028381 Bacteria 1234
576 Ga0307515_10092535 3300028794 Bacteria 3762
577 Ga0265338_10000508 3300028800 Bacteria 68840
578 Ga0265338_10003131 3300028800 Bacteria 23632
579 Ga0265324_10033521 3300029957 Bacteria 1791
580 Ga0268256_1005317 3300030500 Bacteria 5091
581 Ga0316177_1078822 3300030731 Bacteria 1430
582 Ga0316177_1198814 3300030731 Bacteria 862
583 Ga0316178_1123774 3300030735 Bacteria 1628
584 Ga0316180_1047314 3300030736 Bacteria 2219
585 Ga0316181_1294152 3300030744 Bacteria 5213
586 Ga0316182_1184083 3300030745 Bacteria 1197
587 Ga0265330_10019289 3300031235 Bacteria 3127
588 Ga0265332_10000058 3300031238 Bacteria 102565
589 Ga0265332_10004893 3300031238 Bacteria 6229
590 Ga0265332_10007247 3300031238 Bacteria 5021
591 Ga0265329_10106457 3300031242 Bacteria 895
592 Ga0265340_10051639 3300031247 Bacteria 1990
593 Ga0265327_10029616 3300031251 Bacteria 3111
594 Ga0265316_10556983 3300031344 Bacteria 815
595 Ga0307513_10140733 3300031456 Bacteria 2340
596 Ga0307513_10162661 3300031456 Bacteria 2122
597 Ga0307408_100000489 3300031548 Bacteria 34649
598 Ga0307408_100005084 3300031548 Bacteria 8826
599 Ga0307408_100007334 3300031548 Bacteria 7296
600 Ga0307408_100011280 3300031548 Bacteria 5902
601 Ga0307408_100025874 3300031548 Bacteria 4022
602 Ga0307408_100083439 3300031548 Bacteria 2394
603 Ga0307408_100563736 3300031548 Bacteria 1007
604 Ga0307508_10098778 3300031616 Bacteria 2513
605 Ga0265314_10017068 3300031711 Bacteria 5707
606 Ga0265342_10105897 3300031712 Bacteria 1596
607 Ga0307405_10501617 3300031731 Bacteria 973
608 Ga0307518_10043423 3300031838 Bacteria 3271
609 Ga0307409_100189793 3300031995 Bacteria 1828
610 Ga0307409_100897598 3300031995 Bacteria 900
611 Ga0307416_100012509 3300032002 Bacteria 5719
612 Ga0307414_10008756 3300032004 Bacteria 5767
613 Ga0307411_10140516 3300032005 Bacteria 1780
614 Ga0373923_0128650 3300035111 Bacteria 1137
615 Ga0373937_0034163 3300036401 Bacteria 4625
616 Ga0395899_0000078 3300037312 Bacteria 174141
617 Ga0395899_0000080 3300037312 Bacteria 171568
618 Ga0395899_0001210 3300037312 Bacteria 22624
619 Ga0395899_0003316 3300037312 Bacteria 12759
620 Ga0395899_0005062 3300037312 Bacteria 10254
621 Ga0395899_0017845 3300037312 Bacteria 5403
622 Ga0395899_0045495 3300037312 Bacteria 3270
623 Ga0395899_0064618 3300037312 Bacteria 2690
624 Ga0395899_0066754 3300037312 Bacteria 2641
625 Ga0395899_0068196 3300037312 Bacteria 2608
626 Ga0395900_0000087 3300037418 Bacteria 171568
627 Ga0395900_0000673 3300037418 Bacteria 45477
628 Ga0395900_0050324 3300037418 Bacteria 4291
629 Ga0395900_0056698 3300037418 Bacteria 4032
630 Ga0395900_0071176 3300037418 Bacteria 3574
631 Ga0395900_0081902 3300037418 Bacteria 3315
632 Ga0395900_0082976 3300037418 Bacteria 3293
633 Ga0395900_0097488 3300037418 Bacteria 3020
634 Ga0395900_0120777 3300037418 Bacteria 2688
635 Ga0395900_0121245 3300037418 Bacteria 2682
636 Ga0395900_0130173 3300037418 Bacteria 2579
637 Ga0395900_0135403 3300037418 Bacteria 2524
638 Ga0395900_0233233 3300037418 Bacteria 1850
639 Ga0395900_0262494 3300037418 Bacteria 1724
640 Ga0395900_0350600 3300037418 Bacteria 1449
641 Ga0395900_0460033 3300037418 Bacteria 1227
642 Ga0395900_0485464 3300037418 Bacteria 1187
643 Ga0395900_0627325 3300037418 Bacteria 1013
644 Ga0395898_0000448 3300037466 Bacteria 84953
645 Ga0395898_0003251 3300037466 Bacteria 18262
646 Ga0395898_0003576 3300037466 Bacteria 17324
647 Ga0395898_0022487 3300037466 Bacteria 6385
648 Ga0395898_0023949 3300037466 Bacteria 6162
649 Ga0395898_0198956 3300037466 Bacteria 1913
650 Ga0395898_0662743 3300037466 Bacteria 986
651 Ga0395905_0001411 3300037471 Bacteria 29041
652 Ga0395905_0002893 3300037471 Bacteria 18759
653 Ga0395905_0011080 3300037471 Bacteria 8728
654 Ga0395905_0011772 3300037471 Bacteria 8445
655 Ga0395905_0046496 3300037471 Bacteria 4069
656 Ga0395905_0047155 3300037471 Bacteria 4040
657 Ga0395905_0050498 3300037471 Bacteria 3896
658 Ga0395905_0055782 3300037471 Bacteria 3698
659 Ga0395905_0059658 3300037471 Bacteria 3566
660 Ga0395905_0073135 3300037471 Bacteria 3213
661 Ga0395905_0145219 3300037471 Bacteria 2232
662 Ga0395905_0248558 3300037471 Bacteria 1661
663 Ga0395905_0398559 3300037471 Bacteria 1271
664 Ga0395905_0774517 3300037471 Bacteria 862
665 Ga0395901_0000053 3300038443 Bacteria 163807
666 Ga0395901_0000393 3300038443 Bacteria 52127
667 Ga0395901_0000924 3300038443 Bacteria 31960
668 Ga0395901_0006004 3300038443 Bacteria 12301
669 Ga0395901_0009275 3300038443 Bacteria 9977
670 Ga0395901_0012912 3300038443 Bacteria 8472
671 Ga0395901_0066987 3300038443 Bacteria 3739
672 Ga0395901_0125038 3300038443 Bacteria 2702
673 Ga0395901_0125499 3300038443 Bacteria 2697
674 Ga0395901_0209122 3300038443 Bacteria 2043
675 Ga0395901_0313806 3300038443 Bacteria 1623
676 Ga0395901_0339914 3300038443 Bacteria 1551
677 Ga0395901_0370435 3300038443 Bacteria 1475
678 Ga0395901_0391077 3300038443 Bacteria 1430
679 Ga0395901_0472670 3300038443 Bacteria 1279
680 Ga0395901_0578154 3300038443 Bacteria 1135
681 Ga0436361_0079181 3300039447 Bacteria 1717
682 Ga0436361_0102476 3300039447 Bacteria 1106
683 Ga0436361_0161710 3300039447 Bacteria 866
684 Ga0436361_0224368 3300039447 Bacteria 99317
685 Ga0436361_0599717 3300039447 Bacteria 43072
686 Ga0436361_0767605 3300039447 Bacteria 6074
687 Ga0436361_0894241 3300039447 Bacteria 10135
688 Ga0439433_0087825 3300041999 Bacteria 762
689 Ga0439437_005890 3300042000 Bacteria 1354
690 Ga0439448_0004496 3300042005 Bacteria 3936
691 Ga0439448_0021749 3300042005 Bacteria 1989
692 Ga0439449_0001931 3300042007 Bacteria 8140
693 Ga0439455_0012317 3300042012 Bacteria 1919
694 Ga0439455_0024129 3300042012 Bacteria 1469
695 Ga0439457_023059 3300042014 Bacteria 1378
696 Ga0439462_0043322 3300042015 Bacteria 1203
697 Ga0450888_013337 3300042126 Bacteria 983
698 Ga0450890_006334 3300042127 Bacteria 1516
699 Ga0450904_000386 3300042139 Bacteria 9139
700 Ga0439446_0023268 3300042156 Bacteria 1761
701 Ga0439458_0019286 3300042157 Bacteria 1568
702 Ga0439458_0019319 3300042157 Bacteria 1568
703 Ga0451577_0005927 3300042876 Bacteria 12320
704 Ga0451577_0014648 3300042876 Bacteria 7307
705 Ga0451577_0063542 3300042876 Bacteria 3292
706 Ga0451577_0348134 3300042876 Bacteria 1344
707 Ga0451577_0372038 3300042876 Bacteria 1296
708 Ga0466969_0000901 3300044656 Bacteria 16055
709 Ga0466969_0005144 3300044656 Bacteria 6955
710 Ga0466969_0084418 3300044656 Bacteria 1511
711 Ga0466969_0087059 3300044656 Bacteria 1483
712 Ga0466969_0117940 3300044656 Bacteria 1237
713 Ga0466972_0000290 3300044658 Bacteria 30636
714 Ga0466972_0004693 3300044658 Bacteria 6847
715 Ga0466972_0010105 3300044658 Bacteria 4741
716 Ga0466972_0087351 3300044658 Bacteria 1481
717 Ga0466973_0033070 3300044659 Bacteria 4929
718 Ga0453683_0047497 3300044673 Bacteria 2692
719 Ga0466965_0002106 3300044683 Bacteria 8356
720 Ga0466965_0005814 3300044683 Bacteria 5565
721 Ga0466965_0009529 3300044683 Bacteria 4512
722 Ga0466965_0047090 3300044683 Bacteria 2135
723 Ga0466965_0164056 3300044683 Bacteria 1166
724 Ga0466965_0273601 3300044683 Bacteria 910
725 Ga0466966_0000070 3300044684 Bacteria 67510
726 Ga0466966_0001458 3300044684 Bacteria 15214
727 Ga0466966_0002015 3300044684 Bacteria 13179
728 Ga0466966_0018583 3300044684 Bacteria 4582
729 Ga0466966_0023441 3300044684 Bacteria 4041
730 Ga0466966_0031772 3300044684 Bacteria 3424
731 Ga0466966_0106779 3300044684 Bacteria 1728
732 Ga0466966_0113110 3300044684 Bacteria 1672
733 Ga0466966_0317349 3300044684 Bacteria 936
734 Ga0466961_0000382 3300044693 Bacteria 28543
735 Ga0466961_0026078 3300044693 Bacteria 3757
736 Ga0466961_0030801 3300044693 Bacteria 3447
737 Ga0466961_0093077 3300044693 Bacteria 1902
738 Ga0466963_0000156 3300044694 Bacteria 27358
739 Ga0466963_0023867 3300044694 Bacteria 3889
740 Ga0466963_0112189 3300044694 Bacteria 1872
741 Ga0466963_0231656 3300044694 Bacteria 1294
742 Ga0466964_0019148 3300044706 Bacteria 2629
743 Ga0453684_0000716 3300044712 Bacteria 117287
744 Ga0453684_0003881 3300044712 Bacteria 32897
745 Ga0453684_0027030 3300044712 Bacteria 8253
746 Ga0453684_0095863 3300044712 Bacteria 3646
747 Ga0453684_0181113 3300044712 Bacteria 2473
748 Ga0453684_1008831 3300044712 Bacteria 885
749 Ga0466971_0012419 3300044719 Bacteria 3732
750 Ga0466971_0047844 3300044719 Bacteria 1923
751 Ga0466971_0089128 3300044719 Bacteria 1411
752 Ga0466971_0094381 3300044719 Bacteria 1371
753 Ga0466968_0015240 3300044735 Bacteria 3043
754 Ga0466970_0001718 3300044765 Bacteria 10539
755 Ga0466970_0029992 3300044765 Bacteria 2867
756 Ga0466970_0147776 3300044765 Bacteria 1297
757 Ga0466970_0314679 3300044765 Bacteria 884
758 Ga0466957_0000646 3300044842 Bacteria 17689
759 Ga0466957_0006404 3300044842 Bacteria 6648
760 Ga0466957_0016515 3300044842 Bacteria 4318
761 Ga0466957_0024930 3300044842 Bacteria 3543
762 Ga0466957_0026257 3300044842 Bacteria 3454
763 Ga0466957_0095826 3300044842 Bacteria 1864
764 Ga0466957_0147486 3300044842 Bacteria 1519
765 Ga0466957_0243711 3300044842 Bacteria 1193
766 Ga0466957_0270031 3300044842 Bacteria 1135
767 Ga0466957_0522928 3300044842 Bacteria 824
768 Ga0466960_0068700 3300044901 Bacteria 1759
769 Ga0466960_0090869 3300044901 Bacteria 1556
770 Ga0466959_0013509 3300045049 Bacteria 5917
771 Ga0466959_0025178 3300045049 Bacteria 4408
772 Ga0466959_0034425 3300045049 Bacteria 3746
773 Ga0466959_0049528 3300045049 Bacteria 3086
774 Ga0466959_0052451 3300045049 Bacteria 2987
775 Ga0466959_0088963 3300045049 Bacteria 2219
776 Ga0451576_0000239 3300045051 Bacteria 134323
777 Ga0451576_0000313 3300045051 Bacteria 117520
778 Ga0451576_0002171 3300045051 Bacteria 30352
779 Ga0451576_0008528 3300045051 Bacteria 12017
780 Ga0451576_0016875 3300045051 Bacteria 8044
781 Ga0451576_0265587 3300045051 Bacteria 1794
782 Ga0451576_0415269 3300045051 Bacteria 1412
783 Ga0466958_0014519 3300045836 Bacteria 4495
784 Ga0466958_0071687 3300045836 Bacteria 2121
785 Ga0466958_0080449 3300045836 Bacteria 2005
786 Ga0466967_0047541 3300045976 Bacteria 3741
787 Ga0466967_0164782 3300045976 Bacteria 2082
788 Ga0466967_0298690 3300045976 Bacteria 1549
789 Ga0466967_0566512 3300045976 Bacteria 1119
790 Ga0495617_000010 3300046452 Bacteria 310258
791 Ga0495617_000020 3300046452 Bacteria 230257
792 Ga0495617_000338 3300046452 Bacteria 25897
793 Ga0495617_009279 3300046452 Bacteria 3377
794 Ga0495617_018563 3300046452 Bacteria 2351
795 Ga0495627_000004 3300046453 Bacteria 640612
796 Ga0495627_002330 3300046453 Bacteria 9310
797 Ga0495627_030358 3300046453 Bacteria 1713
798 Ga0495627_052634 3300046453 Bacteria 1220
799 Ga0495592_0007047 3300046454 Bacteria 8409
800 Ga0495592_0007842 3300046454 Bacteria 7999
801 Ga0495603_0004544 3300046455 Bacteria 8279
802 Ga0495603_0025725 3300046455 Bacteria 3558
803 Ga0495603_0044853 3300046455 Bacteria 2638
804 Ga0495603_0053485 3300046455 Bacteria 2395
805 Ga0495603_0057613 3300046455 Bacteria 2298
806 Ga0495603_0230709 3300046455 Bacteria 1067
807 Ga0495590_0000009 3300046457 Bacteria 320425
808 Ga0495590_0000012 3300046457 Bacteria 303377
809 Ga0495590_0000811 3300046457 Bacteria 14198
810 Ga0495590_0002807 3300046457 Bacteria 7196
811 Ga0495590_0003730 3300046457 Bacteria 6200
812 Ga0495590_0005189 3300046457 Bacteria 5179
813 Ga0495590_0008831 3300046457 Bacteria 3831
814 Ga0495590_0018303 3300046457 Bacteria 2508
815 Ga0495590_0058860 3300046457 Bacteria 1344
816 Ga0495590_0066198 3300046457 Bacteria 1265
817 Ga0495590_0101496 3300046457 Bacteria 1022
818 Ga0495591_000312 3300046458 Bacteria 44043
819 Ga0495591_010692 3300046458 Bacteria 3534
820 Ga0495591_038492 3300046458 Bacteria 1376
821 Ga0495629_0000162 3300046459 Bacteria 58860
822 Ga0495629_0000590 3300046459 Bacteria 29493
823 Ga0495629_0017871 3300046459 Bacteria 5082
824 Ga0495629_0018888 3300046459 Bacteria 4927
825 Ga0495629_0082659 3300046459 Bacteria 2241
826 Ga0495629_0195629 3300046459 Bacteria 1398
827 Ga0495638_0000047 3300046460 Bacteria 216004
828 Ga0495638_0005328 3300046460 Bacteria 9592
829 Ga0495638_0006905 3300046460 Bacteria 8190
830 Ga0495638_0008837 3300046460 Bacteria 7112
831 Ga0495638_0015873 3300046460 Bacteria 5047
832 Ga0495638_0078523 3300046460 Bacteria 2008
833 Ga0495638_0134201 3300046460 Bacteria 1451
834 Ga0495638_0233337 3300046460 Bacteria 1022
835 Ga0495651_0002594 3300046462 Bacteria 13981
836 Ga0495651_0009717 3300046462 Bacteria 7396
837 Ga0495651_0085300 3300046462 Bacteria 2378
838 Ga0495653_0000035 3300046463 Bacteria 129875
839 Ga0495653_0002868 3300046463 Bacteria 13781
840 Ga0495653_0005359 3300046463 Bacteria 10436
841 Ga0495653_0019705 3300046463 Bacteria 5470
842 Ga0495653_0023820 3300046463 Bacteria 4941
843 Ga0495653_0056177 3300046463 Bacteria 3001
844 Ga0495653_0282222 3300046463 Bacteria 1089
845 Ga0495653_0389966 3300046463 Bacteria 887
846 Ga0495650_0000077 3300046471 Bacteria 245511
847 Ga0495650_0000128 3300046471 Bacteria 177256
848 Ga0495650_0000167 3300046471 Bacteria 145804
849 Ga0495650_0000261 3300046471 Bacteria 101830
850 Ga0495650_0002873 3300046471 Bacteria 13135
851 Ga0495650_0003960 3300046471 Bacteria 10409
852 Ga0495650_0017253 3300046471 Bacteria 3624
853 Ga0495650_0029713 3300046471 Bacteria 2487
854 Ga0495580_0004249 3300046472 Bacteria 12047
855 Ga0495580_0011235 3300046472 Bacteria 6928
856 Ga0495580_0034358 3300046472 Bacteria 3650
857 Ga0495580_0071806 3300046472 Bacteria 2418
858 Ga0495580_0131714 3300046472 Bacteria 1734
859 Ga0495580_0132898 3300046472 Bacteria 1725
860 Ga0495580_0204026 3300046472 Bacteria 1362
861 Ga0495580_0289561 3300046472 Bacteria 1116
862 Ga0495582_0003873 3300046473 Bacteria 8428
863 Ga0495582_0033637 3300046473 Bacteria 2818
864 Ga0495582_0049401 3300046473 Bacteria 2316
865 Ga0495582_0152436 3300046473 Bacteria 1312
866 Ga0495582_0239201 3300046473 Bacteria 1040
867 Ga0495605_0000018 3300046474 Bacteria 270187
868 Ga0495605_0000055 3300046474 Bacteria 157514
869 Ga0495605_0000961 3300046474 Bacteria 19587
870 Ga0495605_0001384 3300046474 Bacteria 15959
871 Ga0495605_0010923 3300046474 Bacteria 5072
872 Ga0495605_0011263 3300046474 Bacteria 4993
873 Ga0495605_0028227 3300046474 Bacteria 2898
874 Ga0495605_0033268 3300046474 Bacteria 2618
875 Ga0495605_0078987 3300046474 Bacteria 1542
876 Ga0495605_0128887 3300046474 Bacteria 1142
877 Ga0495605_0131316 3300046474 Bacteria 1129
878 Ga0495605_0168055 3300046474 Bacteria 970
879 Ga0495662_0008371 3300046476 Bacteria 5087
880 Ga0495662_0103141 3300046476 Bacteria 1395
881 Ga0495664_0030381 3300046477 Bacteria 3164
882 Ga0495664_0059563 3300046477 Bacteria 2273
883 Ga0495664_0064656 3300046477 Bacteria 2180
884 Ga0495584_0000004 3300046491 Bacteria 314714
885 Ga0495584_0000073 3300046491 Bacteria 72062
886 Ga0495584_0001460 3300046491 Bacteria 14200
887 Ga0495584_0002768 3300046491 Bacteria 9803
888 Ga0495584_0005708 3300046491 Bacteria 6570
889 Ga0495584_0031663 3300046491 Bacteria 2676
890 Ga0495584_0041975 3300046491 Bacteria 2308
891 Ga0495584_0054502 3300046491 Bacteria 2012
892 Ga0495584_0106154 3300046491 Bacteria 1420
893 Ga0495584_0125728 3300046491 Bacteria 1299
894 Ga0495584_0232985 3300046491 Bacteria 936
895 Ga0495585_0000119 3300046492 Bacteria 85131
896 Ga0495585_0000692 3300046492 Bacteria 30662
897 Ga0495585_0000859 3300046492 Bacteria 25985
898 Ga0495585_0002189 3300046492 Bacteria 14194
899 Ga0495585_0002462 3300046492 Bacteria 13241
900 Ga0495585_0004522 3300046492 Bacteria 9010
901 Ga0495585_0005821 3300046492 Bacteria 7730
902 Ga0495585_0033255 3300046492 Bacteria 2919
903 Ga0495585_0037334 3300046492 Bacteria 2736
904 Ga0495585_0048752 3300046492 Bacteria 2354
905 Ga0495585_0050185 3300046492 Bacteria 2314
906 Ga0495585_0087035 3300046492 Bacteria 1686
907 Ga0495585_0141409 3300046492 Bacteria 1260
908 Ga0495585_0156197 3300046492 Bacteria 1186
909 Ga0495594_0003092 3300046499 Bacteria 8617
910 Ga0495594_0008963 3300046499 Bacteria 5160
911 Ga0495594_0032602 3300046499 Bacteria 2828
912 Ga0495594_0035150 3300046499 Bacteria 2728
913 Ga0495594_0040861 3300046499 Bacteria 2539
914 Ga0495594_0232613 3300046499 Bacteria 1050
915 Ga0495596_0000916 3300046500 Bacteria 17571
916 Ga0495596_0000968 3300046500 Bacteria 17100
917 Ga0495596_0002756 3300046500 Bacteria 9213
918 Ga0495596_0009364 3300046500 Bacteria 4309
919 Ga0495596_0016204 3300046500 Bacteria 3100
920 Ga0495596_0036884 3300046500 Bacteria 1935
921 Ga0495596_0067744 3300046500 Bacteria 1387
922 Ga0495596_0068581 3300046500 Bacteria 1378
923 Ga0495596_0123354 3300046500 Bacteria 1005
924 Ga0495607_0001276 3300046501 Bacteria 22530
925 Ga0495607_0006186 3300046501 Bacteria 8459
926 Ga0495607_0006362 3300046501 Bacteria 8316
927 Ga0495607_0009405 3300046501 Bacteria 6617
928 Ga0495607_0028869 3300046501 Bacteria 3416
929 Ga0495607_0031432 3300046501 Bacteria 3250
930 Ga0495607_0033315 3300046501 Bacteria 3135
931 Ga0495607_0039916 3300046501 Bacteria 2799
932 Ga0495607_0057223 3300046501 Bacteria 2235
933 Ga0495607_0072083 3300046501 Bacteria 1924
934 Ga0495607_0088201 3300046501 Bacteria 1686
935 Ga0495607_0088926 3300046501 Bacteria 1677
936 Ga0495583_0000115 3300046506 Bacteria 135762
937 Ga0495583_0000132 3300046506 Bacteria 125343
938 Ga0495583_0000493 3300046506 Bacteria 57328
939 Ga0495583_0001058 3300046506 Bacteria 30795
940 Ga0495583_0002029 3300046506 Bacteria 18434
941 Ga0495583_0002050 3300046506 Bacteria 18274
942 Ga0495583_0002235 3300046506 Bacteria 17049
943 Ga0495583_0006944 3300046506 Bacteria 7262
944 Ga0495583_0010659 3300046506 Bacteria 5342
945 Ga0495583_0012070 3300046506 Bacteria 4919
946 Ga0495583_0037921 3300046506 Bacteria 2281
947 Ga0495583_0095812 3300046506 Bacteria 1272
948 Ga0495583_0123575 3300046506 Bacteria 1087
949 Ga0495606_0000288 3300046507 Bacteria 87389
950 Ga0495606_0000512 3300046507 Bacteria 63012
951 Ga0495606_0000790 3300046507 Bacteria 48364
952 Ga0495606_0001762 3300046507 Bacteria 27726
953 Ga0495606_0003944 3300046507 Bacteria 15250
954 Ga0495606_0004472 3300046507 Bacteria 13939
955 Ga0495606_0010834 3300046507 Bacteria 7513
956 Ga0495606_0015287 3300046507 Bacteria 5922
957 Ga0495606_0017462 3300046507 Bacteria 5423
958 Ga0495606_0027510 3300046507 Bacteria 4030
959 Ga0495606_0078968 3300046507 Bacteria 2051
960 Ga0495606_0087127 3300046507 Bacteria 1928
961 Ga0495606_0099424 3300046507 Bacteria 1773
962 Ga0495606_0171442 3300046507 Bacteria 1258
963 Ga0495606_0229789 3300046507 Bacteria 1040
964 Ga0495608_0002285 3300046511 Bacteria 13831
965 Ga0495608_0008809 3300046511 Bacteria 7060
966 Ga0495608_0009653 3300046511 Bacteria 6733
967 Ga0495610_0000014 3300046512 Bacteria 444708
968 Ga0495610_0001174 3300046512 Bacteria 23735
969 Ga0495610_0002561 3300046512 Bacteria 15121
970 Ga0495610_0008287 3300046512 Bacteria 6751
971 Ga0495610_0011267 3300046512 Bacteria 5480
972 Ga0495610_0017992 3300046512 Bacteria 4006
973 Ga0495610_0065200 3300046512 Bacteria 1719
974 Ga0495610_0127224 3300046512 Bacteria 1110
975 Ga0495616_0000157 3300046513 Bacteria 59518
976 Ga0495616_0003730 3300046513 Bacteria 9718
977 Ga0495616_0006125 3300046513 Bacteria 7322
978 Ga0495616_0006610 3300046513 Bacteria 7004
979 Ga0495616_0008291 3300046513 Bacteria 6167
980 Ga0495616_0009471 3300046513 Bacteria 5690
981 Ga0495616_0019415 3300046513 Bacteria 3710
982 Ga0495616_0031569 3300046513 Bacteria 2772
983 Ga0495616_0055111 3300046513 Bacteria 1969
984 Ga0495616_0064591 3300046513 Bacteria 1785
985 Ga0495616_0158514 3300046513 Bacteria 1019
986 Ga0495616_0191137 3300046513 Bacteria 905
987 Ga0495618_0002173 3300046514 Bacteria 12828
988 Ga0495618_0004385 3300046514 Bacteria 8678
989 Ga0495618_0112545 3300046514 Bacteria 1743
990 Ga0495620_0012913 3300046515 Bacteria 4294
991 Ga0495620_0016011 3300046515 Bacteria 3773
992 Ga0495620_0029433 3300046515 Bacteria 2541
993 Ga0495628_0001227 3300046516 Bacteria 23459
994 Ga0495628_0002006 3300046516 Bacteria 18454
995 Ga0495628_0013732 3300046516 Bacteria 6808
996 Ga0495628_0023641 3300046516 Bacteria 5042
997 Ga0495628_0068051 3300046516 Bacteria 2779
998 Ga0495628_0106929 3300046516 Bacteria 2154
999 Ga0495630_0009319 3300046517 Bacteria 7059
1000 Ga0495630_0031536 3300046517 Bacteria 3946
1001 Ga0495630_0140791 3300046517 Bacteria 1834
1002 Ga0495630_0165717 3300046517 Bacteria 1682
1003 Ga0495630_0184907 3300046517 Bacteria 1589
1004 Ga0495630_0235013 3300046517 Bacteria 1401
1005 Ga0495631_0000272 3300046518 Bacteria 36059
1006 Ga0495631_0000791 3300046518 Bacteria 20226
1007 Ga0495631_0026569 3300046518 Bacteria 2656
1008 Ga0495631_0046671 3300046518 Bacteria 1903
1009 Ga0495631_0054078 3300046518 Bacteria 1751
1010 Ga0495631_0056641 3300046518 Bacteria 1706
1011 Ga0495632_0000017 3300046519 Bacteria 228941
1012 Ga0495632_0009675 3300046519 Bacteria 5787
1013 Ga0495632_0014248 3300046519 Bacteria 4504
1014 Ga0495632_0023987 3300046519 Bacteria 3248
1015 Ga0495632_0024729 3300046519 Bacteria 3185
1016 Ga0495637_0000003 3300046520 Bacteria 623293
1017 Ga0495637_0000142 3300046520 Bacteria 54212
1018 Ga0495637_0003152 3300046520 Bacteria 8802
1019 Ga0495637_0022607 3300046520 Bacteria 2866
1020 Ga0495643_0000082 3300046522 Bacteria 159651
1021 Ga0495643_0000085 3300046522 Bacteria 157223
1022 Ga0495643_0000160 3300046522 Bacteria 107502
1023 Ga0495643_0016840 3300046522 Bacteria 4289
1024 Ga0495643_0030664 3300046522 Bacteria 3000
1025 Ga0495643_0032926 3300046522 Bacteria 2871
1026 Ga0495643_0043739 3300046522 Bacteria 2436
1027 Ga0495643_0070739 3300046522 Bacteria 1832
1028 Ga0495643_0291830 3300046522 Bacteria 746
1029 Ga0495644_0000831 3300046523 Bacteria 12737
1030 Ga0495644_0048664 3300046523 Bacteria 1592
1031 Ga0495644_0054796 3300046523 Bacteria 1497
1032 Ga0495644_0065013 3300046523 Bacteria 1370
1033 Ga0495644_0089619 3300046523 Bacteria 1160
1034 Ga0495648_0000019 3300046524 Bacteria 276407
1035 Ga0495648_0000052 3300046524 Bacteria 162169
1036 Ga0495648_0000732 3300046524 Bacteria 35084
1037 Ga0495648_0005994 3300046524 Bacteria 9991
1038 Ga0495648_0007724 3300046524 Bacteria 8565
1039 Ga0495648_0013458 3300046524 Bacteria 6046
1040 Ga0495648_0068950 3300046524 Bacteria 2060
1041 Ga0495648_0079104 3300046524 Bacteria 1878
1042 Ga0495648_0126544 3300046524 Bacteria 1364
1043 Ga0495648_0142867 3300046524 Bacteria 1257
1044 Ga0495648_0154276 3300046524 Bacteria 1194
1045 Ga0495648_0171493 3300046524 Bacteria 1111
1046 Ga0495663_0004983 3300046525 Bacteria 3712
1047 Ga0495666_0002778 3300046526 Bacteria 8743
1048 Ga0495666_0004516 3300046526 Bacteria 7030
1049 Ga0495666_0027014 3300046526 Bacteria 2825
1050 Ga0495666_0027173 3300046526 Bacteria 2818
1051 Ga0495666_0028331 3300046526 Bacteria 2755
1052 Ga0495666_0076052 3300046526 Bacteria 1591
1053 Ga0495666_0136393 3300046526 Bacteria 1145
1054 Ga0495642_0000449 3300046528 Bacteria 21699
1055 Ga0495642_0001035 3300046528 Bacteria 12914
1056 Ga0495642_0014414 3300046528 Bacteria 3063
1057 Ga0495642_0014960 3300046528 Bacteria 3011
1058 Ga0495642_0025140 3300046528 Bacteria 2359
1059 Ga0495642_0033463 3300046528 Bacteria 2066
1060 Ga0495642_0049869 3300046528 Bacteria 1720
1061 Ga0495642_0155630 3300046528 Bacteria 990
1062 Ga0495652_0005308 3300046529 Bacteria 12152
1063 Ga0495652_0005804 3300046529 Bacteria 11558
1064 Ga0495652_0032944 3300046529 Bacteria 4528
1065 Ga0495652_0047949 3300046529 Bacteria 3662
1066 Ga0495652_0057709 3300046529 Bacteria 3290
1067 Ga0495652_0073703 3300046529 Bacteria 2842
1068 Ga0495652_0158900 3300046529 Bacteria 1757
1069 Ga0495654_0000014 3300046530 Bacteria 312126
1070 Ga0495654_0012762 3300046530 Bacteria 4510
1071 Ga0495654_0013228 3300046530 Bacteria 4419
1072 Ga0495654_0019607 3300046530 Bacteria 3537
1073 Ga0495665_0006743 3300046531 Bacteria 6190
1074 Ga0495665_0029480 3300046531 Bacteria 2939
1075 Ga0495665_0063431 3300046531 Bacteria 1950
1076 Ga0495665_0085729 3300046531 Bacteria 1655
1077 Ga0495665_0094168 3300046531 Bacteria 1573
1078 Ga0495665_0094478 3300046531 Bacteria 1570
1079 Ga0495665_0149897 3300046531 Bacteria 1217
1080 Ga0495640_0004166 3300046533 Bacteria 11565
1081 Ga0495640_0009652 3300046533 Bacteria 7504
1082 Ga0495640_0053150 3300046533 Bacteria 2778
1083 Ga0495586_0009640 3300046535 Bacteria 5142
1084 Ga0495586_0017078 3300046535 Bacteria 3857
1085 Ga0495586_0049963 3300046535 Bacteria 2262
1086 Ga0495587_0040545 3300046536 Bacteria 2782
1087 Ga0495587_0164319 3300046536 Bacteria 1262
1088 Ga0495598_0043154 3300046537 Bacteria 1327
1089 Ga0495609_0000038 3300046538 Bacteria 182264
1090 Ga0495609_0000434 3300046538 Bacteria 34673
1091 Ga0495609_0000537 3300046538 Bacteria 30126
1092 Ga0495609_0002203 3300046538 Bacteria 12207
1093 Ga0495609_0002312 3300046538 Bacteria 11786
1094 Ga0495609_0006214 3300046538 Bacteria 6135
1095 Ga0495609_0007989 3300046538 Bacteria 5225
1096 Ga0495609_0090705 3300046538 Bacteria 1329
1097 Ga0495609_0102196 3300046538 Bacteria 1241
1098 Ga0495621_0082827 3300046539 Bacteria 1198
1099 Ga0495597_0000535 3300046542 Bacteria 31448
1100 Ga0495597_0001237 3300046542 Bacteria 18972
1101 Ga0495597_0003960 3300046542 Bacteria 8335
1102 Ga0495597_0004345 3300046542 Bacteria 7815
1103 Ga0495597_0004947 3300046542 Bacteria 7163
1104 Ga0495597_0005518 3300046542 Bacteria 6688
1105 Ga0495597_0006195 3300046542 Bacteria 6213
1106 Ga0495597_0024516 3300046542 Bacteria 2783
1107 Ga0495597_0036258 3300046542 Bacteria 2221
1108 Ga0495597_0054840 3300046542 Bacteria 1749
1109 Ga0495597_0072295 3300046542 Bacteria 1484
1110 Ga0495597_0116327 3300046542 Bacteria 1117
1111 Ga0495597_0131329 3300046542 Bacteria 1038
1112 Ga0495645_0041113 3300046543 Bacteria 3371
1113 Ga0495645_0086937 3300046543 Bacteria 2236
1114 Ga0495622_0000034 3300046557 Bacteria 123671
1115 Ga0495622_0000071 3300046557 Bacteria 89071
1116 Ga0495622_0000349 3300046557 Bacteria 32902
1117 Ga0495622_0008287 3300046557 Bacteria 4814
1118 Ga0495622_0017586 3300046557 Bacteria 3329
1119 Ga0495622_0072440 3300046557 Bacteria 1589
1120 Ga0495622_0136592 3300046557 Bacteria 1115
1121 Ga0495633_0000086 3300046558 Bacteria 124357
1122 Ga0495633_0000217 3300046558 Bacteria 71892
1123 Ga0495633_0001397 3300046558 Bacteria 18813
1124 Ga0495633_0007711 3300046558 Bacteria 6157
1125 Ga0495633_0009061 3300046558 Bacteria 5534
1126 Ga0495633_0018429 3300046558 Bacteria 3546
1127 Ga0495633_0047647 3300046558 Bacteria 2025
1128 Ga0495633_0114237 3300046558 Bacteria 1251
1129 Ga0495633_0246407 3300046558 Bacteria 816
1130 Ga0495633_0303533 3300046558 Bacteria 725
1131 Ga0495667_0056055 3300046559 Bacteria 2592
1132 Ga0495656_0019673 3300046615 Bacteria 2608
1133 Ga0495656_0026775 3300046615 Bacteria 2298
1134 Ga0495656_0263058 3300046615 Bacteria 875
1135 Ga0495668_0000231 3300046616 Bacteria 79433
1136 Ga0495668_0000308 3300046616 Bacteria 67599
1137 Ga0495668_0000822 3300046616 Bacteria 35513
1138 Ga0495668_0002035 3300046616 Bacteria 17616
1139 Ga0495668_0002722 3300046616 Bacteria 14158
1140 Ga0495668_0003129 3300046616 Bacteria 12780
1141 Ga0495668_0014233 3300046616 Bacteria 4670
1142 Ga0495668_0028317 3300046616 Bacteria 3168
1143 Ga0495668_0029834 3300046616 Bacteria 3081
1144 Ga0495668_0037703 3300046616 Bacteria 2704
1145 Ga0495668_0047238 3300046616 Bacteria 2390
1146 Ga0495668_0202517 3300046616 Bacteria 1086
1147 Ga0495634_0004419 3300046642 Bacteria 11046
1148 Ga0495634_0008989 3300046642 Bacteria 7394
1149 Ga0495611_0000662 3300046648 Bacteria 19659
1150 Ga0495611_0005010 3300046648 Bacteria 5676
1151 Ga0495611_0020370 3300046648 Bacteria 2854
1152 Ga0495611_0030031 3300046648 Bacteria 2387
1153 Ga0495611_0091055 3300046648 Bacteria 1409
1154 Ga0495611_0218670 3300046648 Bacteria 886
1155 Ga0495625_0000447 3300046660 Bacteria 62017
1156 Ga0495625_0008737 3300046660 Bacteria 8587
1157 Ga0495625_0009504 3300046660 Bacteria 8125
1158 Ga0495625_0010695 3300046660 Bacteria 7559
1159 Ga0495625_0011910 3300046660 Bacteria 7061
1160 Ga0495625_0025498 3300046660 Bacteria 4483
1161 Ga0495625_0032036 3300046660 Bacteria 3904
1162 Ga0495625_0080111 3300046660 Bacteria 2275
1163 Ga0495625_0156004 3300046660 Bacteria 1532
1164 Ga0495625_0175047 3300046660 Bacteria 1430
1165 Ga0495625_0213522 3300046660 Bacteria 1267
1166 Ga0495625_0304701 3300046660 Bacteria 1018
1167 Ga0495625_0402420 3300046660 Bacteria 855
1168 Ga0495635_0008843 3300046663 Bacteria 7031
1169 Ga0495635_0009665 3300046663 Bacteria 6744
1170 Ga0495635_0010196 3300046663 Bacteria 6568
1171 Ga0495635_0348576 3300046663 Bacteria 988
1172 Ga0495659_0000272 3300046664 Bacteria 21144
1173 Ga0495659_0000630 3300046664 Bacteria 12815
1174 Ga0495659_0000744 3300046664 Bacteria 11693
1175 Ga0495659_0004261 3300046664 Bacteria 4508
1176 Ga0495659_0056764 3300046664 Bacteria 1437
1177 Ga0495661_0002878 3300046665 Bacteria 13018
1178 Ga0495661_0005985 3300046665 Bacteria 8586
1179 Ga0495661_0006475 3300046665 Bacteria 8232
1180 Ga0495661_0007851 3300046665 Bacteria 7424
1181 Ga0495661_0017607 3300046665 Bacteria 4717
1182 Ga0495661_0025557 3300046665 Bacteria 3812
1183 Ga0495661_0036985 3300046665 Bacteria 3050
1184 Ga0495661_0038428 3300046665 Bacteria 2981
1185 Ga0495661_0039078 3300046665 Bacteria 2950
1186 Ga0495661_0040712 3300046665 Bacteria 2879
1187 Ga0495661_0066900 3300046665 Bacteria 2112
1188 Ga0495661_0073436 3300046665 Bacteria 1993
1189 Ga0495661_0076343 3300046665 Bacteria 1944
1190 Ga0495661_0083077 3300046665 Bacteria 1842
1191 Ga0495661_0090715 3300046665 Bacteria 1738
1192 Ga0495661_0111090 3300046665 Bacteria 1527
1193 Ga0495661_0132759 3300046665 Bacteria 1362
1194 Ga0495588_0000156 3300046674 Bacteria 93559
1195 Ga0495588_0010066 3300046674 Bacteria 4384
1196 Ga0495588_0013550 3300046674 Bacteria 3886
1197 Ga0495588_0017175 3300046674 Bacteria 3508
1198 Ga0495588_0174410 3300046674 Bacteria 1137
1199 Ga0495588_0194080 3300046674 Bacteria 1073
1200 Ga0495657_0134738 3300046675 Bacteria 1544
1201 Ga0495599_0002035 3300046678 Bacteria 11709
1202 Ga0495599_0003910 3300046678 Bacteria 8768
1203 Ga0495599_0032961 3300046678 Bacteria 3253
1204 Ga0495623_0004581 3300046679 Bacteria 9082
1205 Ga0495623_0061391 3300046679 Bacteria 2357
1206 Ga0495623_0063989 3300046679 Bacteria 2302
1207 Ga0495623_0078436 3300046679 Bacteria 2047
1208 Ga0495623_0099299 3300046679 Bacteria 1775
1209 Ga0495623_0109846 3300046679 Bacteria 1672
1210 Ga0495646_0004004 3300046680 Bacteria 9228
1211 Ga0495646_0010465 3300046680 Bacteria 5892
1212 Ga0495646_0034115 3300046680 Bacteria 3161
1213 Ga0495646_0109108 3300046680 Bacteria 1577
1214 Ga0495646_0161502 3300046680 Bacteria 1240
1215 Ga0495646_0207045 3300046680 Bacteria 1066
1216 Ga0495646_0271151 3300046680 Bacteria 904
1217 Ga0495669_0000032 3300046684 Bacteria 100472
1218 Ga0495669_0001674 3300046684 Bacteria 9085
1219 Ga0495669_0002103 3300046684 Bacteria 8161
1220 Ga0495669_0015525 3300046684 Bacteria 3262
1221 Ga0495669_0026320 3300046684 Bacteria 2542
1222 Ga0495669_0031466 3300046684 Bacteria 2330
1223 Ga0495669_0102186 3300046684 Bacteria 1332
1224 Ga0495669_0109494 3300046684 Bacteria 1289
1225 Ga0495669_0133049 3300046684 Bacteria 1171
1226 Ga0495669_0190462 3300046684 Bacteria 979
1227 Ga0495669_0194990 3300046684 Bacteria 967
1228 Ga0495613_0042351 3300046689 Bacteria 3369
1229 Ga0495613_0182819 3300046689 Bacteria 1484
1230 Ga0495613_0461470 3300046689 Bacteria 859
1231 Ga0495624_0002465 3300046690 Bacteria 14028
1232 Ga0495624_0014854 3300046690 Bacteria 5274
1233 Ga0495624_0045723 3300046690 Bacteria 2785
1234 Ga0495624_0050306 3300046690 Bacteria 2640
1235 Ga0495624_0065961 3300046690 Bacteria 2260
1236 Ga0495670_0004415 3300046691 Bacteria 6901
1237 Ga0495670_0017711 3300046691 Bacteria 3508
1238 Ga0495670_0028611 3300046691 Bacteria 2762
1239 Ga0495670_0039883 3300046691 Bacteria 2342
1240 Ga0495670_0072859 3300046691 Bacteria 1740
1241 Ga0495670_0074328 3300046691 Bacteria 1724
1242 Ga0495670_0083889 3300046691 Bacteria 1625
1243 Ga0495670_0152113 3300046691 Bacteria 1213
1244 Ga0495671_0000005 3300046692 Bacteria 509397
1245 Ga0495671_0001606 3300046692 Bacteria 14869
1246 Ga0495671_0001885 3300046692 Bacteria 13469
1247 Ga0495671_0016807 3300046692 Bacteria 3901
1248 Ga0495671_0018043 3300046692 Bacteria 3752
1249 Ga0495671_0036030 3300046692 Bacteria 2509
1250 Ga0495671_0062961 3300046692 Bacteria 1827
1251 Ga0495671_0071613 3300046692 Bacteria 1703
1252 Ga0495671_0149699 3300046692 Bacteria 1136
1253 Ga0495671_0160819 3300046692 Bacteria 1092
1254 Ga0495649_0002812 3300046694 Bacteria 12114
1255 Ga0495649_0008870 3300046694 Bacteria 6020
1256 Ga0495649_0008873 3300046694 Bacteria 6019
1257 Ga0495649_0014241 3300046694 Bacteria 4566
1258 Ga0495649_0017212 3300046694 Bacteria 4082
1259 Ga0495649_0017985 3300046694 Bacteria 3983
1260 Ga0495649_0039696 3300046694 Bacteria 2580
1261 Ga0495649_0041563 3300046694 Bacteria 2514
1262 Ga0495649_0056269 3300046694 Bacteria 2124
1263 Ga0495649_0060626 3300046694 Bacteria 2035
1264 Ga0495649_0086892 3300046694 Bacteria 1669
1265 Ga0495649_0122194 3300046694 Bacteria 1376
1266 Ga0495649_0157343 3300046694 Bacteria 1192
1267 Ga0495649_0178694 3300046694 Bacteria 1108
1268 Ga0495649_0209767 3300046694 Bacteria 1009
1269 Ga0495589_0000074 3300046794 Bacteria 93716
1270 Ga0495589_0000099 3300046794 Bacteria 83606
1271 Ga0495589_0001423 3300046794 Bacteria 13829
1272 Ga0495589_0006294 3300046794 Bacteria 6269
1273 Ga0495589_0006917 3300046794 Bacteria 5957
1274 Ga0495589_0025671 3300046794 Bacteria 2989
1275 Ga0495589_0035708 3300046794 Bacteria 2492
1276 Ga0495589_0061700 3300046794 Bacteria 1839
1277 Ga0495589_0063633 3300046794 Bacteria 1809
1278 Ga0495589_0084510 3300046794 Bacteria 1542
1279 Ga0495589_0105948 3300046794 Bacteria 1358
1280 Ga0495589_0114945 3300046794 Bacteria 1297
1281 Ga0495600_0001954 3300046809 Bacteria 11584
1282 Ga0495600_0009048 3300046809 Bacteria 6138
1283 Ga0495600_0066604 3300046809 Bacteria 2354
1284 Ga0495600_0176102 3300046809 Bacteria 1379
1285 Ga0495660_0000047 3300046810 Bacteria 149291
1286 Ga0495660_0010921 3300046810 Bacteria 5277
1287 Ga0495660_0012239 3300046810 Bacteria 4978
1288 Ga0495660_0020748 3300046810 Bacteria 3766
1289 Ga0495660_0028815 3300046810 Bacteria 3135
1290 Ga0495660_0045275 3300046810 Bacteria 2416
1291 Ga0495660_0050151 3300046810 Bacteria 2275
1292 Ga0495660_0053255 3300046810 Bacteria 2197
1293 Ga0495660_0057073 3300046810 Bacteria 2107
1294 Ga0495660_0057347 3300046810 Bacteria 2101
1295 Ga0495660_0213770 3300046810 Bacteria 913
1296 Ga0495581_0003264 3300047315 Bacteria 9298
1297 Ga0495581_0004538 3300047315 Bacteria 8020
1298 Ga0495581_0012662 3300047315 Bacteria 4888
1299 Ga0495604_0006827 3300047317 Bacteria 9045
1300 Ga0495604_0015545 3300047317 Bacteria 6075
1301 Ga0495604_0024936 3300047317 Bacteria 4768
1302 Ga0495604_0057662 3300047317 Bacteria 2986
1303 Ga0495604_0065726 3300047317 Bacteria 2760
1304 Ga0495604_0139727 3300047317 Bacteria 1731
1305 Ga0495604_0176657 3300047317 Bacteria 1497
1306 Ga0495604_0402983 3300047317 Bacteria 900
1307 Ga0495636_0000635 3300047318 Bacteria 12874
1308 Ga0495636_0000793 3300047318 Bacteria 11615
1309 Ga0495636_0014027 3300047318 Bacteria 3184
1310 Ga0495636_0034548 3300047318 Bacteria 2081
1311 Ga0495636_0059415 3300047318 Bacteria 1613
1312 Ga0495636_0141278 3300047318 Bacteria 1075
1313 Ga0495674_0012431 3300047319 Bacteria 8022
1314 Ga0495674_0015155 3300047319 Bacteria 7211
1315 Ga0495674_0032425 3300047319 Bacteria 4737
1316 Ga0495674_0106237 3300047319 Bacteria 2384
1317 Ga0495674_0126426 3300047319 Bacteria 2156
1318 Ga0495674_0134158 3300047319 Bacteria 2084
1319 Ga0495672_0000019 3300047320 Bacteria 448153
1320 Ga0495672_0000026 3300047320 Bacteria 340319
1321 Ga0495672_0000081 3300047320 Bacteria 159863
1322 Ga0495672_0000256 3300047320 Bacteria 74232
1323 Ga0495672_0000421 3300047320 Bacteria 50887
1324 Ga0495672_0000532 3300047320 Bacteria 43305
1325 Ga0495672_0001024 3300047320 Bacteria 28735
1326 Ga0495672_0001885 3300047320 Bacteria 19961
1327 Ga0495672_0005608 3300047320 Bacteria 9909
1328 Ga0495672_0015255 3300047320 Bacteria 5223
1329 Ga0495672_0015962 3300047320 Bacteria 5084
1330 Ga0495672_0026927 3300047320 Bacteria 3660
1331 Ga0495672_0033773 3300047320 Bacteria 3167
1332 Ga0495672_0075323 3300047320 Bacteria 1898
1333 Ga0495672_0303651 3300047320 Bacteria 755
1334 Ga0495676_0000031 3300047321 Bacteria 132364
1335 Ga0495676_0015996 3300047321 Bacteria 6662
1336 Ga0495676_0032388 3300047321 Bacteria 4412
1337 Ga0495676_0112806 3300047321 Bacteria 1991
1338 Ga0495680_0006910 3300047322 Bacteria 10471
1339 Ga0495680_0051022 3300047322 Bacteria 3232
1340 Ga0495680_0089862 3300047322 Bacteria 2305
1341 Ga0495680_0101214 3300047322 Bacteria 2146
1342 Ga0495680_0173109 3300047322 Bacteria 1562
1343 Ga0495683_0000211 3300047323 Bacteria 55182
1344 Ga0495683_0000799 3300047323 Bacteria 22405
1345 Ga0495683_0001275 3300047323 Bacteria 17066
1346 Ga0495683_0005185 3300047323 Bacteria 7257
1347 Ga0495683_0007236 3300047323 Bacteria 6023
1348 Ga0495683_0013201 3300047323 Bacteria 4325
1349 Ga0495683_0022535 3300047323 Bacteria 3238
1350 Ga0495683_0037886 3300047323 Bacteria 2442
1351 Ga0495683_0043763 3300047323 Bacteria 2253
1352 Ga0495683_0067786 3300047323 Bacteria 1756
1353 Ga0495683_0092695 3300047323 Bacteria 1461
1354 Ga0495683_0106040 3300047323 Bacteria 1346
1355 Ga0495687_000071 3300047443 Bacteria 159096
1356 Ga0495687_000172 3300047443 Bacteria 95963
1357 Ga0495687_000216 3300047443 Bacteria 81734
1358 Ga0495687_000238 3300047443 Bacteria 76186
1359 Ga0495687_000446 3300047443 Bacteria 50964
1360 Ga0495687_000699 3300047443 Bacteria 37523
1361 Ga0495687_000941 3300047443 Bacteria 30047
1362 Ga0495687_004764 3300047443 Bacteria 8963
1363 Ga0495687_006200 3300047443 Bacteria 7387
1364 Ga0495687_008808 3300047443 Bacteria 5723
1365 Ga0495687_008897 3300047443 Bacteria 5685
1366 Ga0495687_015441 3300047443 Bacteria 3883
1367 Ga0495687_131201 3300047443 Bacteria 886
1368 Ga0495675_0005062 3300047444 Bacteria 8022
1369 Ga0495675_0006246 3300047444 Bacteria 7288
1370 Ga0495675_0006408 3300047444 Bacteria 7203
1371 Ga0495675_0013243 3300047444 Bacteria 5205
1372 Ga0495675_0035531 3300047444 Bacteria 3182
1373 Ga0495675_0045043 3300047444 Bacteria 2809
1374 Ga0495675_0062507 3300047444 Bacteria 2357
1375 Ga0495675_0105246 3300047444 Bacteria 1763
1376 Ga0495677_0000016 3300047445 Bacteria 126981
1377 Ga0495677_0001452 3300047445 Bacteria 9509
1378 Ga0495677_0002703 3300047445 Bacteria 6930
1379 Ga0495677_0005954 3300047445 Bacteria 4618
1380 Ga0495677_0020955 3300047445 Bacteria 2369
1381 Ga0495677_0046077 3300047445 Bacteria 1600
1382 Ga0495677_0059357 3300047445 Bacteria 1416
1383 Ga0495677_0070831 3300047445 Bacteria 1299
1384 Ga0495677_0074019 3300047445 Bacteria 1271
1385 Ga0495677_0150993 3300047445 Bacteria 894
1386 Ga0495679_000742 3300047446 Bacteria 20949
1387 Ga0495679_004470 3300047446 Bacteria 6435
1388 Ga0495679_007958 3300047446 Bacteria 4361
1389 Ga0495679_017101 3300047446 Bacteria 2604
1390 Ga0495679_028786 3300047446 Bacteria 1818
1391 Ga0495679_034019 3300047446 Bacteria 1624
1392 Ga0495679_061921 3300047446 Bacteria 1095
1393 Ga0495685_000034 3300047447 Bacteria 56654
1394 Ga0495685_009165 3300047447 Bacteria 3300
1395 Ga0495685_021702 3300047447 Bacteria 2209
1396 Ga0495685_034875 3300047447 Bacteria 1729
1397 Ga0495673_0000008 3300047469 Bacteria 752462
1398 Ga0495673_0000009 3300047469 Bacteria 731993
1399 Ga0495673_0000012 3300047469 Bacteria 656908
1400 Ga0495673_0006968 3300047469 Bacteria 6577
1401 Ga0495673_0013138 3300047469 Bacteria 4360
1402 Ga0495673_0021744 3300047469 Bacteria 3159
1403 Ga0495673_0026625 3300047469 Bacteria 2762
1404 Ga0495681_0000455 3300047470 Bacteria 31371
1405 Ga0495681_0001167 3300047470 Bacteria 19943
1406 Ga0495681_0003571 3300047470 Bacteria 10824
1407 Ga0495681_0005081 3300047470 Bacteria 8869
1408 Ga0495681_0011268 3300047470 Bacteria 5338
1409 Ga0495681_0042030 3300047470 Bacteria 2215
1410 Ga0495681_0054511 3300047470 Bacteria 1867
1411 Ga0495684_0406607 3300047471 Bacteria 954
1412 Ga0495686_0000114 3300047472 Bacteria 167232
1413 Ga0495686_0000130 3300047472 Bacteria 152244
1414 Ga0495686_0000214 3300047472 Bacteria 106493
1415 Ga0495686_0000604 3300047472 Bacteria 49704
1416 Ga0495686_0000677 3300047472 Bacteria 46044
1417 Ga0495686_0021809 3300047472 Bacteria 4247
1418 Ga0495686_0023072 3300047472 Bacteria 4111
1419 Ga0495686_0121314 3300047472 Bacteria 1557
1420 Ga0495686_0125907 3300047472 Bacteria 1523
1421 Ga0495686_0142896 3300047472 Bacteria 1411
1422 Ga0495593_0002595 3300047673 Bacteria 10859
1423 Ga0495593_0003130 3300047673 Bacteria 9940
1424 Ga0495593_0004295 3300047673 Bacteria 8474
1425 Ga0495593_0027862 3300047673 Bacteria 3106
1426 Ga0495593_0042247 3300047673 Bacteria 2447
1427 Ga0495593_0077530 3300047673 Bacteria 1721
1428 Ga0495593_0118899 3300047673 Bacteria 1345
1429 Ga0495602_0013599 3300048088 Bacteria 8310
1430 Ga0495602_0015119 3300048088 Bacteria 7802
1431 Ga0495602_0025623 3300048088 Bacteria 5703
1432 Ga0495602_0057560 3300048088 Bacteria 3408
1433 Ga0495602_0099477 3300048088 Bacteria 2390
1434 Ga0495602_0119911 3300048088 Bacteria 2118
1435 Ga0495602_0144787 3300048088 Bacteria 1876
1436 Ga0495602_0322882 3300048088 Bacteria 1122
1437 Ga0495614_0004355 3300048089 Bacteria 6380
1438 Ga0495614_0021779 3300048089 Bacteria 2767
1439 Ga0495614_0055344 3300048089 Bacteria 1701
1440 Ga0495614_0205042 3300048089 Bacteria 893
1441 Ga0495626_0000005 3300048091 Bacteria 337534
1442 Ga0495626_0000042 3300048091 Bacteria 169058
1443 Ga0495626_0002637 3300048091 Bacteria 12188
1444 Ga0495626_0003725 3300048091 Bacteria 9629
1445 Ga0495626_0007878 3300048091 Bacteria 5897
1446 Ga0495626_0009196 3300048091 Bacteria 5349
1447 Ga0495626_0016797 3300048091 Bacteria 3709
1448 Ga0495626_0018784 3300048091 Bacteria 3463
1449 Ga0495626_0021029 3300048091 Bacteria 3244
1450 Ga0495626_0025433 3300048091 Bacteria 2896
1451 Ga0495626_0036313 3300048091 Bacteria 2348
1452 Ga0495626_0042688 3300048091 Bacteria 2130
1453 Ga0495626_0064570 3300048091 Bacteria 1658
1454 Ga0495626_0117655 3300048091 Bacteria 1145
1455 Ga0495626_0224271 3300048091 Bacteria 762
1456 Ga0496100_0021845 3300048903 Bacteria 3861
1457 Ga0496100_0058980 3300048903 Bacteria 2520
1458 Ga0496100_0169077 3300048903 Bacteria 1573
1459 Ga0496101_0007572 3300048904 Bacteria 7045
1460 Ga0496101_0033588 3300048904 Bacteria 3618
1461 Ga0496101_0068275 3300048904 Bacteria 2599
1462 Ga0496101_0266999 3300048904 Bacteria 1335
1463 Ga0496102_0000153 3300048905 Bacteria 94014
1464 Ga0496102_0010940 3300048905 Bacteria 7815
1465 Ga0496102_0014119 3300048905 Bacteria 6938
1466 Ga0496102_0040268 3300048905 Bacteria 4226
1467 Ga0496102_0042124 3300048905 Bacteria 4137
1468 Ga0496102_0049020 3300048905 Bacteria 3841
1469 Ga0496102_0066897 3300048905 Bacteria 3294
1470 Ga0496102_0070985 3300048905 Bacteria 3198
1471 Ga0496102_0104739 3300048905 Bacteria 2631
1472 Ga0496102_0119231 3300048905 Bacteria 2463
1473 Ga0496102_0297722 3300048905 Bacteria 1520
1474 Ga0496102_0575395 3300048905 Bacteria 1049
1475 Ga0496103_0006283 3300048906 Bacteria 7105
1476 Ga0496103_0012243 3300048906 Bacteria 5092
1477 Ga0496103_0025854 3300048906 Bacteria 3550
1478 Ga0496103_0030757 3300048906 Bacteria 3268
1479 Ga0496103_0033633 3300048906 Bacteria 3132
1480 Ga0496103_0046265 3300048906 Bacteria 2686
1481 Ga0496103_0055585 3300048906 Bacteria 2455
1482 Ga0496103_0126747 3300048906 Bacteria 1628
1483 Ga0496104_0015668 3300048907 Bacteria 6875
1484 Ga0496104_0373506 3300048907 Bacteria 1338
1485 Ga0496104_0599773 3300048907 Bacteria 1011
1486 Ga0496105_0005306 3300048908 Bacteria 9770
1487 Ga0496105_0034843 3300048908 Bacteria 4142
1488 Ga0496105_0136979 3300048908 Bacteria 2016
1489 Ga0496105_0170036 3300048908 Bacteria 1787
1490 Ga0496105_0243329 3300048908 Bacteria 1459
1491 Ga0496105_0258171 3300048908 Bacteria 1410
1492 Ga0496105_0451217 3300048908 Bacteria 1015
1493 Ga0496106_0004246 3300048909 Bacteria 10663
1494 Ga0496106_0325648 3300048909 Bacteria 1233
1495 Ga0496106_0499668 3300048909 Bacteria 977
1496 Ga0496107_0019168 3300048910 Bacteria 4826
1497 Ga0496107_0061371 3300048910 Bacteria 2722
1498 Ga0496107_0174210 3300048910 Bacteria 1597
1499 Ga0496108_0205525 3300048911 Bacteria 1709
1500 Ga0496110_0001119 3300048913 Bacteria 18923
1501 Ga0496110_0014359 3300048913 Bacteria 6574
1502 Ga0496110_0447153 3300048913 Bacteria 1178
1503 Ga0496111_0064487 3300048914 Bacteria 2657
1504 Ga0496111_0095487 3300048914 Bacteria 2181
1505 Ga0496111_0140926 3300048914 Bacteria 1786
1506 Ga0496111_0385842 3300048914 Bacteria 1036
1507 Ga0496112_0003721 3300048915 Bacteria 12730
1508 Ga0496112_0552453 3300048915 Bacteria 1085
1509 Ga0496113_0042671 3300048916 Bacteria 3352
1510 Ga0496113_0259416 3300048916 Bacteria 1388
1511 Ga0496113_0614063 3300048916 Bacteria 870
1512 Ga0496114_0006589 3300048917 Bacteria 9155
1513 Ga0496114_0013611 3300048917 Bacteria 6524
1514 Ga0496114_0296113 3300048917 Bacteria 1428
1515 Ga0496114_0706976 3300048917 Bacteria 883
1516 Ga0496115_0026345 3300048918 Bacteria 4537
1517 Ga0496115_0285314 3300048918 Bacteria 1355
1518 Ga0496115_0307667 3300048918 Bacteria 1298
1519 Ga0496115_0359440 3300048918 Bacteria 1187
1520 Ga0496116_0002301 3300048919 Bacteria 20255
1521 Ga0496116_0003977 3300048919 Bacteria 14348
1522 Ga0496116_0006519 3300048919 Bacteria 10578
1523 Ga0496116_0035630 3300048919 Bacteria 3492
1524 Ga0496116_0148333 3300048919 Bacteria 1307
1525 Ga0496116_0180846 3300048919 Bacteria 1129
1526 Ga0496117_0000075 3300048920 Bacteria 232451
1527 Ga0496117_0002965 3300048920 Bacteria 20478
1528 Ga0496117_0007390 3300048920 Bacteria 10751
1529 Ga0496117_0020664 3300048920 Bacteria 5359
1530 Ga0496117_0059875 3300048920 Bacteria 2627
1531 Ga0496117_0114617 3300048920 Bacteria 1670
1532 Ga0496117_0138545 3300048920 Bacteria 1461
1533 Ga0496118_0000055 3300048921 Bacteria 232451
1534 Ga0496118_0012236 3300048921 Bacteria 8266
1535 Ga0496118_0012622 3300048921 Bacteria 8084
1536 Ga0496118_0021867 3300048921 Bacteria 5611
1537 Ga0496118_0037387 3300048921 Bacteria 3907
1538 Ga0496118_0040474 3300048921 Bacteria 3705
1539 Ga0496118_0065965 3300048921 Bacteria 2645
1540 Ga0496118_0133309 3300048921 Bacteria 1590
1541 Ga0496118_0173698 3300048921 Bacteria 1312
1542 Ga0496119_0126347 3300048922 Bacteria 1399
1543 Ga0496120_0034146 3300048923 Bacteria 3051
1544 Ga0496121_0003706 3300048924 Bacteria 21439
1545 Ga0496121_0009309 3300048924 Bacteria 11329
1546 Ga0496121_0011742 3300048924 Bacteria 9662
1547 Ga0496121_0013029 3300048924 Bacteria 8981
1548 Ga0496121_0033030 3300048924 Bacteria 4692
1549 Ga0496121_0039504 3300048924 Bacteria 4156
1550 Ga0496121_0081145 3300048924 Bacteria 2568
1551 Ga0496121_0088281 3300048924 Bacteria 2431
1552 Ga0496121_0146384 3300048924 Bacteria 1745
1553 Ga0496121_0185230 3300048924 Bacteria 1498
1554 Ga0496121_0206157 3300048924 Bacteria 1397
1555 Ga0496121_0241183 3300048924 Bacteria 1259
1556 Ga0496121_0419912 3300048924 Bacteria 870
1557 Ga0496122_0000482 3300048925 Bacteria 82868
1558 Ga0496122_0000905 3300048925 Bacteria 54607
1559 Ga0496122_0003176 3300048925 Bacteria 21923
1560 Ga0496122_0012773 3300048925 Bacteria 8311
1561 Ga0496122_0118903 3300048925 Bacteria 1710
1562 Ga0496122_0124401 3300048925 Bacteria 1654
1563 Ga0496123_0000227 3300048926 Bacteria 113878
1564 Ga0496123_0005248 3300048926 Bacteria 13151
1565 Ga0496123_0008164 3300048926 Bacteria 9657
1566 Ga0496123_0009479 3300048926 Bacteria 8763
1567 Ga0496124_0005752 3300048927 Bacteria 13803
1568 Ga0496124_0008580 3300048927 Bacteria 10663
1569 Ga0496124_0063191 3300048927 Bacteria 3094
1570 Ga0496124_0154510 3300048927 Bacteria 1796
1571 Ga0496124_0319898 3300048927 Bacteria 1111
1572 Ga0496125_0001380 3300048928 Bacteria 35616
1573 Ga0496125_0001638 3300048928 Bacteria 31567
1574 Ga0496125_0004412 3300048928 Bacteria 16261
1575 Ga0496125_0005828 3300048928 Bacteria 13535
1576 Ga0496125_0049459 3300048928 Bacteria 3493
1577 Ga0496125_0203749 3300048928 Bacteria 1292
1578 Ga0496126_0000538 3300048929 Bacteria 73271
1579 Ga0496126_0001364 3300048929 Bacteria 38662
1580 Ga0496126_0028130 3300048929 Bacteria 5360
1581 Ga0496126_0030437 3300048929 Bacteria 5113
1582 Ga0496126_0050858 3300048929 Bacteria 3775
1583 Ga0496126_0102401 3300048929 Bacteria 2503
1584 Ga0496126_0270939 3300048929 Bacteria 1409
1585 Ga0496126_0344123 3300048929 Bacteria 1221
1586 Ga0501308_003113 3300049128 Bacteria 1512
1587 Ga0501310_002876 3300049130 Bacteria 1659
1588 Ga0501304_000643 3300049160 Bacteria 1914
1589 Ga0495678_000027 3300049459 Bacteria 222075
1590 Ga0495678_000346 3300049459 Bacteria 48212
1591 Ga0495678_000660 3300049459 Bacteria 31650
1592 Ga0495678_001631 3300049459 Bacteria 17084
1593 Ga0495678_008745 3300049459 Bacteria 5075
1594 Ga0495678_011120 3300049459 Bacteria 4324
1595 Ga0495678_011978 3300049459 Bacteria 4128
1596 Ga0495678_041381 3300049459 Bacteria 1844
1597 Ga0495682_0004354 3300049460 Bacteria 6079
1598 Ga0495682_0005090 3300049460 Bacteria 5513
1599 Ga0495682_0023225 3300049460 Bacteria 2315
1600 Ga0495682_0031900 3300049460 Bacteria 1946
1601 Ga0495682_0040244 3300049460 Bacteria 1714
1602 Ga0495682_0049386 3300049460 Bacteria 1533
1603 Ga0501311_003911 3300049527 Bacteria 1555
1604 Ga0501032_0009427 3300049569 Bacteria 7075
1605 Ga0501032_0301310 3300049569 Bacteria 1036
1606 Ga0501033_0018594 3300049570 Bacteria 5252
1607 Ga0501033_0048541 3300049570 Bacteria 3153
1608 Ga0501033_0177259 3300049570 Bacteria 1529
1609 Ga0501034_0000134 3300049571 Bacteria 137745
1610 Ga0501034_0033780 3300049571 Bacteria 5185
1611 Ga0501034_0051630 3300049571 Bacteria 4146
1612 Ga0501034_0198293 3300049571 Bacteria 1966
1613 Ga0501034_0228065 3300049571 Bacteria 1812
1614 Ga0501034_0355196 3300049571 Bacteria 1393
1615 Ga0501036_0005627 3300049572 Bacteria 10163
1616 Ga0501037_0003798 3300049573 Bacteria 10958
1617 Ga0501038_0000308 3300049574 Bacteria 41640
1618 Ga0501038_0051942 3300049574 Bacteria 3535
1619 Ga0501039_0049683 3300049575 Bacteria 3243
1620 Ga0501039_0165429 3300049575 Bacteria 1739
1621 Ga0501041_0289320 3300049577 Bacteria 1032
1622 Ga0501043_0011593 3300049579 Bacteria 6899
1623 Ga0501043_0125819 3300049579 Bacteria 2010
1624 Ga0501046_0005535 3300049580 Bacteria 11282
1625 Ga0501047_0203883 3300049581 Bacteria 1838
1626 Ga0501067_0014769 3300049583 Bacteria 4321
1627 Ga0501068_0011775 3300049584 Bacteria 4944
1628 Ga0501068_0016177 3300049584 Bacteria 4297
1629 Ga0501069_0005304 3300049585 Bacteria 6697
1630 Ga0501070_0004972 3300049586 Bacteria 11345
1631 Ga0501070_0325343 3300049586 Bacteria 1250
1632 Ga0501072_0111710 3300049588 Bacteria 2175
1633 Ga0501073_0004706 3300049589 Bacteria 10250
1634 Ga0501073_0020338 3300049589 Bacteria 4789
1635 Ga0501073_0085988 3300049589 Bacteria 2187
1636 Ga0501073_0196247 3300049589 Bacteria 1396
1637 Ga0501074_0015194 3300049590 Bacteria 5596
1638 Ga0501074_0098931 3300049590 Bacteria 2088
1639 Ga0501074_0571461 3300049590 Bacteria 800
1640 Ga0501075_0090612 3300049591 Bacteria 2320
1641 Ga0501227_029079 3300049665 Bacteria 1316
1642 Ga0501230_007380 3300049667 Bacteria 1627
1643 Ga0501249_008251 3300049679 Bacteria 2160
1644 Ga0501079_0029242 3300049741 Bacteria 4230
1645 Ga0501079_0567053 3300049741 Bacteria 893
1646 Ga0501080_0003344 3300049742 Bacteria 14161
1647 Ga0501080_0011689 3300049742 Bacteria 8042
1648 Ga0501080_0017218 3300049742 Bacteria 6677
1649 Ga0501080_0053880 3300049742 Bacteria 3746
1650 Ga0501080_0060315 3300049742 Bacteria 3531
1651 Ga0501083_0005028 3300049744 Bacteria 9367
1652 Ga0501083_0009361 3300049744 Bacteria 6915
1653 Ga0501083_0103712 3300049744 Bacteria 1874
1654 Ga0501083_0141541 3300049744 Bacteria 1575
1655 Ga0501269_000005 3300049766 Bacteria 77832
1656 Ga0501279_002403 3300049775 Bacteria 2458
1657 Ga0501280_003292 3300049776 Bacteria 2505
1658 Ga0501035_0003996 3300049822 Bacteria 14068
1659 Ga0501035_0019309 3300049822 Bacteria 6272
1660 Ga0501035_0133784 3300049822 Bacteria 2160
1661 Ga0501044_0004681 3300049823 Bacteria 15300
1662 Ga0501044_0009119 3300049823 Bacteria 10836
1663 Ga0501044_0325587 3300049823 Bacteria 1460
1664 nmdc:mga03683_151849_c1 3300050489 Bacteria 1045
1665 nmdc:mga0yw44_179258_c1 3300050492 Bacteria 1394
1666 nmdc:mga07m45_241138_c1 3300050496 Bacteria 1052
1667 nmdc:mga07m45_337944_c1 3300050496 Bacteria 875
1668 nmdc:mga08y16_411247_c1 3300050511 Bacteria 1383
1669 Ga0495601_0121240 3300053077 Bacteria 1698
1670 Ga0500646_0023312 3300053090 Bacteria 1659
1671 Ga0500650_0176643 3300053098 Bacteria 980
1672 Ga0500593_000047 3300053117 Bacteria 42992
1673 Ga0500618_000170 3300053125 Bacteria 54570
1674 Ga0500642_0003458 3300053130 Bacteria 4778
1675 Ga0500568_0016908 3300053139 Bacteria 3230
1676 Ga0500568_0020397 3300053139 Bacteria 2867
1677 Ga0500568_0187588 3300053139 Bacteria 759
1678 Ga0500604_0000369 3300053151 Bacteria 12308
1679 Ga0500619_004428 3300053154 Bacteria 3014
1680 Ga0500633_0097212 3300053160 Bacteria 1081
1681 Ga0500609_000967 3300053731 Bacteria 4306
1682 Ga0501084_0216487 3300054114 Bacteria 1616
1683 Ga0587080_021915 3300059503 Bacteria 1054
1684 Ga0587082_005565 3300059504 Bacteria 1643
1685 Ga0587106_018043 3300059605 Bacteria 1015
1686 Ga0587067_007373 3300059640 Bacteria 1569
1687 Ga0587068_000188 3300059641 Bacteria 4690
1688 Ga0587069_015391 3300059642 Bacteria 1079
1689 Ga0587072_020606 3300059643 Bacteria 1164
1690 Ga0587076_029378 3300059645 Bacteria 965
1691 Ga0587079_015520 3300059647 Bacteria 1295
1692 Ga0501082_0110399 3300060353 Bacteria 2380
1693 Ga0466962_0001912 3300061719 Bacteria 9801
1694 Ga0466962_0006689 3300061719 Bacteria 5526
1695 Ga0466962_0035485 3300061719 Bacteria 2387
1696 Ga0466962_0080936 3300061719 Bacteria 1553
1697 Ga0466962_0093419 3300061719 Bacteria 1442
1698 Ga0466962_0119613 3300061719 Bacteria 1270
1699 Ga0466962_0216021 3300061719 Bacteria 938
1700 2501075052 2501025501 Bacteria 7768574
1701 2501084062 2501025502 Bacteria 9641094
1702 2501412749 2501025504 Bacteria 8008976
1703 2510252524 2510065045 Bacteria 7761063
1704 2511093383 2510917013 Bacteria 9951648
1705 2511099833 2510917014 Bacteria 8296963
1706 2511102396 2510917015 Bacteria 7950052
1707 2511249686 2511231003 Bacteria 5606035
1708 2511385816 2511231026 Bacteria 5225445
1709 2512348381 2512047030 Bacteria 9031815
1710 2513556090 2513237082 Bacteria 8640282
1711 2513564276 2513237083 Bacteria 8410967
1712 2513956682 2513237150 Bacteria 6553639
1713 2513962659 2513237151 Bacteria 6309801
1714 2514044488 2513237165 Bacteria 6771773
1715 2514050841 2513237166 Bacteria 10373764
1716 2515684801 2515154122 Bacteria 8609520
1717 2515690884 2515154123 Bacteria 6387382
1718 2516022285 2515154189 Bacteria 9629850
1719 2519457570 2519103095 Bacteria 6629912
1720 2521560069 2521172590 Bacteria 5047645
1721 2527079969 2526164713 Bacteria 6780608
1722 2548848704 2547132512 Bacteria 3416496
1723 2550695173 2548876994 Bacteria 4904866
1724 2553008061 2551306416 Bacteria 6152985
1725 2563061588 2562617112 Bacteria 10918404
1726 2585294095 2582581311 Bacteria 6763856
1727 2597031592 2596583598 Bacteria 5251611
1728 2599448057 2599185178 Bacteria 5365746
1729 2599741100 2599185239 Bacteria 8686614
1730 2599748407 2599185240 Bacteria 7968121
1731 2600210319 2599185355 Bacteria 7968906
1732 2600813852 2600255067 Bacteria 6795583
1733 2601666860 2600255292 Bacteria 6300551
1734 2643792562 2643221554 Bacteria 6603920
1735 2643800949 2643221556 Bacteria 7251154
1736 2643867717 2643221570 Bacteria 5103772
1737 2643991580 2643221596 Bacteria 5006805
1738 2644027012 2643221603 Bacteria 6147767
1739 2644216922 2643221638 Bacteria 6579467
1740 2644250544 2643221645 Bacteria 7207331
1741 2644293326 2643221652 Bacteria 5140275
1742 2644358865 2643221664 Bacteria 7272945
1743 2644471315 2643221684 Bacteria 7145183
1744 2676745756 2675903129 Bacteria 7964495
1745 2713478546 2711768613 Bacteria 11048459
1746 2719641622 2718217991 Bacteria 7829542
1747 2722881943 2721755523 Bacteria 6430384
1748 2738738683 2738541280 Bacteria 6630198
1749 2738826219 2738541297 Bacteria 6549566
1750 2738842499 2738541300 Bacteria 6675882
1751 2739150016 2738541357 Bacteria 6549408
1752 2739191935 2738543003 Bacteria 6549560
1753 2739273246 2738543018 Bacteria 6718814
1754 2739318412 2738543026 Bacteria 6549408
1755 2739336653 2738543029 Bacteria 6549249
1756 2739342290 2738543030 Bacteria 6719714
1757 2746087286 2744054900 Bacteria 8399525
1758 2746093207 2744054901 Bacteria 8397047
1759 2753566139 2751185846 Bacteria 7242164
1760 2765571248 2765235838 Bacteria 5445269
1761 2792837008 2791355137 Bacteria 9654227
1762 2808972911 2808606384 Bacteria 8474373
1763 2808982585 2808606386 Bacteria 4471946
1764 2809007924 2808606390 Bacteria 8476311
1765 2809015436 2808606391 Bacteria 8308166
1766 2809146397 2808606418 Bacteria 6724496
1767 2817259760 2816332253 Bacteria 6764532
1768 2817277429 2816332256 Bacteria 6891714
1769 2817453595 2816332286 Bacteria 6853759
1770 2819543795 2818991436 Bacteria 5376622
1771 2819592780 2818991445 Bacteria 4955017
1772 2819616432 2818991449 Bacteria 5518009
1773 2819636856 2818991452 Bacteria 8442785
1774 2821134978 2821131069 Bacteria 6108407
1775 2839099089 2839094727 Bacteria 5534556
1776 2839144892 2839138175 Bacteria 6549354
1777 2842332124 2842324504 Bacteria 9364110
1778 2842356424 2842348783 Bacteria 9002918
1779 2842461222 2842454564 Bacteria 8730687
1780 2842715837 2842711865 Bacteria 7155354
1781 2857552747 2857547612 Bacteria 6179999
1782 2857558123 2857553236 Bacteria 6166726
1783 2857558772 2857558681 Bacteria 6617694
1784 2857569649 2857564685 Bacteria 6290584
1785 2863426438 2863421361 Bacteria 7300805
1786 2870069344 2870068957 Bacteria 8925310
1787 2883091382 2883087390 Bacteria 9532701
1788 2884815964 2884811622 Bacteria 5552861
1789 2884838653 2884836552 Bacteria 5219991
1790 2884854944 2884852848 Bacteria 5221161
1791 2885086327 2885080285 Bacteria 6355622
1792 2885269473 2885266251 Bacteria 4796748
1793 2885272422 2885270888 Bacteria 9831543
1794 2894024279 2894023352 Bacteria 5167372
1795 2896156387 2896154374 Bacteria 5221518
1796 2900580405 2900577576 Bacteria 5438534
1797 2900637133 2900634093 Bacteria 10263517
1798 2901312862 2901300506 Bacteria 8463898
1799 2902686737 2902682994 Bacteria 8951596
1800 2904428342 2904424332 Bacteria 7633521
1801 2904439041 2904434214 Bacteria 6230908
1802 2904440897 2904439833 Bacteria 5931679
1803 2904490178 2904483920 Bacteria 7545285
1804 2904535499 2904530477 Bacteria 5876334
1805 2904569397 2904564687 Bacteria 7609577
1806 2904576766 2904571731 Bacteria 7608790
1807 2904588360 2904584206 Bacteria 6028872
1808 2904594752 2904589729 Bacteria 6113573
1809 2904606015 2904601388 Bacteria 5884906
1810 2904621508 2904615490 Bacteria 10047340
1811 2919049064 2919046199 Bacteria 5567169
1812 2919084673 2919079590 Bacteria 5946433
1813 2919476431 2919476304 Bacteria 5888696
1814 2919533347 2919527303 Bacteria 7718827
1815 2921647674 2921643360 Bacteria 11448031
1816 2923513800 2923510766 Bacteria 5926163
1817 2928063672 2928058823 Bacteria 5520022
1818 2928134360 2928130867 Bacteria 5467269
1819 2928163104 2928157003 Bacteria 7522202
1820 2928170146 2928163908 Bacteria 7561269
1821 2928176276 2928170801 Bacteria 8785406
1822 2928542074 2928536128 Bacteria 7657547
1823 2932415682 2932410948 Bacteria 6312192
1824 2932421672 2932416698 Bacteria 6315112
1825 2939635101 2939631187 Bacteria 6118131
1826 2981996049 2981990288 Bacteria 7590678
1827 2990713974 2990710928 Bacteria 5002431
1828 642416515 641736154 Bacteria 7689995
1829 642594556 642555112 Bacteria 8676562
1830 642623141 642555113 Bacteria 8214658
1831 644749193 644736347 Bacteria 6476522
1832 8003402207 8003400568 Bacteria 5535898
1833 8003956768 8003955200 Bacteria 8601927
1834 8018847987 8018845410 Bacteria 8933938
1835 8020813972 8020807995 Bacteria 6801506
1836 8020938988 8020938398 Bacteria 7472757
1837 8020947704 8020945358 Bacteria 8467355
1838 8020953465 8020953355 Bacteria 7439080
1839 8021127571 8021120328 Bacteria 8782274
1840 8039099721 8039098773 Bacteria 6602928
1841 8040171549 8040167225 Bacteria 6542727
1842 8040174163 8040173305 Bacteria 6827067
1843 8047674662 8047673197 Bacteria 7395230
1844 8055269487 8055266321 Bacteria 7999742
1845 8055307351 8055301274 Bacteria 8587385
1846 Ga0105243_10474243
1847 JGI24740J21852_10000135
1848 JGI24740J21852_10001768
1849 JGI24740J21852_10001853
1850 JGI24740J21852_10005999
1851 JGI24739J22299_10022915
1852 JGI24737J22298_10022880
1853 JGI24735J21928_10000235
1854 JGI24735J21928_10001052
1855 JGI24735J21928_10007731
1856 JGI24735J21928_10013935
1857 JGI25155J39150_1000252
1858 JGI25155J39150_1000471
1859 JGI25156J39149_1000288
1860 JGI25156J39149_1002224
1861 JGI25156J39149_1007840
1862 JGI25156J39149_1008996
1863 JGI25156J39149_1009715
1864 JGI25156J39149_1009801
1865 JGI25162J39368_1000040
1866 JGI25154J39366_1000311
1867 JGI25154J39366_1000313
1868 JGI25154J39366_1000782
1869 JGI25154J39366_1000843
1870 JGI25158J39367_1001551
1871 JGI25157J39369_1000171
1872 JGI25157J39369_1017636
1873 JGI25163J39215_1002715
1874 JGI25152J39213_1003291
1875 JGI25150J39212_1002934
1876 JGI25159J45721_1001892
1877 JGI25159J45721_1003724
1878 JGI25159J45721_1009166
1879 JGI25151J46595_10004715
1880 JGI25165J46597_1000051
1881 JGI25165J46597_1000794
1882 JGI25165J46597_1002173
1883 JGI25153J46596_10009739
1884 JGI25160J50197_1000146
1885 JGI25160J50197_1010487
1886 JGI25161J50226_1001522
1887 JGI25161J50226_1011238
1888 Ga0007409J51694_1025088
1889 Ga0007409J51694_1048233
1890 Ga0006562J51391_1104372
1891 Ga0055538_1000025
1892 Ga0055538_1000038
1893 Ga0055538_1008095
1894 Ga0055539_1000032
1895 Ga0055539_1000049
1896 Ga0055539_1000218
1897 Ga0055539_1009140
1898 Ga0055533_1000042
1899 Ga0055533_1000060
1900 Ga0055533_1000476
1901 Ga0055533_1002544
1902 Ga0055532_1000044
1903 Ga0055532_1000066
1904 Ga0055532_1000092
1905 Ga0055525_1000028
1906 Ga0055525_1000050
1907 Ga0055525_1000068
1908 Ga0055527_1000035
1909 Ga0055527_1000754
1910 Ga0055527_1000965
1911 Ga0055527_1001071
1912 Ga0055535_1000046
1913 Ga0055535_1000050
1914 Ga0055535_1003356
1915 Ga0055535_1003379
1916 Ga0055542_1000120
1917 Ga0055542_1000632
1918 Ga0055542_1003203
1919 Ga0055542_1003219
1920 Ga0055529_1000015
1921 Ga0055529_1000087
1922 Ga0055529_1000089
1923 Ga0055529_1001970
1924 Ga0055529_1007909
1925 Ga0055526_1000007
1926 Ga0055526_1000037
1927 Ga0055526_1000343
1928 Ga0055526_1007575
1929 Ga0055526_1009468
1930 Ga0055526_1009857
1931 Ga0055526_1011535
1932 Ga0055526_1022838
1933 Ga0055537_1000919
1934 Ga0055537_1006082
1935 Ga0055537_1007456
1936 Ga0055537_1009989
1937 Ga0055524_1000247
1938 Ga0055524_1000274
1939 Ga0055524_1000669
1940 Ga0055524_1006368
1941 Ga0055524_1007455
1942 Ga0055524_1008701
1943 Ga0055524_1012087
1944 Ga0055536_1000176
1945 Ga0055534_1000243
1946 Ga0055534_1001271
1947 Ga0055534_1004240
1948 Ga0055528_1000136
1949 Ga0055528_1003558
1950 Ga0055528_1018811
1951 Ga0055530_10012077
1952 Ga0055530_10023764
1953 Ga0055540_1000260
1954 Ga0055531_10013625
1955 Ga0055531_10016969
1956 Ga0055531_10018308
1957 Ga0055541_1000023
1958 Ga0055541_1000036
1959 Ga0055541_1000458
1960 Ga0058692_1002468
1961 Ga0055543_1001677
1962 Ga0055543_1013860
1963 Ga0065165_1000034
1964 Ga0065165_1000648
1965 Ga0065165_1002291
1966 Ga0065165_1004802
1967 Ga0065165_1019021
1968 Ga0065704_10074875
1969 Ga0065715_10031298
1970 Ga0070658_10009738
1971 Ga0070658_10252810
1972 Ga0070658_10298740
1973 Ga0070670_100051316
1974 Ga0070670_100583848
1975 Ga0068869_100145809
1976 Ga0068869_100374272
1977 Ga0070680_100217122
1978 Ga0070680_100400374
1979 Ga0070680_100679046
1980 Ga0070682_100005659
1981 Ga0070660_100000025
1982 Ga0070660_100000555
1983 Ga0070660_100010089
1984 Ga0070660_100051976
1985 Ga0070660_100058207
1986 Ga0070660_100612637
1987 Ga0070661_100000262
1988 Ga0070661_100022926
1989 Ga0070661_100164696
1990 Ga0070674_100040498
1991 Ga0070659_100000264
1992 Ga0070659_100005724
1993 Ga0070659_100018272
1994 Ga0070667_100010109
1995 Ga0070663_100000023
1996 Ga0070663_100000091
1997 Ga0070663_100018911
1998 Ga0070663_100091103
1999 Ga0070678_100025024
2000 Ga0070662_100095737
2001 Ga0070662_100134647
2002 Ga0070681_10722485
2003 Ga0070685_10221124
2004 Ga0070679_100054548
2005 Ga0070679_100128291
2006 Ga0070679_100332861
2007 Ga0068853_100700698
2008 Ga0068853_100737576
2009 Ga0070672_100548352
2010 Ga0070665_100712212
2011 Ga0068855_100001111
2012 Ga0068855_100006806
2013 Ga0068855_100008147
2014 Ga0068855_100016221
2015 Ga0068855_100059989
2016 Ga0068855_100148173
2017 Ga0068855_100299736
2018 Ga0068855_100374634
2019 Ga0068855_100491942
2020 Ga0070664_100000018
2021 Ga0070664_100026949
2022 Ga0070664_100144131
2023 Ga0070664_100401467
2024 Ga0068857_100001732
2025 Ga0068857_100225732
2026 Ga0068857_100283044
2027 Ga0068854_100000172
2028 Ga0068854_100007750
2029 Ga0068854_100104816
2030 Ga0068856_100000070
2031 Ga0068856_100199213
2032 Ga0068856_100314369
2033 Ga0068856_100367835
2034 Ga0068856_100599143
2035 Ga0068852_100010880
2036 Ga0068852_100035944
2037 Ga0068852_100518981
2038 Ga0068852_100843943
2039 Ga0068863_100273120
2040 Ga0068862_100023985
2041 Ga0081539_10032489
2042 Ga0075365_10171293
2043 Ga0075368_10117034
2044 Ga0070712_100149818
2045 Ga0075362_10039286
2046 Ga0068871_100077185
2047 Ga0075430_100050939
2048 Ga0068865_100497723
2049 Ga0079104_1000016
2050 Ga0079104_1000711
2051 Ga0079104_1006155
2052 Ga0099826_10000008
2053 Ga0099826_10000024
2054 Ga0105251_10004486
2055 Ga0105251_10030439
2056 Ga0105251_10051013
2057 Ga0105251_10072269
2058 Ga0105244_10000412
2059 Ga0105244_10002472
2060 Ga0105244_10085866
2061 Ga0105244_10117988
2062 Ga0105244_10121236
2063 Ga0105244_10169461
2064 Ga0105250_10009366
2065 Ga0105250_10019362
2066 Ga0105250_10110629
2067 Ga0105240_10006365
2068 Ga0105240_10006528
2069 Ga0105240_10008072
2070 Ga0105240_10026536
2071 Ga0105240_10128381
2072 Ga0105240_10300619
2073 Ga0105240_10393484
2074 Ga0105245_10169237
2075 Ga0105245_10246184
2076 Ga0105243_10009503
2077 Ga0105243_10010684
2078 Ga0105241_10021587
2079 Ga0105241_10071497
2080 Ga0105241_10232011
2081 Ga0105241_10809255
2082 Ga0105242_10230046
2083 Ga0105242_10295858
2084 Ga0105242_10601415
2085 Ga0105248_10022233
2086 Ga0105237_10037418
2087 Ga0105237_10063263
2088 Ga0105237_10182266
2089 Ga0105237_10313441
2090 Ga0105238_10000037
2091 Ga0105238_10004242
2092 Ga0105238_10141596
2093 Ga0105238_10155359
2094 Ga0105238_10303145
2095 Ga0105238_10800359
2096 Ga0105239_10013346
2097 Ga0105239_10030147
2098 Ga0105239_10598343
2099 Ga0105239_11135403
2100 Ga0105246_10515812
2101 Ga0105246_10922743
2102 Ga0157373_10010458
2103 Ga0157373_10029055
2104 Ga0157371_10000003
2105 Ga0157371_10000275
2106 Ga0157371_10194209
2107 Ga0157370_10000237
2108 Ga0157370_10000560
2109 Ga0157370_10016731
2110 Ga0157370_10222721
2111 Ga0157369_10000147
2112 Ga0157369_10000872
2113 Ga0157369_10002777
2114 Ga0157369_10015223
2115 Ga0157369_10028956
2116 Ga0157369_10140094
2117 Ga0157369_10205442
2118 Ga0157369_10505654
2119 Ga0157374_10000251
2120 Ga0157378_10272358
2121 Ga0157378_10549407
2122 Ga0157378_10696155
2123 Ga0163162_10016362
2124 Ga0163162_10191271
2125 Ga0157372_10000307
2126 Ga0157372_10000323
2127 Ga0157372_11030646
2128 Ga0182008_10008961
2129 Ga0182008_10099147
2130 Ga0157379_10054648
2131 Ga0157379_10292136
2132 Ga0182006_1000023
2133 Ga0182006_1000125
2134 Ga0182006_1000649
2135 Ga0182006_1050376
2136 Ga0182007_10000082
2137 Ga0182007_10000738
2138 Ga0182007_10018446
2139 Ga0182007_10031446
2140 Ga0182007_10053762
2141 Ga0182007_10083360
2142 Ga0182005_1000006
2143 Ga0182005_1000047
2144 Ga0182005_1015068
2145 Ga0183361_10015
2146 Ga0206356_11205717
2147 Ga0206351_10335588
2148 Ga0154015_1261654
2149 Ga0213872_10000024
2150 Ga0213872_10000714
2151 Ga0213872_10030904
2152 Ga0213872_10034286
2153 Ga0213872_10239475
2154 Ga0224712_10000002
2155 Ga0209435_100004
2156 Ga0209435_100168
2157 Ga0209760_102818
2158 Ga0209436_104927
2159 Ga0209784_100010
2160 Ga0209784_100021
2161 Ga0209784_100052
2162 Ga0209784_100807
2163 Ga0209784_102019
2164 Ga0209566_100008
2165 Ga0209566_100039
2166 Ga0209566_100068
2167 Ga0209566_100235
2168 Ga0209566_100312
2169 Ga0209566_101794
2170 Ga0209674_100019
2171 Ga0209674_100036
2172 Ga0209674_100087
2173 Ga0209674_100153
2174 Ga0209674_100296
2175 Ga0209674_101200
2176 Ga0209672_100054
2177 Ga0209672_100072
2178 Ga0209672_100073
2179 Ga0209672_100214
2180 Ga0209672_100308
2181 Ga0209147_100011
2182 Ga0209147_100085
2183 Ga0209147_100090
2184 Ga0209147_100093
2185 Ga0209147_100100
2186 Ga0209563_100011
2187 Ga0209563_100021
2188 Ga0209563_100040
2189 Ga0209563_100108
2190 Ga0209563_102096
2191 Ga0207427_100432
2192 Ga0207427_101304
2193 Ga0209437_100019
2194 Ga0209437_100207
2195 Ga0209258_100130
2196 Ga0209258_100140
2197 Ga0209258_100168
2198 Ga0209258_100279
2199 Ga0209258_100397
2200 Ga0207425_1000009
2201 Ga0207425_1000036
2202 Ga0207425_1000176
2203 Ga0207425_1014788
2204 Ga0209646_1000119
2205 Ga0209646_1000125
2206 Ga0209646_1000140
2207 Ga0209646_1000205
2208 Ga0209646_1014119
2209 Ga0209026_1000066
2210 Ga0209026_1002319
2211 Ga0209026_1002536
2212 Ga0209026_1010192
2213 Ga0209026_1024616
2214 Ga0209677_100011
2215 Ga0209677_100023
2216 Ga0209677_100043
2217 Ga0209677_102613
2218 Ga0209677_105141
2219 Ga0209148_1000119
2220 Ga0209148_1000140
2221 Ga0209148_1000451
2222 Ga0209148_1000470
2223 Ga0209148_1005948
2224 Ga0209759_1000114
2225 Ga0209759_1000281
2226 Ga0209759_1000329
2227 Ga0209759_1000362
2228 Ga0209759_1000961
2229 Ga0209759_1001269
2230 Ga0209759_1001696
2231 Ga0209759_1004527
2232 Ga0209759_1024031
2233 Ga0209129_1000051
2234 Ga0209129_1005038
2235 Ga0209233_1000025
2236 Ga0209233_1000173
2237 Ga0209565_1000082
2238 Ga0209565_1000727
2239 Ga0209565_1001389
2240 Ga0209565_1004441
2241 Ga0209565_1012568
2242 Ga0209565_1028887
2243 Ga0209455_1000031
2244 Ga0209455_1000119
2245 Ga0209455_1000125
2246 Ga0209455_1000217
2247 Ga0209455_1002842
2248 Ga0209455_1007044
2249 Ga0209673_1000098
2250 Ga0209673_1000381
2251 Ga0209673_1016805
2252 Ga0209673_1032983
2253 Ga0209130_1000016
2254 Ga0209130_1000834
2255 Ga0209130_1002465
2256 Ga0209130_1008973
2257 Ga0209675_1000166
2258 Ga0209675_1000684
2259 Ga0209675_1001176
2260 Ga0209675_1010828
2261 Ga0209675_1018977
2262 Ga0209675_1019471
2263 Ga0209675_1020572
2264 Ga0209676_1000331
2265 Ga0209025_1000485
2266 Ga0209025_1000823
2267 Ga0209025_1000853
2268 Ga0209025_1001173
2269 Ga0209025_1003577
2270 Ga0209564_1000010
2271 Ga0209564_1000042
2272 Ga0209564_1000710
2273 Ga0209564_1000927
2274 Ga0209564_1001559
2275 Ga0209564_1003986
2276 Ga0209564_1004745
2277 Ga0209564_1004809
2278 Ga0209564_1011217
2279 Ga0209758_1000028
2280 Ga0209758_1000054
2281 Ga0209758_1000433
2282 Ga0209758_1013994
2283 Ga0209758_1027115
2284 Ga0209050_1000086
2285 Ga0209050_1000549
2286 Ga0209050_1003829
2287 Ga0209050_1011261
2288 Ga0209256_1000018
2289 Ga0209256_1000049
2290 Ga0209256_1000380
2291 Ga0209256_1000612
2292 Ga0209256_1000802
2293 Ga0209256_1002718
2294 Ga0209256_1008331
2295 Ga0209256_1009346
2296 Ga0207426_1000199
2297 Ga0207426_1005650
2298 Ga0207426_1055235
2299 Ga0207426_1072359
2300 Ga0209051_1000196
2301 Ga0209051_1000247
2302 Ga0209051_1007632
2303 Ga0209257_1000087
2304 Ga0209257_1000141
2305 Ga0209257_1000305
2306 Ga0209257_1000758
2307 Ga0209257_1009026
2308 Ga0209257_1037163
2309 Ga0207696_1007984
2310 Ga0207696_1014759
2311 Ga0207655_1001385
2312 Ga0207655_1001828
2313 Ga0207655_1053955
2314 Ga0207655_1057336
2315 Ga0207655_1083082
2316 Ga0207713_1002620
2317 Ga0207713_1047112
2318 Ga0207713_1072075
2319 Ga0207647_10000126
2320 Ga0207647_10002757
2321 Ga0207647_10020622
2322 Ga0207647_10062878
2323 Ga0207643_10424232
2324 Ga0207705_10001027
2325 Ga0207705_10014561
2326 Ga0207654_10015780
2327 Ga0207654_10101797
2328 Ga0207654_10236979
2329 Ga0207654_10386936
2330 Ga0207695_10004822
2331 Ga0207695_10007348
2332 Ga0207695_10016358
2333 Ga0207695_10021117
2334 Ga0207695_10060685
2335 Ga0207695_10070563
2336 Ga0207695_10123779
2337 Ga0207695_10136490
2338 Ga0207695_10241007
2339 Ga0207695_10513073
2340 Ga0207671_10015181
2341 Ga0207671_10019071
2342 Ga0207671_10020701
2343 Ga0207671_10129901
2344 Ga0207671_10371378
2345 Ga0207693_10123859
2346 Ga0207660_10108304
2347 Ga0207660_10227973
2348 Ga0207657_10000065
2349 Ga0207657_10001751
2350 Ga0207657_10002121
2351 Ga0207657_10014060
2352 Ga0207657_10090401
2353 Ga0207657_10122346
2354 Ga0207657_10395596
2355 Ga0207657_10415552
2356 Ga0207649_10000269
2357 Ga0207649_10117243
2358 Ga0207649_10269111
2359 Ga0207652_10192631
2360 Ga0207681_10200324
2361 Ga0207694_10000054
2362 Ga0207694_10022191
2363 Ga0207694_10022934
2364 Ga0207694_10069893
2365 Ga0207694_10098892
2366 Ga0207687_10015912
2367 Ga0207687_10100224
2368 Ga0207690_10000040
2369 Ga0207690_10004347
2370 Ga0207690_10027448
2371 Ga0207690_10044794
2372 Ga0207690_10092299
2373 Ga0207690_10431939
2374 Ga0207706_10171685
2375 Ga0207706_10238320
2376 Ga0207686_10160018
2377 Ga0207686_10205281
2378 Ga0207709_10000111
2379 Ga0207711_10029680
2380 Ga0207689_10217779
2381 Ga0207689_10745558
2382 Ga0207689_10850361
2383 Ga0207679_10000032
2384 Ga0207679_10002535
2385 Ga0207667_10000043
2386 Ga0207667_10018787
2387 Ga0207667_10021851
2388 Ga0207667_10022349
2389 Ga0207667_10030719
2390 Ga0207667_10040684
2391 Ga0207668_10154526
2392 Ga0207640_10000166
2393 Ga0207640_10056874
2394 Ga0207658_10010931
2395 Ga0207639_10407769
2396 Ga0207678_10000024
2397 Ga0207678_10002149
2398 Ga0207678_10110040
2399 Ga0207678_10152975
2400 Ga0207678_10300988
2401 Ga0207702_10000615
2402 Ga0207702_10292433
2403 Ga0207702_10528459
2404 Ga0207648_10010337
2405 Ga0207648_10645126
2406 Ga0207674_10002639
2407 Ga0207674_10105632
2408 Ga0207674_10185832
2409 Ga0207674_11174827
2410 Ga0207698_10021768
2411 Ga0207698_10072384
2412 Ga0207698_10107686
2413 Ga0207698_10163139
2414 Ga0209281_1000017
2415 Ga0209281_1000395
2416 Ga0209371_1000141
2417 Ga0209282_1000005
2418 Ga0209282_1000032
2419 Ga0268265_10031277
2420 Ga0268264_10460383
2421 Ga0307515_10092535
2422 Ga0265338_10000508
2423 Ga0265338_10003131
2424 Ga0265324_10033521
2425 Ga0268256_1005317
2426 Ga0316177_1078822
2427 Ga0316177_1198814
2428 Ga0316178_1123774
2429 Ga0316180_1047314
2430 Ga0316181_1294152
2431 Ga0316182_1184083
2432 Ga0265330_10019289
2433 Ga0265332_10000058
2434 Ga0265332_10004893
2435 Ga0265332_10007247
2436 Ga0265329_10106457
2437 Ga0265340_10051639
2438 Ga0265327_10029616
2439 Ga0265316_10556983
2440 Ga0307513_10140733
2441 Ga0307513_10162661
2442 Ga0307408_100000489
2443 Ga0307408_100005084
2444 Ga0307408_100007334
2445 Ga0307408_100011280
2446 Ga0307408_100025874
2447 Ga0307408_100083439
2448 Ga0307408_100563736
2449 Ga0307508_10098778
2450 Ga0265314_10017068
2451 Ga0265342_10105897
2452 Ga0307405_10501617
2453 Ga0307518_10043423
2454 Ga0307409_100189793
2455 Ga0307409_100897598
2456 Ga0307416_100012509
2457 Ga0307414_10008756
2458 Ga0307411_10140516
2459 Ga0373923_0128650
2460 Ga0373937_0034163
2461 Ga0395899_0000078
2462 Ga0395899_0000080
2463 Ga0395899_0001210
2464 Ga0395899_0003316
2465 Ga0395899_0005062
2466 Ga0395899_0017845
2467 Ga0395899_0045495
2468 Ga0395899_0064618
2469 Ga0395899_0066754
2470 Ga0395899_0068196
2471 Ga0395900_0000087
2472 Ga0395900_0000673
2473 Ga0395900_0050324
2474 Ga0395900_0056698
2475 Ga0395900_0071176
2476 Ga0395900_0081902
2477 Ga0395900_0082976
2478 Ga0395900_0097488
2479 Ga0395900_0120777
2480 Ga0395900_0121245
2481 Ga0395900_0130173
2482 Ga0395900_0135403
2483 Ga0395900_0233233
2484 Ga0395900_0262494
2485 Ga0395900_0350600
2486 Ga0395900_0460033
2487 Ga0395900_0485464
2488 Ga0395900_0627325
2489 Ga0395898_0000448
2490 Ga0395898_0003251
2491 Ga0395898_0003576
2492 Ga0395898_0022487
2493 Ga0395898_0023949
2494 Ga0395898_0198956
2495 Ga0395898_0662743
2496 Ga0395905_0001411
2497 Ga0395905_0002893
2498 Ga0395905_0011080
2499 Ga0395905_0011772
2500 Ga0395905_0046496
2501 Ga0395905_0047155
2502 Ga0395905_0050498
2503 Ga0395905_0055782
2504 Ga0395905_0059658
2505 Ga0395905_0073135
2506 Ga0395905_0145219
2507 Ga0395905_0248558
2508 Ga0395905_0398559
2509 Ga0395905_0774517
2510 Ga0395901_0000053
2511 Ga0395901_0000393
2512 Ga0395901_0000924
2513 Ga0395901_0006004
2514 Ga0395901_0009275
2515 Ga0395901_0012912
2516 Ga0395901_0066987
2517 Ga0395901_0125038
2518 Ga0395901_0125499
2519 Ga0395901_0209122
2520 Ga0395901_0313806
2521 Ga0395901_0339914
2522 Ga0395901_0370435
2523 Ga0395901_0391077
2524 Ga0395901_0472670
2525 Ga0395901_0578154
2526 Ga0436361_0079181
2527 Ga0436361_0102476
2528 Ga0436361_0161710
2529 Ga0436361_0224368
2530 Ga0436361_0599717
2531 Ga0436361_0767605
2532 Ga0436361_0894241
2533 Ga0439433_0087825
2534 Ga0439437_005890
2535 Ga0439448_0004496
2536 Ga0439448_0021749
2537 Ga0439449_0001931
2538 Ga0439455_0012317
2539 Ga0439455_0024129
2540 Ga0439457_023059
2541 Ga0439462_0043322
2542 Ga0450888_013337
2543 Ga0450890_006334
2544 Ga0450904_000386
2545 Ga0439446_0023268
2546 Ga0439458_0019286
2547 Ga0439458_0019319
2548 Ga0451577_0005927
2549 Ga0451577_0014648
2550 Ga0451577_0063542
2551 Ga0451577_0348134
2552 Ga0451577_0372038
2553 Ga0466969_0000901
2554 Ga0466969_0005144
2555 Ga0466969_0084418
2556 Ga0466969_0087059
2557 Ga0466969_0117940
2558 Ga0466972_0000290
2559 Ga0466972_0004693
2560 Ga0466972_0010105
2561 Ga0466972_0087351
2562 Ga0466973_0033070
2563 Ga0453683_0047497
2564 Ga0466965_0002106
2565 Ga0466965_0005814
2566 Ga0466965_0009529
2567 Ga0466965_0047090
2568 Ga0466965_0164056
2569 Ga0466965_0273601
2570 Ga0466966_0000070
2571 Ga0466966_0001458
2572 Ga0466966_0002015
2573 Ga0466966_0018583
2574 Ga0466966_0023441
2575 Ga0466966_0031772
2576 Ga0466966_0106779
2577 Ga0466966_0113110
2578 Ga0466966_0317349
2579 Ga0466961_0000382
2580 Ga0466961_0026078
2581 Ga0466961_0030801
2582 Ga0466961_0093077
2583 Ga0466963_0000156
2584 Ga0466963_0023867
2585 Ga0466963_0112189
2586 Ga0466963_0231656
2587 Ga0466964_0019148
2588 Ga0453684_0000716
2589 Ga0453684_0003881
2590 Ga0453684_0027030
2591 Ga0453684_0095863
2592 Ga0453684_0181113
2593 Ga0453684_1008831
2594 Ga0466971_0012419
2595 Ga0466971_0047844
2596 Ga0466971_0089128
2597 Ga0466971_0094381
2598 Ga0466968_0015240
2599 Ga0466970_0001718
2600 Ga0466970_0029992
2601 Ga0466970_0147776
2602 Ga0466970_0314679
2603 Ga0466957_0000646
2604 Ga0466957_0006404
2605 Ga0466957_0016515
2606 Ga0466957_0024930
2607 Ga0466957_0026257
2608 Ga0466957_0095826
2609 Ga0466957_0147486
2610 Ga0466957_0243711
2611 Ga0466957_0270031
2612 Ga0466957_0522928
2613 Ga0466960_0068700
2614 Ga0466960_0090869
2615 Ga0466959_0013509
2616 Ga0466959_0025178
2617 Ga0466959_0034425
2618 Ga0466959_0049528
2619 Ga0466959_0052451
2620 Ga0466959_0088963
2621 Ga0451576_0000239
2622 Ga0451576_0000313
2623 Ga0451576_0002171
2624 Ga0451576_0008528
2625 Ga0451576_0016875
2626 Ga0451576_0265587
2627 Ga0451576_0415269
2628 Ga0466958_0014519
2629 Ga0466958_0071687
2630 Ga0466958_0080449
2631 Ga0466967_0047541
2632 Ga0466967_0164782
2633 Ga0466967_0298690
2634 Ga0466967_0566512
2635 Ga0495617_000010
2636 Ga0495617_000020
2637 Ga0495617_000338
2638 Ga0495617_009279
2639 Ga0495617_018563
2640 Ga0495627_000004
2641 Ga0495627_002330
2642 Ga0495627_030358
2643 Ga0495627_052634
2644 Ga0495592_0007047
2645 Ga0495592_0007842
2646 Ga0495603_0004544
2647 Ga0495603_0025725
2648 Ga0495603_0044853
2649 Ga0495603_0053485
2650 Ga0495603_0057613
2651 Ga0495603_0230709
2652 Ga0495590_0000009
2653 Ga0495590_0000012
2654 Ga0495590_0000811
2655 Ga0495590_0002807
2656 Ga0495590_0003730
2657 Ga0495590_0005189
2658 Ga0495590_0008831
2659 Ga0495590_0018303
2660 Ga0495590_0058860
2661 Ga0495590_0066198
2662 Ga0495590_0101496
2663 Ga0495591_000312
2664 Ga0495591_010692
2665 Ga0495591_038492
2666 Ga0495629_0000162
2667 Ga0495629_0000590
2668 Ga0495629_0017871
2669 Ga0495629_0018888
2670 Ga0495629_0082659
2671 Ga0495629_0195629
2672 Ga0495638_0000047
2673 Ga0495638_0005328
2674 Ga0495638_0006905
2675 Ga0495638_0008837
2676 Ga0495638_0015873
2677 Ga0495638_0078523
2678 Ga0495638_0134201
2679 Ga0495638_0233337
2680 Ga0495651_0002594
2681 Ga0495651_0009717
2682 Ga0495651_0085300
2683 Ga0495653_0000035
2684 Ga0495653_0002868
2685 Ga0495653_0005359
2686 Ga0495653_0019705
2687 Ga0495653_0023820
2688 Ga0495653_0056177
2689 Ga0495653_0282222
2690 Ga0495653_0389966
2691 Ga0495650_0000077
2692 Ga0495650_0000128
2693 Ga0495650_0000167
2694 Ga0495650_0000261
2695 Ga0495650_0002873
2696 Ga0495650_0003960
2697 Ga0495650_0017253
2698 Ga0495650_0029713
2699 Ga0495580_0004249
2700 Ga0495580_0011235
2701 Ga0495580_0034358
2702 Ga0495580_0071806
2703 Ga0495580_0131714
2704 Ga0495580_0132898
2705 Ga0495580_0204026
2706 Ga0495580_0289561
2707 Ga0495582_0003873
2708 Ga0495582_0033637
2709 Ga0495582_0049401
2710 Ga0495582_0152436
2711 Ga0495582_0239201
2712 Ga0495605_0000018
2713 Ga0495605_0000055
2714 Ga0495605_0000961
2715 Ga0495605_0001384
2716 Ga0495605_0010923
2717 Ga0495605_0011263
2718 Ga0495605_0028227
2719 Ga0495605_0033268
2720 Ga0495605_0078987
2721 Ga0495605_0128887
2722 Ga0495605_0131316
2723 Ga0495605_0168055
2724 Ga0495662_0008371
2725 Ga0495662_0103141
2726 Ga0495664_0030381
2727 Ga0495664_0059563
2728 Ga0495664_0064656
2729 Ga0495584_0000004
2730 Ga0495584_0000073
2731 Ga0495584_0001460
2732 Ga0495584_0002768
2733 Ga0495584_0005708
2734 Ga0495584_0031663
2735 Ga0495584_0041975
2736 Ga0495584_0054502
2737 Ga0495584_0106154
2738 Ga0495584_0125728
2739 Ga0495584_0232985
2740 Ga0495585_0000119
2741 Ga0495585_0000692
2742 Ga0495585_0000859
2743 Ga0495585_0002189
2744 Ga0495585_0002462
2745 Ga0495585_0004522
2746 Ga0495585_0005821
2747 Ga0495585_0033255
2748 Ga0495585_0037334
2749 Ga0495585_0048752
2750 Ga0495585_0050185
2751 Ga0495585_0087035
2752 Ga0495585_0141409
2753 Ga0495585_0156197
2754 Ga0495594_0003092
2755 Ga0495594_0008963
2756 Ga0495594_0032602
2757 Ga0495594_0035150
2758 Ga0495594_0040861
2759 Ga0495594_0232613
2760 Ga0495596_0000916
2761 Ga0495596_0000968
2762 Ga0495596_0002756
2763 Ga0495596_0009364
2764 Ga0495596_0016204
2765 Ga0495596_0036884
2766 Ga0495596_0067744
2767 Ga0495596_0068581
2768 Ga0495596_0123354
2769 Ga0495607_0001276
2770 Ga0495607_0006186
2771 Ga0495607_0006362
2772 Ga0495607_0009405
2773 Ga0495607_0028869
2774 Ga0495607_0031432
2775 Ga0495607_0033315
2776 Ga0495607_0039916
2777 Ga0495607_0057223
2778 Ga0495607_0072083
2779 Ga0495607_0088201
2780 Ga0495607_0088926
2781 Ga0495583_0000115
2782 Ga0495583_0000132
2783 Ga0495583_0000493
2784 Ga0495583_0001058
2785 Ga0495583_0002029
2786 Ga0495583_0002050
2787 Ga0495583_0002235
2788 Ga0495583_0006944
2789 Ga0495583_0010659
2790 Ga0495583_0012070
2791 Ga0495583_0037921
2792 Ga0495583_0095812
2793 Ga0495583_0123575
2794 Ga0495606_0000288
2795 Ga0495606_0000512
2796 Ga0495606_0000790
2797 Ga0495606_0001762
2798 Ga0495606_0003944
2799 Ga0495606_0004472
2800 Ga0495606_0010834
2801 Ga0495606_0015287
2802 Ga0495606_0017462
2803 Ga0495606_0027510
2804 Ga0495606_0078968
2805 Ga0495606_0087127
2806 Ga0495606_0099424
2807 Ga0495606_0171442
2808 Ga0495606_0229789
2809 Ga0495608_0002285
2810 Ga0495608_0008809
2811 Ga0495608_0009653
2812 Ga0495610_0000014
2813 Ga0495610_0001174
2814 Ga0495610_0002561
2815 Ga0495610_0008287
2816 Ga0495610_0011267
2817 Ga0495610_0017992
2818 Ga0495610_0065200
2819 Ga0495610_0127224
2820 Ga0495616_0000157
2821 Ga0495616_0003730
2822 Ga0495616_0006125
2823 Ga0495616_0006610
2824 Ga0495616_0008291
2825 Ga0495616_0009471
2826 Ga0495616_0019415
2827 Ga0495616_0031569
2828 Ga0495616_0055111
2829 Ga0495616_0064591
2830 Ga0495616_0158514
2831 Ga0495616_0191137
2832 Ga0495618_0002173
2833 Ga0495618_0004385
2834 Ga0495618_0112545
2835 Ga0495620_0012913
2836 Ga0495620_0016011
2837 Ga0495620_0029433
2838 Ga0495628_0001227
2839 Ga0495628_0002006
2840 Ga0495628_0013732
2841 Ga0495628_0023641
2842 Ga0495628_0068051
2843 Ga0495628_0106929
2844 Ga0495630_0009319
2845 Ga0495630_0031536
2846 Ga0495630_0140791
2847 Ga0495630_0165717
2848 Ga0495630_0184907
2849 Ga0495630_0235013
2850 Ga0495631_0000272
2851 Ga0495631_0000791
2852 Ga0495631_0026569
2853 Ga0495631_0046671
2854 Ga0495631_0054078
2855 Ga0495631_0056641
2856 Ga0495632_0000017
2857 Ga0495632_0009675
2858 Ga0495632_0014248
2859 Ga0495632_0023987
2860 Ga0495632_0024729
2861 Ga0495637_0000003
2862 Ga0495637_0000142
2863 Ga0495637_0003152
2864 Ga0495637_0022607
2865 Ga0495643_0000082
2866 Ga0495643_0000085
2867 Ga0495643_0000160
2868 Ga0495643_0016840
2869 Ga0495643_0030664
2870 Ga0495643_0032926
2871 Ga0495643_0043739
2872 Ga0495643_0070739
2873 Ga0495643_0291830
2874 Ga0495644_0000831
2875 Ga0495644_0048664
2876 Ga0495644_0054796
2877 Ga0495644_0065013
2878 Ga0495644_0089619
2879 Ga0495648_0000019
2880 Ga0495648_0000052
2881 Ga0495648_0000732
2882 Ga0495648_0005994
2883 Ga0495648_0007724
2884 Ga0495648_0013458
2885 Ga0495648_0068950
2886 Ga0495648_0079104
2887 Ga0495648_0126544
2888 Ga0495648_0142867
2889 Ga0495648_0154276
2890 Ga0495648_0171493
2891 Ga0495663_0004983
2892 Ga0495666_0002778
2893 Ga0495666_0004516
2894 Ga0495666_0027014
2895 Ga0495666_0027173
2896 Ga0495666_0028331
2897 Ga0495666_0076052
2898 Ga0495666_0136393
2899 Ga0495642_0000449
2900 Ga0495642_0001035
2901 Ga0495642_0014414
2902 Ga0495642_0014960
2903 Ga0495642_0025140
2904 Ga0495642_0033463
2905 Ga0495642_0049869
2906 Ga0495642_0155630
2907 Ga0495652_0005308
2908 Ga0495652_0005804
2909 Ga0495652_0032944
2910 Ga0495652_0047949
2911 Ga0495652_0057709
2912 Ga0495652_0073703
2913 Ga0495652_0158900
2914 Ga0495654_0000014
2915 Ga0495654_0012762
2916 Ga0495654_0013228
2917 Ga0495654_0019607
2918 Ga0495665_0006743
2919 Ga0495665_0029480
2920 Ga0495665_0063431
2921 Ga0495665_0085729
2922 Ga0495665_0094168
2923 Ga0495665_0094478
2924 Ga0495665_0149897
2925 Ga0495640_0004166
2926 Ga0495640_0009652
2927 Ga0495640_0053150
2928 Ga0495586_0009640
2929 Ga0495586_0017078
2930 Ga0495586_0049963
2931 Ga0495587_0040545
2932 Ga0495587_0164319
2933 Ga0495598_0043154
2934 Ga0495609_0000038
2935 Ga0495609_0000434
2936 Ga0495609_0000537
2937 Ga0495609_0002203
2938 Ga0495609_0002312
2939 Ga0495609_0006214
2940 Ga0495609_0007989
2941 Ga0495609_0090705
2942 Ga0495609_0102196
2943 Ga0495621_0082827
2944 Ga0495597_0000535
2945 Ga0495597_0001237
2946 Ga0495597_0003960
2947 Ga0495597_0004345
2948 Ga0495597_0004947
2949 Ga0495597_0005518
2950 Ga0495597_0006195
2951 Ga0495597_0024516
2952 Ga0495597_0036258
2953 Ga0495597_0054840
2954 Ga0495597_0072295
2955 Ga0495597_0116327
2956 Ga0495597_0131329
2957 Ga0495645_0041113
2958 Ga0495645_0086937
2959 Ga0495622_0000034
2960 Ga0495622_0000071
2961 Ga0495622_0000349
2962 Ga0495622_0008287
2963 Ga0495622_0017586
2964 Ga0495622_0072440
2965 Ga0495622_0136592
2966 Ga0495633_0000086
2967 Ga0495633_0000217
2968 Ga0495633_0001397
2969 Ga0495633_0007711
2970 Ga0495633_0009061
2971 Ga0495633_0018429
2972 Ga0495633_0047647
2973 Ga0495633_0114237
2974 Ga0495633_0246407
2975 Ga0495633_0303533
2976 Ga0495667_0056055
2977 Ga0495656_0019673
2978 Ga0495656_0026775
2979 Ga0495656_0263058
2980 Ga0495668_0000231
2981 Ga0495668_0000308
2982 Ga0495668_0000822
2983 Ga0495668_0002035
2984 Ga0495668_0002722
2985 Ga0495668_0003129
2986 Ga0495668_0014233
2987 Ga0495668_0028317
2988 Ga0495668_0029834
2989 Ga0495668_0037703
2990 Ga0495668_0047238
2991 Ga0495668_0202517
2992 Ga0495634_0004419
2993 Ga0495634_0008989
2994 Ga0495611_0000662
2995 Ga0495611_0005010
2996 Ga0495611_0020370
2997 Ga0495611_0030031
2998 Ga0495611_0091055
2999 Ga0495611_0218670
3000 Ga0495625_0000447
3001 Ga0495625_0008737
3002 Ga0495625_0009504
3003 Ga0495625_0010695
3004 Ga0495625_0011910
3005 Ga0495625_0025498
3006 Ga0495625_0032036
3007 Ga0495625_0080111
3008 Ga0495625_0156004
3009 Ga0495625_0175047
3010 Ga0495625_0213522
3011 Ga0495625_0304701
3012 Ga0495625_0402420
3013 Ga0495635_0008843
3014 Ga0495635_0009665
3015 Ga0495635_0010196
3016 Ga0495635_0348576
3017 Ga0495659_0000272
3018 Ga0495659_0000630
3019 Ga0495659_0000744
3020 Ga0495659_0004261
3021 Ga0495659_0056764
3022 Ga0495661_0002878
3023 Ga0495661_0005985
3024 Ga0495661_0006475
3025 Ga0495661_0007851
3026 Ga0495661_0017607
3027 Ga0495661_0025557
3028 Ga0495661_0036985
3029 Ga0495661_0038428
3030 Ga0495661_0039078
3031 Ga0495661_0040712
3032 Ga0495661_0066900
3033 Ga0495661_0073436
3034 Ga0495661_0076343
3035 Ga0495661_0083077
3036 Ga0495661_0090715
3037 Ga0495661_0111090
3038 Ga0495661_0132759
3039 Ga0495588_0000156
3040 Ga0495588_0010066
3041 Ga0495588_0013550
3042 Ga0495588_0017175
3043 Ga0495588_0174410
3044 Ga0495588_0194080
3045 Ga0495657_0134738
3046 Ga0495599_0002035
3047 Ga0495599_0003910
3048 Ga0495599_0032961
3049 Ga0495623_0004581
3050 Ga0495623_0061391
3051 Ga0495623_0063989
3052 Ga0495623_0078436
3053 Ga0495623_0099299
3054 Ga0495623_0109846
3055 Ga0495646_0004004
3056 Ga0495646_0010465
3057 Ga0495646_0034115
3058 Ga0495646_0109108
3059 Ga0495646_0161502
3060 Ga0495646_0207045
3061 Ga0495646_0271151
3062 Ga0495669_0000032
3063 Ga0495669_0001674
3064 Ga0495669_0002103
3065 Ga0495669_0015525
3066 Ga0495669_0026320
3067 Ga0495669_0031466
3068 Ga0495669_0102186
3069 Ga0495669_0109494
3070 Ga0495669_0133049
3071 Ga0495669_0190462
3072 Ga0495669_0194990
3073 Ga0495613_0042351
3074 Ga0495613_0182819
3075 Ga0495613_0461470
3076 Ga0495624_0002465
3077 Ga0495624_0014854
3078 Ga0495624_0045723
3079 Ga0495624_0050306
3080 Ga0495624_0065961
3081 Ga0495670_0004415
3082 Ga0495670_0017711
3083 Ga0495670_0028611
3084 Ga0495670_0039883
3085 Ga0495670_0072859
3086 Ga0495670_0074328
3087 Ga0495670_0083889
3088 Ga0495670_0152113
3089 Ga0495671_0000005
3090 Ga0495671_0001606
3091 Ga0495671_0001885
3092 Ga0495671_0016807
3093 Ga0495671_0018043
3094 Ga0495671_0036030
3095 Ga0495671_0062961
3096 Ga0495671_0071613
3097 Ga0495671_0149699
3098 Ga0495671_0160819
3099 Ga0495649_0002812
3100 Ga0495649_0008870
3101 Ga0495649_0008873
3102 Ga0495649_0014241
3103 Ga0495649_0017212
3104 Ga0495649_0017985
3105 Ga0495649_0039696
3106 Ga0495649_0041563
3107 Ga0495649_0056269
3108 Ga0495649_0060626
3109 Ga0495649_0086892
3110 Ga0495649_0122194
3111 Ga0495649_0157343
3112 Ga0495649_0178694
3113 Ga0495649_0209767
3114 Ga0495589_0000074
3115 Ga0495589_0000099
3116 Ga0495589_0001423
3117 Ga0495589_0006294
3118 Ga0495589_0006917
3119 Ga0495589_0025671
3120 Ga0495589_0035708
3121 Ga0495589_0061700
3122 Ga0495589_0063633
3123 Ga0495589_0084510
3124 Ga0495589_0105948
3125 Ga0495589_0114945
3126 Ga0495600_0001954
3127 Ga0495600_0009048
3128 Ga0495600_0066604
3129 Ga0495600_0176102
3130 Ga0495660_0000047
3131 Ga0495660_0010921
3132 Ga0495660_0012239
3133 Ga0495660_0020748
3134 Ga0495660_0028815
3135 Ga0495660_0045275
3136 Ga0495660_0050151
3137 Ga0495660_0053255
3138 Ga0495660_0057073
3139 Ga0495660_0057347
3140 Ga0495660_0213770
3141 Ga0495581_0003264
3142 Ga0495581_0004538
3143 Ga0495581_0012662
3144 Ga0495604_0006827
3145 Ga0495604_0015545
3146 Ga0495604_0024936
3147 Ga0495604_0057662
3148 Ga0495604_0065726
3149 Ga0495604_0139727
3150 Ga0495604_0176657
3151 Ga0495604_0402983
3152 Ga0495636_0000635
3153 Ga0495636_0000793
3154 Ga0495636_0014027
3155 Ga0495636_0034548
3156 Ga0495636_0059415
3157 Ga0495636_0141278
3158 Ga0495674_0012431
3159 Ga0495674_0015155
3160 Ga0495674_0032425
3161 Ga0495674_0106237
3162 Ga0495674_0126426
3163 Ga0495674_0134158
3164 Ga0495672_0000019
3165 Ga0495672_0000026
3166 Ga0495672_0000081
3167 Ga0495672_0000256
3168 Ga0495672_0000421
3169 Ga0495672_0000532
3170 Ga0495672_0001024
3171 Ga0495672_0001885
3172 Ga0495672_0005608
3173 Ga0495672_0015255
3174 Ga0495672_0015962
3175 Ga0495672_0026927
3176 Ga0495672_0033773
3177 Ga0495672_0075323
3178 Ga0495672_0303651
3179 Ga0495676_0000031
3180 Ga0495676_0015996
3181 Ga0495676_0032388
3182 Ga0495676_0112806
3183 Ga0495680_0006910
3184 Ga0495680_0051022
3185 Ga0495680_0089862
3186 Ga0495680_0101214
3187 Ga0495680_0173109
3188 Ga0495683_0000211
3189 Ga0495683_0000799
3190 Ga0495683_0001275
3191 Ga0495683_0005185
3192 Ga0495683_0007236
3193 Ga0495683_0013201
3194 Ga0495683_0022535
3195 Ga0495683_0037886
3196 Ga0495683_0043763
3197 Ga0495683_0067786
3198 Ga0495683_0092695
3199 Ga0495683_0106040
3200 Ga0495687_000071
3201 Ga0495687_000172
3202 Ga0495687_000216
3203 Ga0495687_000238
3204 Ga0495687_000446
3205 Ga0495687_000699
3206 Ga0495687_000941
3207 Ga0495687_004764
3208 Ga0495687_006200
3209 Ga0495687_008808
3210 Ga0495687_008897
3211 Ga0495687_015441
3212 Ga0495687_131201
3213 Ga0495675_0005062
3214 Ga0495675_0006246
3215 Ga0495675_0006408
3216 Ga0495675_0013243
3217 Ga0495675_0035531
3218 Ga0495675_0045043
3219 Ga0495675_0062507
3220 Ga0495675_0105246
3221 Ga0495677_0000016
3222 Ga0495677_0001452
3223 Ga0495677_0002703
3224 Ga0495677_0005954
3225 Ga0495677_0020955
3226 Ga0495677_0046077
3227 Ga0495677_0059357
3228 Ga0495677_0070831
3229 Ga0495677_0074019
3230 Ga0495677_0150993
3231 Ga0495679_000742
3232 Ga0495679_004470
3233 Ga0495679_007958
3234 Ga0495679_017101
3235 Ga0495679_028786
3236 Ga0495679_034019
3237 Ga0495679_061921
3238 Ga0495685_000034
3239 Ga0495685_009165
3240 Ga0495685_021702
3241 Ga0495685_034875
3242 Ga0495673_0000008
3243 Ga0495673_0000009
3244 Ga0495673_0000012
3245 Ga0495673_0006968
3246 Ga0495673_0013138
3247 Ga0495673_0021744
3248 Ga0495673_0026625
3249 Ga0495681_0000455
3250 Ga0495681_0001167
3251 Ga0495681_0003571
3252 Ga0495681_0005081
3253 Ga0495681_0011268
3254 Ga0495681_0042030
3255 Ga0495681_0054511
3256 Ga0495684_0406607
3257 Ga0495686_0000114
3258 Ga0495686_0000130
3259 Ga0495686_0000214
3260 Ga0495686_0000604
3261 Ga0495686_0000677
3262 Ga0495686_0021809
3263 Ga0495686_0023072
3264 Ga0495686_0121314
3265 Ga0495686_0125907
3266 Ga0495686_0142896
3267 Ga0495593_0002595
3268 Ga0495593_0003130
3269 Ga0495593_0004295
3270 Ga0495593_0027862
3271 Ga0495593_0042247
3272 Ga0495593_0077530
3273 Ga0495593_0118899
3274 Ga0495602_0013599
3275 Ga0495602_0015119
3276 Ga0495602_0025623
3277 Ga0495602_0057560
3278 Ga0495602_0099477
3279 Ga0495602_0119911
3280 Ga0495602_0144787
3281 Ga0495602_0322882
3282 Ga0495614_0004355
3283 Ga0495614_0021779
3284 Ga0495614_0055344
3285 Ga0495614_0205042
3286 Ga0495626_0000005
3287 Ga0495626_0000042
3288 Ga0495626_0002637
3289 Ga0495626_0003725
3290 Ga0495626_0007878
3291 Ga0495626_0009196
3292 Ga0495626_0016797
3293 Ga0495626_0018784
3294 Ga0495626_0021029
3295 Ga0495626_0025433
3296 Ga0495626_0036313
3297 Ga0495626_0042688
3298 Ga0495626_0064570
3299 Ga0495626_0117655
3300 Ga0495626_0224271
3301 Ga0496100_0021845
3302 Ga0496100_0058980
3303 Ga0496100_0169077
3304 Ga0496101_0007572
3305 Ga0496101_0033588
3306 Ga0496101_0068275
3307 Ga0496101_0266999
3308 Ga0496102_0000153
3309 Ga0496102_0010940
3310 Ga0496102_0014119
3311 Ga0496102_0040268
3312 Ga0496102_0042124
3313 Ga0496102_0049020
3314 Ga0496102_0066897
3315 Ga0496102_0070985
3316 Ga0496102_0104739
3317 Ga0496102_0119231
3318 Ga0496102_0297722
3319 Ga0496102_0575395
3320 Ga0496103_0006283
3321 Ga0496103_0012243
3322 Ga0496103_0025854
3323 Ga0496103_0030757
3324 Ga0496103_0033633
3325 Ga0496103_0046265
3326 Ga0496103_0055585
3327 Ga0496103_0126747
3328 Ga0496104_0015668
3329 Ga0496104_0373506
3330 Ga0496104_0599773
3331 Ga0496105_0005306
3332 Ga0496105_0034843
3333 Ga0496105_0136979
3334 Ga0496105_0170036
3335 Ga0496105_0243329
3336 Ga0496105_0258171
3337 Ga0496105_0451217
3338 Ga0496106_0004246
3339 Ga0496106_0325648
3340 Ga0496106_0499668
3341 Ga0496107_0019168
3342 Ga0496107_0061371
3343 Ga0496107_0174210
3344 Ga0496108_0205525
3345 Ga0496110_0001119
3346 Ga0496110_0014359
3347 Ga0496110_0447153
3348 Ga0496111_0064487
3349 Ga0496111_0095487
3350 Ga0496111_0140926
3351 Ga0496111_0385842
3352 Ga0496112_0003721
3353 Ga0496112_0552453
3354 Ga0496113_0042671
3355 Ga0496113_0259416
3356 Ga0496113_0614063
3357 Ga0496114_0006589
3358 Ga0496114_0013611
3359 Ga0496114_0296113
3360 Ga0496114_0706976
3361 Ga0496115_0026345
3362 Ga0496115_0285314
3363 Ga0496115_0307667
3364 Ga0496115_0359440
3365 Ga0496116_0002301
3366 Ga0496116_0003977
3367 Ga0496116_0006519
3368 Ga0496116_0035630
3369 Ga0496116_0148333
3370 Ga0496116_0180846
3371 Ga0496117_0000075
3372 Ga0496117_0002965
3373 Ga0496117_0007390
3374 Ga0496117_0020664
3375 Ga0496117_0059875
3376 Ga0496117_0114617
3377 Ga0496117_0138545
3378 Ga0496118_0000055
3379 Ga0496118_0012236
3380 Ga0496118_0012622
3381 Ga0496118_0021867
3382 Ga0496118_0037387
3383 Ga0496118_0040474
3384 Ga0496118_0065965
3385 Ga0496118_0133309
3386 Ga0496118_0173698
3387 Ga0496119_0126347
3388 Ga0496120_0034146
3389 Ga0496121_0003706
3390 Ga0496121_0009309
3391 Ga0496121_0011742
3392 Ga0496121_0013029
3393 Ga0496121_0033030
3394 Ga0496121_0039504
3395 Ga0496121_0081145
3396 Ga0496121_0088281
3397 Ga0496121_0146384
3398 Ga0496121_0185230
3399 Ga0496121_0206157
3400 Ga0496121_0241183
3401 Ga0496121_0419912
3402 Ga0496122_0000482
3403 Ga0496122_0000905
3404 Ga0496122_0003176
3405 Ga0496122_0012773
3406 Ga0496122_0118903
3407 Ga0496122_0124401
3408 Ga0496123_0000227
3409 Ga0496123_0005248
3410 Ga0496123_0008164
3411 Ga0496123_0009479
3412 Ga0496124_0005752
3413 Ga0496124_0008580
3414 Ga0496124_0063191
3415 Ga0496124_0154510
3416 Ga0496124_0319898
3417 Ga0496125_0001380
3418 Ga0496125_0001638
3419 Ga0496125_0004412
3420 Ga0496125_0005828
3421 Ga0496125_0049459
3422 Ga0496125_0203749
3423 Ga0496126_0000538
3424 Ga0496126_0001364
3425 Ga0496126_0028130
3426 Ga0496126_0030437
3427 Ga0496126_0050858
3428 Ga0496126_0102401
3429 Ga0496126_0270939
3430 Ga0496126_0344123
3431 Ga0501308_003113
3432 Ga0501310_002876
3433 Ga0501304_000643
3434 Ga0495678_000027
3435 Ga0495678_000346
3436 Ga0495678_000660
3437 Ga0495678_001631
3438 Ga0495678_008745
3439 Ga0495678_011120
3440 Ga0495678_011978
3441 Ga0495678_041381
3442 Ga0495682_0004354
3443 Ga0495682_0005090
3444 Ga0495682_0023225
3445 Ga0495682_0031900
3446 Ga0495682_0040244
3447 Ga0495682_0049386
3448 Ga0501311_003911
3449 Ga0501032_0009427
3450 Ga0501032_0301310
3451 Ga0501033_0018594
3452 Ga0501033_0048541
3453 Ga0501033_0177259
3454 Ga0501034_0000134
3455 Ga0501034_0033780
3456 Ga0501034_0051630
3457 Ga0501034_0198293
3458 Ga0501034_0228065
3459 Ga0501034_0355196
3460 Ga0501036_0005627
3461 Ga0501037_0003798
3462 Ga0501038_0000308
3463 Ga0501038_0051942
3464 Ga0501039_0049683
3465 Ga0501039_0165429
3466 Ga0501041_0289320
3467 Ga0501043_0011593
3468 Ga0501043_0125819
3469 Ga0501046_0005535
3470 Ga0501047_0203883
3471 Ga0501067_0014769
3472 Ga0501068_0011775
3473 Ga0501068_0016177
3474 Ga0501069_0005304
3475 Ga0501070_0004972
3476 Ga0501070_0325343
3477 Ga0501072_0111710
3478 Ga0501073_0004706
3479 Ga0501073_0020338
3480 Ga0501073_0085988
3481 Ga0501073_0196247
3482 Ga0501074_0015194
3483 Ga0501074_0098931
3484 Ga0501074_0571461
3485 Ga0501075_0090612
3486 Ga0501227_029079
3487 Ga0501230_007380
3488 Ga0501249_008251
3489 Ga0501079_0029242
3490 Ga0501079_0567053
3491 Ga0501080_0003344
3492 Ga0501080_0011689
3493 Ga0501080_0017218
3494 Ga0501080_0053880
3495 Ga0501080_0060315
3496 Ga0501083_0005028
3497 Ga0501083_0009361
3498 Ga0501083_0103712
3499 Ga0501083_0141541
3500 Ga0501269_000005
3501 Ga0501279_002403
3502 Ga0501280_003292
3503 Ga0501035_0003996
3504 Ga0501035_0019309
3505 Ga0501035_0133784
3506 Ga0501044_0004681
3507 Ga0501044_0009119
3508 Ga0501044_0325587
3509 nmdc:mga03683_151849_c1
3510 nmdc:mga0yw44_179258_c1
3511 nmdc:mga07m45_241138_c1
3512 nmdc:mga07m45_337944_c1
3513 nmdc:mga08y16_411247_c1
3514 Ga0495601_0121240
3515 Ga0500646_0023312
3516 Ga0500650_0176643
3517 Ga0500593_000047
3518 Ga0500618_000170
3519 Ga0500642_0003458
3520 Ga0500568_0016908
3521 Ga0500568_0020397
3522 Ga0500568_0187588
3523 Ga0500604_0000369
3524 Ga0500619_004428
3525 Ga0500633_0097212
3526 Ga0500609_000967
3527 Ga0501084_0216487
3528 Ga0587080_021915
3529 Ga0587082_005565
3530 Ga0587106_018043
3531 Ga0587067_007373
3532 Ga0587068_000188
3533 Ga0587069_015391
3534 Ga0587072_020606
3535 Ga0587076_029378
3536 Ga0587079_015520
3537 Ga0501082_0110399
3538 Ga0466962_0001912
3539 Ga0466962_0006689
3540 Ga0466962_0035485
3541 Ga0466962_0080936
3542 Ga0466962_0093419
3543 Ga0466962_0119613
3544 Ga0466962_0216021
3545 2501075052
3546 2501084062
3547 2501412749
3548 2510252524
3549 2511093383
3550 2511099833
3551 2511102396
3552 2511249686
3553 2511385816
3554 2512348381
3555 2513556090
3556 2513564276
3557 2513956682
3558 2513962659
3559 2514044488
3560 2514050841
3561 2515684801
3562 2515690884
3563 2516022285
3564 2519457570
3565 2521560069
3566 2527079969
3567 2548848704
3568 2550695173
3569 2553008061
3570 2563061588
3571 2585294095
3572 2597031592
3573 2599448057
3574 2599741100
3575 2599748407
3576 2600210319
3577 2600813852
3578 2601666860
3579 2643792562
3580 2643800949
3581 2643867717
3582 2643991580
3583 2644027012
3584 2644216922
3585 2644250544
3586 2644293326
3587 2644358865
3588 2644471315
3589 2676745756
3590 2713478546
3591 2719641622
3592 2722881943
3593 2738738683
3594 2738826219
3595 2738842499
3596 2739150016
3597 2739191935
3598 2739273246
3599 2739318412
3600 2739336653
3601 2739342290
3602 2746087286
3603 2746093207
3604 2753566139
3605 2765571248
3606 2792837008
3607 2808972911
3608 2808982585
3609 2809007924
3610 2809015436
3611 2809146397
3612 2817259760
3613 2817277429
3614 2817453595
3615 2819543795
3616 2819592780
3617 2819616432
3618 2819636856
3619 2821134978
3620 2839099089
3621 2839144892
3622 2842332124
3623 2842356424
3624 2842461222
3625 2842715837
3626 2857552747
3627 2857558123
3628 2857558772
3629 2857569649
3630 2863426438
3631 2870069344
3632 2883091382
3633 2884815964
3634 2884838653
3635 2884854944
3636 2885086327
3637 2885269473
3638 2885272422
3639 2894024279
3640 2896156387
3641 2900580405
3642 2900637133
3643 2901312862
3644 2902686737
3645 2904428342
3646 2904439041
3647 2904440897
3648 2904490178
3649 2904535499
3650 2904569397
3651 2904576766
3652 2904588360
3653 2904594752
3654 2904606015
3655 2904621508
3656 2919049064
3657 2919084673
3658 2919476431
3659 2919533347
3660 2921647674
3661 2923513800
3662 2928063672
3663 2928134360
3664 2928163104
3665 2928170146
3666 2928176276
3667 2928542074
3668 2932415682
3669 2932421672
3670 2939635101
3671 2981996049
3672 2990713974
3673 642416515
3674 642594556
3675 642623141
3676 644749193
3677 8003402207
3678 8003956768
3679 8018847987
3680 8020813972
3681 8020938988
3682 8020947704
3683 8020953465
3684 8021127571
3685 8039099721
3686 8040171549
3687 8040174163
3688 8047674662
3689 8055269487
3690 8055307351

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01634

HisG

ATP phosphoribosyltransferase

77

234

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6r02-assembly1.cif.gz_E psychrobacter arcticus atp phosphoribosyltransferase bound to histidine and prpp 0.976 10 217
7z8u-assembly1.cif.gz_A-2 catalytic subunit hisg r56a mutant from psychrobacter arcticus atpprt (hisgz) in complex with atp and prpp 0.9755 11 219
6fua-assembly1.cif.gz_D-2 atp phosphoribosyltransferase (hiszg atpprt) from psychrobacter arcticus in complex with prpp and adp 0.9748 10 219
7z6r-assembly1.cif.gz_C psychrobacter arcticus atpprt (hisgz) r56a mutant bound to atp and prpp 0.9733 9 217
6fua-assembly1.cif.gz_C-2 atp phosphoribosyltransferase (hiszg atpprt) from psychrobacter arcticus in complex with prpp and adp 0.9726 10 217
ID Description Score Start End Superfamily
6fuaD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9735 10 219 3.40.190.10
1usyF02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.964 103 187 3.40.190.10
1o63B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9471 103 187 3.40.190.10
6fu2D02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9379 102 186 3.40.190.10
1ve4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9352 102 188 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7Y3NPR9-F1-model_v4 ATP phosphoribosyltransferase (EC 2.4.2.17) 0.9958 10 182 GO:0000105
GO:0003879
GO:0005524
GO:0005737
AF-A0A1R3WLU9-F1-model_v4 deleted 0.9932 10 228
AF-C0EM01-F1-model_v4 ATP phosphoribosyltransferase (ATP-PRT) (ATP-PRTase) (EC 2.4.2.17) 0.993 4 221 GO:0000105
GO:0003879
GO:0005524
GO:0005737
AF-A0A2M8EB40-F1-model_v4 ATP phosphoribosyltransferase (ATP-PRT) (ATP-PRTase) (EC 2.4.2.17) 0.9929 10 219 GO:0000105
GO:0003879
GO:0005524
GO:0005737
AF-Q21U97-F1-model_v4 ATP phosphoribosyltransferase (ATP-PRT) (ATP-PRTase) (EC 2.4.2.17) 0.9921 10 220 GO:0000105
GO:0003879
GO:0005524
GO:0005737

Map