F495829
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1830 | 1264 | 946 | 277 |
Family's Representative Sequence
| Representative Sequence | 3300005367|Ga0070667_100052380|Ga0070667_1000523802 |
| Length | 308 |
| Sequence | MSAAGPPQGTRPLGGAARSAVRGEHSDSRIPEPMLVVDDLRVSFPNRDGGMTEAVRGVSFVLGRERLGIVGESGSGKTQTGRAILGLTAPEGRVSARRLAFNGVDLLHCPPRQRRELRGGRIAMVLQDPKFSLNPVMSIGDQIVETLRAHSRVSARDARARALASLEAVRIDDPRRVYKLYPHEVSGGMGQRAMIAMMLIANPDLLIADEPTSALDVTVQLQVLAILDELVTRRGMGLIFVSHDLRLVSTFCDRILVMYAGRVVEEVEAGNLAAARHPYTRGLVECLPRLGEDRHPLPTLDRQPEWAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 3 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 4 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 5 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 6 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 7 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 8 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 9 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 10 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 11 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 12 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 13 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 14 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 15 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 16 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 17 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 18 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 19 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 20 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 21 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 22 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 23 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 24 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 25 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 26 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 27 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 28 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 29 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 30 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 31 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 32 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 33 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 34 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 35 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 36 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 37 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 38 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 39 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 40 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 41 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 42 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 43 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 44 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 45 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 46 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 47 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 48 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 49 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 50 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 51 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 52 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 53 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 54 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 55 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 56 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 57 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 58 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 59 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 60 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 61 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 62 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 63 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 64 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 65 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 66 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 67 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 68 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 69 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 70 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 71 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 72 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 73 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 74 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 75 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 76 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 77 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 78 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 79 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 80 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 81 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 82 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 83 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 84 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 85 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 86 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 87 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 88 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 89 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 90 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 91 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 92 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 93 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 94 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 95 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 96 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 97 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 98 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 99 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 100 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 101 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 102 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 103 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 104 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 105 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 106 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 107 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 108 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 109 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 110 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 111 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 112 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 113 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 114 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 115 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 116 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 117 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 118 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 119 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 120 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 121 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 122 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 123 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 124 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 125 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 126 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 127 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 128 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 129 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 130 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 131 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 132 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 133 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 134 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 135 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 136 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 137 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 138 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 139 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 140 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 141 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 142 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 143 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 144 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 145 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 146 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 147 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 148 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 149 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 150 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 151 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 152 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 153 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 154 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 155 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 156 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 157 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 158 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 159 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 160 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 161 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 162 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 163 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 164 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 165 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 166 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 167 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 168 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 169 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 170 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 171 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 172 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 173 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 174 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 175 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 176 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 177 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 178 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 179 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 180 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 181 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 182 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 183 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 184 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 185 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 186 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 187 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 188 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 189 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 190 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 191 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 192 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 193 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 194 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 195 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 196 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 197 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 198 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 199 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 200 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 201 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 202 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 203 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 204 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 205 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 206 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 207 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 208 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 209 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 210 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 211 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 212 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 213 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 214 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 215 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 216 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 217 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 218 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 219 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 220 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 221 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 222 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 223 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 224 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 225 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 226 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 227 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 228 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 229 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 230 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 231 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 232 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 233 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 234 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 235 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 236 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 237 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 238 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 239 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 240 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 241 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 242 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 243 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 244 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 245 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 246 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 247 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 248 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 249 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 250 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 251 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 252 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 253 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 254 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 255 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 256 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 257 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 258 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 259 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 260 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 261 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 262 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 263 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 264 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 265 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 266 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 267 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 268 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 269 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 270 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 271 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 272 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 273 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 274 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 275 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 276 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 277 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 278 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 279 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 280 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 281 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 282 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 283 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 284 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 285 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 286 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 287 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 288 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 289 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 290 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 291 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 292 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 293 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 294 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 295 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 296 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 297 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 298 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 299 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 300 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 301 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 302 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 303 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 304 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 305 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 306 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 307 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 308 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 309 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 310 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 311 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 312 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 313 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 314 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 315 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 316 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 317 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 318 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 319 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 320 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 321 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 322 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 323 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 324 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 325 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 326 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 327 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 328 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 329 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 330 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 331 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 332 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 333 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 334 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 335 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 336 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 337 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 338 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 339 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 340 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 341 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 342 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 343 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 344 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 345 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 346 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 347 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 348 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 349 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 350 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 351 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 352 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 353 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 354 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 355 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 356 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 357 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 358 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 359 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 360 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 361 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 362 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 363 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 364 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 365 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 366 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 367 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 368 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 369 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 370 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 371 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 372 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 373 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 374 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 375 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 376 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 377 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 378 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 379 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 380 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 381 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 382 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 383 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 384 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 385 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 386 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 387 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 388 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 389 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 390 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 391 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 392 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 393 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 394 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 395 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 396 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 397 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 398 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 399 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 400 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 401 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 402 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 403 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 404 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 405 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 406 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 407 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 408 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 409 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 410 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 411 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 412 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 413 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 414 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 415 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 416 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 417 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 418 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 419 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 420 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 421 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 422 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 423 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 424 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 425 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 426 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 427 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 428 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 429 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 430 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 431 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 432 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 433 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 434 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 435 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 436 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 437 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 438 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 439 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 440 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 441 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 442 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 443 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 444 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 445 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 446 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 447 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 448 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 449 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 450 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 451 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 452 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 453 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 454 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 455 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 456 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 457 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 458 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 459 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 460 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 461 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 462 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 463 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 464 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 465 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 466 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 467 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 468 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 469 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 470 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 471 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 472 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 473 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 474 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 475 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 476 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 477 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 478 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 479 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 480 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 481 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 482 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 483 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 484 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 485 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 486 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 487 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 488 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 489 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 490 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 491 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 492 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 493 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 494 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 495 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 496 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 497 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 498 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 499 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 500 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 501 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 502 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 503 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 504 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 505 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 506 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 507 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 508 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 509 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 510 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 511 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 512 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 513 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 514 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 515 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 516 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 517 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 518 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 519 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 520 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 521 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 522 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 523 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 524 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 525 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 526 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 527 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 528 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 529 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 530 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 531 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 532 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 533 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 534 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 535 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 536 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 537 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 538 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 539 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 540 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 541 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 542 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 543 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 544 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 545 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 546 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 547 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 548 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 549 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 550 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 551 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 552 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 553 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 554 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 555 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 556 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 557 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 558 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 559 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 560 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 561 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 562 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 563 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 564 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 565 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 566 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 567 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 568 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 569 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 570 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 571 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 572 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 573 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 574 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 575 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 576 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 577 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 578 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 579 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 580 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 581 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 582 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 583 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 584 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 585 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 586 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 587 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 588 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 589 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 590 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 591 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 592 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 593 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 594 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 595 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 596 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 597 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 598 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 599 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 600 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 601 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 602 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 603 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 604 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 605 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 606 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 607 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 608 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 609 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 610 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 611 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 612 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 613 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 614 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 615 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 616 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 617 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 618 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 619 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 620 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 621 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 622 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 623 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 624 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 625 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 626 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 627 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 628 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 629 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 630 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 631 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 632 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 633 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 634 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 635 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 636 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 637 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 638 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 639 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 640 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 641 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 642 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 643 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 644 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 645 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 646 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 647 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 648 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 649 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 650 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 651 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 652 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 653 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 654 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 655 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 656 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 657 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 658 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 659 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 660 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 661 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 662 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 663 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 664 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 665 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 666 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 667 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 668 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 669 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 670 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 671 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 672 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 673 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 674 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 675 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 676 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 677 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 678 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 679 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 680 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 681 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 682 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 683 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 684 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 685 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 686 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 687 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 688 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 689 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 690 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 691 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 692 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 693 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 694 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 695 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 696 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 697 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 698 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 699 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 700 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 701 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 702 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 703 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 704 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 705 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 706 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 707 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 708 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 709 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 710 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 711 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 712 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 713 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 714 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 715 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 716 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 717 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 718 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 719 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 720 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 721 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 722 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 723 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 724 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 725 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 726 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 727 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 728 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 729 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 730 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 731 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 732 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 733 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 734 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 735 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 736 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 737 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 738 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 739 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 740 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 741 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 742 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 743 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 744 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 745 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 746 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 747 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 748 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 749 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 750 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 751 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 752 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 753 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 754 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 755 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 756 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 757 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 758 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 759 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 760 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 761 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 762 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 763 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 764 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 765 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 766 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 767 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 768 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 769 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 770 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 771 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 772 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 773 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 774 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 775 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 776 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 777 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 778 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 779 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 780 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 781 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 782 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 783 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 784 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 785 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 786 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 787 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 788 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 789 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 790 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 791 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 792 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 793 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 794 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 795 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 796 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 797 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 798 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 799 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 800 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 801 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 802 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 803 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 804 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 805 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 806 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 807 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 808 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 809 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 810 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 811 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 812 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 813 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 814 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 815 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 816 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 817 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 818 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 819 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 820 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 821 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 822 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 823 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 824 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 825 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 826 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 827 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 828 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 829 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 830 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 831 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 832 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 833 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 834 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 835 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 836 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 837 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 838 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 839 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 840 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 841 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 842 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 843 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 844 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 845 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 846 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 847 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 848 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 849 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 850 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 851 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 852 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 853 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 854 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 855 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 856 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 857 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 858 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 859 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 860 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 861 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 862 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 863 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 864 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 865 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 866 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 867 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 868 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 869 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 870 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 871 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 872 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 873 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 874 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 875 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 876 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 877 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 878 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 879 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 880 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 881 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 882 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 883 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 884 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 885 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 886 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 887 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 888 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 889 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 890 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 891 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 892 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 893 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 894 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 895 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 896 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 897 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 898 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 899 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 900 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 901 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 902 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 903 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 904 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 905 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 906 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 907 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 908 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 909 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 910 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 911 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 912 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 913 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 914 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 915 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 916 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 917 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 918 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 919 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 920 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 921 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 922 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 923 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 924 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 925 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 926 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 927 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 928 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 929 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 930 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 931 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 932 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 933 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 934 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 935 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 936 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 937 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 938 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 939 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 940 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 941 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 942 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 943 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 944 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 945 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 946 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 947 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 948 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 949 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 950 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 951 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 952 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 953 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 954 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 955 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 956 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 957 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 958 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 959 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 960 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 961 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 962 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 963 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 964 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 965 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 966 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 967 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 968 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 969 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 970 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 971 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 972 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 973 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 974 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 975 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 976 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 977 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 978 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 979 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 980 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 981 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 982 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 983 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 984 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 985 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 986 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 987 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 988 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 989 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 990 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 991 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 992 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 993 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 994 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 995 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 996 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 997 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 998 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 999 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1000 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1001 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1002 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 1003 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 1004 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 1005 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 1006 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 1007 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 1008 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 1009 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 1010 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 1011 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 1012 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 1013 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 1014 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 1015 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 1016 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 1017 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 1018 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 1019 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 1020 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 1021 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 1022 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 1023 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 1024 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 1025 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 1026 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 1027 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 1028 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 1029 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 1030 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 1031 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 1032 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 1033 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 1034 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 1035 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 1036 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 1037 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 1038 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 1039 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 1040 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 1041 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 1042 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 1043 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 1044 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 1045 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 1046 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 1047 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 1048 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 1049 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 1050 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 1051 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 1052 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 1053 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 1054 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 1055 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 1056 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 1057 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 1058 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 1059 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 1060 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 1061 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 1062 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 1063 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 1064 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 1065 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 1066 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 1067 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 1068 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 1069 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 1070 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 1071 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 1072 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 1073 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 1074 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 1075 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 1076 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 1077 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 1078 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 1079 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 1080 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 1081 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 1082 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 1083 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 1084 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 1085 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 1086 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 1087 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 1088 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 1089 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 1090 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 1091 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 1092 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 1093 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 1094 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 1095 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 1096 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 1097 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 1098 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 1099 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 1100 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 1101 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 1102 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 1103 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 1104 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 1105 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 1106 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 1107 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 1108 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 1109 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 1110 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 1111 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 1112 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 1113 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 1114 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 1115 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 1116 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 1117 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 1118 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 1119 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 1120 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 1121 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 1122 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 1123 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 1124 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 1125 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 1126 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 1127 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 1128 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1129 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1130 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1131 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1132 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1133 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1134 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1135 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1136 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1137 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1138 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1139 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1140 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1141 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1142 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1143 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1144 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 1145 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1146 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1147 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1148 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1149 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1150 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 1151 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 1152 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 1153 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 1154 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 1155 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 1156 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 1157 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 1158 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 1159 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 1160 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 1161 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 1162 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 1163 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 1164 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 1165 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 1166 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 1167 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 1168 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 1169 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 1170 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 1171 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 1172 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 1173 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 1174 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 1175 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 1176 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 1177 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 1178 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1179 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 1180 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 1181 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 1182 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 1183 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 1184 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1185 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 1186 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1187 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 1188 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 1189 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 1190 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 1191 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 1192 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 1193 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 1194 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 1195 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 1196 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1197 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1198 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1199 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1200 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1201 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1202 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 1203 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1204 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1205 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1206 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1207 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1208 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1209 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1210 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1211 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 1212 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1213 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1214 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1215 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 1216 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1217 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1218 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1219 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1220 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1221 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1222 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1223 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1224 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1225 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1226 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1227 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1228 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1229 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1230 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1231 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1232 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1233 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1234 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1235 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1236 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1237 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1238 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1239 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1240 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1241 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1242 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 1243 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1244 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1245 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1246 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1247 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1248 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1249 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1250 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1251 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1252 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1253 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1254 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1255 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1256 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1257 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 1258 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 1259 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1260 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1261 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1262 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1263 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1264 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 51.64 |
| Metatranscriptomes | 0.05 |
| Isolates | 48.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.27 |
| Bulb | 0 |
| Endosphere | 16.5 |
| Nodule | 37.16 |
| Rhizoplane | 1.69 |
| Rhizosphere | 28.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10028962 | 3300001979 | Bacteria | 1823 |
| 2 | JGI24740J21852_10045024 | 3300001979 | Bacteria | 1305 |
| 3 | JGI24739J22299_10005813 | 3300001989 | Bacteria | 4671 |
| 4 | JGI25155J39150_1000004 | 3300002704 | Bacteria | 269098 |
| 5 | JGI25155J39150_1000323 | 3300002704 | Bacteria | 16055 |
| 6 | JGI25156J39149_1000015 | 3300002705 | Bacteria | 181949 |
| 7 | JGI25156J39149_1000897 | 3300002705 | Bacteria | 14652 |
| 8 | JGI25162J39368_1000199 | 3300002737 | Bacteria | 63139 |
| 9 | JGI25154J39366_1000026 | 3300002738 | Bacteria | 200613 |
| 10 | JGI25154J39366_1000657 | 3300002738 | Bacteria | 16151 |
| 11 | JGI25158J39367_1003398 | 3300002739 | Bacteria | 2461 |
| 12 | JGI25157J39369_1000005 | 3300002741 | Bacteria | 269089 |
| 13 | JGI25157J39369_1000791 | 3300002741 | Bacteria | 16148 |
| 14 | JGI25157J39369_1001657 | 3300002741 | Bacteria | 7623 |
| 15 | JGI25152J39213_1002516 | 3300002773 | Bacteria | 6916 |
| 16 | JGI25152J39213_1004259 | 3300002773 | Bacteria | 4571 |
| 17 | JGI25152J39213_1008325 | 3300002773 | Bacteria | 2583 |
| 18 | JGI25150J39212_1000018 | 3300002774 | Bacteria | 146535 |
| 19 | JGI25150J39212_1006657 | 3300002774 | Bacteria | 2367 |
| 20 | JGI25150J39212_1008418 | 3300002774 | Bacteria | 2019 |
| 21 | JGI25150J39212_1009168 | 3300002774 | Bacteria | 1901 |
| 22 | JGI25159J45721_1000008 | 3300002987 | Bacteria | 172667 |
| 23 | JGI25159J45721_1000079 | 3300002987 | Bacteria | 46703 |
| 24 | JGI25159J45721_1000407 | 3300002987 | Bacteria | 19965 |
| 25 | JGI25159J45721_1001232 | 3300002987 | Bacteria | 10832 |
| 26 | JGI25159J45721_1011617 | 3300002987 | Bacteria | 2146 |
| 27 | JGI25159J45721_1024023 | 3300002987 | Bacteria | 1093 |
| 28 | JGI25151J46595_10000034 | 3300003187 | Bacteria | 192271 |
| 29 | JGI25151J46595_10000143 | 3300003187 | Bacteria | 95160 |
| 30 | JGI25151J46595_10001127 | 3300003187 | Bacteria | 19435 |
| 31 | JGI25151J46595_10002080 | 3300003187 | Bacteria | 12469 |
| 32 | JGI25151J46595_10009811 | 3300003187 | Bacteria | 4504 |
| 33 | JGI25151J46595_10010876 | 3300003187 | Bacteria | 4210 |
| 34 | JGI25151J46595_10013943 | 3300003187 | Bacteria | 3599 |
| 35 | JGI25151J46595_10015475 | 3300003187 | Bacteria | 3359 |
| 36 | JGI25151J46595_10017735 | 3300003187 | Bacteria | 3077 |
| 37 | JGI25151J46595_10039673 | 3300003187 | Bacteria | 1735 |
| 38 | JGI25151J46595_10049082 | 3300003187 | Bacteria | 1451 |
| 39 | JGI25165J46597_1000019 | 3300003214 | Bacteria | 371528 |
| 40 | JGI25165J46597_1000307 | 3300003214 | Bacteria | 59794 |
| 41 | JGI25153J46596_10004405 | 3300003215 | Bacteria | 7600 |
| 42 | JGI25153J46596_10006553 | 3300003215 | Bacteria | 5870 |
| 43 | JGI25153J46596_10022201 | 3300003215 | Bacteria | 2346 |
| 44 | JGI25153J46596_10022839 | 3300003215 | Bacteria | 2295 |
| 45 | JGI25160J50197_1000033 | 3300003354 | Bacteria | 172667 |
| 46 | JGI25160J50197_1000109 | 3300003354 | Bacteria | 77318 |
| 47 | JGI25160J50197_1000172 | 3300003354 | Bacteria | 55781 |
| 48 | JGI25160J50197_1002009 | 3300003354 | Bacteria | 9705 |
| 49 | JGI25160J50197_1005531 | 3300003354 | Bacteria | 5243 |
| 50 | JGI25161J50226_1000007 | 3300003374 | Bacteria | 256181 |
| 51 | JGI25161J50226_1000011 | 3300003374 | Bacteria | 210140 |
| 52 | JGI25161J50226_1000038 | 3300003374 | Bacteria | 131804 |
| 53 | JGI25161J50226_1000079 | 3300003374 | Bacteria | 83375 |
| 54 | JGI25161J50226_1000357 | 3300003374 | Bacteria | 23707 |
| 55 | JGI25161J50226_1010655 | 3300003374 | Bacteria | 1211 |
| 56 | Ga0006562J51391_1045286 | 3300003578 | Bacteria | 1470 |
| 57 | Ga0055525_1000053 | 3300003759 | Bacteria | 218067 |
| 58 | Ga0055542_1000625 | 3300003762 | Bacteria | 29738 |
| 59 | Ga0055526_1000361 | 3300003771 | Bacteria | 36774 |
| 60 | Ga0055526_1001066 | 3300003771 | Bacteria | 20046 |
| 61 | Ga0055526_1002672 | 3300003771 | Bacteria | 11909 |
| 62 | Ga0055526_1002681 | 3300003771 | Bacteria | 11889 |
| 63 | Ga0055526_1003358 | 3300003771 | Bacteria | 10218 |
| 64 | Ga0055526_1003566 | 3300003771 | Bacteria | 9799 |
| 65 | Ga0055526_1014546 | 3300003771 | Bacteria | 3228 |
| 66 | Ga0055537_1000356 | 3300003773 | Bacteria | 31055 |
| 67 | Ga0055524_1000213 | 3300003775 | Bacteria | 61225 |
| 68 | Ga0055524_1001146 | 3300003775 | Bacteria | 15972 |
| 69 | Ga0055524_1001370 | 3300003775 | Bacteria | 14145 |
| 70 | Ga0055524_1001377 | 3300003775 | Bacteria | 14116 |
| 71 | Ga0055524_1002351 | 3300003775 | Bacteria | 9835 |
| 72 | Ga0055524_1020238 | 3300003775 | Bacteria | 2249 |
| 73 | Ga0055524_1026321 | 3300003775 | Bacteria | 1800 |
| 74 | Ga0055536_1001937 | 3300003781 | Bacteria | 11944 |
| 75 | Ga0055536_1003918 | 3300003781 | Bacteria | 7806 |
| 76 | Ga0055536_1005157 | 3300003781 | Bacteria | 6459 |
| 77 | Ga0055534_1008979 | 3300003784 | Bacteria | 2214 |
| 78 | Ga0055528_1000433 | 3300003790 | Bacteria | 33610 |
| 79 | Ga0055528_1001020 | 3300003790 | Bacteria | 18582 |
| 80 | Ga0055528_1001206 | 3300003790 | Bacteria | 16585 |
| 81 | Ga0055528_1001875 | 3300003790 | Bacteria | 11973 |
| 82 | Ga0055528_1004586 | 3300003790 | Bacteria | 6618 |
| 83 | Ga0055528_1005560 | 3300003790 | Bacteria | 5837 |
| 84 | Ga0055528_1008511 | 3300003790 | Bacteria | 4387 |
| 85 | Ga0055528_1028327 | 3300003790 | Bacteria | 1548 |
| 86 | Ga0055530_10000763 | 3300003791 | Bacteria | 26793 |
| 87 | Ga0055530_10001299 | 3300003791 | Bacteria | 18844 |
| 88 | Ga0055530_10011055 | 3300003791 | Bacteria | 3274 |
| 89 | Ga0055540_1000324 | 3300003792 | Bacteria | 41825 |
| 90 | Ga0055540_1000504 | 3300003792 | Bacteria | 29761 |
| 91 | Ga0055540_1003695 | 3300003792 | Bacteria | 7251 |
| 92 | Ga0055540_1010512 | 3300003792 | Bacteria | 3074 |
| 93 | Ga0055540_1016977 | 3300003792 | Bacteria | 2047 |
| 94 | Ga0055531_10004306 | 3300003794 | Bacteria | 8724 |
| 95 | Ga0055531_10004903 | 3300003794 | Bacteria | 7961 |
| 96 | Ga0055531_10005891 | 3300003794 | Bacteria | 7071 |
| 97 | Ga0058692_1002714 | 3300003856 | Bacteria | 5822 |
| 98 | Ga0058692_1005559 | 3300003856 | Bacteria | 3577 |
| 99 | Ga0058692_1008272 | 3300003856 | Bacteria | 2692 |
| 100 | Ga0055543_1000026 | 3300004625 | Bacteria | 136177 |
| 101 | Ga0055543_1000071 | 3300004625 | Bacteria | 91797 |
| 102 | Ga0055543_1000106 | 3300004625 | Bacteria | 73351 |
| 103 | Ga0065165_1000135 | 3300005262 | Bacteria | 127785 |
| 104 | Ga0065165_1000178 | 3300005262 | Bacteria | 113319 |
| 105 | Ga0065165_1007140 | 3300005262 | Bacteria | 5593 |
| 106 | Ga0065165_1018011 | 3300005262 | Bacteria | 2577 |
| 107 | Ga0070658_10166017 | 3300005327 | Bacteria | 1853 |
| 108 | Ga0070676_10134497 | 3300005328 | Bacteria | 1567 |
| 109 | Ga0070676_10156017 | 3300005328 | Bacteria | 1465 |
| 110 | Ga0070670_100000061 | 3300005331 | Bacteria | 113254 |
| 111 | Ga0070670_100002139 | 3300005331 | Bacteria | 16217 |
| 112 | Ga0070670_100004009 | 3300005331 | Bacteria | 12288 |
| 113 | Ga0070670_100004917 | 3300005331 | Bacteria | 11246 |
| 114 | Ga0070670_100024623 | 3300005331 | Bacteria | 5176 |
| 115 | Ga0070670_100071595 | 3300005331 | Bacteria | 2977 |
| 116 | Ga0070670_100546630 | 3300005331 | Bacteria | 1033 |
| 117 | Ga0070677_10089624 | 3300005333 | Bacteria | 1335 |
| 118 | Ga0068869_100000007 | 3300005334 | Bacteria | 78820 |
| 119 | Ga0068869_100011980 | 3300005334 | Bacteria | 5708 |
| 120 | Ga0070666_10138111 | 3300005335 | Bacteria | 1697 |
| 121 | Ga0070689_100143158 | 3300005340 | Bacteria | 1924 |
| 122 | Ga0070668_100010303 | 3300005347 | Bacteria | 6941 |
| 123 | Ga0070669_100009394 | 3300005353 | Bacteria | 6964 |
| 124 | Ga0070669_100012984 | 3300005353 | Bacteria | 5915 |
| 125 | Ga0070669_100031327 | 3300005353 | Bacteria | 3842 |
| 126 | Ga0070669_100306936 | 3300005353 | Bacteria | 1278 |
| 127 | Ga0070675_100008830 | 3300005354 | Bacteria | 7832 |
| 128 | Ga0070675_100008944 | 3300005354 | Bacteria | 7781 |
| 129 | Ga0070675_100273768 | 3300005354 | Bacteria | 1482 |
| 130 | Ga0070671_100012661 | 3300005355 | Bacteria | 6799 |
| 131 | Ga0070671_100304582 | 3300005355 | Bacteria | 1357 |
| 132 | Ga0070674_100002629 | 3300005356 | Bacteria | 9934 |
| 133 | Ga0070674_100023406 | 3300005356 | Bacteria | 3998 |
| 134 | Ga0070673_100044158 | 3300005364 | Bacteria | 3449 |
| 135 | Ga0070673_100115291 | 3300005364 | Bacteria | 2234 |
| 136 | Ga0070667_100001939 | 3300005367 | Bacteria | 18351 |
| 137 | Ga0070667_100028382 | 3300005367 | Bacteria | 4658 |
| 138 | Ga0070667_100033931 | 3300005367 | Bacteria | 4269 |
| 139 | Ga0070667_100052380 | 3300005367 | Bacteria | 3444 |
| 140 | Ga0070667_100393191 | 3300005367 | Bacteria | 1261 |
| 141 | Ga0070701_10109495 | 3300005438 | Bacteria | 1541 |
| 142 | Ga0070663_100123092 | 3300005455 | Bacteria | 1961 |
| 143 | Ga0070678_100159653 | 3300005456 | Bacteria | 1825 |
| 144 | Ga0070678_100287784 | 3300005456 | Bacteria | 1392 |
| 145 | Ga0070662_100032281 | 3300005457 | Bacteria | 3680 |
| 146 | Ga0070662_100066591 | 3300005457 | Bacteria | 2643 |
| 147 | Ga0068867_100038765 | 3300005459 | Bacteria | 3470 |
| 148 | Ga0068867_100103872 | 3300005459 | Bacteria | 2174 |
| 149 | Ga0068867_100189789 | 3300005459 | Bacteria | 1639 |
| 150 | Ga0068867_100448275 | 3300005459 | Bacteria | 1099 |
| 151 | Ga0070707_100077038 | 3300005468 | Bacteria | 3217 |
| 152 | Ga0070698_100156871 | 3300005471 | Bacteria | 2222 |
| 153 | Ga0070698_100265986 | 3300005471 | Bacteria | 1647 |
| 154 | Ga0068853_100103622 | 3300005539 | Bacteria | 2518 |
| 155 | Ga0070672_100024379 | 3300005543 | Bacteria | 4470 |
| 156 | Ga0070672_100144065 | 3300005543 | Bacteria | 1968 |
| 157 | Ga0070665_100038392 | 3300005548 | Bacteria | 4814 |
| 158 | Ga0070665_100187873 | 3300005548 | Bacteria | 2067 |
| 159 | Ga0070665_100190852 | 3300005548 | Bacteria | 2050 |
| 160 | Ga0070665_100299133 | 3300005548 | Bacteria | 1612 |
| 161 | Ga0070665_100468584 | 3300005548 | Bacteria | 1270 |
| 162 | Ga0068855_100158526 | 3300005563 | Bacteria | 2570 |
| 163 | Ga0068855_100653813 | 3300005563 | Bacteria | 1129 |
| 164 | Ga0068857_100000676 | 3300005577 | Bacteria | 25307 |
| 165 | Ga0068856_100173944 | 3300005614 | Bacteria | 2166 |
| 166 | Ga0068856_100261907 | 3300005614 | Bacteria | 1744 |
| 167 | Ga0068856_100423633 | 3300005614 | Bacteria | 1351 |
| 168 | Ga0068852_100316193 | 3300005616 | Bacteria | 1515 |
| 169 | Ga0068852_100509436 | 3300005616 | Bacteria | 1199 |
| 170 | Ga0068859_100003514 | 3300005617 | Bacteria | 15961 |
| 171 | Ga0068864_100001466 | 3300005618 | Bacteria | 19448 |
| 172 | Ga0068864_100018957 | 3300005618 | Bacteria | 5752 |
| 173 | Ga0068864_100031537 | 3300005618 | Bacteria | 4497 |
| 174 | Ga0068864_100305512 | 3300005618 | Bacteria | 1490 |
| 175 | Ga0068861_100001688 | 3300005719 | Bacteria | 14166 |
| 176 | Ga0068861_100005778 | 3300005719 | Bacteria | 8395 |
| 177 | Ga0068861_100075375 | 3300005719 | Bacteria | 2626 |
| 178 | Ga0068863_100001574 | 3300005841 | Bacteria | 22566 |
| 179 | Ga0068863_100010047 | 3300005841 | Bacteria | 9211 |
| 180 | Ga0068863_100078212 | 3300005841 | Bacteria | 3132 |
| 181 | Ga0068858_100013010 | 3300005842 | Bacteria | 7847 |
| 182 | Ga0068858_100135039 | 3300005842 | Bacteria | 2314 |
| 183 | Ga0068860_100005878 | 3300005843 | Bacteria | 12351 |
| 184 | Ga0068860_100073368 | 3300005843 | Bacteria | 3253 |
| 185 | Ga0068860_100140560 | 3300005843 | Bacteria | 2320 |
| 186 | Ga0068862_100002922 | 3300005844 | Bacteria | 14933 |
| 187 | Ga0068862_100018133 | 3300005844 | Bacteria | 5861 |
| 188 | Ga0068862_100021865 | 3300005844 | Bacteria | 5348 |
| 189 | Ga0068862_100072758 | 3300005844 | Bacteria | 2970 |
| 190 | Ga0068862_100159767 | 3300005844 | Bacteria | 2011 |
| 191 | Ga0081455_10102813 | 3300005937 | Bacteria | 2289 |
| 192 | Ga0081538_10006847 | 3300005981 | Bacteria | 9934 |
| 193 | Ga0081540_1082712 | 3300005983 | Bacteria | 1439 |
| 194 | Ga0075365_10002874 | 3300006038 | Bacteria | 8664 |
| 195 | Ga0075365_10003514 | 3300006038 | Bacteria | 8101 |
| 196 | Ga0075368_10001283 | 3300006042 | Bacteria | 7960 |
| 197 | Ga0075368_10057189 | 3300006042 | Bacteria | 1557 |
| 198 | Ga0075368_10061687 | 3300006042 | Bacteria | 1502 |
| 199 | Ga0075363_100030258 | 3300006048 | Bacteria | 2801 |
| 200 | Ga0075363_100104619 | 3300006048 | Bacteria | 1569 |
| 201 | Ga0075363_100106804 | 3300006048 | Bacteria | 1553 |
| 202 | Ga0075364_10000074 | 3300006051 | Bacteria | 38784 |
| 203 | Ga0075364_10007527 | 3300006051 | Bacteria | 6472 |
| 204 | Ga0075364_10033083 | 3300006051 | Bacteria | 3326 |
| 205 | Ga0075364_10087480 | 3300006051 | Bacteria | 2065 |
| 206 | Ga0075364_10152919 | 3300006051 | Bacteria | 1555 |
| 207 | Ga0075362_10052148 | 3300006177 | Bacteria | 1832 |
| 208 | Ga0075362_10066958 | 3300006177 | Bacteria | 1633 |
| 209 | Ga0075367_10010987 | 3300006178 | Bacteria | 4773 |
| 210 | Ga0075367_10155514 | 3300006178 | Bacteria | 1420 |
| 211 | Ga0075367_10183470 | 3300006178 | Bacteria | 1305 |
| 212 | Ga0075367_10247910 | 3300006178 | Bacteria | 1117 |
| 213 | Ga0075367_10261283 | 3300006178 | Bacteria | 1087 |
| 214 | Ga0075369_10134910 | 3300006186 | Bacteria | 1123 |
| 215 | Ga0075366_10031674 | 3300006195 | Bacteria | 3113 |
| 216 | Ga0097621_100011117 | 3300006237 | Bacteria | 6621 |
| 217 | Ga0068871_100236521 | 3300006358 | Bacteria | 1587 |
| 218 | Ga0075428_100154157 | 3300006844 | Bacteria | 2496 |
| 219 | Ga0068865_100015032 | 3300006881 | Bacteria | 4929 |
| 220 | Ga0068865_100028929 | 3300006881 | Bacteria | 3672 |
| 221 | Ga0097620_100003514 | 3300006931 | Bacteria | 15961 |
| 222 | Ga0079104_1000063 | 3300006946 | Bacteria | 159519 |
| 223 | Ga0079104_1003309 | 3300006946 | Bacteria | 7646 |
| 224 | Ga0079104_1003311 | 3300006946 | Bacteria | 7645 |
| 225 | Ga0079104_1020326 | 3300006946 | Bacteria | 1832 |
| 226 | Ga0099826_10000045 | 3300006948 | Bacteria | 75912 |
| 227 | Ga0105244_10014754 | 3300009036 | Bacteria | 4506 |
| 228 | Ga0105240_10000013 | 3300009093 | Bacteria | 483458 |
| 229 | Ga0111539_10000300 | 3300009094 | Bacteria | 59922 |
| 230 | Ga0105247_10138500 | 3300009101 | Bacteria | 1592 |
| 231 | Ga0105247_10151109 | 3300009101 | Bacteria | 1530 |
| 232 | Ga0114129_10483459 | 3300009147 | Bacteria | 1620 |
| 233 | Ga0105243_10059067 | 3300009148 | Bacteria | 3059 |
| 234 | Ga0105243_10231444 | 3300009148 | Bacteria | 1640 |
| 235 | Ga0105241_10152731 | 3300009174 | Bacteria | 1890 |
| 236 | Ga0105248_10001664 | 3300009177 | Bacteria | 24713 |
| 237 | Ga0105248_10049509 | 3300009177 | Bacteria | 4713 |
| 238 | Ga0105248_10049981 | 3300009177 | Bacteria | 4688 |
| 239 | Ga0105248_10157139 | 3300009177 | Bacteria | 2566 |
| 240 | Ga0105237_10009556 | 3300009545 | Bacteria | 10382 |
| 241 | Ga0105237_10025658 | 3300009545 | Bacteria | 6024 |
| 242 | Ga0105237_10764993 | 3300009545 | Bacteria | 972 |
| 243 | Ga0105238_10002270 | 3300009551 | Bacteria | 19365 |
| 244 | Ga0105249_10104647 | 3300009553 | Bacteria | 2667 |
| 245 | Ga0123341_1000218 | 3300009765 | Bacteria | 30001 |
| 246 | Ga0123342_1025427 | 3300009766 | Bacteria | 3569 |
| 247 | Ga0105239_10006528 | 3300010375 | Bacteria | 13515 |
| 248 | Ga0105239_10012124 | 3300010375 | Bacteria | 9611 |
| 249 | Ga0105239_10059347 | 3300010375 | Bacteria | 4198 |
| 250 | Ga0105246_10404112 | 3300011119 | Bacteria | 1135 |
| 251 | Ga0157314_1001166 | 3300012500 | Bacteria | 1950 |
| 252 | Ga0157326_1005231 | 3300012513 | Bacteria | 1368 |
| 253 | Ga0157373_10044853 | 3300013100 | Bacteria | 3156 |
| 254 | Ga0157371_10000031 | 3300013102 | Bacteria | 230441 |
| 255 | Ga0157371_10078481 | 3300013102 | Bacteria | 2339 |
| 256 | Ga0157370_10000836 | 3300013104 | Bacteria | 39048 |
| 257 | Ga0157370_10004414 | 3300013104 | Bacteria | 16121 |
| 258 | Ga0157369_10141283 | 3300013105 | Bacteria | 2548 |
| 259 | Ga0157369_10442365 | 3300013105 | Bacteria | 1346 |
| 260 | Ga0171463_1007 | 3300013249 | Bacteria | 301198 |
| 261 | Ga0157378_10061358 | 3300013297 | Bacteria | 3355 |
| 262 | Ga0157378_10499879 | 3300013297 | Bacteria | 1214 |
| 263 | Ga0163162_10045639 | 3300013306 | Bacteria | 4390 |
| 264 | Ga0163162_10125421 | 3300013306 | Bacteria | 2673 |
| 265 | Ga0163162_10665787 | 3300013306 | Bacteria | 1164 |
| 266 | Ga0157375_10001469 | 3300013308 | Bacteria | 20277 |
| 267 | Ga0157375_10255482 | 3300013308 | Bacteria | 1914 |
| 268 | Ga0157375_10306556 | 3300013308 | Bacteria | 1752 |
| 269 | Ga0157375_10366068 | 3300013308 | Bacteria | 1608 |
| 270 | Ga0163163_10001547 | 3300014325 | Bacteria | 19382 |
| 271 | Ga0163163_10036645 | 3300014325 | Bacteria | 4766 |
| 272 | Ga0163163_10253799 | 3300014325 | Bacteria | 1809 |
| 273 | Ga0157380_10195657 | 3300014326 | Bacteria | 1789 |
| 274 | Ga0157380_10231296 | 3300014326 | Bacteria | 1660 |
| 275 | Ga0157380_10452536 | 3300014326 | Bacteria | 1233 |
| 276 | Ga0157380_10585573 | 3300014326 | Bacteria | 1101 |
| 277 | Ga0182008_10015519 | 3300014497 | Bacteria | 3973 |
| 278 | Ga0157379_10000142 | 3300014968 | Bacteria | 51727 |
| 279 | Ga0157379_10471952 | 3300014968 | Bacteria | 1160 |
| 280 | Ga0157376_10029249 | 3300014969 | Bacteria | 4389 |
| 281 | Ga0157376_10261079 | 3300014969 | Bacteria | 1623 |
| 282 | Ga0182007_10007442 | 3300015262 | Bacteria | 4590 |
| 283 | Ga0182005_1000640 | 3300015265 | Bacteria | 16664 |
| 284 | Ga0183365_10112 | 3300015684 | Bacteria | 2038 |
| 285 | Ga0183363_1138 | 3300015690 | Bacteria | 18553 |
| 286 | Ga0214544_1000010 | 3300021320 | Bacteria | 270164 |
| 287 | Ga0214542_1000023 | 3300021321 | Bacteria | 191557 |
| 288 | Ga0214542_1019691 | 3300021321 | Bacteria | 5217 |
| 289 | Ga0214543_1000019 | 3300021327 | Bacteria | 267908 |
| 290 | Ga0214543_1000022 | 3300021327 | Bacteria | 241930 |
| 291 | Ga0213872_10000023 | 3300021361 | Bacteria | 157443 |
| 292 | Ga0213875_10009112 | 3300021388 | Bacteria | 5041 |
| 293 | Ga0228711_1000017 | 3300022739 | Bacteria | 121084 |
| 294 | Ga0228710_1000005 | 3300022740 | Bacteria | 233531 |
| 295 | Ga0209435_100009 | 3300025206 | Bacteria | 476614 |
| 296 | Ga0209435_100019 | 3300025206 | Bacteria | 260989 |
| 297 | Ga0209436_100045 | 3300025208 | Bacteria | 69503 |
| 298 | Ga0209436_101207 | 3300025208 | Bacteria | 9430 |
| 299 | Ga0209563_100014 | 3300025230 | Bacteria | 940582 |
| 300 | Ga0209437_100182 | 3300025233 | Bacteria | 130514 |
| 301 | Ga0209437_100204 | 3300025233 | Bacteria | 115781 |
| 302 | Ga0207425_1000035 | 3300025245 | Bacteria | 225942 |
| 303 | Ga0207425_1001535 | 3300025245 | Bacteria | 9474 |
| 304 | Ga0207425_1001851 | 3300025245 | Bacteria | 8164 |
| 305 | Ga0207425_1030933 | 3300025245 | Bacteria | 1069 |
| 306 | Ga0209646_1000018 | 3300025246 | Bacteria | 476716 |
| 307 | Ga0209646_1000038 | 3300025246 | Bacteria | 353982 |
| 308 | Ga0209646_1004669 | 3300025246 | Bacteria | 2471 |
| 309 | Ga0209026_1000013 | 3300025250 | Bacteria | 415633 |
| 310 | Ga0209026_1000043 | 3300025250 | Bacteria | 269142 |
| 311 | Ga0209026_1000048 | 3300025250 | Bacteria | 257264 |
| 312 | Ga0209677_100728 | 3300025253 | Bacteria | 16757 |
| 313 | Ga0209148_1000032 | 3300025254 | Bacteria | 557660 |
| 314 | Ga0209148_1000349 | 3300025254 | Bacteria | 59964 |
| 315 | Ga0209759_1000007 | 3300025256 | Bacteria | 476614 |
| 316 | Ga0209759_1000038 | 3300025256 | Bacteria | 257264 |
| 317 | Ga0209759_1000058 | 3300025256 | Bacteria | 203580 |
| 318 | Ga0209129_1000029 | 3300025258 | Bacteria | 401149 |
| 319 | Ga0209129_1000050 | 3300025258 | Bacteria | 267408 |
| 320 | Ga0209129_1000623 | 3300025258 | Bacteria | 23785 |
| 321 | Ga0209129_1000807 | 3300025258 | Bacteria | 19792 |
| 322 | Ga0209129_1001333 | 3300025258 | Bacteria | 13956 |
| 323 | Ga0209129_1004423 | 3300025258 | Bacteria | 5484 |
| 324 | Ga0209129_1011796 | 3300025258 | Bacteria | 2060 |
| 325 | Ga0209233_1000034 | 3300025261 | Bacteria | 578898 |
| 326 | Ga0209233_1000231 | 3300025261 | Bacteria | 97534 |
| 327 | Ga0209233_1000280 | 3300025261 | Bacteria | 70793 |
| 328 | Ga0209233_1000388 | 3300025261 | Bacteria | 37536 |
| 329 | Ga0209233_1005717 | 3300025261 | Bacteria | 4099 |
| 330 | Ga0209565_1000041 | 3300025263 | Bacteria | 251081 |
| 331 | Ga0209565_1000333 | 3300025263 | Bacteria | 42094 |
| 332 | Ga0209565_1016313 | 3300025263 | Bacteria | 1655 |
| 333 | Ga0209565_1019493 | 3300025263 | Bacteria | 1448 |
| 334 | Ga0209455_1000098 | 3300025272 | Bacteria | 213890 |
| 335 | Ga0209455_1000872 | 3300025272 | Bacteria | 15986 |
| 336 | Ga0209455_1019769 | 3300025272 | Bacteria | 1351 |
| 337 | Ga0209673_1000033 | 3300025273 | Bacteria | 335369 |
| 338 | Ga0209673_1000050 | 3300025273 | Bacteria | 285287 |
| 339 | Ga0209673_1000052 | 3300025273 | Bacteria | 279795 |
| 340 | Ga0209673_1000364 | 3300025273 | Bacteria | 81319 |
| 341 | Ga0209673_1001686 | 3300025273 | Bacteria | 18856 |
| 342 | Ga0209673_1006199 | 3300025273 | Bacteria | 5841 |
| 343 | Ga0209673_1016436 | 3300025273 | Bacteria | 2767 |
| 344 | Ga0209673_1024925 | 3300025273 | Bacteria | 2000 |
| 345 | Ga0209130_1000009 | 3300025284 | Bacteria | 498952 |
| 346 | Ga0209130_1000017 | 3300025284 | Bacteria | 388431 |
| 347 | Ga0209130_1000058 | 3300025284 | Bacteria | 210250 |
| 348 | Ga0209130_1000160 | 3300025284 | Bacteria | 100965 |
| 349 | Ga0209130_1000245 | 3300025284 | Bacteria | 68668 |
| 350 | Ga0209130_1000708 | 3300025284 | Bacteria | 29740 |
| 351 | Ga0209130_1005012 | 3300025284 | Bacteria | 4767 |
| 352 | Ga0209675_1003873 | 3300025291 | Bacteria | 6883 |
| 353 | Ga0209675_1004149 | 3300025291 | Bacteria | 6578 |
| 354 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 355 | Ga0209676_1002248 | 3300025292 | Bacteria | 14263 |
| 356 | Ga0209676_1002662 | 3300025292 | Bacteria | 12128 |
| 357 | Ga0209676_1003354 | 3300025292 | Bacteria | 9980 |
| 358 | Ga0209676_1004193 | 3300025292 | Bacteria | 8182 |
| 359 | Ga0209676_1021737 | 3300025292 | Bacteria | 2144 |
| 360 | Ga0209676_1033837 | 3300025292 | Bacteria | 1517 |
| 361 | Ga0209025_1000132 | 3300025294 | Bacteria | 197432 |
| 362 | Ga0209025_1000153 | 3300025294 | Bacteria | 170548 |
| 363 | Ga0209025_1000227 | 3300025294 | Bacteria | 132244 |
| 364 | Ga0209025_1000299 | 3300025294 | Bacteria | 110988 |
| 365 | Ga0209025_1001158 | 3300025294 | Bacteria | 37312 |
| 366 | Ga0209025_1001511 | 3300025294 | Bacteria | 29888 |
| 367 | Ga0209025_1004718 | 3300025294 | Bacteria | 11627 |
| 368 | Ga0209025_1006680 | 3300025294 | Bacteria | 8858 |
| 369 | Ga0209025_1009265 | 3300025294 | Bacteria | 6894 |
| 370 | Ga0209025_1010428 | 3300025294 | Bacteria | 6294 |
| 371 | Ga0209025_1020559 | 3300025294 | Bacteria | 3604 |
| 372 | Ga0209025_1033375 | 3300025294 | Bacteria | 2379 |
| 373 | Ga0209025_1035476 | 3300025294 | Bacteria | 2253 |
| 374 | Ga0209025_1041425 | 3300025294 | Bacteria | 1973 |
| 375 | Ga0209025_1081078 | 3300025294 | Bacteria | 1101 |
| 376 | Ga0209564_1000013 | 3300025295 | Bacteria | 775755 |
| 377 | Ga0209564_1000236 | 3300025295 | Bacteria | 120648 |
| 378 | Ga0209564_1000795 | 3300025295 | Bacteria | 43436 |
| 379 | Ga0209564_1000875 | 3300025295 | Bacteria | 40039 |
| 380 | Ga0209564_1001920 | 3300025295 | Bacteria | 18579 |
| 381 | Ga0209564_1002543 | 3300025295 | Bacteria | 14056 |
| 382 | Ga0209564_1021554 | 3300025295 | Bacteria | 2312 |
| 383 | Ga0209564_1030732 | 3300025295 | Bacteria | 1658 |
| 384 | Ga0209758_1000105 | 3300025297 | Bacteria | 221415 |
| 385 | Ga0209758_1000299 | 3300025297 | Bacteria | 97367 |
| 386 | Ga0209758_1000672 | 3300025297 | Bacteria | 51157 |
| 387 | Ga0209758_1002015 | 3300025297 | Bacteria | 21863 |
| 388 | Ga0209758_1003869 | 3300025297 | Bacteria | 13112 |
| 389 | Ga0209758_1006091 | 3300025297 | Bacteria | 8861 |
| 390 | Ga0209758_1006131 | 3300025297 | Bacteria | 8811 |
| 391 | Ga0209758_1039062 | 3300025297 | Bacteria | 1811 |
| 392 | Ga0209758_1048222 | 3300025297 | Bacteria | 1516 |
| 393 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 394 | Ga0209050_1001244 | 3300025298 | Bacteria | 29472 |
| 395 | Ga0209050_1007330 | 3300025298 | Bacteria | 6215 |
| 396 | Ga0209050_1009958 | 3300025298 | Bacteria | 4767 |
| 397 | Ga0209050_1014517 | 3300025298 | Bacteria | 3385 |
| 398 | Ga0209050_1015111 | 3300025298 | Bacteria | 3270 |
| 399 | Ga0209050_1026031 | 3300025298 | Bacteria | 1970 |
| 400 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 401 | Ga0209256_1000211 | 3300025299 | Bacteria | 110131 |
| 402 | Ga0209256_1000250 | 3300025299 | Bacteria | 95262 |
| 403 | Ga0209256_1000279 | 3300025299 | Bacteria | 89712 |
| 404 | Ga0209256_1000563 | 3300025299 | Bacteria | 53065 |
| 405 | Ga0209256_1002290 | 3300025299 | Bacteria | 16100 |
| 406 | Ga0209256_1003062 | 3300025299 | Bacteria | 12310 |
| 407 | Ga0209256_1021436 | 3300025299 | Bacteria | 1983 |
| 408 | Ga0209256_1038815 | 3300025299 | Bacteria | 1230 |
| 409 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 410 | Ga0207426_1000041 | 3300025302 | Bacteria | 433536 |
| 411 | Ga0207426_1000070 | 3300025302 | Bacteria | 331559 |
| 412 | Ga0207426_1000091 | 3300025302 | Bacteria | 280561 |
| 413 | Ga0207426_1000098 | 3300025302 | Bacteria | 264264 |
| 414 | Ga0207426_1000131 | 3300025302 | Bacteria | 210250 |
| 415 | Ga0207426_1001967 | 3300025302 | Bacteria | 14592 |
| 416 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 417 | Ga0209051_1000118 | 3300025303 | Bacteria | 149426 |
| 418 | Ga0209051_1001915 | 3300025303 | Bacteria | 16158 |
| 419 | Ga0209051_1003142 | 3300025303 | Bacteria | 11108 |
| 420 | Ga0209051_1005999 | 3300025303 | Bacteria | 6945 |
| 421 | Ga0209051_1017785 | 3300025303 | Bacteria | 3167 |
| 422 | Ga0209051_1026475 | 3300025303 | Bacteria | 2336 |
| 423 | Ga0209051_1033218 | 3300025303 | Bacteria | 1954 |
| 424 | Ga0209257_1000048 | 3300025304 | Bacteria | 455536 |
| 425 | Ga0209257_1000407 | 3300025304 | Bacteria | 83438 |
| 426 | Ga0209257_1002408 | 3300025304 | Bacteria | 18693 |
| 427 | Ga0209257_1002982 | 3300025304 | Bacteria | 15409 |
| 428 | Ga0209257_1003928 | 3300025304 | Bacteria | 12083 |
| 429 | Ga0209257_1005759 | 3300025304 | Bacteria | 8468 |
| 430 | Ga0209257_1011541 | 3300025304 | Bacteria | 4237 |
| 431 | Ga0209257_1015344 | 3300025304 | Bacteria | 3198 |
| 432 | Ga0207642_10050764 | 3300025899 | Bacteria | 1873 |
| 433 | Ga0207647_10034917 | 3300025904 | Bacteria | 3207 |
| 434 | Ga0207645_10009537 | 3300025907 | Bacteria | 6709 |
| 435 | Ga0207645_10066091 | 3300025907 | Bacteria | 2312 |
| 436 | Ga0207645_10085566 | 3300025907 | Bacteria | 2024 |
| 437 | Ga0207643_10091362 | 3300025908 | Bacteria | 1775 |
| 438 | Ga0207695_10000044 | 3300025913 | Bacteria | 440819 |
| 439 | Ga0207695_10068039 | 3300025913 | Bacteria | 3650 |
| 440 | Ga0207671_10000043 | 3300025914 | Bacteria | 206915 |
| 441 | Ga0207671_10164400 | 3300025914 | Bacteria | 1720 |
| 442 | Ga0207657_10026933 | 3300025919 | Bacteria | 5272 |
| 443 | Ga0207657_10074778 | 3300025919 | Bacteria | 2860 |
| 444 | Ga0207646_10368222 | 3300025922 | Bacteria | 1298 |
| 445 | Ga0207681_10021049 | 3300025923 | Bacteria | 4140 |
| 446 | Ga0207694_10013279 | 3300025924 | Bacteria | 6201 |
| 447 | Ga0207650_10000207 | 3300025925 | Bacteria | 67267 |
| 448 | Ga0207650_10054175 | 3300025925 | Bacteria | 2975 |
| 449 | Ga0207650_10095453 | 3300025925 | Bacteria | 2279 |
| 450 | Ga0207650_10139975 | 3300025925 | Bacteria | 1901 |
| 451 | Ga0207659_10016896 | 3300025926 | Bacteria | 4758 |
| 452 | Ga0207659_10254334 | 3300025926 | Bacteria | 1426 |
| 453 | Ga0207644_10080691 | 3300025931 | Bacteria | 2403 |
| 454 | Ga0207644_10104340 | 3300025931 | Bacteria | 2134 |
| 455 | Ga0207644_10324825 | 3300025931 | Bacteria | 1245 |
| 456 | Ga0207690_10081354 | 3300025932 | Bacteria | 2263 |
| 457 | Ga0207706_10008309 | 3300025933 | Bacteria | 9570 |
| 458 | Ga0207706_10047586 | 3300025933 | Bacteria | 3794 |
| 459 | Ga0207709_10169285 | 3300025935 | Bacteria | 1531 |
| 460 | Ga0207709_10215432 | 3300025935 | Bacteria | 1381 |
| 461 | Ga0207709_10324441 | 3300025935 | Bacteria | 1154 |
| 462 | Ga0207670_10107346 | 3300025936 | Bacteria | 2004 |
| 463 | Ga0207669_10005604 | 3300025937 | Bacteria | 5654 |
| 464 | Ga0207669_10313464 | 3300025937 | Bacteria | 1197 |
| 465 | Ga0207704_10033798 | 3300025938 | Bacteria | 2912 |
| 466 | Ga0207691_10000111 | 3300025940 | Bacteria | 72961 |
| 467 | Ga0207691_10016814 | 3300025940 | Bacteria | 6943 |
| 468 | Ga0207711_10009821 | 3300025941 | Bacteria | 7959 |
| 469 | Ga0207711_10037209 | 3300025941 | Bacteria | 4132 |
| 470 | Ga0207711_10041717 | 3300025941 | Bacteria | 3909 |
| 471 | Ga0207711_10054634 | 3300025941 | Bacteria | 3428 |
| 472 | Ga0207711_10122206 | 3300025941 | Bacteria | 2326 |
| 473 | Ga0207689_10000142 | 3300025942 | Bacteria | 61457 |
| 474 | Ga0207689_10026848 | 3300025942 | Bacteria | 4820 |
| 475 | Ga0207689_10271511 | 3300025942 | Bacteria | 1404 |
| 476 | Ga0207689_10473176 | 3300025942 | Bacteria | 1048 |
| 477 | Ga0207651_10008045 | 3300025960 | Bacteria | 5658 |
| 478 | Ga0207651_10060537 | 3300025960 | Bacteria | 2629 |
| 479 | Ga0207651_10255704 | 3300025960 | Bacteria | 1435 |
| 480 | Ga0207712_10263753 | 3300025961 | Bacteria | 1398 |
| 481 | Ga0207668_10013845 | 3300025972 | Bacteria | 4980 |
| 482 | Ga0207668_10015772 | 3300025972 | Bacteria | 4701 |
| 483 | Ga0207668_10141713 | 3300025972 | Bacteria | 1850 |
| 484 | Ga0207668_10420134 | 3300025972 | Bacteria | 1135 |
| 485 | Ga0207658_10040270 | 3300025986 | Bacteria | 3377 |
| 486 | Ga0207658_10117353 | 3300025986 | Bacteria | 2115 |
| 487 | Ga0207658_10229732 | 3300025986 | Bacteria | 1565 |
| 488 | Ga0207703_10000195 | 3300026035 | Bacteria | 70480 |
| 489 | Ga0207703_10255494 | 3300026035 | Bacteria | 1582 |
| 490 | Ga0207639_10061117 | 3300026041 | Bacteria | 2908 |
| 491 | Ga0207639_10160953 | 3300026041 | Bacteria | 1891 |
| 492 | Ga0207639_10270663 | 3300026041 | Bacteria | 1490 |
| 493 | Ga0207708_10111582 | 3300026075 | Bacteria | 2123 |
| 494 | Ga0207641_10006316 | 3300026088 | Bacteria | 10019 |
| 495 | Ga0207641_10018427 | 3300026088 | Bacteria | 5724 |
| 496 | Ga0207641_10761890 | 3300026088 | Bacteria | 956 |
| 497 | Ga0207648_10005172 | 3300026089 | Bacteria | 13215 |
| 498 | Ga0207648_10016833 | 3300026089 | Bacteria | 6666 |
| 499 | Ga0207648_10147107 | 3300026089 | Bacteria | 2078 |
| 500 | Ga0207648_10215624 | 3300026089 | Bacteria | 1705 |
| 501 | Ga0207676_10001696 | 3300026095 | Bacteria | 16247 |
| 502 | Ga0207676_10002462 | 3300026095 | Bacteria | 13209 |
| 503 | Ga0207676_10177500 | 3300026095 | Bacteria | 1862 |
| 504 | Ga0207676_10321138 | 3300026095 | Bacteria | 1421 |
| 505 | Ga0207674_10002098 | 3300026116 | Bacteria | 25266 |
| 506 | Ga0207675_100004037 | 3300026118 | Bacteria | 14223 |
| 507 | Ga0207675_100005489 | 3300026118 | Bacteria | 12147 |
| 508 | Ga0207675_100262624 | 3300026118 | Bacteria | 1674 |
| 509 | Ga0207675_100531298 | 3300026118 | Bacteria | 1174 |
| 510 | Ga0207683_10026873 | 3300026121 | Bacteria | 4972 |
| 511 | Ga0207683_10224210 | 3300026121 | Bacteria | 1713 |
| 512 | Ga0207683_10709857 | 3300026121 | Bacteria | 932 |
| 513 | Ga0207698_10107153 | 3300026142 | Bacteria | 2332 |
| 514 | Ga0207698_10251386 | 3300026142 | Bacteria | 1618 |
| 515 | Ga0207698_10490349 | 3300026142 | Bacteria | 1194 |
| 516 | Ga0207698_10800667 | 3300026142 | Bacteria | 944 |
| 517 | Ga0209281_1000082 | 3300027111 | Bacteria | 257684 |
| 518 | Ga0209281_1000110 | 3300027111 | Bacteria | 215631 |
| 519 | Ga0209281_1001180 | 3300027111 | Bacteria | 18042 |
| 520 | Ga0209371_1000003 | 3300027312 | Bacteria | 1122971 |
| 521 | Ga0209371_1000283 | 3300027312 | Bacteria | 58483 |
| 522 | Ga0209371_1004798 | 3300027312 | Bacteria | 5684 |
| 523 | Ga0209282_1000006 | 3300027666 | Bacteria | 276998 |
| 524 | Ga0209282_1000210 | 3300027666 | Bacteria | 31123 |
| 525 | Ga0207428_10000050 | 3300027907 | Bacteria | 177286 |
| 526 | Ga0268266_10008596 | 3300028379 | Bacteria | 9069 |
| 527 | Ga0268266_10044304 | 3300028379 | Bacteria | 3804 |
| 528 | Ga0268266_10066625 | 3300028379 | Bacteria | 3115 |
| 529 | Ga0268266_10125430 | 3300028379 | Bacteria | 2290 |
| 530 | Ga0268266_10318960 | 3300028379 | Bacteria | 1454 |
| 531 | Ga0268265_10002425 | 3300028380 | Bacteria | 14080 |
| 532 | Ga0268265_10008132 | 3300028380 | Bacteria | 7089 |
| 533 | Ga0268265_10021422 | 3300028380 | Bacteria | 4528 |
| 534 | Ga0268265_10171638 | 3300028380 | Bacteria | 1854 |
| 535 | Ga0268264_10000606 | 3300028381 | Bacteria | 43164 |
| 536 | Ga0268264_10057162 | 3300028381 | Bacteria | 3262 |
| 537 | Ga0268264_10248685 | 3300028381 | Bacteria | 1650 |
| 538 | Ga0307515_10000017 | 3300028794 | Bacteria | 550465 |
| 539 | Ga0307515_10001299 | 3300028794 | Bacteria | 56720 |
| 540 | Ga0307515_10003849 | 3300028794 | Bacteria | 31385 |
| 541 | Ga0307515_10019285 | 3300028794 | Bacteria | 12293 |
| 542 | Ga0307515_10057315 | 3300028794 | Bacteria | 5640 |
| 543 | Ga0307515_10061360 | 3300028794 | Bacteria | 5336 |
| 544 | Ga0265338_10256126 | 3300028800 | Bacteria | 1289 |
| 545 | Ga0268256_1000004 | 3300030500 | Bacteria | 1122967 |
| 546 | Ga0268256_1001389 | 3300030500 | Bacteria | 14698 |
| 547 | Ga0268256_1005352 | 3300030500 | Bacteria | 5061 |
| 548 | Ga0307512_10097469 | 3300030522 | Bacteria | 2011 |
| 549 | Ga0307512_10196894 | 3300030522 | Bacteria | 1099 |
| 550 | Ga0265330_10048954 | 3300031235 | Bacteria | 1858 |
| 551 | Ga0265327_10024986 | 3300031251 | Bacteria | 3493 |
| 552 | Ga0307513_10000206 | 3300031456 | Bacteria | 85338 |
| 553 | Ga0307513_10002736 | 3300031456 | Bacteria | 24255 |
| 554 | Ga0307513_10011846 | 3300031456 | Bacteria | 10805 |
| 555 | Ga0307513_10397732 | 3300031456 | Bacteria | 1113 |
| 556 | Ga0307509_10316479 | 3300031507 | Bacteria | 1300 |
| 557 | Ga0307408_100021734 | 3300031548 | Bacteria | 4346 |
| 558 | Ga0307408_100213063 | 3300031548 | Bacteria | 1571 |
| 559 | Ga0265313_10035166 | 3300031595 | Bacteria | 2526 |
| 560 | Ga0307514_10004553 | 3300031649 | Bacteria | 12734 |
| 561 | Ga0265314_10082126 | 3300031711 | Bacteria | 2121 |
| 562 | Ga0265342_10102778 | 3300031712 | Bacteria | 1626 |
| 563 | Ga0307405_10000125 | 3300031731 | Bacteria | 30390 |
| 564 | Ga0307405_10253710 | 3300031731 | Bacteria | 1310 |
| 565 | Ga0307405_10371062 | 3300031731 | Bacteria | 1111 |
| 566 | Ga0307405_10417700 | 3300031731 | Bacteria | 1055 |
| 567 | Ga0307413_10362456 | 3300031824 | Bacteria | 1123 |
| 568 | Ga0307410_10195697 | 3300031852 | Bacteria | 1540 |
| 569 | Ga0307406_10034901 | 3300031901 | Bacteria | 3088 |
| 570 | Ga0307412_10000786 | 3300031911 | Bacteria | 18336 |
| 571 | Ga0307412_10143313 | 3300031911 | Bacteria | 1753 |
| 572 | Ga0307412_10305232 | 3300031911 | Bacteria | 1260 |
| 573 | Ga0315914_1000003 | 3300031967 | Bacteria | 314370 |
| 574 | Ga0307416_100374461 | 3300032002 | Bacteria | 1451 |
| 575 | Ga0307411_10081872 | 3300032005 | Bacteria | 2224 |
| 576 | Ga0315913_1000001 | 3300033430 | Bacteria | 284459 |
| 577 | Ga0315915_1000008 | 3300033464 | Bacteria | 258517 |
| 578 | Ga0373955_0238927 | 3300035172 | Bacteria | 1088 |
| 579 | Ga0373931_0069965 | 3300035691 | Bacteria | 1913 |
| 580 | Ga0373935_0257134 | 3300035692 | Bacteria | 1224 |
| 581 | Ga0373927_0000412 | 3300035695 | Bacteria | 32914 |
| 582 | Ga0373947_0145929 | 3300035725 | Bacteria | 1521 |
| 583 | Ga0373937_0138393 | 3300036401 | Bacteria | 2277 |
| 584 | Ga0373925_0001026 | 3300037068 | Bacteria | 25273 |
| 585 | Ga0395899_0000589 | 3300037312 | Bacteria | 38294 |
| 586 | Ga0395900_0000375 | 3300037418 | Bacteria | 64534 |
| 587 | Ga0395900_0011818 | 3300037418 | Bacteria | 8928 |
| 588 | Ga0395898_0000629 | 3300037466 | Bacteria | 64534 |
| 589 | Ga0395905_0000361 | 3300037471 | Bacteria | 64517 |
| 590 | Ga0395905_0015961 | 3300037471 | Bacteria | 7138 |
| 591 | Ga0395905_0109369 | 3300037471 | Bacteria | 2595 |
| 592 | Ga0395905_0131670 | 3300037471 | Bacteria | 2352 |
| 593 | Ga0436364_0174941 | 3300037853 | Bacteria | 14119 |
| 594 | Ga0395901_0000273 | 3300038443 | Bacteria | 64425 |
| 595 | Ga0395901_0074295 | 3300038443 | Bacteria | 3546 |
| 596 | Ga0400483_171274 | 3300039062 | Bacteria | 2690 |
| 597 | Ga0436361_0060434 | 3300039447 | Bacteria | 165633 |
| 598 | Ga0439436_0003871 | 3300041404 | Bacteria | 4583 |
| 599 | Ga0439436_0061503 | 3300041404 | Bacteria | 1051 |
| 600 | Ga0439466_0015456 | 3300041411 | Bacteria | 2772 |
| 601 | Ga0439466_0048103 | 3300041411 | Bacteria | 1404 |
| 602 | Ga0439465_0015623 | 3300041413 | Bacteria | 2368 |
| 603 | Ga0451800_0608245 | 3300041459 | Bacteria | 825 |
| 604 | Ga0451807_1468043 | 3300041486 | Bacteria | 979 |
| 605 | Ga0451833_1239942 | 3300041491 | Bacteria | 1212 |
| 606 | Ga0451835_0200957 | 3300041492 | Bacteria | 3844 |
| 607 | Ga0451835_0892570 | 3300041492 | Bacteria | 1143 |
| 608 | Ga0451837_1046754 | 3300041494 | Bacteria | 2687 |
| 609 | Ga0451845_0285704 | 3300041501 | Bacteria | 3513 |
| 610 | Ga0451847_0217734 | 3300041503 | Bacteria | 2993 |
| 611 | Ga0451849_0065926 | 3300041505 | Bacteria | 1417 |
| 612 | Ga0451851_0226558 | 3300041507 | Bacteria | 3332 |
| 613 | Ga0451843_0603985 | 3300041509 | Bacteria | 1705 |
| 614 | Ga0451855_0216231 | 3300041511 | Bacteria | 1297 |
| 615 | Ga0439449_0083621 | 3300042007 | Bacteria | 1177 |
| 616 | Ga0450920_004815 | 3300042122 | Bacteria | 2386 |
| 617 | Ga0450907_024445 | 3300042146 | Bacteria | 1021 |
| 618 | Ga0450909_016064 | 3300042185 | Bacteria | 1105 |
| 619 | Ga0466972_0100113 | 3300044658 | Bacteria | 1372 |
| 620 | Ga0453683_0014712 | 3300044673 | Bacteria | 5077 |
| 621 | Ga0466965_0090576 | 3300044683 | Bacteria | 1556 |
| 622 | Ga0466963_0217153 | 3300044694 | Bacteria | 1339 |
| 623 | Ga0453684_0350884 | 3300044712 | Bacteria | 1664 |
| 624 | Ga0453684_0362447 | 3300044712 | Bacteria | 1631 |
| 625 | Ga0466968_0116997 | 3300044735 | Bacteria | 1203 |
| 626 | Ga0466970_0173567 | 3300044765 | Bacteria | 1195 |
| 627 | Ga0466970_0215394 | 3300044765 | Bacteria | 1071 |
| 628 | Ga0451576_0037377 | 3300045051 | Bacteria | 5143 |
| 629 | Ga0451576_0157735 | 3300045051 | Bacteria | 2367 |
| 630 | Ga0451576_0191525 | 3300045051 | Bacteria | 2136 |
| 631 | Ga0495627_027745 | 3300046453 | Bacteria | 1814 |
| 632 | Ga0495590_0096732 | 3300046457 | Bacteria | 1047 |
| 633 | Ga0495629_0175228 | 3300046459 | Bacteria | 1487 |
| 634 | Ga0495638_0000634 | 3300046460 | Bacteria | 38683 |
| 635 | Ga0495638_0241188 | 3300046460 | Bacteria | 1001 |
| 636 | Ga0495605_0016147 | 3300046474 | Bacteria | 4046 |
| 637 | Ga0495639_0130758 | 3300046475 | Bacteria | 1202 |
| 638 | Ga0495662_0002911 | 3300046476 | Bacteria | 8646 |
| 639 | Ga0495585_0002182 | 3300046492 | Bacteria | 14212 |
| 640 | Ga0495585_0032209 | 3300046492 | Bacteria | 2970 |
| 641 | Ga0495585_0053063 | 3300046492 | Bacteria | 2244 |
| 642 | Ga0495585_0080926 | 3300046492 | Bacteria | 1760 |
| 643 | Ga0495607_0078139 | 3300046501 | Bacteria | 1826 |
| 644 | Ga0495583_0002088 | 3300046506 | Bacteria | 18023 |
| 645 | Ga0495583_0006812 | 3300046506 | Bacteria | 7377 |
| 646 | Ga0495606_0008031 | 3300046507 | Bacteria | 9266 |
| 647 | Ga0495606_0033446 | 3300046507 | Bacteria | 3546 |
| 648 | Ga0495610_0004788 | 3300046512 | Bacteria | 9879 |
| 649 | Ga0495610_0048628 | 3300046512 | Bacteria | 2081 |
| 650 | Ga0495610_0064304 | 3300046512 | Bacteria | 1735 |
| 651 | Ga0495610_0099345 | 3300046512 | Bacteria | 1306 |
| 652 | Ga0495620_0009481 | 3300046515 | Bacteria | 5175 |
| 653 | Ga0495620_0092922 | 3300046515 | Bacteria | 1208 |
| 654 | Ga0495631_0016767 | 3300046518 | Bacteria | 3482 |
| 655 | Ga0495632_0061726 | 3300046519 | Bacteria | 1819 |
| 656 | Ga0495632_0065342 | 3300046519 | Bacteria | 1757 |
| 657 | Ga0495643_0009505 | 3300046522 | Bacteria | 6040 |
| 658 | Ga0495643_0040962 | 3300046522 | Bacteria | 2527 |
| 659 | Ga0495643_0151207 | 3300046522 | Bacteria | 1149 |
| 660 | Ga0495648_0073693 | 3300046524 | Bacteria | 1970 |
| 661 | Ga0495652_0176058 | 3300046529 | Bacteria | 1647 |
| 662 | Ga0495654_0000121 | 3300046530 | Bacteria | 86743 |
| 663 | Ga0495654_0003858 | 3300046530 | Bacteria | 9057 |
| 664 | Ga0495587_0106087 | 3300046536 | Bacteria | 1616 |
| 665 | Ga0495609_0074646 | 3300046538 | Bacteria | 1487 |
| 666 | Ga0495609_0099492 | 3300046538 | Bacteria | 1261 |
| 667 | Ga0495645_0129862 | 3300046543 | Bacteria | 1767 |
| 668 | Ga0495633_0037299 | 3300046558 | Bacteria | 2325 |
| 669 | Ga0495656_0263350 | 3300046615 | Bacteria | 874 |
| 670 | Ga0495668_0020510 | 3300046616 | Bacteria | 3802 |
| 671 | Ga0495668_0041859 | 3300046616 | Bacteria | 2551 |
| 672 | Ga0495668_0105978 | 3300046616 | Bacteria | 1537 |
| 673 | Ga0495625_0034062 | 3300046660 | Bacteria | 3760 |
| 674 | Ga0495625_0109913 | 3300046660 | Bacteria | 1885 |
| 675 | Ga0495625_0137971 | 3300046660 | Bacteria | 1647 |
| 676 | Ga0495625_0196946 | 3300046660 | Bacteria | 1332 |
| 677 | Ga0495661_0136083 | 3300046665 | Bacteria | 1341 |
| 678 | Ga0495588_0000403 | 3300046674 | Bacteria | 24269 |
| 679 | Ga0495657_0043948 | 3300046675 | Bacteria | 3043 |
| 680 | Ga0495670_0034654 | 3300046691 | Bacteria | 2515 |
| 681 | Ga0495670_0077759 | 3300046691 | Bacteria | 1687 |
| 682 | Ga0495649_0007419 | 3300046694 | Bacteria | 6684 |
| 683 | Ga0495600_0008229 | 3300046809 | Bacteria | 6403 |
| 684 | Ga0495660_0033073 | 3300046810 | Bacteria | 2902 |
| 685 | Ga0495604_0042947 | 3300047317 | Bacteria | 3541 |
| 686 | Ga0495683_0079008 | 3300047323 | Bacteria | 1607 |
| 687 | Ga0495673_0043370 | 3300047469 | Bacteria | 2014 |
| 688 | Ga0495673_0106801 | 3300047469 | Bacteria | 1124 |
| 689 | Ga0495681_0009787 | 3300047470 | Bacteria | 5866 |
| 690 | Ga0495681_0024616 | 3300047470 | Bacteria | 3165 |
| 691 | Ga0495686_0001023 | 3300047472 | Bacteria | 33801 |
| 692 | Ga0495686_0131029 | 3300047472 | Bacteria | 1487 |
| 693 | Ga0496100_0037004 | 3300048903 | Bacteria | 3082 |
| 694 | Ga0496101_0116995 | 3300048904 | Bacteria | 2012 |
| 695 | Ga0496102_0020537 | 3300048905 | Bacteria | 5836 |
| 696 | Ga0496102_0425485 | 3300048905 | Bacteria | 1247 |
| 697 | Ga0496102_0610531 | 3300048905 | Bacteria | 1014 |
| 698 | Ga0496103_0022451 | 3300048906 | Bacteria | 3800 |
| 699 | Ga0496106_0005081 | 3300048909 | Bacteria | 9739 |
| 700 | Ga0496107_0193890 | 3300048910 | Bacteria | 1510 |
| 701 | Ga0496109_0038003 | 3300048912 | Bacteria | 4351 |
| 702 | Ga0496111_0001276 | 3300048914 | Bacteria | 14109 |
| 703 | Ga0496111_0338320 | 3300048914 | Bacteria | 1114 |
| 704 | Ga0496112_0024574 | 3300048915 | Bacteria | 5773 |
| 705 | Ga0496112_0192983 | 3300048915 | Bacteria | 1998 |
| 706 | Ga0496113_0014581 | 3300048916 | Bacteria | 5367 |
| 707 | Ga0496113_0340259 | 3300048916 | Bacteria | 1203 |
| 708 | Ga0496114_0731784 | 3300048917 | Bacteria | 866 |
| 709 | Ga0496115_0157399 | 3300048918 | Bacteria | 1877 |
| 710 | Ga0496116_0000135 | 3300048919 | Bacteria | 153165 |
| 711 | Ga0496116_0001063 | 3300048919 | Bacteria | 33168 |
| 712 | Ga0496116_0008500 | 3300048919 | Bacteria | 8898 |
| 713 | Ga0496116_0017944 | 3300048919 | Bacteria | 5472 |
| 714 | Ga0496116_0030619 | 3300048919 | Bacteria | 3862 |
| 715 | Ga0496116_0034781 | 3300048919 | Bacteria | 3548 |
| 716 | Ga0496116_0074355 | 3300048919 | Bacteria | 2138 |
| 717 | Ga0496116_0119594 | 3300048919 | Bacteria | 1528 |
| 718 | Ga0496117_0000030 | 3300048920 | Bacteria | 389141 |
| 719 | Ga0496117_0015059 | 3300048920 | Bacteria | 6623 |
| 720 | Ga0496117_0015836 | 3300048920 | Bacteria | 6398 |
| 721 | Ga0496117_0028078 | 3300048920 | Bacteria | 4362 |
| 722 | Ga0496117_0031765 | 3300048920 | Bacteria | 4025 |
| 723 | Ga0496117_0074188 | 3300048920 | Bacteria | 2266 |
| 724 | Ga0496117_0097863 | 3300048920 | Bacteria | 1867 |
| 725 | Ga0496117_0116420 | 3300048920 | Bacteria | 1652 |
| 726 | Ga0496117_0144445 | 3300048920 | Bacteria | 1419 |
| 727 | Ga0496118_0001480 | 3300048921 | Bacteria | 35175 |
| 728 | Ga0496118_0014815 | 3300048921 | Bacteria | 7273 |
| 729 | Ga0496118_0016479 | 3300048921 | Bacteria | 6777 |
| 730 | Ga0496118_0017008 | 3300048921 | Bacteria | 6642 |
| 731 | Ga0496118_0028329 | 3300048921 | Bacteria | 4719 |
| 732 | Ga0496118_0094049 | 3300048921 | Bacteria | 2051 |
| 733 | Ga0496118_0190246 | 3300048921 | Bacteria | 1228 |
| 734 | Ga0496119_0004719 | 3300048922 | Bacteria | 13399 |
| 735 | Ga0496119_0028509 | 3300048922 | Bacteria | 3807 |
| 736 | Ga0496119_0030888 | 3300048922 | Bacteria | 3603 |
| 737 | Ga0496120_0000047 | 3300048923 | Bacteria | 190569 |
| 738 | Ga0496120_0004732 | 3300048923 | Bacteria | 11183 |
| 739 | Ga0496120_0016612 | 3300048923 | Bacteria | 4805 |
| 740 | Ga0496120_0023341 | 3300048923 | Bacteria | 3872 |
| 741 | Ga0496120_0036634 | 3300048923 | Bacteria | 2917 |
| 742 | Ga0496120_0039500 | 3300048923 | Bacteria | 2783 |
| 743 | Ga0496120_0061971 | 3300048923 | Bacteria | 2085 |
| 744 | Ga0496120_0134113 | 3300048923 | Bacteria | 1265 |
| 745 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 746 | Ga0496121_0000180 | 3300048924 | Bacteria | 141128 |
| 747 | Ga0496121_0021428 | 3300048924 | Bacteria | 6328 |
| 748 | Ga0496121_0028286 | 3300048924 | Bacteria | 5222 |
| 749 | Ga0496121_0033506 | 3300048924 | Bacteria | 4647 |
| 750 | Ga0496121_0094049 | 3300048924 | Bacteria | 2332 |
| 751 | Ga0496121_0097455 | 3300048924 | Bacteria | 2279 |
| 752 | Ga0496121_0229919 | 3300048924 | Bacteria | 1300 |
| 753 | Ga0496121_0254992 | 3300048924 | Bacteria | 1214 |
| 754 | Ga0496122_0000076 | 3300048925 | Bacteria | 218690 |
| 755 | Ga0496122_0000107 | 3300048925 | Bacteria | 193163 |
| 756 | Ga0496122_0011537 | 3300048925 | Bacteria | 8935 |
| 757 | Ga0496122_0016039 | 3300048925 | Bacteria | 7120 |
| 758 | Ga0496122_0021667 | 3300048925 | Bacteria | 5743 |
| 759 | Ga0496122_0028970 | 3300048925 | Bacteria | 4682 |
| 760 | Ga0496122_0054177 | 3300048925 | Bacteria | 3015 |
| 761 | Ga0496122_0054210 | 3300048925 | Bacteria | 3014 |
| 762 | Ga0496122_0062302 | 3300048925 | Bacteria | 2731 |
| 763 | Ga0496122_0107495 | 3300048925 | Bacteria | 1843 |
| 764 | Ga0496122_0128635 | 3300048925 | Bacteria | 1615 |
| 765 | Ga0496122_0160986 | 3300048925 | Bacteria | 1368 |
| 766 | Ga0496123_0000023 | 3300048926 | Bacteria | 346894 |
| 767 | Ga0496123_0000063 | 3300048926 | Bacteria | 216072 |
| 768 | Ga0496123_0014544 | 3300048926 | Bacteria | 6514 |
| 769 | Ga0496123_0021425 | 3300048926 | Bacteria | 5024 |
| 770 | Ga0496123_0025149 | 3300048926 | Bacteria | 4498 |
| 771 | Ga0496123_0119937 | 3300048926 | Bacteria | 1482 |
| 772 | Ga0496123_0184079 | 3300048926 | Bacteria | 1087 |
| 773 | Ga0496124_0000239 | 3300048927 | Bacteria | 106633 |
| 774 | Ga0496124_0000951 | 3300048927 | Bacteria | 46191 |
| 775 | Ga0496124_0005130 | 3300048927 | Bacteria | 14908 |
| 776 | Ga0496124_0026109 | 3300048927 | Bacteria | 5273 |
| 777 | Ga0496124_0030519 | 3300048927 | Bacteria | 4783 |
| 778 | Ga0496124_0064780 | 3300048927 | Bacteria | 3050 |
| 779 | Ga0496124_0065263 | 3300048927 | Bacteria | 3036 |
| 780 | Ga0496124_0084208 | 3300048927 | Bacteria | 2608 |
| 781 | Ga0496124_0099829 | 3300048927 | Bacteria | 2353 |
| 782 | Ga0496124_0115510 | 3300048927 | Bacteria | 2153 |
| 783 | Ga0496124_0269696 | 3300048927 | Bacteria | 1247 |
| 784 | Ga0496125_0000200 | 3300048928 | Bacteria | 126369 |
| 785 | Ga0496125_0010291 | 3300048928 | Bacteria | 9472 |
| 786 | Ga0496125_0032868 | 3300048928 | Bacteria | 4601 |
| 787 | Ga0496125_0058346 | 3300048928 | Bacteria | 3118 |
| 788 | Ga0496125_0063816 | 3300048928 | Bacteria | 2933 |
| 789 | Ga0496125_0112647 | 3300048928 | Bacteria | 1965 |
| 790 | Ga0496125_0288286 | 3300048928 | Bacteria | 1012 |
| 791 | Ga0496126_0000129 | 3300048929 | Bacteria | 174059 |
| 792 | Ga0496126_0000965 | 3300048929 | Bacteria | 49314 |
| 793 | Ga0496126_0037901 | 3300048929 | Bacteria | 4490 |
| 794 | Ga0496126_0059556 | 3300048929 | Bacteria | 3439 |
| 795 | Ga0496126_0107840 | 3300048929 | Bacteria | 2429 |
| 796 | Ga0496126_0300887 | 3300048929 | Bacteria | 1323 |
| 797 | Ga0496126_0309726 | 3300048929 | Bacteria | 1300 |
| 798 | Ga0496126_0357054 | 3300048929 | Bacteria | 1194 |
| 799 | Ga0495678_030868 | 3300049459 | Bacteria | 2239 |
| 800 | Ga0495678_040302 | 3300049459 | Bacteria | 1878 |
| 801 | Ga0495678_040389 | 3300049459 | Bacteria | 1876 |
| 802 | Ga0495678_100858 | 3300049459 | Bacteria | 1000 |
| 803 | Ga0501031_0000218 | 3300049568 | Bacteria | 32961 |
| 804 | Ga0501031_0075315 | 3300049568 | Bacteria | 2197 |
| 805 | Ga0501032_0000457 | 3300049569 | Bacteria | 32961 |
| 806 | Ga0501032_0265117 | 3300049569 | Bacteria | 1113 |
| 807 | Ga0501033_0000612 | 3300049570 | Bacteria | 33054 |
| 808 | Ga0501033_0006558 | 3300049570 | Bacteria | 9105 |
| 809 | Ga0501033_0016076 | 3300049570 | Bacteria | 5667 |
| 810 | Ga0501033_0048133 | 3300049570 | Bacteria | 3167 |
| 811 | Ga0501033_0099576 | 3300049570 | Bacteria | 2122 |
| 812 | Ga0501033_0252792 | 3300049570 | Bacteria | 1248 |
| 813 | Ga0501034_0001364 | 3300049571 | Bacteria | 32961 |
| 814 | Ga0501034_0038350 | 3300049571 | Bacteria | 4851 |
| 815 | Ga0501034_0049448 | 3300049571 | Bacteria | 4242 |
| 816 | Ga0501034_0061166 | 3300049571 | Bacteria | 3783 |
| 817 | Ga0501034_0063834 | 3300049571 | Bacteria | 3697 |
| 818 | Ga0501034_0074936 | 3300049571 | Bacteria | 3391 |
| 819 | Ga0501034_0092703 | 3300049571 | Bacteria | 3017 |
| 820 | Ga0501034_0121215 | 3300049571 | Bacteria | 2601 |
| 821 | Ga0501034_0576456 | 3300049571 | Bacteria | 1032 |
| 822 | Ga0501036_0000335 | 3300049572 | Bacteria | 32961 |
| 823 | Ga0501036_0123992 | 3300049572 | Bacteria | 2182 |
| 824 | Ga0501036_0168513 | 3300049572 | Bacteria | 1845 |
| 825 | Ga0501036_0336208 | 3300049572 | Bacteria | 1261 |
| 826 | Ga0501036_0354756 | 3300049572 | Bacteria | 1225 |
| 827 | Ga0501037_0000468 | 3300049573 | Bacteria | 32961 |
| 828 | Ga0501037_0039495 | 3300049573 | Bacteria | 3474 |
| 829 | Ga0501037_0083375 | 3300049573 | Bacteria | 2316 |
| 830 | Ga0501037_0099956 | 3300049573 | Bacteria | 2095 |
| 831 | Ga0501038_0000557 | 3300049574 | Bacteria | 32961 |
| 832 | Ga0501038_0040126 | 3300049574 | Bacteria | 4091 |
| 833 | Ga0501038_0058174 | 3300049574 | Bacteria | 3315 |
| 834 | Ga0501038_0113492 | 3300049574 | Bacteria | 2242 |
| 835 | Ga0501038_0113718 | 3300049574 | Bacteria | 2240 |
| 836 | Ga0501038_0116545 | 3300049574 | Bacteria | 2207 |
| 837 | Ga0501039_0000689 | 3300049575 | Bacteria | 24309 |
| 838 | Ga0501039_0041520 | 3300049575 | Bacteria | 3553 |
| 839 | Ga0501040_0005022 | 3300049576 | Bacteria | 8550 |
| 840 | Ga0501043_0004029 | 3300049579 | Bacteria | 12015 |
| 841 | Ga0501043_0022353 | 3300049579 | Bacteria | 4961 |
| 842 | Ga0501043_0077095 | 3300049579 | Bacteria | 2618 |
| 843 | Ga0501043_0162739 | 3300049579 | Bacteria | 1743 |
| 844 | Ga0501043_0217300 | 3300049579 | Bacteria | 1480 |
| 845 | Ga0501047_0003732 | 3300049581 | Bacteria | 14344 |
| 846 | Ga0501047_0062927 | 3300049581 | Bacteria | 3579 |
| 847 | Ga0501047_0066505 | 3300049581 | Bacteria | 3474 |
| 848 | Ga0501047_0268538 | 3300049581 | Bacteria | 1552 |
| 849 | Ga0501047_0506694 | 3300049581 | Bacteria | 1033 |
| 850 | Ga0501069_0011784 | 3300049585 | Bacteria | 4636 |
| 851 | Ga0501070_0000227 | 3300049586 | Bacteria | 53051 |
| 852 | Ga0501070_0002902 | 3300049586 | Bacteria | 14938 |
| 853 | Ga0501070_0059818 | 3300049586 | Bacteria | 3158 |
| 854 | Ga0501070_0077896 | 3300049586 | Bacteria | 2743 |
| 855 | Ga0501070_0117439 | 3300049586 | Bacteria | 2197 |
| 856 | Ga0501070_0136045 | 3300049586 | Bacteria | 2029 |
| 857 | Ga0501071_0025714 | 3300049587 | Bacteria | 4125 |
| 858 | Ga0501071_0313549 | 3300049587 | Bacteria | 1190 |
| 859 | Ga0501073_0005747 | 3300049589 | Bacteria | 9274 |
| 860 | Ga0501074_0020802 | 3300049590 | Bacteria | 4767 |
| 861 | Ga0501238_002164 | 3300049671 | Bacteria | 2324 |
| 862 | Ga0501080_0003478 | 3300049742 | Bacteria | 13869 |
| 863 | Ga0501080_0057050 | 3300049742 | Bacteria | 3636 |
| 864 | Ga0501083_0008800 | 3300049744 | Bacteria | 7127 |
| 865 | Ga0501083_0022018 | 3300049744 | Bacteria | 4425 |
| 866 | Ga0501083_0047441 | 3300049744 | Bacteria | 2902 |
| 867 | Ga0501083_0124686 | 3300049744 | Bacteria | 1689 |
| 868 | Ga0501035_0000833 | 3300049822 | Bacteria | 32961 |
| 869 | Ga0501035_0005626 | 3300049822 | Bacteria | 11835 |
| 870 | Ga0501035_0411605 | 3300049822 | Bacteria | 1123 |
| 871 | Ga0501044_0001065 | 3300049823 | Bacteria | 32961 |
| 872 | Ga0501044_0032749 | 3300049823 | Bacteria | 5463 |
| 873 | Ga0501044_0113991 | 3300049823 | Bacteria | 2709 |
| 874 | Ga0501044_0141041 | 3300049823 | Bacteria | 2398 |
| 875 | Ga0501044_0642997 | 3300049823 | Bacteria | 950 |
| 876 | Ga0501045_0144011 | 3300049824 | Bacteria | 1772 |
| 877 | nmdc:mga03683_160722_c1 | 3300050489 | Bacteria | 1017 |
| 878 | nmdc:mga03683_2237_c1 | 3300050489 | Bacteria | 5970 |
| 879 | nmdc:mga03683_23744_c1 | 3300050489 | Bacteria | 2392 |
| 880 | nmdc:mga03n38_4361_c1 | 3300050490 | Bacteria | 4678 |
| 881 | nmdc:mga03n38_74341_c1 | 3300050490 | Bacteria | 1580 |
| 882 | nmdc:mga00v17_2539_c1 | 3300050491 | Bacteria | 9344 |
| 883 | nmdc:mga00v17_327499_c1 | 3300050491 | Bacteria | 995 |
| 884 | nmdc:mga00v17_4_c1 | 3300050491 | Bacteria | 238758 |
| 885 | nmdc:mga00v17_7500_c1 | 3300050491 | Bacteria | 5823 |
| 886 | nmdc:mga00v17_78_c2 | 3300050491 | Bacteria | 19083 |
| 887 | nmdc:mga00v17_94859_c1 | 3300050491 | Bacteria | 1877 |
| 888 | nmdc:mga0yw44_155727_c1 | 3300050492 | Bacteria | 1493 |
| 889 | nmdc:mga0yw44_199_c1 | 3300050492 | Bacteria | 21228 |
| 890 | nmdc:mga0yw44_232528_c1 | 3300050492 | Bacteria | 1224 |
| 891 | nmdc:mga0k408_155389_c1 | 3300050493 | Bacteria | 1362 |
| 892 | nmdc:mga0k408_196002_c1 | 3300050493 | Bacteria | 1205 |
| 893 | nmdc:mga0k408_98378_c1 | 3300050493 | Bacteria | 1724 |
| 894 | nmdc:mga06z11_54842_c1 | 3300050494 | Bacteria | 2056 |
| 895 | nmdc:mga04h51_62340_c1 | 3300050495 | Bacteria | 1281 |
| 896 | nmdc:mga07m45_40409_c1 | 3300050496 | Bacteria | 2610 |
| 897 | nmdc:mga07m45_85171_c1 | 3300050496 | Bacteria | 1807 |
| 898 | nmdc:mga05p37_185934_c1 | 3300050507 | Bacteria | 2526 |
| 899 | nmdc:mga09592_231954_c1 | 3300050508 | Bacteria | 1599 |
| 900 | nmdc:mga06r32_970943_c1 | 3300050510 | Bacteria | 803 |
| 901 | nmdc:mga08y16_315_c1 | 3300050511 | Bacteria | 43782 |
| 902 | nmdc:mga0sz30_2210_c1 | 3300050516 | Bacteria | 6955 |
| 903 | Ga0495619_0012995 | 3300053085 | Bacteria | 5246 |
| 904 | Ga0500578_0064397 | 3300053086 | Bacteria | 2338 |
| 905 | Ga0500643_004113 | 3300053087 | Bacteria | 6699 |
| 906 | Ga0500646_0004016 | 3300053090 | Bacteria | 3741 |
| 907 | Ga0500651_0021798 | 3300053093 | Bacteria | 3998 |
| 908 | Ga0500660_077223 | 3300053100 | Bacteria | 1539 |
| 909 | Ga0500555_001270 | 3300053103 | Bacteria | 8083 |
| 910 | Ga0500560_002524 | 3300053107 | Bacteria | 3515 |
| 911 | Ga0500562_053643 | 3300053108 | Bacteria | 1080 |
| 912 | Ga0500569_013290 | 3300053109 | Bacteria | 2012 |
| 913 | Ga0500572_005742 | 3300053111 | Bacteria | 2822 |
| 914 | Ga0500593_000456 | 3300053117 | Bacteria | 16197 |
| 915 | Ga0500618_000171 | 3300053125 | Bacteria | 54421 |
| 916 | Ga0500618_001171 | 3300053125 | Bacteria | 12670 |
| 917 | Ga0500628_012658 | 3300053129 | Bacteria | 1558 |
| 918 | Ga0500642_0004355 | 3300053130 | Bacteria | 4422 |
| 919 | Ga0500658_0001109 | 3300053134 | Bacteria | 11024 |
| 920 | Ga0500658_0002691 | 3300053134 | Bacteria | 6832 |
| 921 | Ga0500568_0000116 | 3300053139 | Bacteria | 71883 |
| 922 | Ga0500568_0000543 | 3300053139 | Bacteria | 27846 |
| 923 | Ga0500568_0040675 | 3300053139 | Bacteria | 1870 |
| 924 | Ga0500568_0043745 | 3300053139 | Bacteria | 1789 |
| 925 | Ga0500573_0001489 | 3300053140 | Bacteria | 11252 |
| 926 | Ga0500588_0060600 | 3300053146 | Bacteria | 1211 |
| 927 | Ga0500590_000074 | 3300053148 | Bacteria | 25195 |
| 928 | Ga0500604_0006180 | 3300053151 | Bacteria | 3164 |
| 929 | Ga0500604_0019009 | 3300053151 | Bacteria | 1920 |
| 930 | Ga0500604_0038371 | 3300053151 | Bacteria | 1437 |
| 931 | Ga0500616_0000402 | 3300053153 | Bacteria | 59210 |
| 932 | Ga0500616_0024890 | 3300053153 | Bacteria | 3321 |
| 933 | Ga0500620_000147 | 3300053155 | Bacteria | 14180 |
| 934 | Ga0500622_0000726 | 3300053156 | Bacteria | 28807 |
| 935 | Ga0500622_0024581 | 3300053156 | Bacteria | 3186 |
| 936 | Ga0500624_000410 | 3300053157 | Bacteria | 13225 |
| 937 | Ga0500634_0003689 | 3300053161 | Bacteria | 6894 |
| 938 | Ga0500636_0000005 | 3300053177 | Bacteria | 197561 |
| 939 | Ga0500611_014440 | 3300053727 | Bacteria | 1378 |
| 940 | Ga0500645_000042 | 3300053730 | Bacteria | 110470 |
| 941 | Ga0500645_002276 | 3300053730 | Bacteria | 8718 |
| 942 | Ga0500645_029267 | 3300053730 | Bacteria | 1663 |
| 943 | Ga0500609_000889 | 3300053731 | Bacteria | 4484 |
| 944 | Ga0500599_008922 | 3300053736 | Bacteria | 1307 |
| 945 | Ga0500661_000314 | 3300055283 | Bacteria | 8843 |
| 946 | Ga0590074_021251 | 3300059423 | Bacteria | 1118 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041492 | Ga0451835_0200957 | Ga0451835_0200957_34_735 | 224 |
| 2 | 3300050510 | nmdc:mga06r32_970943_c1 | nmdc:mga06r32_970943_c1_17_754 | 243 |
| 3 | iso_pu_bacteria | 2874102143 | 2874109046 | 249 |
| 4 | iso_pu_bacteria | 2874131515 | 2874133818 | 249 |
| 5 | iso_pu_bacteria | 3004232784 | 3004237280 | 250 |
| 6 | 3300005328 | Ga0070676_10134497 | Ga0070676_101344972 | 251 |
| 7 | 3300005331 | Ga0070670_100546630 | Ga0070670_1005466301 | 251 |
| 8 | 3300005354 | Ga0070675_100273768 | Ga0070675_1002737681 | 251 |
| 9 | 3300005842 | Ga0068858_100135039 | Ga0068858_1001350392 | 251 |
| 10 | 3300025907 | Ga0207645_10085566 | Ga0207645_100855663 | 251 |
| 11 | 3300025942 | Ga0207689_10271511 | Ga0207689_102715111 | 251 |
| 12 | 3300005367 | Ga0070667_100393191 | Ga0070667_1003931912 | 254 |
| 13 | 3300035172 | Ga0373955_0238927 | Ga0373955_0238927_10_774 | 254 |
| 14 | 3300005471 | Ga0070698_100156871 | Ga0070698_1001568712 | 255 |
| 15 | 3300048917 | Ga0496114_0731784 | Ga0496114_0731784_76_852 | 257 |
| 16 | 3300041459 | Ga0451800_0608245 | Ga0451800_0608245_29_805 | 258 |
| 17 | 3300046512 | Ga0495610_0099345 | Ga0495610_0099345_219_1055 | 258 |
| 18 | 3300046615 | Ga0495656_0263350 | Ga0495656_0263350_88_864 | 258 |
| 19 | 3300048919 | Ga0496116_0119594 | Ga0496116_0119594_19_795 | 258 |
| 20 | 3300049459 | Ga0495678_030868 | Ga0495678_030868_10_786 | 258 |
| 21 | 3300053156 | Ga0500622_0024581 | Ga0500622_0024581_2388_3164 | 258 |
| 22 | 3300042185 | Ga0450909_016064 | Ga0450909_016064_249_1085 | 259 |
| 23 | 3300046512 | Ga0495610_0048628 | Ga0495610_0048628_1099_1935 | 259 |
| 24 | iso_pu_bacteria | 2885318864 | 2885324013 | 260 |
| 25 | 3300003187 | JGI25151J46595_10000143 | JGI25151J46595_1000014325 | 261 |
| 26 | 3300005367 | Ga0070667_100028382 | Ga0070667_1000283822 | 261 |
| 27 | 3300005983 | Ga0081540_1082712 | Ga0081540_10827122 | 261 |
| 28 | 3300006048 | Ga0075363_100106804 | Ga0075363_1001068042 | 261 |
| 29 | 3300025294 | Ga0209025_1000299 | Ga0209025_100029982 | 261 |
| 30 | 3300025297 | Ga0209758_1006131 | Ga0209758_10061317 | 261 |
| 31 | 3300025972 | Ga0207668_10141713 | Ga0207668_101417132 | 261 |
| 32 | 3300025986 | Ga0207658_10040270 | Ga0207658_100402704 | 261 |
| 33 | 3300026118 | Ga0207675_100531298 | Ga0207675_1005312982 | 261 |
| 34 | 3300002987 | JGI25159J45721_1024023 | JGI25159J45721_10240231 | 262 |
| 35 | 3300003354 | JGI25160J50197_1002009 | JGI25160J50197_10020097 | 262 |
| 36 | 3300025284 | Ga0209130_1000160 | Ga0209130_100016063 | 262 |
| 37 | 3300025302 | Ga0207426_1000098 | Ga0207426_100009867 | 262 |
| 38 | 3300044694 | Ga0466963_0217153 | Ga0466963_0217153_365_1159 | 262 |
| 39 | 3300032002 | Ga0307416_100374461 | Ga0307416_1003744612 | 264 |
| 40 | 3300032005 | Ga0307411_10081872 | Ga0307411_100818722 | 264 |
| 41 | 3300039062 | Ga0400483_171274 | Ga0400483_171274_1693_2490 | 264 |
| 42 | 3300028800 | Ga0265338_10256126 | Ga0265338_102561262 | 265 |
| 43 | 3300031235 | Ga0265330_10048954 | Ga0265330_100489542 | 265 |
| 44 | 3300031251 | Ga0265327_10024986 | Ga0265327_100249862 | 265 |
| 45 | 3300031712 | Ga0265342_10102778 | Ga0265342_101027782 | 265 |
| 46 | 3300049570 | Ga0501033_0006558 | Ga0501033_0006558_3304_4161 | 265 |
| 47 | 3300049571 | Ga0501034_0063834 | Ga0501034_0063834_1717_2574 | 265 |
| 48 | 3300049572 | Ga0501036_0354756 | Ga0501036_0354756_49_906 | 265 |
| 49 | 3300049585 | Ga0501069_0011784 | Ga0501069_0011784_3298_4155 | 265 |
| 50 | 3300049586 | Ga0501070_0000227 | Ga0501070_0000227_24412_25269 | 265 |
| 51 | 3300049590 | Ga0501074_0020802 | Ga0501074_0020802_1257_2114 | 265 |
| 52 | 3300049742 | Ga0501080_0003478 | Ga0501080_0003478_9256_10113 | 265 |
| 53 | 3300049822 | Ga0501035_0005626 | Ga0501035_0005626_5718_6575 | 265 |
| 54 | 3300026095 | Ga0207676_10321138 | Ga0207676_103211382 | 266 |
| 55 | 3300035692 | Ga0373935_0257134 | Ga0373935_0257134_344_1147 | 266 |
| 56 | iso_pu_bacteria | 2856320880 | 2856327870 | 267 |
| 57 | 3300046660 | Ga0495625_0137971 | Ga0495625_0137971_283_1089 | 268 |
| 58 | iso_pu_bacteria | 2516143018 | 2516207912 | 269 |
| 59 | iso_pu_bacteria | 2791355091 | 2792619782 | 269 |
| 60 | iso_pu_bacteria | 2791355092 | 2792627556 | 269 |
| 61 | iso_pu_bacteria | 2854681122 | 2854682370 | 269 |
| 62 | iso_pu_bacteria | 2582581299 | 2585228178 | 270 |
| 63 | iso_pu_bacteria | 2751185821 | 2753461459 | 270 |
| 64 | iso_pu_bacteria | 2844533157 | 2844536384 | 271 |
| 65 | iso_pu_bacteria | 3000017691 | 3000021045 | 271 |
| 66 | 3300049573 | Ga0501037_0083375 | Ga0501037_0083375_804_1646 | 272 |
| 67 | 3300049589 | Ga0501073_0005747 | Ga0501073_0005747_429_1271 | 272 |
| 68 | 3300049744 | Ga0501083_0008800 | Ga0501083_0008800_3440_4282 | 272 |
| 69 | 3300053151 | Ga0500604_0006180 | Ga0500604_0006180_13_849 | 272 |
| 70 | iso_pu_bacteria | 2821443989 | 2821449724 | 272 |
| 71 | iso_pu_bacteria | 2920760137 | 2920761205 | 272 |
| 72 | 3300003374 | JGI25161J50226_1000079 | JGI25161J50226_100007925 | 273 |
| 73 | 3300005353 | Ga0070669_100012984 | Ga0070669_1000129842 | 273 |
| 74 | 3300005356 | Ga0070674_100002629 | Ga0070674_1000026298 | 273 |
| 75 | 3300005459 | Ga0068867_100448275 | Ga0068867_1004482751 | 273 |
| 76 | 3300005719 | Ga0068861_100005778 | Ga0068861_1000057784 | 273 |
| 77 | 3300005844 | Ga0068862_100021865 | Ga0068862_1000218655 | 273 |
| 78 | 3300005981 | Ga0081538_10006847 | Ga0081538_100068472 | 273 |
| 79 | 3300006844 | Ga0075428_100154157 | Ga0075428_1001541573 | 273 |
| 80 | 3300006881 | Ga0068865_100015032 | Ga0068865_1000150325 | 273 |
| 81 | 3300009094 | Ga0111539_10000300 | Ga0111539_1000030023 | 273 |
| 82 | 3300009147 | Ga0114129_10483459 | Ga0114129_104834592 | 273 |
| 83 | 3300009545 | Ga0105237_10764993 | Ga0105237_107649931 | 273 |
| 84 | 3300013105 | Ga0157369_10442365 | Ga0157369_104423652 | 273 |
| 85 | 3300014326 | Ga0157380_10231296 | Ga0157380_102312962 | 273 |
| 86 | 3300014326 | Ga0157380_10585573 | Ga0157380_105855732 | 273 |
| 87 | 3300025254 | Ga0209148_1000349 | Ga0209148_100034954 | 273 |
| 88 | 3300025272 | Ga0209455_1000872 | Ga0209455_100087213 | 273 |
| 89 | 3300025292 | Ga0209676_1033837 | Ga0209676_10338372 | 273 |
| 90 | 3300025298 | Ga0209050_1014517 | Ga0209050_10145172 | 273 |
| 91 | 3300025304 | Ga0209257_1000407 | Ga0209257_100040710 | 273 |
| 92 | 3300025937 | Ga0207669_10005604 | Ga0207669_100056043 | 273 |
| 93 | 3300026118 | Ga0207675_100005489 | Ga0207675_1000054895 | 273 |
| 94 | 3300027907 | Ga0207428_10000050 | Ga0207428_1000005098 | 273 |
| 95 | 3300028380 | Ga0268265_10008132 | Ga0268265_100081324 | 273 |
| 96 | 3300030522 | Ga0307512_10097469 | Ga0307512_100974693 | 273 |
| 97 | 3300031456 | Ga0307513_10397732 | Ga0307513_103977321 | 273 |
| 98 | 3300041411 | Ga0439466_0048103 | Ga0439466_0048103_548_1375 | 273 |
| 99 | 3300041492 | Ga0451835_0892570 | Ga0451835_0892570_10_834 | 273 |
| 100 | 3300045051 | Ga0451576_0191525 | Ga0451576_0191525_793_1632 | 273 |
| 101 | 3300046492 | Ga0495585_0080926 | Ga0495585_0080926_592_1416 | 273 |
| 102 | 3300046506 | Ga0495583_0002088 | Ga0495583_0002088_11212_12036 | 273 |
| 103 | 3300046660 | Ga0495625_0196946 | Ga0495625_0196946_34_873 | 273 |
| 104 | 3300047469 | Ga0495673_0043370 | Ga0495673_0043370_391_1215 | 273 |
| 105 | 3300048919 | Ga0496116_0000135 | Ga0496116_0000135_133058_133879 | 273 |
| 106 | 3300048925 | Ga0496122_0107495 | Ga0496122_0107495_629_1450 | 273 |
| 107 | 3300048929 | Ga0496126_0000129 | Ga0496126_0000129_78928_79749 | 273 |
| 108 | 3300049581 | Ga0501047_0268538 | Ga0501047_0268538_364_1200 | 273 |
| 109 | 3300049586 | Ga0501070_0059818 | Ga0501070_0059818_2014_2850 | 273 |
| 110 | 3300049587 | Ga0501071_0313549 | Ga0501071_0313549_139_987 | 273 |
| 111 | 3300049744 | Ga0501083_0047441 | Ga0501083_0047441_1384_2220 | 273 |
| 112 | 3300050507 | nmdc:mga05p37_185934_c1 | nmdc:mga05p37_185934_c1_822_1661 | 273 |
| 113 | 3300050508 | nmdc:mga09592_231954_c1 | nmdc:mga09592_231954_c1_429_1262 | 273 |
| 114 | 3300050511 | nmdc:mga08y16_315_c1 | nmdc:mga08y16_315_c1_38553_39395 | 273 |
| 115 | 3300053090 | Ga0500646_0004016 | Ga0500646_0004016_616_1455 | 273 |
| 116 | 3300053093 | Ga0500651_0021798 | Ga0500651_0021798_2197_3033 | 273 |
| 117 | 3300053130 | Ga0500642_0004355 | Ga0500642_0004355_429_1268 | 273 |
| 118 | 3300053146 | Ga0500588_0060600 | Ga0500588_0060600_37_876 | 273 |
| 119 | 3300053151 | Ga0500604_0019009 | Ga0500604_0019009_154_993 | 273 |
| 120 | 3300053731 | Ga0500609_000889 | Ga0500609_000889_127_966 | 273 |
| 121 | 3300053736 | Ga0500599_008922 | Ga0500599_008922_310_1149 | 273 |
| 122 | iso_pu_bacteria | 2508501122 | 2509108065 | 273 |
| 123 | iso_pu_bacteria | 2508501127 | 2509140284 | 273 |
| 124 | iso_pu_bacteria | 2509276019 | 2509376756 | 273 |
| 125 | iso_pu_bacteria | 2509276021 | 2509389312 | 273 |
| 126 | iso_pu_bacteria | 2509276033 | 2509446296 | 273 |
| 127 | iso_pu_bacteria | 2510065019 | 2510135346 | 273 |
| 128 | iso_pu_bacteria | 2510065057 | 2510305344 | 273 |
| 129 | iso_pu_bacteria | 2510461069 | 2510841582 | 273 |
| 130 | iso_pu_bacteria | 2510461076 | 2510896800 | 273 |
| 131 | iso_pu_bacteria | 2510917022 | 2511133178 | 273 |
| 132 | iso_pu_bacteria | 2510917028 | 2511185253 | 273 |
| 133 | iso_pu_bacteria | 2510917030 | 2511199432 | 273 |
| 134 | iso_pu_bacteria | 2511231027 | 2511389039 | 273 |
| 135 | iso_pu_bacteria | 2511231052 | 2511502482 | 273 |
| 136 | iso_pu_bacteria | 2512047086 | 2512533858 | 273 |
| 137 | iso_pu_bacteria | 2512875026 | 2512970385 | 273 |
| 138 | iso_pu_bacteria | 2513237084 | 2513573614 | 273 |
| 139 | iso_pu_bacteria | 2513237085 | 2513578777 | 273 |
| 140 | iso_pu_bacteria | 2513237086 | 2513588409 | 273 |
| 141 | iso_pu_bacteria | 2513237088 | 2513597874 | 273 |
| 142 | iso_pu_bacteria | 2513237089 | 2513601449 | 273 |
| 143 | iso_pu_bacteria | 2513237091 | 2513619538 | 273 |
| 144 | iso_pu_bacteria | 2513237093 | 2513634995 | 273 |
| 145 | iso_pu_bacteria | 2513237103 | 2513711446 | 273 |
| 146 | iso_pu_bacteria | 2513237138 | 2513865154 | 273 |
| 147 | iso_pu_bacteria | 2513237140 | 2513887164 | 273 |
| 148 | iso_pu_bacteria | 2513237143 | 2513904507 | 273 |
| 149 | iso_pu_bacteria | 2513237144 | 2513912647 | 273 |
| 150 | iso_pu_bacteria | 2513237146 | 2513928603 | 273 |
| 151 | iso_pu_bacteria | 2513237156 | 2513983647 | 273 |
| 152 | iso_pu_bacteria | 2513237159 | 2513997596 | 273 |
| 153 | iso_pu_bacteria | 2513237160 | 2514003104 | 273 |
| 154 | iso_pu_bacteria | 2513237162 | 2514019511 | 273 |
| 155 | iso_pu_bacteria | 2513237351 | 2514587038 | 273 |
| 156 | iso_pu_bacteria | 2515075009 | 2515114514 | 273 |
| 157 | iso_pu_bacteria | 2515154107 | 2515609275 | 273 |
| 158 | iso_pu_bacteria | 2515154113 | 2515635066 | 273 |
| 159 | iso_pu_bacteria | 2515154114 | 2515644372 | 273 |
| 160 | iso_pu_bacteria | 2515154116 | 2515657550 | 273 |
| 161 | iso_pu_bacteria | 2515154134 | 2515741698 | 273 |
| 162 | iso_pu_bacteria | 2516143018 | 2516206094 | 273 |
| 163 | iso_pu_bacteria | 2516653046 | 2516893857 | 273 |
| 164 | iso_pu_bacteria | 2516653077 | 2517038156 | 273 |
| 165 | iso_pu_bacteria | 2516653085 | 2517078437 | 273 |
| 166 | iso_pu_bacteria | 2517093000 | 2517097175 | 273 |
| 167 | iso_pu_bacteria | 2517287029 | 2517408437 | 273 |
| 168 | iso_pu_bacteria | 2517487022 | 2517570577 | 273 |
| 169 | iso_pu_bacteria | 2519899620 | 2520379738 | 273 |
| 170 | iso_pu_bacteria | 2523231067 | 2523466740 | 273 |
| 171 | iso_pu_bacteria | 2524023207 | 2524448317 | 273 |
| 172 | iso_pu_bacteria | 2524023209 | 2524458689 | 273 |
| 173 | iso_pu_bacteria | 2529292951 | 2530647261 | 273 |
| 174 | iso_pu_bacteria | 2534681796 | 2535519187 | 273 |
| 175 | iso_pu_bacteria | 2551306084 | 2551675711 | 273 |
| 176 | iso_pu_bacteria | 2551306085 | 2551688775 | 273 |
| 177 | iso_pu_bacteria | 2551306086 | 2551694922 | 273 |
| 178 | iso_pu_bacteria | 2551306087 | 2551698928 | 273 |
| 179 | iso_pu_bacteria | 2551306089 | 2551710612 | 273 |
| 180 | iso_pu_bacteria | 2551306090 | 2551720127 | 273 |
| 181 | iso_pu_bacteria | 2551306091 | 2551731286 | 273 |
| 182 | iso_pu_bacteria | 2551306093 | 2551744550 | 273 |
| 183 | iso_pu_bacteria | 2558860100 | 2558865886 | 273 |
| 184 | iso_pu_bacteria | 2558860983 | 2561467996 | 273 |
| 185 | iso_pu_bacteria | 2582581283 | 2585167531 | 273 |
| 186 | iso_pu_bacteria | 2582581294 | 2585201578 | 273 |
| 187 | iso_pu_bacteria | 2582581298 | 2585224031 | 273 |
| 188 | iso_pu_bacteria | 2582581299 | 2585231898 | 273 |
| 189 | iso_pu_bacteria | 2582581304 | 2585257200 | 273 |
| 190 | iso_pu_bacteria | 2582581306 | 2585265757 | 273 |
| 191 | iso_pu_bacteria | 2582581307 | 2585271914 | 273 |
| 192 | iso_pu_bacteria | 2582581308 | 2585279726 | 273 |
| 193 | iso_pu_bacteria | 2582581315 | 2585327562 | 273 |
| 194 | iso_pu_bacteria | 2582581316 | 2585333896 | 273 |
| 195 | iso_pu_bacteria | 2582581865 | 2585389003 | 273 |
| 196 | iso_pu_bacteria | 2582581866 | 2585395150 | 273 |
| 197 | iso_pu_bacteria | 2582581867 | 2585399915 | 273 |
| 198 | iso_pu_bacteria | 2585427526 | 2585525936 | 273 |
| 199 | iso_pu_bacteria | 2585427527 | 2585531871 | 273 |
| 200 | iso_pu_bacteria | 2585427528 | 2585540880 | 273 |
| 201 | iso_pu_bacteria | 2585427529 | 2585549731 | 273 |
| 202 | iso_pu_bacteria | 2585427530 | 2585551182 | 273 |
| 203 | iso_pu_bacteria | 2585427531 | 2585563720 | 273 |
| 204 | iso_pu_bacteria | 2585427590 | 2585821004 | 273 |
| 205 | iso_pu_bacteria | 2585427593 | 2585839149 | 273 |
| 206 | iso_pu_bacteria | 2585427594 | 2585845037 | 273 |
| 207 | iso_pu_bacteria | 2585427608 | 2585897081 | 273 |
| 208 | iso_pu_bacteria | 2585427609 | 2585907058 | 273 |
| 209 | iso_pu_bacteria | 2585428125 | 2587982948 | 273 |
| 210 | iso_pu_bacteria | 2597489875 | 2597810134 | 273 |
| 211 | iso_pu_bacteria | 2599185156 | 2599332072 | 273 |
| 212 | iso_pu_bacteria | 2599185170 | 2599420045 | 273 |
| 213 | iso_pu_bacteria | 2599185352 | 2600196101 | 273 |
| 214 | iso_pu_bacteria | 2615840624 | 2616296279 | 273 |
| 215 | iso_pu_bacteria | 2615840626 | 2616306515 | 273 |
| 216 | iso_pu_bacteria | 2615840698 | 2616551778 | 273 |
| 217 | iso_pu_bacteria | 2617270742 | 2617383941 | 273 |
| 218 | iso_pu_bacteria | 2643221551 | 2643777657 | 273 |
| 219 | iso_pu_bacteria | 2643221555 | 2643796105 | 273 |
| 220 | iso_pu_bacteria | 2643221557 | 2643804358 | 273 |
| 221 | iso_pu_bacteria | 2643221558 | 2643813348 | 273 |
| 222 | iso_pu_bacteria | 2643221595 | 2643985006 | 273 |
| 223 | iso_pu_bacteria | 2643221599 | 2644002603 | 273 |
| 224 | iso_pu_bacteria | 2643221607 | 2644050126 | 273 |
| 225 | iso_pu_bacteria | 2643221610 | 2644065129 | 273 |
| 226 | iso_pu_bacteria | 2643221618 | 2644105424 | 273 |
| 227 | iso_pu_bacteria | 2643221623 | 2644130693 | 273 |
| 228 | iso_pu_bacteria | 2643221626 | 2644145758 | 273 |
| 229 | iso_pu_bacteria | 2643221627 | 2644154064 | 273 |
| 230 | iso_pu_bacteria | 2643221629 | 2644168773 | 273 |
| 231 | iso_pu_bacteria | 2643221634 | 2644194675 | 273 |
| 232 | iso_pu_bacteria | 2643221636 | 2644204815 | 273 |
| 233 | iso_pu_bacteria | 2643221637 | 2644208719 | 273 |
| 234 | iso_pu_bacteria | 2643221643 | 2644240362 | 273 |
| 235 | iso_pu_bacteria | 2643221653 | 2644299347 | 273 |
| 236 | iso_pu_bacteria | 2643221655 | 2644311349 | 273 |
| 237 | iso_pu_bacteria | 2643221659 | 2644331252 | 273 |
| 238 | iso_pu_bacteria | 2643221662 | 2644347321 | 273 |
| 239 | iso_pu_bacteria | 2643221668 | 2644377538 | 273 |
| 240 | iso_pu_bacteria | 2643221675 | 2644416801 | 273 |
| 241 | iso_pu_bacteria | 2643221680 | 2644449841 | 273 |
| 242 | iso_pu_bacteria | 2643221686 | 2644483047 | 273 |
| 243 | iso_pu_bacteria | 2643221688 | 2644494234 | 273 |
| 244 | iso_pu_bacteria | 2643221689 | 2644497713 | 273 |
| 245 | iso_pu_bacteria | 2643221698 | 2644544653 | 273 |
| 246 | iso_pu_bacteria | 2643221712 | 2644617023 | 273 |
| 247 | iso_pu_bacteria | 2643221718 | 2644652249 | 273 |
| 248 | iso_pu_bacteria | 2643221719 | 2644657575 | 273 |
| 249 | iso_pu_bacteria | 2643221723 | 2644672806 | 273 |
| 250 | iso_pu_bacteria | 2643221726 | 2644689975 | 273 |
| 251 | iso_pu_bacteria | 2657244999 | 2657684883 | 273 |
| 252 | iso_pu_bacteria | 2667528174 | 2671113274 | 273 |
| 253 | iso_pu_bacteria | 2687453129 | 2687578954 | 273 |
| 254 | iso_pu_bacteria | 2690316117 | 2692315201 | 273 |
| 255 | iso_pu_bacteria | 2718217882 | 2719182995 | 273 |
| 256 | iso_pu_bacteria | 2718217927 | 2719387774 | 273 |
| 257 | iso_pu_bacteria | 2718217997 | 2719667343 | 273 |
| 258 | iso_pu_bacteria | 2718218009 | 2719733712 | 273 |
| 259 | iso_pu_bacteria | 2718218199 | 2720493763 | 273 |
| 260 | iso_pu_bacteria | 2718218232 | 2720615219 | 273 |
| 261 | iso_pu_bacteria | 2718218233 | 2720622012 | 273 |
| 262 | iso_pu_bacteria | 2718218235 | 2720633362 | 273 |
| 263 | iso_pu_bacteria | 2718218269 | 2720777060 | 273 |
| 264 | iso_pu_bacteria | 2718218363 | 2721149107 | 273 |
| 265 | iso_pu_bacteria | 2718218365 | 2721160505 | 273 |
| 266 | iso_pu_bacteria | 2718218366 | 2721165920 | 273 |
| 267 | iso_pu_bacteria | 2718218423 | 2721401407 | 273 |
| 268 | iso_pu_bacteria | 2721755514 | 2722842090 | 273 |
| 269 | iso_pu_bacteria | 2721755556 | 2723028659 | 273 |
| 270 | iso_pu_bacteria | 2721755684 | 2723562272 | 273 |
| 271 | iso_pu_bacteria | 2721755685 | 2723568965 | 273 |
| 272 | iso_pu_bacteria | 2721755809 | 2724040221 | 273 |
| 273 | iso_pu_bacteria | 2721755810 | 2724046468 | 273 |
| 274 | iso_pu_bacteria | 2721755819 | 2724091667 | 273 |
| 275 | iso_pu_bacteria | 2721755822 | 2724106230 | 273 |
| 276 | iso_pu_bacteria | 2721755823 | 2724112035 | 273 |
| 277 | iso_pu_bacteria | 2724679232 | 2725945704 | 273 |
| 278 | iso_pu_bacteria | 2728369352 | 2730109595 | 273 |
| 279 | iso_pu_bacteria | 2728369365 | 2730166230 | 273 |
| 280 | iso_pu_bacteria | 2728369397 | 2730300137 | 273 |
| 281 | iso_pu_bacteria | 2738541293 | 2738801048 | 273 |
| 282 | iso_pu_bacteria | 2738541333 | 2739038518 | 273 |
| 283 | iso_pu_bacteria | 2738543024 | 2739305989 | 273 |
| 284 | iso_pu_bacteria | 2738543031 | 2739347191 | 273 |
| 285 | iso_pu_bacteria | 2738543031 | 2739351061 | 273 |
| 286 | iso_pu_bacteria | 2751185800 | 2753359629 | 273 |
| 287 | iso_pu_bacteria | 2751185821 | 2753463378 | 273 |
| 288 | iso_pu_bacteria | 2757320392 | 2757569802 | 273 |
| 289 | iso_pu_bacteria | 2758568016 | 2758641888 | 273 |
| 290 | iso_pu_bacteria | 2765235802 | 2765463879 | 273 |
| 291 | iso_pu_bacteria | 2765235942 | 2766064161 | 273 |
| 292 | iso_pu_bacteria | 2767802442 | 2770197912 | 273 |
| 293 | iso_pu_bacteria | 2775506902 | 2776269011 | 273 |
| 294 | iso_pu_bacteria | 2775506904 | 2776283852 | 273 |
| 295 | iso_pu_bacteria | 2775507049 | 2776914687 | 273 |
| 296 | iso_pu_bacteria | 2775507266 | 2778179111 | 273 |
| 297 | iso_pu_bacteria | 2791355082 | 2792581518 | 273 |
| 298 | iso_pu_bacteria | 2791355091 | 2792620502 | 273 |
| 299 | iso_pu_bacteria | 2791355092 | 2792625861 | 273 |
| 300 | iso_pu_bacteria | 2791355094 | 2792638802 | 273 |
| 301 | iso_pu_bacteria | 2791355123 | 2792746558 | 273 |
| 302 | iso_pu_bacteria | 2791355253 | 2793280468 | 273 |
| 303 | iso_pu_bacteria | 2791355256 | 2793295594 | 273 |
| 304 | iso_pu_bacteria | 2791355259 | 2793317645 | 273 |
| 305 | iso_pu_bacteria | 2791355260 | 2793320757 | 273 |
| 306 | iso_pu_bacteria | 2791355261 | 2793327383 | 273 |
| 307 | iso_pu_bacteria | 2791355262 | 2793332271 | 273 |
| 308 | iso_pu_bacteria | 2791355263 | 2793338914 | 273 |
| 309 | iso_pu_bacteria | 2791355264 | 2793346632 | 273 |
| 310 | iso_pu_bacteria | 2791355265 | 2793353828 | 273 |
| 311 | iso_pu_bacteria | 2791355266 | 2793359300 | 273 |
| 312 | iso_pu_bacteria | 2791355267 | 2793365995 | 273 |
| 313 | iso_pu_bacteria | 2802428858 | 2802716742 | 273 |
| 314 | iso_pu_bacteria | 2802428859 | 2802725553 | 273 |
| 315 | iso_pu_bacteria | 2802428860 | 2802730355 | 273 |
| 316 | iso_pu_bacteria | 2802428861 | 2802737674 | 273 |
| 317 | iso_pu_bacteria | 2802428862 | 2802742937 | 273 |
| 318 | iso_pu_bacteria | 2802428863 | 2802750361 | 273 |
| 319 | iso_pu_bacteria | 2802429268 | 2804752989 | 273 |
| 320 | iso_pu_bacteria | 2802429605 | 2805926248 | 273 |
| 321 | iso_pu_bacteria | 2802429606 | 2805933974 | 273 |
| 322 | iso_pu_bacteria | 2802429633 | 2806049101 | 273 |
| 323 | iso_pu_bacteria | 2802429634 | 2806054325 | 273 |
| 324 | iso_pu_bacteria | 2802429635 | 2806060091 | 273 |
| 325 | iso_pu_bacteria | 2802429636 | 2806068705 | 273 |
| 326 | iso_pu_bacteria | 2802429637 | 2806076311 | 273 |
| 327 | iso_pu_bacteria | 2818991272 | 2819243920 | 273 |
| 328 | iso_pu_bacteria | 2818991448 | 2819611705 | 273 |
| 329 | iso_pu_bacteria | 2818991453 | 2819638613 | 273 |
| 330 | iso_pu_bacteria | 2838016132 | 2838018298 | 273 |
| 331 | iso_pu_bacteria | 2838022645 | 2838023975 | 273 |
| 332 | iso_pu_bacteria | 2838029111 | 2838034276 | 273 |
| 333 | iso_pu_bacteria | 2838035591 | 2838040254 | 273 |
| 334 | iso_pu_bacteria | 2838042994 | 2838046673 | 273 |
| 335 | iso_pu_bacteria | 2838048938 | 2838050842 | 273 |
| 336 | iso_pu_bacteria | 2838061910 | 2838062610 | 273 |
| 337 | iso_pu_bacteria | 2838068647 | 2838072159 | 273 |
| 338 | iso_pu_bacteria | 2838074704 | 2838079696 | 273 |
| 339 | iso_pu_bacteria | 2838661181 | 2838667070 | 273 |
| 340 | iso_pu_bacteria | 2838668709 | 2838672197 | 273 |
| 341 | iso_pu_bacteria | 2838680041 | 2838683787 | 273 |
| 342 | iso_pu_bacteria | 2838686498 | 2838690417 | 273 |
| 343 | iso_pu_bacteria | 2838694306 | 2838698315 | 273 |
| 344 | iso_pu_bacteria | 2838701080 | 2838704933 | 273 |
| 345 | iso_pu_bacteria | 2838707686 | 2838711430 | 273 |
| 346 | iso_pu_bacteria | 2838729681 | 2838732175 | 273 |
| 347 | iso_pu_bacteria | 2838742623 | 2838745071 | 273 |
| 348 | iso_pu_bacteria | 2839993093 | 2839993832 | 273 |
| 349 | iso_pu_bacteria | 2840764183 | 2840766836 | 273 |
| 350 | iso_pu_bacteria | 2841734538 | 2841735829 | 273 |
| 351 | iso_pu_bacteria | 2841851746 | 2841856130 | 273 |
| 352 | iso_pu_bacteria | 2841864319 | 2841867662 | 273 |
| 353 | iso_pu_bacteria | 2842077413 | 2842081231 | 273 |
| 354 | iso_pu_bacteria | 2842110456 | 2842116516 | 273 |
| 355 | iso_pu_bacteria | 2842118031 | 2842121992 | 273 |
| 356 | iso_pu_bacteria | 2842146304 | 2842148831 | 273 |
| 357 | iso_pu_bacteria | 2842156927 | 2842161298 | 273 |
| 358 | iso_pu_bacteria | 2842163707 | 2842166804 | 273 |
| 359 | iso_pu_bacteria | 2842180545 | 2842184915 | 273 |
| 360 | iso_pu_bacteria | 2842192696 | 2842194849 | 273 |
| 361 | iso_pu_bacteria | 2842198810 | 2842201568 | 273 |
| 362 | iso_pu_bacteria | 2842205361 | 2842207453 | 273 |
| 363 | iso_pu_bacteria | 2842217011 | 2842221879 | 273 |
| 364 | iso_pu_bacteria | 2842229732 | 2842232497 | 273 |
| 365 | iso_pu_bacteria | 2842237096 | 2842241006 | 273 |
| 366 | iso_pu_bacteria | 2842243621 | 2842246913 | 273 |
| 367 | iso_pu_bacteria | 2842250916 | 2842254614 | 273 |
| 368 | iso_pu_bacteria | 2842257432 | 2842260986 | 273 |
| 369 | iso_pu_bacteria | 2842264693 | 2842269673 | 273 |
| 370 | iso_pu_bacteria | 2842271015 | 2842274437 | 273 |
| 371 | iso_pu_bacteria | 2842278818 | 2842280836 | 273 |
| 372 | iso_pu_bacteria | 2842285085 | 2842288553 | 273 |
| 373 | iso_pu_bacteria | 2842291075 | 2842294888 | 273 |
| 374 | iso_pu_bacteria | 2842298080 | 2842300048 | 273 |
| 375 | iso_pu_bacteria | 2842304105 | 2842305721 | 273 |
| 376 | iso_pu_bacteria | 2842311132 | 2842311448 | 273 |
| 377 | iso_pu_bacteria | 2842317721 | 2842321144 | 273 |
| 378 | iso_pu_bacteria | 2842341865 | 2842346791 | 273 |
| 379 | iso_pu_bacteria | 2842357229 | 2842358959 | 273 |
| 380 | iso_pu_bacteria | 2842363717 | 2842366176 | 273 |
| 381 | iso_pu_bacteria | 2842370503 | 2842375094 | 273 |
| 382 | iso_pu_bacteria | 2842377471 | 2842381287 | 273 |
| 383 | iso_pu_bacteria | 2842384541 | 2842388357 | 273 |
| 384 | iso_pu_bacteria | 2842395702 | 2842395844 | 273 |
| 385 | iso_pu_bacteria | 2842402390 | 2842406101 | 273 |
| 386 | iso_pu_bacteria | 2842409023 | 2842412686 | 273 |
| 387 | iso_pu_bacteria | 2842415677 | 2842419435 | 273 |
| 388 | iso_pu_bacteria | 2842422224 | 2842425791 | 273 |
| 389 | iso_pu_bacteria | 2842428310 | 2842433565 | 273 |
| 390 | iso_pu_bacteria | 2842434925 | 2842439893 | 273 |
| 391 | iso_pu_bacteria | 2842441272 | 2842446522 | 273 |
| 392 | iso_pu_bacteria | 2842447887 | 2842448743 | 273 |
| 393 | iso_pu_bacteria | 2842462802 | 2842467969 | 273 |
| 394 | iso_pu_bacteria | 2842469257 | 2842474502 | 273 |
| 395 | iso_pu_bacteria | 2842475841 | 2842481022 | 273 |
| 396 | iso_pu_bacteria | 2842482326 | 2842485170 | 273 |
| 397 | iso_pu_bacteria | 2842489311 | 2842491197 | 273 |
| 398 | iso_pu_bacteria | 2842495871 | 2842498535 | 273 |
| 399 | iso_pu_bacteria | 2842502639 | 2842507633 | 273 |
| 400 | iso_pu_bacteria | 2842509118 | 2842511474 | 273 |
| 401 | iso_pu_bacteria | 2842521101 | 2842522161 | 273 |
| 402 | iso_pu_bacteria | 2842871566 | 2842873444 | 273 |
| 403 | iso_pu_bacteria | 2842922631 | 2842924425 | 273 |
| 404 | iso_pu_bacteria | 2844002411 | 2844004125 | 273 |
| 405 | iso_pu_bacteria | 2844163670 | 2844163920 | 273 |
| 406 | iso_pu_bacteria | 2844454524 | 2844456883 | 273 |
| 407 | iso_pu_bacteria | 2847417321 | 2847419742 | 273 |
| 408 | iso_pu_bacteria | 2848992105 | 2848994759 | 273 |
| 409 | iso_pu_bacteria | 2850079185 | 2850081758 | 273 |
| 410 | iso_pu_bacteria | 2852387548 | 2852391987 | 273 |
| 411 | iso_pu_bacteria | 2854911287 | 2854912248 | 273 |
| 412 | iso_pu_bacteria | 2855825444 | 2855826583 | 273 |
| 413 | iso_pu_bacteria | 2855839649 | 2855841973 | 273 |
| 414 | iso_pu_bacteria | 2855872281 | 2855877258 | 273 |
| 415 | iso_pu_bacteria | 2856342000 | 2856345430 | 273 |
| 416 | iso_pu_bacteria | 2857516855 | 2857519681 | 273 |
| 417 | iso_pu_bacteria | 2858800743 | 2858802647 | 273 |
| 418 | iso_pu_bacteria | 2869162929 | 2869168726 | 273 |
| 419 | iso_pu_bacteria | 2869234852 | 2869236046 | 273 |
| 420 | iso_pu_bacteria | 2871435913 | 2871436146 | 273 |
| 421 | iso_pu_bacteria | 2871474448 | 2871475465 | 273 |
| 422 | iso_pu_bacteria | 2874109183 | 2874115536 | 273 |
| 423 | iso_pu_bacteria | 2874123672 | 2874129521 | 273 |
| 424 | iso_pu_bacteria | 2874168670 | 2874171756 | 273 |
| 425 | iso_pu_bacteria | 2878730984 | 2878735054 | 273 |
| 426 | iso_pu_bacteria | 2878788777 | 2878796021 | 273 |
| 427 | iso_pu_bacteria | 2882632389 | 2882632775 | 273 |
| 428 | iso_pu_bacteria | 2885312484 | 2885314700 | 273 |
| 429 | iso_pu_bacteria | 2888343758 | 2888343803 | 273 |
| 430 | iso_pu_bacteria | 2894652903 | 2894653238 | 273 |
| 431 | iso_pu_bacteria | 2896384573 | 2896391193 | 273 |
| 432 | iso_pu_bacteria | 2899803654 | 2899804126 | 273 |
| 433 | iso_pu_bacteria | 2903513507 | 2903517200 | 273 |
| 434 | iso_pu_bacteria | 2904578770 | 2904579480 | 273 |
| 435 | iso_pu_bacteria | 2913295892 | 2913299140 | 273 |
| 436 | iso_pu_bacteria | 2915650412 | 2915653019 | 273 |
| 437 | iso_pu_bacteria | 2915980308 | 2915982854 | 273 |
| 438 | iso_pu_bacteria | 2915986958 | 2915989266 | 273 |
| 439 | iso_pu_bacteria | 2915993759 | 2915999060 | 273 |
| 440 | iso_pu_bacteria | 2916000859 | 2916005024 | 273 |
| 441 | iso_pu_bacteria | 2916007675 | 2916012690 | 273 |
| 442 | iso_pu_bacteria | 2916014648 | 2916018982 | 273 |
| 443 | iso_pu_bacteria | 2916021584 | 2916022995 | 273 |
| 444 | iso_pu_bacteria | 2916028427 | 2916033834 | 273 |
| 445 | iso_pu_bacteria | 2916041962 | 2916044352 | 273 |
| 446 | iso_pu_bacteria | 2916048683 | 2916050400 | 273 |
| 447 | iso_pu_bacteria | 2916055098 | 2916060312 | 273 |
| 448 | iso_pu_bacteria | 2916061851 | 2916065490 | 273 |
| 449 | iso_pu_bacteria | 2916068649 | 2916073867 | 273 |
| 450 | iso_pu_bacteria | 2916076590 | 2916078343 | 273 |
| 451 | iso_pu_bacteria | 2919100787 | 2919105496 | 273 |
| 452 | iso_pu_bacteria | 2919119836 | 2919120853 | 273 |
| 453 | iso_pu_bacteria | 2919408235 | 2919411266 | 273 |
| 454 | iso_pu_bacteria | 2920822456 | 2920825598 | 273 |
| 455 | iso_pu_bacteria | 2921201388 | 2921205742 | 273 |
| 456 | iso_pu_bacteria | 2921208531 | 2921212535 | 273 |
| 457 | iso_pu_bacteria | 2921237296 | 2921243967 | 273 |
| 458 | iso_pu_bacteria | 2921244191 | 2921244508 | 273 |
| 459 | iso_pu_bacteria | 2921250672 | 2921253707 | 273 |
| 460 | iso_pu_bacteria | 2921257292 | 2921257844 | 273 |
| 461 | iso_pu_bacteria | 2921263974 | 2921269434 | 273 |
| 462 | iso_pu_bacteria | 2921289301 | 2921291103 | 273 |
| 463 | iso_pu_bacteria | 2923556063 | 2923559998 | 273 |
| 464 | iso_pu_bacteria | 2924144063 | 2924150341 | 273 |
| 465 | iso_pu_bacteria | 2924150972 | 2924156507 | 273 |
| 466 | iso_pu_bacteria | 2924158325 | 2924159862 | 273 |
| 467 | iso_pu_bacteria | 2924165586 | 2924167491 | 273 |
| 468 | iso_pu_bacteria | 2924172951 | 2924178452 | 273 |
| 469 | iso_pu_bacteria | 2924179722 | 2924183523 | 273 |
| 470 | iso_pu_bacteria | 2924186466 | 2924187697 | 273 |
| 471 | iso_pu_bacteria | 2924193448 | 2924196416 | 273 |
| 472 | iso_pu_bacteria | 2924200457 | 2924203866 | 273 |
| 473 | iso_pu_bacteria | 2924207177 | 2924210777 | 273 |
| 474 | iso_pu_bacteria | 2924214083 | 2924216852 | 273 |
| 475 | iso_pu_bacteria | 2924221636 | 2924225611 | 273 |
| 476 | iso_pu_bacteria | 2924228884 | 2924233295 | 273 |
| 477 | iso_pu_bacteria | 2924710171 | 2924715466 | 273 |
| 478 | iso_pu_bacteria | 2924733363 | 2924734294 | 273 |
| 479 | iso_pu_bacteria | 2924754689 | 2924756115 | 273 |
| 480 | iso_pu_bacteria | 2928521798 | 2928522281 | 273 |
| 481 | iso_pu_bacteria | 2929138655 | 2929141453 | 273 |
| 482 | iso_pu_bacteria | 2933016740 | 2933018640 | 273 |
| 483 | iso_pu_bacteria | 2933570622 | 2933572227 | 273 |
| 484 | iso_pu_bacteria | 2933586486 | 2933592877 | 273 |
| 485 | iso_pu_bacteria | 2933599457 | 2933602988 | 273 |
| 486 | iso_pu_bacteria | 2935894831 | 2935898033 | 273 |
| 487 | iso_pu_bacteria | 2935901341 | 2935903524 | 273 |
| 488 | iso_pu_bacteria | 2936367885 | 2936369988 | 273 |
| 489 | iso_pu_bacteria | 2936375103 | 2936379174 | 273 |
| 490 | iso_pu_bacteria | 2936381700 | 2936381848 | 273 |
| 491 | iso_pu_bacteria | 2936996657 | 2937002737 | 273 |
| 492 | iso_pu_bacteria | 2937002841 | 2937005298 | 273 |
| 493 | iso_pu_bacteria | 2937009748 | 2937012834 | 273 |
| 494 | iso_pu_bacteria | 2937016420 | 2937021901 | 273 |
| 495 | iso_pu_bacteria | 2937023124 | 2937027309 | 273 |
| 496 | iso_pu_bacteria | 2937029754 | 2937033360 | 273 |
| 497 | iso_pu_bacteria | 2937036028 | 2937038462 | 273 |
| 498 | iso_pu_bacteria | 2937042894 | 2937048491 | 273 |
| 499 | iso_pu_bacteria | 2937049772 | 2937052819 | 273 |
| 500 | iso_pu_bacteria | 2937056579 | 2937062892 | 273 |
| 501 | iso_pu_bacteria | 2937063883 | 2937068721 | 273 |
| 502 | iso_pu_bacteria | 2937071275 | 2937075902 | 273 |
| 503 | iso_pu_bacteria | 2937078374 | 2937080670 | 273 |
| 504 | iso_pu_bacteria | 2937084907 | 2937087980 | 273 |
| 505 | iso_pu_bacteria | 2937091812 | 2937097462 | 273 |
| 506 | iso_pu_bacteria | 2937098957 | 2937100045 | 273 |
| 507 | iso_pu_bacteria | 2937106411 | 2937110186 | 273 |
| 508 | iso_pu_bacteria | 2937113482 | 2937117708 | 273 |
| 509 | iso_pu_bacteria | 2937119839 | 2937124541 | 273 |
| 510 | iso_pu_bacteria | 2937126314 | 2937132264 | 273 |
| 511 | iso_pu_bacteria | 2937836603 | 2937839122 | 273 |
| 512 | iso_pu_bacteria | 2941499720 | 2941504635 | 273 |
| 513 | iso_pu_bacteria | 2954011201 | 2954014294 | 273 |
| 514 | iso_pu_bacteria | 2957375807 | 2957380717 | 273 |
| 515 | iso_pu_bacteria | 2957382221 | 2957387294 | 273 |
| 516 | iso_pu_bacteria | 2957388812 | 2957389534 | 273 |
| 517 | iso_pu_bacteria | 2957395598 | 2957397226 | 273 |
| 518 | iso_pu_bacteria | 2957402308 | 2957408289 | 273 |
| 519 | iso_pu_bacteria | 2957408893 | 2957412955 | 273 |
| 520 | iso_pu_bacteria | 2957415311 | 2957418911 | 273 |
| 521 | iso_pu_bacteria | 2957422303 | 2957428443 | 273 |
| 522 | iso_pu_bacteria | 2957430029 | 2957435849 | 273 |
| 523 | iso_pu_bacteria | 2957437181 | 2957440674 | 273 |
| 524 | iso_pu_bacteria | 2957443900 | 2957450211 | 273 |
| 525 | iso_pu_bacteria | 2957450854 | 2957455748 | 273 |
| 526 | iso_pu_bacteria | 2957457609 | 2957460482 | 273 |
| 527 | iso_pu_bacteria | 2957464669 | 2957468788 | 273 |
| 528 | iso_pu_bacteria | 2957478035 | 2957483138 | 273 |
| 529 | iso_pu_bacteria | 2957484790 | 2957489210 | 273 |
| 530 | iso_pu_bacteria | 2957491536 | 2957495164 | 273 |
| 531 | iso_pu_bacteria | 2957498199 | 2957498974 | 273 |
| 532 | iso_pu_bacteria | 2957505466 | 2957507085 | 273 |
| 533 | iso_pu_bacteria | 2958071322 | 2958076306 | 273 |
| 534 | iso_pu_bacteria | 2960584000 | 2960589860 | 273 |
| 535 | iso_pu_bacteria | 2960591022 | 2960594041 | 273 |
| 536 | iso_pu_bacteria | 2960597568 | 2960602137 | 273 |
| 537 | iso_pu_bacteria | 2960603979 | 2960610240 | 273 |
| 538 | iso_pu_bacteria | 2960610863 | 2960613130 | 273 |
| 539 | iso_pu_bacteria | 2960617483 | 2960617965 | 273 |
| 540 | iso_pu_bacteria | 2960624210 | 2960629749 | 273 |
| 541 | iso_pu_bacteria | 2960631154 | 2960635606 | 273 |
| 542 | iso_pu_bacteria | 2960645483 | 2960647425 | 273 |
| 543 | iso_pu_bacteria | 2960652885 | 2960655069 | 273 |
| 544 | iso_pu_bacteria | 2960660292 | 2960667059 | 273 |
| 545 | iso_pu_bacteria | 2960667422 | 2960670695 | 273 |
| 546 | iso_pu_bacteria | 2960674078 | 2960680556 | 273 |
| 547 | iso_pu_bacteria | 2960680706 | 2960680833 | 273 |
| 548 | iso_pu_bacteria | 2960687367 | 2960688174 | 273 |
| 549 | iso_pu_bacteria | 2960693952 | 2960697290 | 273 |
| 550 | iso_pu_bacteria | 2964607997 | 2964614412 | 273 |
| 551 | iso_pu_bacteria | 2964615318 | 2964618146 | 273 |
| 552 | iso_pu_bacteria | 2964621998 | 2964628065 | 273 |
| 553 | iso_pu_bacteria | 2964628898 | 2964634237 | 273 |
| 554 | iso_pu_bacteria | 2964636051 | 2964639174 | 273 |
| 555 | iso_pu_bacteria | 2964643177 | 2964646218 | 273 |
| 556 | iso_pu_bacteria | 2964649959 | 2964651279 | 273 |
| 557 | iso_pu_bacteria | 2964656573 | 2964656930 | 273 |
| 558 | iso_pu_bacteria | 2964663802 | 2964667696 | 273 |
| 559 | iso_pu_bacteria | 2964670856 | 2964675082 | 273 |
| 560 | iso_pu_bacteria | 2964678106 | 2964682696 | 273 |
| 561 | iso_pu_bacteria | 2964685014 | 2964689251 | 273 |
| 562 | iso_pu_bacteria | 2964691889 | 2964694773 | 273 |
| 563 | iso_pu_bacteria | 2964698721 | 2964704533 | 273 |
| 564 | iso_pu_bacteria | 2964712639 | 2964718831 | 273 |
| 565 | iso_pu_bacteria | 2964719344 | 2964722640 | 273 |
| 566 | iso_pu_bacteria | 2967664464 | 2967667688 | 273 |
| 567 | iso_pu_bacteria | 2967671571 | 2967677753 | 273 |
| 568 | iso_pu_bacteria | 2967678726 | 2967685792 | 273 |
| 569 | iso_pu_bacteria | 2967686174 | 2967689304 | 273 |
| 570 | iso_pu_bacteria | 2967693043 | 2967698669 | 273 |
| 571 | iso_pu_bacteria | 2967699805 | 2967700037 | 273 |
| 572 | iso_pu_bacteria | 2967706974 | 2967711451 | 273 |
| 573 | iso_pu_bacteria | 2967714385 | 2967720356 | 273 |
| 574 | iso_pu_bacteria | 2967721400 | 2967727210 | 273 |
| 575 | iso_pu_bacteria | 2967728569 | 2967729471 | 273 |
| 576 | iso_pu_bacteria | 2967735183 | 2967739832 | 273 |
| 577 | iso_pu_bacteria | 2967742019 | 2967745277 | 273 |
| 578 | iso_pu_bacteria | 2967748971 | 2967754233 | 273 |
| 579 | iso_pu_bacteria | 2967755722 | 2967759682 | 273 |
| 580 | iso_pu_bacteria | 2967762386 | 2967764021 | 273 |
| 581 | iso_pu_bacteria | 2967769361 | 2967772671 | 273 |
| 582 | iso_pu_bacteria | 2967775926 | 2967778123 | 273 |
| 583 | iso_pu_bacteria | 2970019648 | 2970024349 | 273 |
| 584 | iso_pu_bacteria | 2970026789 | 2970028038 | 273 |
| 585 | iso_pu_bacteria | 2970033650 | 2970035950 | 273 |
| 586 | iso_pu_bacteria | 2970040964 | 2970045232 | 273 |
| 587 | iso_pu_bacteria | 2970047711 | 2970051496 | 273 |
| 588 | iso_pu_bacteria | 2970054988 | 2970056194 | 273 |
| 589 | iso_pu_bacteria | 2970061556 | 2970065470 | 273 |
| 590 | iso_pu_bacteria | 2970068827 | 2970070959 | 273 |
| 591 | iso_pu_bacteria | 2970076120 | 2970079389 | 273 |
| 592 | iso_pu_bacteria | 2970082768 | 2970084642 | 273 |
| 593 | iso_pu_bacteria | 2970088815 | 2970094301 | 273 |
| 594 | iso_pu_bacteria | 2970095765 | 2970099939 | 273 |
| 595 | iso_pu_bacteria | 2970102677 | 2970103999 | 273 |
| 596 | iso_pu_bacteria | 2970109326 | 2970111927 | 273 |
| 597 | iso_pu_bacteria | 2970116247 | 2970120527 | 273 |
| 598 | iso_pu_bacteria | 2970122695 | 2970126069 | 273 |
| 599 | iso_pu_bacteria | 2970129317 | 2970134665 | 273 |
| 600 | iso_pu_bacteria | 2970136068 | 2970141753 | 273 |
| 601 | iso_pu_bacteria | 2970143518 | 2970147234 | 273 |
| 602 | iso_pu_bacteria | 2970149975 | 2970152424 | 273 |
| 603 | iso_pu_bacteria | 2970156795 | 2970162233 | 273 |
| 604 | iso_pu_bacteria | 2970164137 | 2970168244 | 273 |
| 605 | iso_pu_bacteria | 2970170962 | 2970175962 | 273 |
| 606 | iso_pu_bacteria | 2970177841 | 2970181137 | 273 |
| 607 | iso_pu_bacteria | 2970184632 | 2970186212 | 273 |
| 608 | iso_pu_bacteria | 2970191845 | 2970192569 | 273 |
| 609 | iso_pu_bacteria | 2977516862 | 2977519040 | 273 |
| 610 | iso_pu_bacteria | 2977523885 | 2977528113 | 273 |
| 611 | iso_pu_bacteria | 2977530762 | 2977536422 | 273 |
| 612 | iso_pu_bacteria | 2977537788 | 2977543369 | 273 |
| 613 | iso_pu_bacteria | 2977544691 | 2977550513 | 273 |
| 614 | iso_pu_bacteria | 2977551784 | 2977552993 | 273 |
| 615 | iso_pu_bacteria | 2977558990 | 2977564126 | 273 |
| 616 | iso_pu_bacteria | 2977565890 | 2977568789 | 273 |
| 617 | iso_pu_bacteria | 2977572785 | 2977574119 | 273 |
| 618 | iso_pu_bacteria | 2977579622 | 2977585977 | 273 |
| 619 | iso_pu_bacteria | 2977898635 | 2977903664 | 273 |
| 620 | iso_pu_bacteria | 2989349275 | 2989351217 | 273 |
| 621 | iso_pu_bacteria | 2989776772 | 2989780452 | 273 |
| 622 | iso_pu_bacteria | 2996310559 | 2996315618 | 273 |
| 623 | iso_pu_bacteria | 2996336353 | 2996341246 | 273 |
| 624 | iso_pu_bacteria | 2996386984 | 2996388498 | 273 |
| 625 | iso_pu_bacteria | 2996887358 | 2996890431 | 273 |
| 626 | iso_pu_bacteria | 2996893221 | 2996896099 | 273 |
| 627 | iso_pu_bacteria | 3000135777 | 3000135930 | 273 |
| 628 | iso_pu_bacteria | 3002141150 | 3002142259 | 273 |
| 629 | iso_pu_bacteria | 3004334049 | 3004338066 | 273 |
| 630 | iso_pu_bacteria | 3005409236 | 3005415892 | 273 |
| 631 | iso_pu_bacteria | 3005416602 | 3005421418 | 273 |
| 632 | iso_pu_bacteria | 3005445848 | 3005449769 | 273 |
| 633 | iso_pu_bacteria | 639633055 | 639650524 | 273 |
| 634 | iso_pu_bacteria | 643692032 | 643826637 | 273 |
| 635 | iso_pu_bacteria | 648276728 | 648739472 | 273 |
| 636 | iso_pu_bacteria | 8002285264 | 8002291901 | 273 |
| 637 | iso_pu_bacteria | 8003992118 | 8003994409 | 273 |
| 638 | iso_pu_bacteria | 8003999396 | 8004002114 | 273 |
| 639 | iso_pu_bacteria | 8004395343 | 8004401446 | 273 |
| 640 | iso_pu_bacteria | 8004633249 | 8004638721 | 273 |
| 641 | iso_pu_bacteria | 8005246636 | 8005248234 | 273 |
| 642 | iso_pu_bacteria | 8005258706 | 8005262618 | 273 |
| 643 | iso_pu_bacteria | 8005275841 | 8005282531 | 273 |
| 644 | iso_pu_bacteria | 8005282627 | 8005286714 | 273 |
| 645 | iso_pu_bacteria | 8005289223 | 8005295116 | 273 |
| 646 | iso_pu_bacteria | 8005301065 | 8005305993 | 273 |
| 647 | iso_pu_bacteria | 8005307578 | 8005313810 | 273 |
| 648 | iso_pu_bacteria | 8005314921 | 8005319877 | 273 |
| 649 | iso_pu_bacteria | 8005321885 | 8005324958 | 273 |
| 650 | iso_pu_bacteria | 8005376324 | 8005381471 | 273 |
| 651 | iso_pu_bacteria | 8005382845 | 8005387680 | 273 |
| 652 | iso_pu_bacteria | 8005395548 | 8005400711 | 273 |
| 653 | iso_pu_bacteria | 8005430974 | 8005431139 | 273 |
| 654 | iso_pu_bacteria | 8005460587 | 8005465208 | 273 |
| 655 | iso_pu_bacteria | 8005484373 | 8005486898 | 273 |
| 656 | iso_pu_bacteria | 8005497431 | 8005497723 | 273 |
| 657 | iso_pu_bacteria | 8005542996 | 8005546843 | 273 |
| 658 | iso_pu_bacteria | 8005556819 | 8005561272 | 273 |
| 659 | iso_pu_bacteria | 8005563573 | 8005565895 | 273 |
| 660 | iso_pu_bacteria | 8005570704 | 8005571944 | 273 |
| 661 | iso_pu_bacteria | 8005619151 | 8005623440 | 273 |
| 662 | iso_pu_bacteria | 8005626139 | 8005630978 | 273 |
| 663 | iso_pu_bacteria | 8005645114 | 8005647148 | 273 |
| 664 | iso_pu_bacteria | 8005658619 | 8005661682 | 273 |
| 665 | iso_pu_bacteria | 8005668836 | 8005669128 | 273 |
| 666 | iso_pu_bacteria | 8005682033 | 8005687076 | 273 |
| 667 | iso_pu_bacteria | 8005688590 | 8005694308 | 273 |
| 668 | iso_pu_bacteria | 8005695170 | 8005695901 | 273 |
| 669 | iso_pu_bacteria | 8018127388 | 8018128947 | 273 |
| 670 | iso_pu_bacteria | 8018150411 | 8018154655 | 273 |
| 671 | iso_pu_bacteria | 8018163183 | 8018164990 | 273 |
| 672 | iso_pu_bacteria | 8018176218 | 8018177568 | 273 |
| 673 | iso_pu_bacteria | 8023680758 | 8023686653 | 273 |
| 674 | iso_pu_bacteria | 8024479707 | 8024484469 | 273 |
| 675 | iso_pu_bacteria | 8024486573 | 8024490944 | 273 |
| 676 | iso_pu_bacteria | 8024501048 | 8024502042 | 273 |
| 677 | iso_pu_bacteria | 8046767195 | 8046767473 | 273 |
| 678 | iso_pu_bacteria | 8049293176 | 8049295599 | 273 |
| 679 | iso_pu_bacteria | 8055431914 | 8055431959 | 273 |
| 680 | iso_pu_bacteria | 8055617313 | 8055617359 | 273 |
| 681 | iso_pu_bacteria | 8056375014 | 8056380506 | 273 |
| 682 | iso_pu_bacteria | 8056382006 | 8056385277 | 273 |
| 683 | iso_pu_bacteria | 8056875544 | 8056876275 | 273 |
| 684 | iso_pu_bacteria | 8057575449 | 8057581864 | 273 |
| 685 | iso_pu_bacteria | 8057874678 | 8057879389 | 273 |
| 686 | 3300003187 | JGI25151J46595_10001127 | JGI25151J46595_1000112713 | 274 |
| 687 | 3300003771 | Ga0055526_1001066 | Ga0055526_10010668 | 274 |
| 688 | 3300003775 | Ga0055524_1001370 | Ga0055524_10013707 | 274 |
| 689 | 3300009101 | Ga0105247_10151109 | Ga0105247_101511091 | 274 |
| 690 | 3300009177 | Ga0105248_10001664 | Ga0105248_1000166418 | 274 |
| 691 | 3300009177 | Ga0105248_10049509 | Ga0105248_100495093 | 274 |
| 692 | 3300009177 | Ga0105248_10049981 | Ga0105248_100499814 | 274 |
| 693 | 3300009553 | Ga0105249_10104647 | Ga0105249_101046471 | 274 |
| 694 | 3300013297 | Ga0157378_10499879 | Ga0157378_104998791 | 274 |
| 695 | 3300013306 | Ga0163162_10045639 | Ga0163162_100456394 | 274 |
| 696 | 3300013308 | Ga0157375_10001469 | Ga0157375_1000146910 | 274 |
| 697 | 3300013308 | Ga0157375_10255482 | Ga0157375_102554821 | 274 |
| 698 | 3300014325 | Ga0163163_10036645 | Ga0163163_100366453 | 274 |
| 699 | 3300014325 | Ga0163163_10253799 | Ga0163163_102537992 | 274 |
| 700 | 3300014326 | Ga0157380_10195657 | Ga0157380_101956572 | 274 |
| 701 | 3300014326 | Ga0157380_10452536 | Ga0157380_104525362 | 274 |
| 702 | 3300014968 | Ga0157379_10000142 | Ga0157379_1000014252 | 274 |
| 703 | 3300025941 | Ga0207711_10009821 | Ga0207711_100098213 | 274 |
| 704 | 3300025960 | Ga0207651_10008045 | Ga0207651_100080451 | 274 |
| 705 | 3300041486 | Ga0451807_1468043 | Ga0451807_1468043_16_843 | 274 |
| 706 | 3300041511 | Ga0451855_0216231 | Ga0451855_0216231_302_1135 | 274 |
| 707 | 3300044673 | Ga0453683_0014712 | Ga0453683_0014712_1998_2825 | 274 |
| 708 | 3300045051 | Ga0451576_0037377 | Ga0451576_0037377_3535_4362 | 274 |
| 709 | 3300046459 | Ga0495629_0175228 | Ga0495629_0175228_457_1281 | 274 |
| 710 | 3300046460 | Ga0495638_0000634 | Ga0495638_0000634_16154_16978 | 274 |
| 711 | 3300046474 | Ga0495605_0016147 | Ga0495605_0016147_436_1260 | 274 |
| 712 | 3300046476 | Ga0495662_0002911 | Ga0495662_0002911_1919_2743 | 274 |
| 713 | 3300046507 | Ga0495606_0008031 | Ga0495606_0008031_4699_5523 | 274 |
| 714 | 3300046519 | Ga0495632_0061726 | Ga0495632_0061726_744_1568 | 274 |
| 715 | 3300046524 | Ga0495648_0073693 | Ga0495648_0073693_65_889 | 274 |
| 716 | 3300046529 | Ga0495652_0176058 | Ga0495652_0176058_627_1451 | 274 |
| 717 | 3300046536 | Ga0495587_0106087 | Ga0495587_0106087_597_1421 | 274 |
| 718 | 3300046538 | Ga0495609_0074646 | Ga0495609_0074646_496_1320 | 274 |
| 719 | 3300046616 | Ga0495668_0105978 | Ga0495668_0105978_507_1331 | 274 |
| 720 | 3300046660 | Ga0495625_0109913 | Ga0495625_0109913_828_1652 | 274 |
| 721 | 3300046675 | Ga0495657_0043948 | Ga0495657_0043948_2103_2927 | 274 |
| 722 | 3300046691 | Ga0495670_0077759 | Ga0495670_0077759_517_1341 | 274 |
| 723 | 3300046809 | Ga0495600_0008229 | Ga0495600_0008229_891_1715 | 274 |
| 724 | 3300046810 | Ga0495660_0033073 | Ga0495660_0033073_1646_2470 | 274 |
| 725 | 3300047317 | Ga0495604_0042947 | Ga0495604_0042947_2683_3507 | 274 |
| 726 | 3300047323 | Ga0495683_0079008 | Ga0495683_0079008_457_1281 | 274 |
| 727 | 3300048905 | Ga0496102_0020537 | Ga0496102_0020537_15_842 | 274 |
| 728 | 3300048906 | Ga0496103_0022451 | Ga0496103_0022451_726_1553 | 274 |
| 729 | 3300048910 | Ga0496107_0193890 | Ga0496107_0193890_398_1225 | 274 |
| 730 | 3300048912 | Ga0496109_0038003 | Ga0496109_0038003_326_1153 | 274 |
| 731 | 3300048914 | Ga0496111_0338320 | Ga0496111_0338320_51_878 | 274 |
| 732 | 3300048924 | Ga0496121_0097455 | Ga0496121_0097455_120_944 | 274 |
| 733 | 3300048927 | Ga0496124_0026109 | Ga0496124_0026109_1534_2358 | 274 |
| 734 | 3300053085 | Ga0495619_0012995 | Ga0495619_0012995_1157_1981 | 274 |
| 735 | 3300053086 | Ga0500578_0064397 | Ga0500578_0064397_880_1704 | 274 |
| 736 | 3300053139 | Ga0500568_0000543 | Ga0500568_0000543_20797_21621 | 274 |
| 737 | 3300053148 | Ga0500590_000074 | Ga0500590_000074_6146_6970 | 274 |
| 738 | iso_pu_bacteria | 2508501050 | 2508727659 | 274 |
| 739 | iso_pu_bacteria | 2508501114 | 2509077361 | 274 |
| 740 | iso_pu_bacteria | 2512875016 | 2512934468 | 274 |
| 741 | iso_pu_bacteria | 2513237090 | 2513609511 | 274 |
| 742 | iso_pu_bacteria | 2513237305 | 2514422093 | 274 |
| 743 | iso_pu_bacteria | 2537561587 | 2537876396 | 274 |
| 744 | iso_pu_bacteria | 2554235003 | 2554244582 | 274 |
| 745 | iso_pu_bacteria | 2558860242 | 2559297578 | 274 |
| 746 | iso_pu_bacteria | 2588253730 | 2588520638 | 274 |
| 747 | iso_pu_bacteria | 2599185210 | 2599604886 | 274 |
| 748 | iso_pu_bacteria | 2599185236 | 2599719981 | 274 |
| 749 | iso_pu_bacteria | 2600255279 | 2601612879 | 274 |
| 750 | iso_pu_bacteria | 2600255308 | 2601749608 | 274 |
| 751 | iso_pu_bacteria | 2643221564 | 2643839603 | 274 |
| 752 | iso_pu_bacteria | 2643221582 | 2643922171 | 274 |
| 753 | iso_pu_bacteria | 2643221693 | 2644523220 | 274 |
| 754 | iso_pu_bacteria | 2693429783 | 2694628509 | 274 |
| 755 | iso_pu_bacteria | 2693429784 | 2694640592 | 274 |
| 756 | iso_pu_bacteria | 2721755686 | 2723572580 | 274 |
| 757 | iso_pu_bacteria | 2738541317 | 2738944600 | 274 |
| 758 | iso_pu_bacteria | 2773857925 | 2774869155 | 274 |
| 759 | iso_pu_bacteria | 2775506901 | 2776258387 | 274 |
| 760 | iso_pu_bacteria | 2808606387 | 2808989934 | 274 |
| 761 | iso_pu_bacteria | 2818991439 | 2819557621 | 274 |
| 762 | iso_pu_bacteria | 2835312727 | 2835317457 | 274 |
| 763 | iso_pu_bacteria | 2838675328 | 2838678844 | 274 |
| 764 | iso_pu_bacteria | 2838714209 | 2838717795 | 274 |
| 765 | iso_pu_bacteria | 2838719591 | 2838723141 | 274 |
| 766 | iso_pu_bacteria | 2838724970 | 2838728512 | 274 |
| 767 | iso_pu_bacteria | 2841846520 | 2841849925 | 274 |
| 768 | iso_pu_bacteria | 2841859092 | 2841863728 | 274 |
| 769 | iso_pu_bacteria | 2842124991 | 2842128397 | 274 |
| 770 | iso_pu_bacteria | 2842130223 | 2842134005 | 274 |
| 771 | iso_pu_bacteria | 2842152218 | 2842155731 | 274 |
| 772 | iso_pu_bacteria | 2842170452 | 2842174041 | 274 |
| 773 | iso_pu_bacteria | 2842175837 | 2842179619 | 274 |
| 774 | iso_pu_bacteria | 2842187318 | 2842191140 | 274 |
| 775 | iso_pu_bacteria | 2842211629 | 2842215455 | 274 |
| 776 | iso_pu_bacteria | 2842224351 | 2842227906 | 274 |
| 777 | iso_pu_bacteria | 2842515876 | 2842520510 | 274 |
| 778 | iso_pu_bacteria | 2856364286 | 2856371242 | 274 |
| 779 | iso_pu_bacteria | 2857349434 | 2857354338 | 274 |
| 780 | iso_pu_bacteria | 2869285874 | 2869292465 | 274 |
| 781 | iso_pu_bacteria | 2871429161 | 2871429280 | 274 |
| 782 | iso_pu_bacteria | 2874146452 | 2874154186 | 274 |
| 783 | iso_pu_bacteria | 2874155637 | 2874161688 | 274 |
| 784 | iso_pu_bacteria | 2876363079 | 2876363270 | 274 |
| 785 | iso_pu_bacteria | 2876377896 | 2876379931 | 274 |
| 786 | iso_pu_bacteria | 2876413966 | 2876419870 | 274 |
| 787 | iso_pu_bacteria | 2878745973 | 2878752808 | 274 |
| 788 | iso_pu_bacteria | 2882456835 | 2882457615 | 274 |
| 789 | iso_pu_bacteria | 2884298095 | 2884301216 | 274 |
| 790 | iso_pu_bacteria | 2888350351 | 2888352276 | 274 |
| 791 | iso_pu_bacteria | 2889016732 | 2889021029 | 274 |
| 792 | iso_pu_bacteria | 2894232714 | 2894236160 | 274 |
| 793 | iso_pu_bacteria | 2899792073 | 2899793791 | 274 |
| 794 | iso_pu_bacteria | 2899845264 | 2899847624 | 274 |
| 795 | iso_pu_bacteria | 2903448605 | 2903454655 | 274 |
| 796 | iso_pu_bacteria | 2903492973 | 2903494907 | 274 |
| 797 | iso_pu_bacteria | 2903521522 | 2903525220 | 274 |
| 798 | iso_pu_bacteria | 2903528002 | 2903532035 | 274 |
| 799 | iso_pu_bacteria | 2906308376 | 2906315199 | 274 |
| 800 | iso_pu_bacteria | 2906321335 | 2906321455 | 274 |
| 801 | iso_pu_bacteria | 2906354277 | 2906354988 | 274 |
| 802 | iso_pu_bacteria | 2913308742 | 2913309221 | 274 |
| 803 | iso_pu_bacteria | 2919114240 | 2919118075 | 274 |
| 804 | iso_pu_bacteria | 2922130491 | 2922136777 | 274 |
| 805 | iso_pu_bacteria | 2926754445 | 2926757840 | 274 |
| 806 | iso_pu_bacteria | 2926760298 | 2926764536 | 274 |
| 807 | iso_pu_bacteria | 2933006813 | 2933006838 | 274 |
| 808 | iso_pu_bacteria | 2933011516 | 2933012063 | 274 |
| 809 | iso_pu_bacteria | 2933594066 | 2933597323 | 274 |
| 810 | iso_pu_bacteria | 2937813078 | 2937821741 | 274 |
| 811 | iso_pu_bacteria | 2937822353 | 2937826016 | 274 |
| 812 | iso_pu_bacteria | 2937848649 | 2937849836 | 274 |
| 813 | iso_pu_bacteria | 2938014810 | 2938016932 | 274 |
| 814 | iso_pu_bacteria | 2958100919 | 2958101452 | 274 |
| 815 | iso_pu_bacteria | 2958130278 | 2958136865 | 274 |
| 816 | iso_pu_bacteria | 2958172287 | 2958173747 | 274 |
| 817 | iso_pu_bacteria | 2958179912 | 2958186748 | 274 |
| 818 | iso_pu_bacteria | 2961077736 | 2961085249 | 274 |
| 819 | iso_pu_bacteria | 2963644680 | 2963644730 | 274 |
| 820 | iso_pu_bacteria | 2965119406 | 2965122422 | 274 |
| 821 | iso_pu_bacteria | 2968083720 | 2968088994 | 274 |
| 822 | iso_pu_bacteria | 2977843712 | 2977850034 | 274 |
| 823 | iso_pu_bacteria | 2977922695 | 2977925380 | 274 |
| 824 | iso_pu_bacteria | 2977971508 | 2977977363 | 274 |
| 825 | iso_pu_bacteria | 2977986579 | 2977987349 | 274 |
| 826 | iso_pu_bacteria | 2979089926 | 2979090358 | 274 |
| 827 | iso_pu_bacteria | 2979095461 | 2979095884 | 274 |
| 828 | iso_pu_bacteria | 2979100975 | 2979102663 | 274 |
| 829 | iso_pu_bacteria | 2979710463 | 2979712339 | 274 |
| 830 | iso_pu_bacteria | 2979742915 | 2979745168 | 274 |
| 831 | iso_pu_bacteria | 2984509177 | 2984509451 | 274 |
| 832 | iso_pu_bacteria | 2984518228 | 2984519849 | 274 |
| 833 | iso_pu_bacteria | 2984537506 | 2984537785 | 274 |
| 834 | iso_pu_bacteria | 2984601300 | 2984604527 | 274 |
| 835 | iso_pu_bacteria | 2987636660 | 2987642253 | 274 |
| 836 | iso_pu_bacteria | 2987652177 | 2987656385 | 274 |
| 837 | iso_pu_bacteria | 3004211236 | 3004216699 | 274 |
| 838 | iso_pu_bacteria | 3004218560 | 3004219732 | 274 |
| 839 | iso_pu_bacteria | 637000159 | 637077639 | 274 |
| 840 | iso_pu_bacteria | 650716007 | 650844017 | 274 |
| 841 | iso_pu_bacteria | 8003570095 | 8003574462 | 274 |
| 842 | iso_pu_bacteria | 8004387939 | 8004395139 | 274 |
| 843 | iso_pu_bacteria | 8004640170 | 8004646919 | 274 |
| 844 | iso_pu_bacteria | 8004714634 | 8004721460 | 274 |
| 845 | iso_pu_bacteria | 8054460903 | 8054463549 | 274 |
| 846 | 3300001979 | JGI24740J21852_10045024 | JGI24740J21852_100450242 | 275 |
| 847 | 3300003762 | Ga0055542_1000625 | Ga0055542_10006254 | 275 |
| 848 | 3300005459 | Ga0068867_100103872 | Ga0068867_1001038722 | 275 |
| 849 | 3300005616 | Ga0068852_100509436 | Ga0068852_1005094362 | 275 |
| 850 | 3300006048 | Ga0075363_100104619 | Ga0075363_1001046192 | 275 |
| 851 | 3300006051 | Ga0075364_10033083 | Ga0075364_100330834 | 275 |
| 852 | 3300009174 | Ga0105241_10152731 | Ga0105241_101527312 | 275 |
| 853 | 3300014969 | Ga0157376_10261079 | Ga0157376_102610792 | 275 |
| 854 | 3300021361 | Ga0213872_10000023 | Ga0213872_1000002348 | 275 |
| 855 | 3300025254 | Ga0209148_1000032 | Ga0209148_100003249 | 275 |
| 856 | 3300025272 | Ga0209455_1000098 | Ga0209455_1000098140 | 275 |
| 857 | 3300025907 | Ga0207645_10066091 | Ga0207645_100660913 | 275 |
| 858 | 3300025919 | Ga0207657_10074778 | Ga0207657_100747782 | 275 |
| 859 | 3300025935 | Ga0207709_10324441 | Ga0207709_103244412 | 275 |
| 860 | 3300026089 | Ga0207648_10147107 | Ga0207648_101471072 | 275 |
| 861 | 3300026089 | Ga0207648_10215624 | Ga0207648_102156242 | 275 |
| 862 | 3300026142 | Ga0207698_10107153 | Ga0207698_101071533 | 275 |
| 863 | 3300028379 | Ga0268266_10125430 | Ga0268266_101254302 | 275 |
| 864 | 3300039447 | Ga0436361_0060434 | Ga0436361_0060434_116266_117099 | 275 |
| 865 | 3300046460 | Ga0495638_0241188 | Ga0495638_0241188_49_885 | 275 |
| 866 | 3300046660 | Ga0495625_0034062 | Ga0495625_0034062_86_922 | 275 |
| 867 | 3300047472 | Ga0495686_0131029 | Ga0495686_0131029_402_1238 | 275 |
| 868 | 3300048924 | Ga0496121_0000180 | Ga0496121_0000180_76023_76859 | 275 |
| 869 | 3300050491 | nmdc:mga00v17_94859_c1 | nmdc:mga00v17_94859_c1_666_1499 | 275 |
| 870 | 3300050492 | nmdc:mga0yw44_155727_c1 | nmdc:mga0yw44_155727_c1_30_863 | 275 |
| 871 | 3300050492 | nmdc:mga0yw44_232528_c1 | nmdc:mga0yw44_232528_c1_309_1145 | 275 |
| 872 | 3300053139 | Ga0500568_0040675 | Ga0500568_0040675_671_1504 | 275 |
| 873 | 3300053727 | Ga0500611_014440 | Ga0500611_014440_532_1368 | 275 |
| 874 | 3300059423 | Ga0590074_021251 | Ga0590074_021251_97_942 | 275 |
| 875 | iso_pu_bacteria | 2599185301 | 2599935748 | 275 |
| 876 | iso_pu_bacteria | 2687453129 | 2687580809 | 275 |
| 877 | iso_pu_bacteria | 2838736955 | 2838737238 | 275 |
| 878 | iso_pu_bacteria | 2841840854 | 2841842393 | 275 |
| 879 | iso_pu_bacteria | 2842140634 | 2842142173 | 275 |
| 880 | iso_pu_bacteria | 2889010040 | 2889014266 | 275 |
| 881 | iso_pu_bacteria | 2968117919 | 2968121588 | 275 |
| 882 | iso_pu_bacteria | 2977942078 | 2977943647 | 275 |
| 883 | iso_pu_bacteria | 3004203850 | 3004210339 | 275 |
| 884 | 3300001989 | JGI24739J22299_10005813 | JGI24739J22299_100058135 | 276 |
| 885 | 3300003771 | Ga0055526_1003358 | Ga0055526_10033586 | 276 |
| 886 | 3300003773 | Ga0055537_1000356 | Ga0055537_10003569 | 276 |
| 887 | 3300003775 | Ga0055524_1000213 | Ga0055524_100021324 | 276 |
| 888 | 3300003784 | Ga0055534_1008979 | Ga0055534_10089792 | 276 |
| 889 | 3300003790 | Ga0055528_1004586 | Ga0055528_10045865 | 276 |
| 890 | 3300005327 | Ga0070658_10166017 | Ga0070658_101660172 | 276 |
| 891 | 3300005331 | Ga0070670_100000061 | Ga0070670_10000006150 | 276 |
| 892 | 3300005356 | Ga0070674_100023406 | Ga0070674_1000234063 | 276 |
| 893 | 3300005539 | Ga0068853_100103622 | Ga0068853_1001036222 | 276 |
| 894 | 3300005563 | Ga0068855_100653813 | Ga0068855_1006538132 | 276 |
| 895 | 3300005614 | Ga0068856_100261907 | Ga0068856_1002619072 | 276 |
| 896 | 3300005616 | Ga0068852_100316193 | Ga0068852_1003161932 | 276 |
| 897 | 3300009545 | Ga0105237_10009556 | Ga0105237_100095565 | 276 |
| 898 | 3300009551 | Ga0105238_10002270 | Ga0105238_1000227011 | 276 |
| 899 | 3300010375 | Ga0105239_10012124 | Ga0105239_100121247 | 276 |
| 900 | 3300010375 | Ga0105239_10059347 | Ga0105239_100593472 | 276 |
| 901 | 3300013105 | Ga0157369_10141283 | Ga0157369_101412833 | 276 |
| 902 | 3300025263 | Ga0209565_1000041 | Ga0209565_100004128 | 276 |
| 903 | 3300025273 | Ga0209673_1000364 | Ga0209673_100036419 | 276 |
| 904 | 3300025291 | Ga0209675_1004149 | Ga0209675_10041497 | 276 |
| 905 | 3300025295 | Ga0209564_1000875 | Ga0209564_100087510 | 276 |
| 906 | 3300025297 | Ga0209758_1003869 | Ga0209758_10038692 | 276 |
| 907 | 3300025299 | Ga0209256_1000003 | Ga0209256_1000003138 | 276 |
| 908 | 3300025904 | Ga0207647_10034917 | Ga0207647_100349174 | 276 |
| 909 | 3300025913 | Ga0207695_10068039 | Ga0207695_100680392 | 276 |
| 910 | 3300025914 | Ga0207671_10164400 | Ga0207671_101644002 | 276 |
| 911 | 3300025919 | Ga0207657_10026933 | Ga0207657_100269333 | 276 |
| 912 | 3300025924 | Ga0207694_10013279 | Ga0207694_100132792 | 276 |
| 913 | 3300025925 | Ga0207650_10000207 | Ga0207650_1000020716 | 276 |
| 914 | 3300025932 | Ga0207690_10081354 | Ga0207690_100813542 | 276 |
| 915 | 3300025937 | Ga0207669_10313464 | Ga0207669_103134642 | 276 |
| 916 | 3300025938 | Ga0207704_10033798 | Ga0207704_100337982 | 276 |
| 917 | 3300025940 | Ga0207691_10016814 | Ga0207691_100168143 | 276 |
| 918 | 3300025960 | Ga0207651_10060537 | Ga0207651_100605372 | 276 |
| 919 | 3300025972 | Ga0207668_10420134 | Ga0207668_104201342 | 276 |
| 920 | 3300026041 | Ga0207639_10061117 | Ga0207639_100611173 | 276 |
| 921 | 3300026142 | Ga0207698_10251386 | Ga0207698_102513862 | 276 |
| 922 | 3300026142 | Ga0207698_10800667 | Ga0207698_108006671 | 276 |
| 923 | 3300046543 | Ga0495645_0129862 | Ga0495645_0129862_637_1473 | 276 |
| 924 | 3300048922 | Ga0496119_0030888 | Ga0496119_0030888_2052_2888 | 276 |
| 925 | 3300048923 | Ga0496120_0004732 | Ga0496120_0004732_840_1676 | 276 |
| 926 | 3300048924 | Ga0496121_0229919 | Ga0496121_0229919_144_992 | 276 |
| 927 | 3300048929 | Ga0496126_0059556 | Ga0496126_0059556_700_1548 | 276 |
| 928 | 3300048929 | Ga0496126_0107840 | Ga0496126_0107840_1153_1989 | 276 |
| 929 | 3300049570 | Ga0501033_0099576 | Ga0501033_0099576_982_1824 | 276 |
| 930 | 3300049571 | Ga0501034_0038350 | Ga0501034_0038350_2577_3419 | 276 |
| 931 | 3300049571 | Ga0501034_0061166 | Ga0501034_0061166_2078_2908 | 276 |
| 932 | 3300049571 | Ga0501034_0092703 | Ga0501034_0092703_1939_2784 | 276 |
| 933 | 3300049571 | Ga0501034_0121215 | Ga0501034_0121215_21_863 | 276 |
| 934 | 3300049574 | Ga0501038_0040126 | Ga0501038_0040126_1332_2174 | 276 |
| 935 | 3300049575 | Ga0501039_0041520 | Ga0501039_0041520_46_888 | 276 |
| 936 | 3300049579 | Ga0501043_0077095 | Ga0501043_0077095_1631_2473 | 276 |
| 937 | 3300049581 | Ga0501047_0506694 | Ga0501047_0506694_41_883 | 276 |
| 938 | 3300049586 | Ga0501070_0077896 | Ga0501070_0077896_1640_2482 | 276 |
| 939 | 3300049823 | Ga0501044_0113991 | Ga0501044_0113991_117_959 | 276 |
| 940 | 3300050493 | nmdc:mga0k408_155389_c1 | nmdc:mga0k408_155389_c1_221_1069 | 276 |
| 941 | 3300053108 | Ga0500562_053643 | Ga0500562_053643_177_1019 | 276 |
| 942 | 3300053139 | Ga0500568_0000116 | Ga0500568_0000116_58587_59417 | 276 |
| 943 | 3300053139 | Ga0500568_0043745 | Ga0500568_0043745_800_1645 | 276 |
| 944 | iso_pu_bacteria | 2977864932 | 2977868316 | 276 |
| 945 | 3300001979 | JGI24740J21852_10028962 | JGI24740J21852_100289622 | 277 |
| 946 | 3300002704 | JGI25155J39150_1000004 | JGI25155J39150_1000004202 | 277 |
| 947 | 3300002704 | JGI25155J39150_1000323 | JGI25155J39150_10003239 | 277 |
| 948 | 3300002705 | JGI25156J39149_1000015 | JGI25156J39149_1000015118 | 277 |
| 949 | 3300002705 | JGI25156J39149_1000897 | JGI25156J39149_10008976 | 277 |
| 950 | 3300002737 | JGI25162J39368_1000199 | JGI25162J39368_100019935 | 277 |
| 951 | 3300002738 | JGI25154J39366_1000026 | JGI25154J39366_1000026130 | 277 |
| 952 | 3300002738 | JGI25154J39366_1000657 | JGI25154J39366_10006577 | 277 |
| 953 | 3300002739 | JGI25158J39367_1003398 | JGI25158J39367_10033983 | 277 |
| 954 | 3300002741 | JGI25157J39369_1000005 | JGI25157J39369_100000561 | 277 |
| 955 | 3300002741 | JGI25157J39369_1000791 | JGI25157J39369_10007917 | 277 |
| 956 | 3300002741 | JGI25157J39369_1001657 | JGI25157J39369_10016576 | 277 |
| 957 | 3300002773 | JGI25152J39213_1002516 | JGI25152J39213_10025166 | 277 |
| 958 | 3300002773 | JGI25152J39213_1004259 | JGI25152J39213_10042594 | 277 |
| 959 | 3300002773 | JGI25152J39213_1008325 | JGI25152J39213_10083251 | 277 |
| 960 | 3300002774 | JGI25150J39212_1000018 | JGI25150J39212_100001885 | 277 |
| 961 | 3300002774 | JGI25150J39212_1006657 | JGI25150J39212_10066573 | 277 |
| 962 | 3300002774 | JGI25150J39212_1008418 | JGI25150J39212_10084182 | 277 |
| 963 | 3300002774 | JGI25150J39212_1009168 | JGI25150J39212_10091682 | 277 |
| 964 | 3300002987 | JGI25159J45721_1000008 | JGI25159J45721_1000008139 | 277 |
| 965 | 3300002987 | JGI25159J45721_1000079 | JGI25159J45721_100007923 | 277 |
| 966 | 3300002987 | JGI25159J45721_1000407 | JGI25159J45721_10004077 | 277 |
| 967 | 3300002987 | JGI25159J45721_1001232 | JGI25159J45721_10012326 | 277 |
| 968 | 3300002987 | JGI25159J45721_1011617 | JGI25159J45721_10116172 | 277 |
| 969 | 3300003187 | JGI25151J46595_10000034 | JGI25151J46595_1000003493 | 277 |
| 970 | 3300003187 | JGI25151J46595_10002080 | JGI25151J46595_100020806 | 277 |
| 971 | 3300003187 | JGI25151J46595_10009811 | JGI25151J46595_100098114 | 277 |
| 972 | 3300003187 | JGI25151J46595_10010876 | JGI25151J46595_100108764 | 277 |
| 973 | 3300003187 | JGI25151J46595_10013943 | JGI25151J46595_100139433 | 277 |
| 974 | 3300003187 | JGI25151J46595_10015475 | JGI25151J46595_100154752 | 277 |
| 975 | 3300003187 | JGI25151J46595_10017735 | JGI25151J46595_100177352 | 277 |
| 976 | 3300003187 | JGI25151J46595_10039673 | JGI25151J46595_100396732 | 277 |
| 977 | 3300003187 | JGI25151J46595_10049082 | JGI25151J46595_100490822 | 277 |
| 978 | 3300003214 | JGI25165J46597_1000019 | JGI25165J46597_1000019211 | 277 |
| 979 | 3300003214 | JGI25165J46597_1000307 | JGI25165J46597_100030714 | 277 |
| 980 | 3300003215 | JGI25153J46596_10004405 | JGI25153J46596_100044056 | 277 |
| 981 | 3300003215 | JGI25153J46596_10006553 | JGI25153J46596_100065536 | 277 |
| 982 | 3300003215 | JGI25153J46596_10022201 | JGI25153J46596_100222012 | 277 |
| 983 | 3300003215 | JGI25153J46596_10022839 | JGI25153J46596_100228393 | 277 |
| 984 | 3300003354 | JGI25160J50197_1000033 | JGI25160J50197_100003336 | 277 |
| 985 | 3300003354 | JGI25160J50197_1000109 | JGI25160J50197_100010924 | 277 |
| 986 | 3300003354 | JGI25160J50197_1000172 | JGI25160J50197_100017243 | 277 |
| 987 | 3300003354 | JGI25160J50197_1005531 | JGI25160J50197_10055315 | 277 |
| 988 | 3300003374 | JGI25161J50226_1000007 | JGI25161J50226_100000786 | 277 |
| 989 | 3300003374 | JGI25161J50226_1000011 | JGI25161J50226_100001124 | 277 |
| 990 | 3300003374 | JGI25161J50226_1000038 | JGI25161J50226_100003888 | 277 |
| 991 | 3300003374 | JGI25161J50226_1000357 | JGI25161J50226_100035721 | 277 |
| 992 | 3300003374 | JGI25161J50226_1010655 | JGI25161J50226_10106551 | 277 |
| 993 | 3300003578 | Ga0006562J51391_1045286 | Ga0006562J51391_10452861 | 277 |
| 994 | 3300003759 | Ga0055525_1000053 | Ga0055525_1000053163 | 277 |
| 995 | 3300003771 | Ga0055526_1000361 | Ga0055526_100036125 | 277 |
| 996 | 3300003771 | Ga0055526_1002672 | Ga0055526_10026726 | 277 |
| 997 | 3300003771 | Ga0055526_1002681 | Ga0055526_10026815 | 277 |
| 998 | 3300003771 | Ga0055526_1003566 | Ga0055526_10035665 | 277 |
| 999 | 3300003771 | Ga0055526_1014546 | Ga0055526_10145463 | 277 |
| 1000 | 3300003775 | Ga0055524_1001146 | Ga0055524_10011465 | 277 |
| 1001 | 3300003775 | Ga0055524_1001377 | Ga0055524_100137712 | 277 |
| 1002 | 3300003775 | Ga0055524_1002351 | Ga0055524_10023518 | 277 |
| 1003 | 3300003775 | Ga0055524_1020238 | Ga0055524_10202382 | 277 |
| 1004 | 3300003775 | Ga0055524_1026321 | Ga0055524_10263211 | 277 |
| 1005 | 3300003781 | Ga0055536_1001937 | Ga0055536_10019376 | 277 |
| 1006 | 3300003781 | Ga0055536_1003918 | Ga0055536_10039182 | 277 |
| 1007 | 3300003781 | Ga0055536_1005157 | Ga0055536_10051577 | 277 |
| 1008 | 3300003790 | Ga0055528_1000433 | Ga0055528_100043314 | 277 |
| 1009 | 3300003790 | Ga0055528_1001020 | Ga0055528_10010203 | 277 |
| 1010 | 3300003790 | Ga0055528_1001206 | Ga0055528_10012068 | 277 |
| 1011 | 3300003790 | Ga0055528_1001875 | Ga0055528_10018755 | 277 |
| 1012 | 3300003790 | Ga0055528_1005560 | Ga0055528_10055604 | 277 |
| 1013 | 3300003790 | Ga0055528_1008511 | Ga0055528_10085116 | 277 |
| 1014 | 3300003790 | Ga0055528_1028327 | Ga0055528_10283272 | 277 |
| 1015 | 3300003791 | Ga0055530_10000763 | Ga0055530_100007634 | 277 |
| 1016 | 3300003791 | Ga0055530_10001299 | Ga0055530_100012997 | 277 |
| 1017 | 3300003791 | Ga0055530_10011055 | Ga0055530_100110552 | 277 |
| 1018 | 3300003792 | Ga0055540_1000324 | Ga0055540_100032430 | 277 |
| 1019 | 3300003792 | Ga0055540_1000504 | Ga0055540_100050425 | 277 |
| 1020 | 3300003792 | Ga0055540_1003695 | Ga0055540_10036953 | 277 |
| 1021 | 3300003792 | Ga0055540_1010512 | Ga0055540_10105122 | 277 |
| 1022 | 3300003792 | Ga0055540_1016977 | Ga0055540_10169772 | 277 |
| 1023 | 3300003794 | Ga0055531_10004306 | Ga0055531_100043067 | 277 |
| 1024 | 3300003794 | Ga0055531_10004903 | Ga0055531_100049036 | 277 |
| 1025 | 3300003794 | Ga0055531_10005891 | Ga0055531_100058914 | 277 |
| 1026 | 3300003856 | Ga0058692_1002714 | Ga0058692_10027145 | 277 |
| 1027 | 3300003856 | Ga0058692_1005559 | Ga0058692_10055592 | 277 |
| 1028 | 3300003856 | Ga0058692_1008272 | Ga0058692_10082722 | 277 |
| 1029 | 3300004625 | Ga0055543_1000026 | Ga0055543_1000026104 | 277 |
| 1030 | 3300004625 | Ga0055543_1000071 | Ga0055543_100007166 | 277 |
| 1031 | 3300004625 | Ga0055543_1000106 | Ga0055543_100010635 | 277 |
| 1032 | 3300005262 | Ga0065165_1000135 | Ga0065165_100013524 | 277 |
| 1033 | 3300005262 | Ga0065165_1000178 | Ga0065165_100017836 | 277 |
| 1034 | 3300005262 | Ga0065165_1007140 | Ga0065165_10071406 | 277 |
| 1035 | 3300005262 | Ga0065165_1018011 | Ga0065165_10180112 | 277 |
| 1036 | 3300005328 | Ga0070676_10156017 | Ga0070676_101560171 | 277 |
| 1037 | 3300005331 | Ga0070670_100002139 | Ga0070670_1000021397 | 277 |
| 1038 | 3300005331 | Ga0070670_100004009 | Ga0070670_10000400912 | 277 |
| 1039 | 3300005331 | Ga0070670_100004917 | Ga0070670_1000049173 | 277 |
| 1040 | 3300005331 | Ga0070670_100024623 | Ga0070670_1000246233 | 277 |
| 1041 | 3300005331 | Ga0070670_100071595 | Ga0070670_1000715953 | 277 |
| 1042 | 3300005333 | Ga0070677_10089624 | Ga0070677_100896241 | 277 |
| 1043 | 3300005334 | Ga0068869_100000007 | Ga0068869_10000000713 | 277 |
| 1044 | 3300005334 | Ga0068869_100011980 | Ga0068869_1000119802 | 277 |
| 1045 | 3300005335 | Ga0070666_10138111 | Ga0070666_101381112 | 277 |
| 1046 | 3300005340 | Ga0070689_100143158 | Ga0070689_1001431582 | 277 |
| 1047 | 3300005347 | Ga0070668_100010303 | Ga0070668_1000103038 | 277 |
| 1048 | 3300005353 | Ga0070669_100009394 | Ga0070669_1000093941 | 277 |
| 1049 | 3300005353 | Ga0070669_100031327 | Ga0070669_1000313273 | 277 |
| 1050 | 3300005353 | Ga0070669_100306936 | Ga0070669_1003069362 | 277 |
| 1051 | 3300005354 | Ga0070675_100008830 | Ga0070675_1000088303 | 277 |
| 1052 | 3300005354 | Ga0070675_100008944 | Ga0070675_1000089444 | 277 |
| 1053 | 3300005355 | Ga0070671_100012661 | Ga0070671_1000126618 | 277 |
| 1054 | 3300005355 | Ga0070671_100304582 | Ga0070671_1003045821 | 277 |
| 1055 | 3300005364 | Ga0070673_100044158 | Ga0070673_1000441582 | 277 |
| 1056 | 3300005364 | Ga0070673_100115291 | Ga0070673_1001152912 | 277 |
| 1057 | 3300005367 | Ga0070667_100001939 | Ga0070667_1000019398 | 277 |
| 1058 | 3300005367 | Ga0070667_100033931 | Ga0070667_1000339314 | 277 |
| 1059 | 3300005367 | Ga0070667_100052380 | Ga0070667_1000523802 | 277 |
| 1060 | 3300005438 | Ga0070701_10109495 | Ga0070701_101094952 | 277 |
| 1061 | 3300005455 | Ga0070663_100123092 | Ga0070663_1001230922 | 277 |
| 1062 | 3300005456 | Ga0070678_100159653 | Ga0070678_1001596532 | 277 |
| 1063 | 3300005456 | Ga0070678_100287784 | Ga0070678_1002877842 | 277 |
| 1064 | 3300005457 | Ga0070662_100032281 | Ga0070662_1000322812 | 277 |
| 1065 | 3300005457 | Ga0070662_100066591 | Ga0070662_1000665913 | 277 |
| 1066 | 3300005459 | Ga0068867_100038765 | Ga0068867_1000387651 | 277 |
| 1067 | 3300005459 | Ga0068867_100189789 | Ga0068867_1001897891 | 277 |
| 1068 | 3300005468 | Ga0070707_100077038 | Ga0070707_1000770383 | 277 |
| 1069 | 3300005471 | Ga0070698_100265986 | Ga0070698_1002659862 | 277 |
| 1070 | 3300005543 | Ga0070672_100024379 | Ga0070672_1000243792 | 277 |
| 1071 | 3300005543 | Ga0070672_100144065 | Ga0070672_1001440652 | 277 |
| 1072 | 3300005548 | Ga0070665_100038392 | Ga0070665_1000383922 | 277 |
| 1073 | 3300005548 | Ga0070665_100187873 | Ga0070665_1001878732 | 277 |
| 1074 | 3300005548 | Ga0070665_100190852 | Ga0070665_1001908521 | 277 |
| 1075 | 3300005548 | Ga0070665_100299133 | Ga0070665_1002991332 | 277 |
| 1076 | 3300005548 | Ga0070665_100468584 | Ga0070665_1004685842 | 277 |
| 1077 | 3300005563 | Ga0068855_100158526 | Ga0068855_1001585262 | 277 |
| 1078 | 3300005577 | Ga0068857_100000676 | Ga0068857_10000067619 | 277 |
| 1079 | 3300005614 | Ga0068856_100173944 | Ga0068856_1001739442 | 277 |
| 1080 | 3300005614 | Ga0068856_100423633 | Ga0068856_1004236332 | 277 |
| 1081 | 3300005617 | Ga0068859_100003514 | Ga0068859_10000351411 | 277 |
| 1082 | 3300005618 | Ga0068864_100001466 | Ga0068864_10000146617 | 277 |
| 1083 | 3300005618 | Ga0068864_100018957 | Ga0068864_1000189573 | 277 |
| 1084 | 3300005618 | Ga0068864_100031537 | Ga0068864_1000315374 | 277 |
| 1085 | 3300005618 | Ga0068864_100305512 | Ga0068864_1003055122 | 277 |
| 1086 | 3300005719 | Ga0068861_100001688 | Ga0068861_10000168812 | 277 |
| 1087 | 3300005719 | Ga0068861_100075375 | Ga0068861_1000753753 | 277 |
| 1088 | 3300005841 | Ga0068863_100001574 | Ga0068863_10000157422 | 277 |
| 1089 | 3300005841 | Ga0068863_100010047 | Ga0068863_10001004712 | 277 |
| 1090 | 3300005841 | Ga0068863_100078212 | Ga0068863_1000782123 | 277 |
| 1091 | 3300005842 | Ga0068858_100013010 | Ga0068858_1000130106 | 277 |
| 1092 | 3300005843 | Ga0068860_100005878 | Ga0068860_10000587810 | 277 |
| 1093 | 3300005843 | Ga0068860_100073368 | Ga0068860_1000733682 | 277 |
| 1094 | 3300005843 | Ga0068860_100140560 | Ga0068860_1001405602 | 277 |
| 1095 | 3300005844 | Ga0068862_100002922 | Ga0068862_10000292210 | 277 |
| 1096 | 3300005844 | Ga0068862_100018133 | Ga0068862_1000181337 | 277 |
| 1097 | 3300005844 | Ga0068862_100072758 | Ga0068862_1000727582 | 277 |
| 1098 | 3300005844 | Ga0068862_100159767 | Ga0068862_1001597672 | 277 |
| 1099 | 3300005937 | Ga0081455_10102813 | Ga0081455_101028132 | 277 |
| 1100 | 3300006038 | Ga0075365_10002874 | Ga0075365_100028744 | 277 |
| 1101 | 3300006038 | Ga0075365_10003514 | Ga0075365_100035146 | 277 |
| 1102 | 3300006042 | Ga0075368_10001283 | Ga0075368_100012832 | 277 |
| 1103 | 3300006042 | Ga0075368_10057189 | Ga0075368_100571892 | 277 |
| 1104 | 3300006042 | Ga0075368_10061687 | Ga0075368_100616872 | 277 |
| 1105 | 3300006048 | Ga0075363_100030258 | Ga0075363_1000302582 | 277 |
| 1106 | 3300006051 | Ga0075364_10000074 | Ga0075364_1000007435 | 277 |
| 1107 | 3300006051 | Ga0075364_10007527 | Ga0075364_100075274 | 277 |
| 1108 | 3300006051 | Ga0075364_10087480 | Ga0075364_100874802 | 277 |
| 1109 | 3300006051 | Ga0075364_10152919 | Ga0075364_101529192 | 277 |
| 1110 | 3300006177 | Ga0075362_10052148 | Ga0075362_100521482 | 277 |
| 1111 | 3300006177 | Ga0075362_10066958 | Ga0075362_100669582 | 277 |
| 1112 | 3300006178 | Ga0075367_10010987 | Ga0075367_100109872 | 277 |
| 1113 | 3300006178 | Ga0075367_10155514 | Ga0075367_101555142 | 277 |
| 1114 | 3300006178 | Ga0075367_10183470 | Ga0075367_101834702 | 277 |
| 1115 | 3300006178 | Ga0075367_10247910 | Ga0075367_102479102 | 277 |
| 1116 | 3300006178 | Ga0075367_10261283 | Ga0075367_102612832 | 277 |
| 1117 | 3300006186 | Ga0075369_10134910 | Ga0075369_101349102 | 277 |
| 1118 | 3300006195 | Ga0075366_10031674 | Ga0075366_100316743 | 277 |
| 1119 | 3300006237 | Ga0097621_100011117 | Ga0097621_1000111173 | 277 |
| 1120 | 3300006358 | Ga0068871_100236521 | Ga0068871_1002365212 | 277 |
| 1121 | 3300006881 | Ga0068865_100028929 | Ga0068865_1000289292 | 277 |
| 1122 | 3300006931 | Ga0097620_100003514 | Ga0097620_10000351411 | 277 |
| 1123 | 3300006946 | Ga0079104_1000063 | Ga0079104_100006334 | 277 |
| 1124 | 3300006946 | Ga0079104_1003309 | Ga0079104_10033097 | 277 |
| 1125 | 3300006946 | Ga0079104_1003311 | Ga0079104_10033118 | 277 |
| 1126 | 3300006946 | Ga0079104_1020326 | Ga0079104_10203262 | 277 |
| 1127 | 3300006948 | Ga0099826_10000045 | Ga0099826_1000004553 | 277 |
| 1128 | 3300009036 | Ga0105244_10014754 | Ga0105244_100147545 | 277 |
| 1129 | 3300009093 | Ga0105240_10000013 | Ga0105240_10000013433 | 277 |
| 1130 | 3300009101 | Ga0105247_10138500 | Ga0105247_101385002 | 277 |
| 1131 | 3300009148 | Ga0105243_10059067 | Ga0105243_100590672 | 277 |
| 1132 | 3300009148 | Ga0105243_10231444 | Ga0105243_102314442 | 277 |
| 1133 | 3300009177 | Ga0105248_10157139 | Ga0105248_101571392 | 277 |
| 1134 | 3300009545 | Ga0105237_10025658 | Ga0105237_100256582 | 277 |
| 1135 | 3300009765 | Ga0123341_1000218 | Ga0123341_100021817 | 277 |
| 1136 | 3300009766 | Ga0123342_1025427 | Ga0123342_10254274 | 277 |
| 1137 | 3300010375 | Ga0105239_10006528 | Ga0105239_100065284 | 277 |
| 1138 | 3300011119 | Ga0105246_10404112 | Ga0105246_104041122 | 277 |
| 1139 | 3300012500 | Ga0157314_1001166 | Ga0157314_10011662 | 277 |
| 1140 | 3300012513 | Ga0157326_1005231 | Ga0157326_10052312 | 277 |
| 1141 | 3300013100 | Ga0157373_10044853 | Ga0157373_100448533 | 277 |
| 1142 | 3300013102 | Ga0157371_10000031 | Ga0157371_10000031187 | 277 |
| 1143 | 3300013102 | Ga0157371_10078481 | Ga0157371_100784812 | 277 |
| 1144 | 3300013104 | Ga0157370_10000836 | Ga0157370_1000083622 | 277 |
| 1145 | 3300013104 | Ga0157370_10004414 | Ga0157370_1000441412 | 277 |
| 1146 | 3300013249 | Ga0171463_1007 | Ga0171463_1007160 | 277 |
| 1147 | 3300013297 | Ga0157378_10061358 | Ga0157378_100613584 | 277 |
| 1148 | 3300013306 | Ga0163162_10125421 | Ga0163162_101254212 | 277 |
| 1149 | 3300013306 | Ga0163162_10665787 | Ga0163162_106657872 | 277 |
| 1150 | 3300013308 | Ga0157375_10306556 | Ga0157375_103065562 | 277 |
| 1151 | 3300013308 | Ga0157375_10366068 | Ga0157375_103660682 | 277 |
| 1152 | 3300014325 | Ga0163163_10001547 | Ga0163163_1000154712 | 277 |
| 1153 | 3300014497 | Ga0182008_10015519 | Ga0182008_100155191 | 277 |
| 1154 | 3300014968 | Ga0157379_10471952 | Ga0157379_104719522 | 277 |
| 1155 | 3300014969 | Ga0157376_10029249 | Ga0157376_100292493 | 277 |
| 1156 | 3300015262 | Ga0182007_10007442 | Ga0182007_100074424 | 277 |
| 1157 | 3300015265 | Ga0182005_1000640 | Ga0182005_10006405 | 277 |
| 1158 | 3300015684 | Ga0183365_10112 | Ga0183365_101122 | 277 |
| 1159 | 3300015690 | Ga0183363_1138 | Ga0183363_11383 | 277 |
| 1160 | 3300021320 | Ga0214544_1000010 | Ga0214544_1000010102 | 277 |
| 1161 | 3300021321 | Ga0214542_1000023 | Ga0214542_1000023150 | 277 |
| 1162 | 3300021321 | Ga0214542_1019691 | Ga0214542_10196913 | 277 |
| 1163 | 3300021327 | Ga0214543_1000019 | Ga0214543_1000019225 | 277 |
| 1164 | 3300021327 | Ga0214543_1000022 | Ga0214543_1000022179 | 277 |
| 1165 | 3300021388 | Ga0213875_10009112 | Ga0213875_100091124 | 277 |
| 1166 | 3300022739 | Ga0228711_1000017 | Ga0228711_1000017120 | 277 |
| 1167 | 3300022740 | Ga0228710_1000005 | Ga0228710_1000005133 | 277 |
| 1168 | 3300025206 | Ga0209435_100009 | Ga0209435_10000960 | 277 |
| 1169 | 3300025206 | Ga0209435_100019 | Ga0209435_100019125 | 277 |
| 1170 | 3300025208 | Ga0209436_100045 | Ga0209436_10004536 | 277 |
| 1171 | 3300025208 | Ga0209436_101207 | Ga0209436_1012072 | 277 |
| 1172 | 3300025230 | Ga0209563_100014 | Ga0209563_100014825 | 277 |
| 1173 | 3300025233 | Ga0209437_100182 | Ga0209437_10018264 | 277 |
| 1174 | 3300025233 | Ga0209437_100204 | Ga0209437_10020458 | 277 |
| 1175 | 3300025245 | Ga0207425_1000035 | Ga0207425_1000035116 | 277 |
| 1176 | 3300025245 | Ga0207425_1001535 | Ga0207425_10015357 | 277 |
| 1177 | 3300025245 | Ga0207425_1001851 | Ga0207425_10018519 | 277 |
| 1178 | 3300025245 | Ga0207425_1030933 | Ga0207425_10309331 | 277 |
| 1179 | 3300025246 | Ga0209646_1000018 | Ga0209646_100001860 | 277 |
| 1180 | 3300025246 | Ga0209646_1000038 | Ga0209646_1000038126 | 277 |
| 1181 | 3300025246 | Ga0209646_1004669 | Ga0209646_10046694 | 277 |
| 1182 | 3300025250 | Ga0209026_1000013 | Ga0209026_1000013184 | 277 |
| 1183 | 3300025250 | Ga0209026_1000043 | Ga0209026_100004360 | 277 |
| 1184 | 3300025250 | Ga0209026_1000048 | Ga0209026_1000048125 | 277 |
| 1185 | 3300025253 | Ga0209677_100728 | Ga0209677_1007285 | 277 |
| 1186 | 3300025256 | Ga0209759_1000007 | Ga0209759_100000760 | 277 |
| 1187 | 3300025256 | Ga0209759_1000038 | Ga0209759_1000038119 | 277 |
| 1188 | 3300025256 | Ga0209759_1000058 | Ga0209759_1000058132 | 277 |
| 1189 | 3300025258 | Ga0209129_1000029 | Ga0209129_1000029116 | 277 |
| 1190 | 3300025258 | Ga0209129_1000050 | Ga0209129_1000050224 | 277 |
| 1191 | 3300025258 | Ga0209129_1000623 | Ga0209129_10006237 | 277 |
| 1192 | 3300025258 | Ga0209129_1000807 | Ga0209129_100080722 | 277 |
| 1193 | 3300025258 | Ga0209129_1001333 | Ga0209129_10013338 | 277 |
| 1194 | 3300025258 | Ga0209129_1004423 | Ga0209129_10044234 | 277 |
| 1195 | 3300025258 | Ga0209129_1011796 | Ga0209129_10117962 | 277 |
| 1196 | 3300025261 | Ga0209233_1000034 | Ga0209233_1000034395 | 277 |
| 1197 | 3300025261 | Ga0209233_1000231 | Ga0209233_100023151 | 277 |
| 1198 | 3300025261 | Ga0209233_1000280 | Ga0209233_100028019 | 277 |
| 1199 | 3300025261 | Ga0209233_1000388 | Ga0209233_100038822 | 277 |
| 1200 | 3300025261 | Ga0209233_1005717 | Ga0209233_10057172 | 277 |
| 1201 | 3300025263 | Ga0209565_1000333 | Ga0209565_10003338 | 277 |
| 1202 | 3300025263 | Ga0209565_1016313 | Ga0209565_10163132 | 277 |
| 1203 | 3300025263 | Ga0209565_1019493 | Ga0209565_10194932 | 277 |
| 1204 | 3300025272 | Ga0209455_1019769 | Ga0209455_10197692 | 277 |
| 1205 | 3300025273 | Ga0209673_1000033 | Ga0209673_1000033140 | 277 |
| 1206 | 3300025273 | Ga0209673_1000050 | Ga0209673_1000050117 | 277 |
| 1207 | 3300025273 | Ga0209673_1000052 | Ga0209673_1000052255 | 277 |
| 1208 | 3300025273 | Ga0209673_1001686 | Ga0209673_10016865 | 277 |
| 1209 | 3300025273 | Ga0209673_1006199 | Ga0209673_10061992 | 277 |
| 1210 | 3300025273 | Ga0209673_1016436 | Ga0209673_10164362 | 277 |
| 1211 | 3300025273 | Ga0209673_1024925 | Ga0209673_10249252 | 277 |
| 1212 | 3300025284 | Ga0209130_1000009 | Ga0209130_1000009157 | 277 |
| 1213 | 3300025284 | Ga0209130_1000017 | Ga0209130_1000017141 | 277 |
| 1214 | 3300025284 | Ga0209130_1000058 | Ga0209130_1000058166 | 277 |
| 1215 | 3300025284 | Ga0209130_1000245 | Ga0209130_10002457 | 277 |
| 1216 | 3300025284 | Ga0209130_1000708 | Ga0209130_100070824 | 277 |
| 1217 | 3300025284 | Ga0209130_1005012 | Ga0209130_10050122 | 277 |
| 1218 | 3300025291 | Ga0209675_1003873 | Ga0209675_10038734 | 277 |
| 1219 | 3300025292 | Ga0209676_1000013 | Ga0209676_1000013263 | 277 |
| 1220 | 3300025292 | Ga0209676_1002248 | Ga0209676_10022486 | 277 |
| 1221 | 3300025292 | Ga0209676_1002662 | Ga0209676_10026626 | 277 |
| 1222 | 3300025292 | Ga0209676_1003354 | Ga0209676_10033544 | 277 |
| 1223 | 3300025292 | Ga0209676_1004193 | Ga0209676_10041937 | 277 |
| 1224 | 3300025292 | Ga0209676_1021737 | Ga0209676_10217372 | 277 |
| 1225 | 3300025294 | Ga0209025_1000132 | Ga0209025_100013290 | 277 |
| 1226 | 3300025294 | Ga0209025_1000153 | Ga0209025_100015334 | 277 |
| 1227 | 3300025294 | Ga0209025_1000227 | Ga0209025_100022759 | 277 |
| 1228 | 3300025294 | Ga0209025_1001158 | Ga0209025_10011588 | 277 |
| 1229 | 3300025294 | Ga0209025_1001511 | Ga0209025_100151117 | 277 |
| 1230 | 3300025294 | Ga0209025_1004718 | Ga0209025_10047182 | 277 |
| 1231 | 3300025294 | Ga0209025_1006680 | Ga0209025_10066805 | 277 |
| 1232 | 3300025294 | Ga0209025_1009265 | Ga0209025_10092653 | 277 |
| 1233 | 3300025294 | Ga0209025_1010428 | Ga0209025_10104284 | 277 |
| 1234 | 3300025294 | Ga0209025_1020559 | Ga0209025_10205593 | 277 |
| 1235 | 3300025294 | Ga0209025_1033375 | Ga0209025_10333752 | 277 |
| 1236 | 3300025294 | Ga0209025_1035476 | Ga0209025_10354763 | 277 |
| 1237 | 3300025294 | Ga0209025_1041425 | Ga0209025_10414252 | 277 |
| 1238 | 3300025294 | Ga0209025_1081078 | Ga0209025_10810781 | 277 |
| 1239 | 3300025295 | Ga0209564_1000013 | Ga0209564_1000013590 | 277 |
| 1240 | 3300025295 | Ga0209564_1000236 | Ga0209564_100023618 | 277 |
| 1241 | 3300025295 | Ga0209564_1000795 | Ga0209564_10007955 | 277 |
| 1242 | 3300025295 | Ga0209564_1001920 | Ga0209564_10019201 | 277 |
| 1243 | 3300025295 | Ga0209564_1002543 | Ga0209564_10025435 | 277 |
| 1244 | 3300025295 | Ga0209564_1021554 | Ga0209564_10215543 | 277 |
| 1245 | 3300025295 | Ga0209564_1030732 | Ga0209564_10307322 | 277 |
| 1246 | 3300025297 | Ga0209758_1000105 | Ga0209758_100010584 | 277 |
| 1247 | 3300025297 | Ga0209758_1000299 | Ga0209758_100029969 | 277 |
| 1248 | 3300025297 | Ga0209758_1000672 | Ga0209758_100067214 | 277 |
| 1249 | 3300025297 | Ga0209758_1002015 | Ga0209758_10020158 | 277 |
| 1250 | 3300025297 | Ga0209758_1006091 | Ga0209758_10060914 | 277 |
| 1251 | 3300025297 | Ga0209758_1039062 | Ga0209758_10390622 | 277 |
| 1252 | 3300025297 | Ga0209758_1048222 | Ga0209758_10482222 | 277 |
| 1253 | 3300025298 | Ga0209050_1000008 | Ga0209050_1000008263 | 277 |
| 1254 | 3300025298 | Ga0209050_1001244 | Ga0209050_10012444 | 277 |
| 1255 | 3300025298 | Ga0209050_1007330 | Ga0209050_10073304 | 277 |
| 1256 | 3300025298 | Ga0209050_1009958 | Ga0209050_10099583 | 277 |
| 1257 | 3300025298 | Ga0209050_1015111 | Ga0209050_10151113 | 277 |
| 1258 | 3300025298 | Ga0209050_1026031 | Ga0209050_10260312 | 277 |
| 1259 | 3300025299 | Ga0209256_1000211 | Ga0209256_100021181 | 277 |
| 1260 | 3300025299 | Ga0209256_1000250 | Ga0209256_100025064 | 277 |
| 1261 | 3300025299 | Ga0209256_1000279 | Ga0209256_100027962 | 277 |
| 1262 | 3300025299 | Ga0209256_1000563 | Ga0209256_100056329 | 277 |
| 1263 | 3300025299 | Ga0209256_1002290 | Ga0209256_100229016 | 277 |
| 1264 | 3300025299 | Ga0209256_1003062 | Ga0209256_10030624 | 277 |
| 1265 | 3300025299 | Ga0209256_1021436 | Ga0209256_10214362 | 277 |
| 1266 | 3300025299 | Ga0209256_1038815 | Ga0209256_10388152 | 277 |
| 1267 | 3300025302 | Ga0207426_1000006 | Ga0207426_1000006140 | 277 |
| 1268 | 3300025302 | Ga0207426_1000041 | Ga0207426_100004195 | 277 |
| 1269 | 3300025302 | Ga0207426_1000070 | Ga0207426_1000070250 | 277 |
| 1270 | 3300025302 | Ga0207426_1000091 | Ga0207426_1000091133 | 277 |
| 1271 | 3300025302 | Ga0207426_1000131 | Ga0207426_1000131166 | 277 |
| 1272 | 3300025302 | Ga0207426_1001967 | Ga0207426_10019676 | 277 |
| 1273 | 3300025303 | Ga0209051_1000005 | Ga0209051_1000005263 | 277 |
| 1274 | 3300025303 | Ga0209051_1000118 | Ga0209051_1000118107 | 277 |
| 1275 | 3300025303 | Ga0209051_1001915 | Ga0209051_10019153 | 277 |
| 1276 | 3300025303 | Ga0209051_1003142 | Ga0209051_100314212 | 277 |
| 1277 | 3300025303 | Ga0209051_1005999 | Ga0209051_10059995 | 277 |
| 1278 | 3300025303 | Ga0209051_1017785 | Ga0209051_10177852 | 277 |
| 1279 | 3300025303 | Ga0209051_1026475 | Ga0209051_10264753 | 277 |
| 1280 | 3300025303 | Ga0209051_1033218 | Ga0209051_10332182 | 277 |
| 1281 | 3300025304 | Ga0209257_1000048 | Ga0209257_1000048263 | 277 |
| 1282 | 3300025304 | Ga0209257_1002408 | Ga0209257_10024085 | 277 |
| 1283 | 3300025304 | Ga0209257_1002982 | Ga0209257_100298217 | 277 |
| 1284 | 3300025304 | Ga0209257_1003928 | Ga0209257_10039287 | 277 |
| 1285 | 3300025304 | Ga0209257_1005759 | Ga0209257_10057592 | 277 |
| 1286 | 3300025304 | Ga0209257_1011541 | Ga0209257_10115411 | 277 |
| 1287 | 3300025304 | Ga0209257_1015344 | Ga0209257_10153443 | 277 |
| 1288 | 3300025899 | Ga0207642_10050764 | Ga0207642_100507642 | 277 |
| 1289 | 3300025907 | Ga0207645_10009537 | Ga0207645_100095376 | 277 |
| 1290 | 3300025908 | Ga0207643_10091362 | Ga0207643_100913622 | 277 |
| 1291 | 3300025913 | Ga0207695_10000044 | Ga0207695_10000044390 | 277 |
| 1292 | 3300025914 | Ga0207671_10000043 | Ga0207671_1000004398 | 277 |
| 1293 | 3300025922 | Ga0207646_10368222 | Ga0207646_103682222 | 277 |
| 1294 | 3300025923 | Ga0207681_10021049 | Ga0207681_100210494 | 277 |
| 1295 | 3300025925 | Ga0207650_10054175 | Ga0207650_100541754 | 277 |
| 1296 | 3300025925 | Ga0207650_10095453 | Ga0207650_100954533 | 277 |
| 1297 | 3300025925 | Ga0207650_10139975 | Ga0207650_101399753 | 277 |
| 1298 | 3300025926 | Ga0207659_10016896 | Ga0207659_100168963 | 277 |
| 1299 | 3300025926 | Ga0207659_10254334 | Ga0207659_102543342 | 277 |
| 1300 | 3300025931 | Ga0207644_10080691 | Ga0207644_100806912 | 277 |
| 1301 | 3300025931 | Ga0207644_10104340 | Ga0207644_101043403 | 277 |
| 1302 | 3300025931 | Ga0207644_10324825 | Ga0207644_103248252 | 277 |
| 1303 | 3300025933 | Ga0207706_10008309 | Ga0207706_1000830910 | 277 |
| 1304 | 3300025933 | Ga0207706_10047586 | Ga0207706_100475864 | 277 |
| 1305 | 3300025935 | Ga0207709_10169285 | Ga0207709_101692852 | 277 |
| 1306 | 3300025935 | Ga0207709_10215432 | Ga0207709_102154322 | 277 |
| 1307 | 3300025936 | Ga0207670_10107346 | Ga0207670_101073462 | 277 |
| 1308 | 3300025940 | Ga0207691_10000111 | Ga0207691_1000011138 | 277 |
| 1309 | 3300025941 | Ga0207711_10037209 | Ga0207711_100372094 | 277 |
| 1310 | 3300025941 | Ga0207711_10041717 | Ga0207711_100417174 | 277 |
| 1311 | 3300025941 | Ga0207711_10054634 | Ga0207711_100546343 | 277 |
| 1312 | 3300025941 | Ga0207711_10122206 | Ga0207711_101222062 | 277 |
| 1313 | 3300025942 | Ga0207689_10000142 | Ga0207689_1000014231 | 277 |
| 1314 | 3300025942 | Ga0207689_10026848 | Ga0207689_100268482 | 277 |
| 1315 | 3300025942 | Ga0207689_10473176 | Ga0207689_104731762 | 277 |
| 1316 | 3300025960 | Ga0207651_10255704 | Ga0207651_102557042 | 277 |
| 1317 | 3300025961 | Ga0207712_10263753 | Ga0207712_102637531 | 277 |
| 1318 | 3300025972 | Ga0207668_10013845 | Ga0207668_100138454 | 277 |
| 1319 | 3300025972 | Ga0207668_10015772 | Ga0207668_100157722 | 277 |
| 1320 | 3300025986 | Ga0207658_10117353 | Ga0207658_101173532 | 277 |
| 1321 | 3300025986 | Ga0207658_10229732 | Ga0207658_102297322 | 277 |
| 1322 | 3300026035 | Ga0207703_10000195 | Ga0207703_100001954 | 277 |
| 1323 | 3300026035 | Ga0207703_10255494 | Ga0207703_102554942 | 277 |
| 1324 | 3300026041 | Ga0207639_10160953 | Ga0207639_101609532 | 277 |
| 1325 | 3300026041 | Ga0207639_10270663 | Ga0207639_102706632 | 277 |
| 1326 | 3300026075 | Ga0207708_10111582 | Ga0207708_101115822 | 277 |
| 1327 | 3300026088 | Ga0207641_10006316 | Ga0207641_100063162 | 277 |
| 1328 | 3300026088 | Ga0207641_10018427 | Ga0207641_100184274 | 277 |
| 1329 | 3300026088 | Ga0207641_10761890 | Ga0207641_107618901 | 277 |
| 1330 | 3300026089 | Ga0207648_10005172 | Ga0207648_1000517213 | 277 |
| 1331 | 3300026089 | Ga0207648_10016833 | Ga0207648_100168335 | 277 |
| 1332 | 3300026095 | Ga0207676_10001696 | Ga0207676_100016969 | 277 |
| 1333 | 3300026095 | Ga0207676_10002462 | Ga0207676_100024628 | 277 |
| 1334 | 3300026095 | Ga0207676_10177500 | Ga0207676_101775002 | 277 |
| 1335 | 3300026116 | Ga0207674_10002098 | Ga0207674_1000209823 | 277 |
| 1336 | 3300026118 | Ga0207675_100004037 | Ga0207675_10000403711 | 277 |
| 1337 | 3300026118 | Ga0207675_100262624 | Ga0207675_1002626242 | 277 |
| 1338 | 3300026121 | Ga0207683_10026873 | Ga0207683_100268732 | 277 |
| 1339 | 3300026121 | Ga0207683_10224210 | Ga0207683_102242102 | 277 |
| 1340 | 3300026121 | Ga0207683_10709857 | Ga0207683_107098571 | 277 |
| 1341 | 3300026142 | Ga0207698_10490349 | Ga0207698_104903492 | 277 |
| 1342 | 3300027111 | Ga0209281_1000082 | Ga0209281_100008281 | 277 |
| 1343 | 3300027111 | Ga0209281_1000110 | Ga0209281_100011035 | 277 |
| 1344 | 3300027111 | Ga0209281_1001180 | Ga0209281_100118024 | 277 |
| 1345 | 3300027312 | Ga0209371_1000003 | Ga0209371_1000003351 | 277 |
| 1346 | 3300027312 | Ga0209371_1000283 | Ga0209371_10002837 | 277 |
| 1347 | 3300027312 | Ga0209371_1004798 | Ga0209371_10047982 | 277 |
| 1348 | 3300027666 | Ga0209282_1000006 | Ga0209282_1000006103 | 277 |
| 1349 | 3300027666 | Ga0209282_1000210 | Ga0209282_100021019 | 277 |
| 1350 | 3300028379 | Ga0268266_10008596 | Ga0268266_100085968 | 277 |
| 1351 | 3300028379 | Ga0268266_10044304 | Ga0268266_100443043 | 277 |
| 1352 | 3300028379 | Ga0268266_10066625 | Ga0268266_100666253 | 277 |
| 1353 | 3300028379 | Ga0268266_10318960 | Ga0268266_103189602 | 277 |
| 1354 | 3300028380 | Ga0268265_10002425 | Ga0268265_100024259 | 277 |
| 1355 | 3300028380 | Ga0268265_10021422 | Ga0268265_100214222 | 277 |
| 1356 | 3300028380 | Ga0268265_10171638 | Ga0268265_101716382 | 277 |
| 1357 | 3300028381 | Ga0268264_10000606 | Ga0268264_1000060625 | 277 |
| 1358 | 3300028381 | Ga0268264_10057162 | Ga0268264_100571622 | 277 |
| 1359 | 3300028381 | Ga0268264_10248685 | Ga0268264_102486852 | 277 |
| 1360 | 3300028794 | Ga0307515_10000017 | Ga0307515_10000017182 | 277 |
| 1361 | 3300028794 | Ga0307515_10001299 | Ga0307515_1000129925 | 277 |
| 1362 | 3300028794 | Ga0307515_10003849 | Ga0307515_1000384917 | 277 |
| 1363 | 3300028794 | Ga0307515_10019285 | Ga0307515_100192853 | 277 |
| 1364 | 3300028794 | Ga0307515_10057315 | Ga0307515_100573154 | 277 |
| 1365 | 3300028794 | Ga0307515_10061360 | Ga0307515_100613605 | 277 |
| 1366 | 3300030500 | Ga0268256_1000004 | Ga0268256_1000004700 | 277 |
| 1367 | 3300030500 | Ga0268256_1001389 | Ga0268256_10013893 | 277 |
| 1368 | 3300030500 | Ga0268256_1005352 | Ga0268256_10053522 | 277 |
| 1369 | 3300030522 | Ga0307512_10196894 | Ga0307512_101968942 | 277 |
| 1370 | 3300031456 | Ga0307513_10000206 | Ga0307513_1000020612 | 277 |
| 1371 | 3300031456 | Ga0307513_10002736 | Ga0307513_100027365 | 277 |
| 1372 | 3300031456 | Ga0307513_10011846 | Ga0307513_100118464 | 277 |
| 1373 | 3300031507 | Ga0307509_10316479 | Ga0307509_103164792 | 277 |
| 1374 | 3300031548 | Ga0307408_100021734 | Ga0307408_1000217344 | 277 |
| 1375 | 3300031548 | Ga0307408_100213063 | Ga0307408_1002130632 | 277 |
| 1376 | 3300031595 | Ga0265313_10035166 | Ga0265313_100351662 | 277 |
| 1377 | 3300031649 | Ga0307514_10004553 | Ga0307514_100045539 | 277 |
| 1378 | 3300031711 | Ga0265314_10082126 | Ga0265314_100821262 | 277 |
| 1379 | 3300031731 | Ga0307405_10000125 | Ga0307405_100001252 | 277 |
| 1380 | 3300031731 | Ga0307405_10253710 | Ga0307405_102537101 | 277 |
| 1381 | 3300031731 | Ga0307405_10371062 | Ga0307405_103710622 | 277 |
| 1382 | 3300031731 | Ga0307405_10417700 | Ga0307405_104177002 | 277 |
| 1383 | 3300031824 | Ga0307413_10362456 | Ga0307413_103624561 | 277 |
| 1384 | 3300031852 | Ga0307410_10195697 | Ga0307410_101956972 | 277 |
| 1385 | 3300031901 | Ga0307406_10034901 | Ga0307406_100349013 | 277 |
| 1386 | 3300031911 | Ga0307412_10000786 | Ga0307412_1000078612 | 277 |
| 1387 | 3300031911 | Ga0307412_10143313 | Ga0307412_101433132 | 277 |
| 1388 | 3300031911 | Ga0307412_10305232 | Ga0307412_103052322 | 277 |
| 1389 | 3300031967 | Ga0315914_1000003 | Ga0315914_1000003158 | 277 |
| 1390 | 3300033430 | Ga0315913_1000001 | Ga0315913_1000001109 | 277 |
| 1391 | 3300033464 | Ga0315915_1000008 | Ga0315915_1000008178 | 277 |
| 1392 | 3300035691 | Ga0373931_0069965 | Ga0373931_0069965_376_1215 | 277 |
| 1393 | 3300035695 | Ga0373927_0000412 | Ga0373927_0000412_23315_24160 | 277 |
| 1394 | 3300035725 | Ga0373947_0145929 | Ga0373947_0145929_211_1056 | 277 |
| 1395 | 3300036401 | Ga0373937_0138393 | Ga0373937_0138393_1335_2174 | 277 |
| 1396 | 3300037068 | Ga0373925_0001026 | Ga0373925_0001026_7611_8456 | 277 |
| 1397 | 3300037312 | Ga0395899_0000589 | Ga0395899_0000589_34064_34897 | 277 |
| 1398 | 3300037418 | Ga0395900_0000375 | Ga0395900_0000375_47798_48631 | 277 |
| 1399 | 3300037418 | Ga0395900_0011818 | Ga0395900_0011818_1769_2608 | 277 |
| 1400 | 3300037466 | Ga0395898_0000629 | Ga0395898_0000629_15904_16737 | 277 |
| 1401 | 3300037471 | Ga0395905_0000361 | Ga0395905_0000361_15887_16720 | 277 |
| 1402 | 3300037471 | Ga0395905_0015961 | Ga0395905_0015961_5268_6107 | 277 |
| 1403 | 3300037471 | Ga0395905_0109369 | Ga0395905_0109369_1350_2186 | 277 |
| 1404 | 3300037471 | Ga0395905_0131670 | Ga0395905_0131670_1174_2013 | 277 |
| 1405 | 3300037853 | Ga0436364_0174941 | Ga0436364_0174941_4567_5418 | 277 |
| 1406 | 3300038443 | Ga0395901_0000273 | Ga0395901_0000273_15812_16645 | 277 |
| 1407 | 3300038443 | Ga0395901_0074295 | Ga0395901_0074295_1922_2761 | 277 |
| 1408 | 3300041404 | Ga0439436_0003871 | Ga0439436_0003871_3472_4305 | 277 |
| 1409 | 3300041404 | Ga0439436_0061503 | Ga0439436_0061503_181_1014 | 277 |
| 1410 | 3300041411 | Ga0439466_0015456 | Ga0439466_0015456_1668_2501 | 277 |
| 1411 | 3300041413 | Ga0439465_0015623 | Ga0439465_0015623_1440_2273 | 277 |
| 1412 | 3300041491 | Ga0451833_1239942 | Ga0451833_1239942_171_1004 | 277 |
| 1413 | 3300041494 | Ga0451837_1046754 | Ga0451837_1046754_1318_2151 | 277 |
| 1414 | 3300041501 | Ga0451845_0285704 | Ga0451845_0285704_2075_2908 | 277 |
| 1415 | 3300041503 | Ga0451847_0217734 | Ga0451847_0217734_1778_2611 | 277 |
| 1416 | 3300041505 | Ga0451849_0065926 | Ga0451849_0065926_28_861 | 277 |
| 1417 | 3300041507 | Ga0451851_0226558 | Ga0451851_0226558_1958_2791 | 277 |
| 1418 | 3300041509 | Ga0451843_0603985 | Ga0451843_0603985_714_1547 | 277 |
| 1419 | 3300042007 | Ga0439449_0083621 | Ga0439449_0083621_123_956 | 277 |
| 1420 | 3300042122 | Ga0450920_004815 | Ga0450920_004815_228_1061 | 277 |
| 1421 | 3300042146 | Ga0450907_024445 | Ga0450907_024445_62_895 | 277 |
| 1422 | 3300044658 | Ga0466972_0100113 | Ga0466972_0100113_58_894 | 277 |
| 1423 | 3300044683 | Ga0466965_0090576 | Ga0466965_0090576_619_1452 | 277 |
| 1424 | 3300044712 | Ga0453684_0350884 | Ga0453684_0350884_340_1179 | 277 |
| 1425 | 3300044712 | Ga0453684_0362447 | Ga0453684_0362447_263_1120 | 277 |
| 1426 | 3300044735 | Ga0466968_0116997 | Ga0466968_0116997_17_856 | 277 |
| 1427 | 3300044765 | Ga0466970_0173567 | Ga0466970_0173567_103_963 | 277 |
| 1428 | 3300044765 | Ga0466970_0215394 | Ga0466970_0215394_181_1017 | 277 |
| 1429 | 3300045051 | Ga0451576_0157735 | Ga0451576_0157735_1007_1846 | 277 |
| 1430 | 3300046453 | Ga0495627_027745 | Ga0495627_027745_157_990 | 277 |
| 1431 | 3300046457 | Ga0495590_0096732 | Ga0495590_0096732_93_926 | 277 |
| 1432 | 3300046475 | Ga0495639_0130758 | Ga0495639_0130758_84_917 | 277 |
| 1433 | 3300046492 | Ga0495585_0002182 | Ga0495585_0002182_75_908 | 277 |
| 1434 | 3300046492 | Ga0495585_0032209 | Ga0495585_0032209_194_1027 | 277 |
| 1435 | 3300046492 | Ga0495585_0053063 | Ga0495585_0053063_880_1713 | 277 |
| 1436 | 3300046501 | Ga0495607_0078139 | Ga0495607_0078139_345_1178 | 277 |
| 1437 | 3300046506 | Ga0495583_0006812 | Ga0495583_0006812_4430_5263 | 277 |
| 1438 | 3300046507 | Ga0495606_0033446 | Ga0495606_0033446_226_1059 | 277 |
| 1439 | 3300046512 | Ga0495610_0004788 | Ga0495610_0004788_2964_3797 | 277 |
| 1440 | 3300046512 | Ga0495610_0064304 | Ga0495610_0064304_264_1097 | 277 |
| 1441 | 3300046515 | Ga0495620_0009481 | Ga0495620_0009481_4246_5079 | 277 |
| 1442 | 3300046515 | Ga0495620_0092922 | Ga0495620_0092922_85_918 | 277 |
| 1443 | 3300046518 | Ga0495631_0016767 | Ga0495631_0016767_1964_2797 | 277 |
| 1444 | 3300046519 | Ga0495632_0065342 | Ga0495632_0065342_714_1547 | 277 |
| 1445 | 3300046522 | Ga0495643_0009505 | Ga0495643_0009505_1942_2775 | 277 |
| 1446 | 3300046522 | Ga0495643_0040962 | Ga0495643_0040962_423_1256 | 277 |
| 1447 | 3300046522 | Ga0495643_0151207 | Ga0495643_0151207_281_1114 | 277 |
| 1448 | 3300046530 | Ga0495654_0000121 | Ga0495654_0000121_9057_9908 | 277 |
| 1449 | 3300046530 | Ga0495654_0003858 | Ga0495654_0003858_3055_3894 | 277 |
| 1450 | 3300046538 | Ga0495609_0099492 | Ga0495609_0099492_409_1242 | 277 |
| 1451 | 3300046558 | Ga0495633_0037299 | Ga0495633_0037299_1432_2265 | 277 |
| 1452 | 3300046616 | Ga0495668_0020510 | Ga0495668_0020510_995_1828 | 277 |
| 1453 | 3300046616 | Ga0495668_0041859 | Ga0495668_0041859_767_1630 | 277 |
| 1454 | 3300046665 | Ga0495661_0136083 | Ga0495661_0136083_476_1309 | 277 |
| 1455 | 3300046674 | Ga0495588_0000403 | Ga0495588_0000403_9999_10835 | 277 |
| 1456 | 3300046691 | Ga0495670_0034654 | Ga0495670_0034654_981_1814 | 277 |
| 1457 | 3300046694 | Ga0495649_0007419 | Ga0495649_0007419_4119_4952 | 277 |
| 1458 | 3300047469 | Ga0495673_0106801 | Ga0495673_0106801_228_1061 | 277 |
| 1459 | 3300047470 | Ga0495681_0009787 | Ga0495681_0009787_1217_2053 | 277 |
| 1460 | 3300047470 | Ga0495681_0024616 | Ga0495681_0024616_1398_2231 | 277 |
| 1461 | 3300047472 | Ga0495686_0001023 | Ga0495686_0001023_11535_12368 | 277 |
| 1462 | 3300048903 | Ga0496100_0037004 | Ga0496100_0037004_1074_1907 | 277 |
| 1463 | 3300048904 | Ga0496101_0116995 | Ga0496101_0116995_719_1552 | 277 |
| 1464 | 3300048905 | Ga0496102_0425485 | Ga0496102_0425485_88_933 | 277 |
| 1465 | 3300048905 | Ga0496102_0610531 | Ga0496102_0610531_59_892 | 277 |
| 1466 | 3300048909 | Ga0496106_0005081 | Ga0496106_0005081_3890_4723 | 277 |
| 1467 | 3300048914 | Ga0496111_0001276 | Ga0496111_0001276_10671_11522 | 277 |
| 1468 | 3300048915 | Ga0496112_0024574 | Ga0496112_0024574_3108_3953 | 277 |
| 1469 | 3300048915 | Ga0496112_0192983 | Ga0496112_0192983_580_1446 | 277 |
| 1470 | 3300048916 | Ga0496113_0014581 | Ga0496113_0014581_1241_2077 | 277 |
| 1471 | 3300048916 | Ga0496113_0340259 | Ga0496113_0340259_66_905 | 277 |
| 1472 | 3300048918 | Ga0496115_0157399 | Ga0496115_0157399_595_1428 | 277 |
| 1473 | 3300048919 | Ga0496116_0001063 | Ga0496116_0001063_31347_32180 | 277 |
| 1474 | 3300048919 | Ga0496116_0008500 | Ga0496116_0008500_1918_2751 | 277 |
| 1475 | 3300048919 | Ga0496116_0017944 | Ga0496116_0017944_2623_3456 | 277 |
| 1476 | 3300048919 | Ga0496116_0030619 | Ga0496116_0030619_1385_2218 | 277 |
| 1477 | 3300048919 | Ga0496116_0034781 | Ga0496116_0034781_65_901 | 277 |
| 1478 | 3300048919 | Ga0496116_0074355 | Ga0496116_0074355_949_1785 | 277 |
| 1479 | 3300048920 | Ga0496117_0000030 | Ga0496117_0000030_177441_178277 | 277 |
| 1480 | 3300048920 | Ga0496117_0015059 | Ga0496117_0015059_1428_2261 | 277 |
| 1481 | 3300048920 | Ga0496117_0015836 | Ga0496117_0015836_2656_3489 | 277 |
| 1482 | 3300048920 | Ga0496117_0028078 | Ga0496117_0028078_16_849 | 277 |
| 1483 | 3300048920 | Ga0496117_0031765 | Ga0496117_0031765_1828_2661 | 277 |
| 1484 | 3300048920 | Ga0496117_0074188 | Ga0496117_0074188_476_1309 | 277 |
| 1485 | 3300048920 | Ga0496117_0097863 | Ga0496117_0097863_57_890 | 277 |
| 1486 | 3300048920 | Ga0496117_0116420 | Ga0496117_0116420_11_844 | 277 |
| 1487 | 3300048920 | Ga0496117_0144445 | Ga0496117_0144445_51_887 | 277 |
| 1488 | 3300048921 | Ga0496118_0001480 | Ga0496118_0001480_1855_2691 | 277 |
| 1489 | 3300048921 | Ga0496118_0014815 | Ga0496118_0014815_2880_3713 | 277 |
| 1490 | 3300048921 | Ga0496118_0016479 | Ga0496118_0016479_4509_5342 | 277 |
| 1491 | 3300048921 | Ga0496118_0017008 | Ga0496118_0017008_2640_3473 | 277 |
| 1492 | 3300048921 | Ga0496118_0028329 | Ga0496118_0028329_93_929 | 277 |
| 1493 | 3300048921 | Ga0496118_0094049 | Ga0496118_0094049_505_1338 | 277 |
| 1494 | 3300048921 | Ga0496118_0190246 | Ga0496118_0190246_65_901 | 277 |
| 1495 | 3300048922 | Ga0496119_0004719 | Ga0496119_0004719_3142_3975 | 277 |
| 1496 | 3300048922 | Ga0496119_0028509 | Ga0496119_0028509_1531_2364 | 277 |
| 1497 | 3300048923 | Ga0496120_0000047 | Ga0496120_0000047_171226_172062 | 277 |
| 1498 | 3300048923 | Ga0496120_0016612 | Ga0496120_0016612_882_1715 | 277 |
| 1499 | 3300048923 | Ga0496120_0023341 | Ga0496120_0023341_1316_2149 | 277 |
| 1500 | 3300048923 | Ga0496120_0036634 | Ga0496120_0036634_244_1089 | 277 |
| 1501 | 3300048923 | Ga0496120_0039500 | Ga0496120_0039500_521_1357 | 277 |
| 1502 | 3300048923 | Ga0496120_0061971 | Ga0496120_0061971_239_1072 | 277 |
| 1503 | 3300048923 | Ga0496120_0134113 | Ga0496120_0134113_56_889 | 277 |
| 1504 | 3300048924 | Ga0496121_0000003 | Ga0496121_0000003_1081109_1081942 | 277 |
| 1505 | 3300048924 | Ga0496121_0021428 | Ga0496121_0021428_1333_2166 | 277 |
| 1506 | 3300048924 | Ga0496121_0028286 | Ga0496121_0028286_732_1565 | 277 |
| 1507 | 3300048924 | Ga0496121_0033506 | Ga0496121_0033506_1707_2558 | 277 |
| 1508 | 3300048924 | Ga0496121_0094049 | Ga0496121_0094049_856_1689 | 277 |
| 1509 | 3300048924 | Ga0496121_0254992 | Ga0496121_0254992_57_890 | 277 |
| 1510 | 3300048925 | Ga0496122_0000076 | Ga0496122_0000076_209883_210719 | 277 |
| 1511 | 3300048925 | Ga0496122_0000107 | Ga0496122_0000107_161949_162797 | 277 |
| 1512 | 3300048925 | Ga0496122_0011537 | Ga0496122_0011537_1020_1856 | 277 |
| 1513 | 3300048925 | Ga0496122_0016039 | Ga0496122_0016039_2378_3211 | 277 |
| 1514 | 3300048925 | Ga0496122_0021667 | Ga0496122_0021667_2662_3495 | 277 |
| 1515 | 3300048925 | Ga0496122_0028970 | Ga0496122_0028970_1259_2092 | 277 |
| 1516 | 3300048925 | Ga0496122_0054177 | Ga0496122_0054177_94_927 | 277 |
| 1517 | 3300048925 | Ga0496122_0054210 | Ga0496122_0054210_1124_1975 | 277 |
| 1518 | 3300048925 | Ga0496122_0062302 | Ga0496122_0062302_895_1728 | 277 |
| 1519 | 3300048925 | Ga0496122_0128635 | Ga0496122_0128635_95_928 | 277 |
| 1520 | 3300048925 | Ga0496122_0160986 | Ga0496122_0160986_66_899 | 277 |
| 1521 | 3300048926 | Ga0496123_0000023 | Ga0496123_0000023_136176_137012 | 277 |
| 1522 | 3300048926 | Ga0496123_0000063 | Ga0496123_0000063_30312_31160 | 277 |
| 1523 | 3300048926 | Ga0496123_0014544 | Ga0496123_0014544_3889_4722 | 277 |
| 1524 | 3300048926 | Ga0496123_0021425 | Ga0496123_0021425_4104_4955 | 277 |
| 1525 | 3300048926 | Ga0496123_0025149 | Ga0496123_0025149_1237_2070 | 277 |
| 1526 | 3300048926 | Ga0496123_0119937 | Ga0496123_0119937_24_857 | 277 |
| 1527 | 3300048926 | Ga0496123_0184079 | Ga0496123_0184079_10_846 | 277 |
| 1528 | 3300048927 | Ga0496124_0000239 | Ga0496124_0000239_32291_33127 | 277 |
| 1529 | 3300048927 | Ga0496124_0000951 | Ga0496124_0000951_18069_18902 | 277 |
| 1530 | 3300048927 | Ga0496124_0005130 | Ga0496124_0005130_11376_12209 | 277 |
| 1531 | 3300048927 | Ga0496124_0030519 | Ga0496124_0030519_1390_2223 | 277 |
| 1532 | 3300048927 | Ga0496124_0064780 | Ga0496124_0064780_345_1196 | 277 |
| 1533 | 3300048927 | Ga0496124_0065263 | Ga0496124_0065263_1540_2373 | 277 |
| 1534 | 3300048927 | Ga0496124_0084208 | Ga0496124_0084208_1315_2148 | 277 |
| 1535 | 3300048927 | Ga0496124_0099829 | Ga0496124_0099829_1317_2153 | 277 |
| 1536 | 3300048927 | Ga0496124_0115510 | Ga0496124_0115510_422_1255 | 277 |
| 1537 | 3300048927 | Ga0496124_0269696 | Ga0496124_0269696_227_1078 | 277 |
| 1538 | 3300048928 | Ga0496125_0000200 | Ga0496125_0000200_108227_109060 | 277 |
| 1539 | 3300048928 | Ga0496125_0010291 | Ga0496125_0010291_181_1014 | 277 |
| 1540 | 3300048928 | Ga0496125_0032868 | Ga0496125_0032868_2553_3386 | 277 |
| 1541 | 3300048928 | Ga0496125_0058346 | Ga0496125_0058346_388_1221 | 277 |
| 1542 | 3300048928 | Ga0496125_0063816 | Ga0496125_0063816_1079_1912 | 277 |
| 1543 | 3300048928 | Ga0496125_0112647 | Ga0496125_0112647_592_1428 | 277 |
| 1544 | 3300048928 | Ga0496125_0288286 | Ga0496125_0288286_34_870 | 277 |
| 1545 | 3300048929 | Ga0496126_0000965 | Ga0496126_0000965_25826_26662 | 277 |
| 1546 | 3300048929 | Ga0496126_0037901 | Ga0496126_0037901_3370_4203 | 277 |
| 1547 | 3300048929 | Ga0496126_0300887 | Ga0496126_0300887_367_1200 | 277 |
| 1548 | 3300048929 | Ga0496126_0309726 | Ga0496126_0309726_441_1274 | 277 |
| 1549 | 3300048929 | Ga0496126_0357054 | Ga0496126_0357054_249_1082 | 277 |
| 1550 | 3300049459 | Ga0495678_040302 | Ga0495678_040302_925_1758 | 277 |
| 1551 | 3300049459 | Ga0495678_040389 | Ga0495678_040389_694_1530 | 277 |
| 1552 | 3300049459 | Ga0495678_100858 | Ga0495678_100858_74_907 | 277 |
| 1553 | 3300049568 | Ga0501031_0000218 | Ga0501031_0000218_18220_19059 | 277 |
| 1554 | 3300049568 | Ga0501031_0075315 | Ga0501031_0075315_195_1031 | 277 |
| 1555 | 3300049569 | Ga0501032_0000457 | Ga0501032_0000457_18220_19059 | 277 |
| 1556 | 3300049569 | Ga0501032_0265117 | Ga0501032_0265117_83_919 | 277 |
| 1557 | 3300049570 | Ga0501033_0000612 | Ga0501033_0000612_18220_19059 | 277 |
| 1558 | 3300049570 | Ga0501033_0016076 | Ga0501033_0016076_296_1150 | 277 |
| 1559 | 3300049570 | Ga0501033_0048133 | Ga0501033_0048133_1744_2577 | 277 |
| 1560 | 3300049570 | Ga0501033_0252792 | Ga0501033_0252792_218_1054 | 277 |
| 1561 | 3300049571 | Ga0501034_0001364 | Ga0501034_0001364_18220_19059 | 277 |
| 1562 | 3300049571 | Ga0501034_0049448 | Ga0501034_0049448_3285_4118 | 277 |
| 1563 | 3300049571 | Ga0501034_0074936 | Ga0501034_0074936_2170_3006 | 277 |
| 1564 | 3300049571 | Ga0501034_0576456 | Ga0501034_0576456_163_996 | 277 |
| 1565 | 3300049572 | Ga0501036_0000335 | Ga0501036_0000335_18220_19059 | 277 |
| 1566 | 3300049572 | Ga0501036_0123992 | Ga0501036_0123992_130_963 | 277 |
| 1567 | 3300049572 | Ga0501036_0168513 | Ga0501036_0168513_815_1651 | 277 |
| 1568 | 3300049572 | Ga0501036_0336208 | Ga0501036_0336208_302_1135 | 277 |
| 1569 | 3300049573 | Ga0501037_0000468 | Ga0501037_0000468_18220_19059 | 277 |
| 1570 | 3300049573 | Ga0501037_0039495 | Ga0501037_0039495_83_919 | 277 |
| 1571 | 3300049573 | Ga0501037_0099956 | Ga0501037_0099956_18_851 | 277 |
| 1572 | 3300049574 | Ga0501038_0000557 | Ga0501038_0000557_13903_14742 | 277 |
| 1573 | 3300049574 | Ga0501038_0058174 | Ga0501038_0058174_2233_3066 | 277 |
| 1574 | 3300049574 | Ga0501038_0113492 | Ga0501038_0113492_1150_1983 | 277 |
| 1575 | 3300049574 | Ga0501038_0113718 | Ga0501038_0113718_1236_2093 | 277 |
| 1576 | 3300049574 | Ga0501038_0116545 | Ga0501038_0116545_205_1041 | 277 |
| 1577 | 3300049575 | Ga0501039_0000689 | Ga0501039_0000689_18220_19059 | 277 |
| 1578 | 3300049576 | Ga0501040_0005022 | Ga0501040_0005022_6742_7581 | 277 |
| 1579 | 3300049579 | Ga0501043_0004029 | Ga0501043_0004029_4694_5533 | 277 |
| 1580 | 3300049579 | Ga0501043_0022353 | Ga0501043_0022353_2758_3594 | 277 |
| 1581 | 3300049579 | Ga0501043_0162739 | Ga0501043_0162739_607_1440 | 277 |
| 1582 | 3300049579 | Ga0501043_0217300 | Ga0501043_0217300_54_887 | 277 |
| 1583 | 3300049581 | Ga0501047_0003732 | Ga0501047_0003732_1069_1908 | 277 |
| 1584 | 3300049581 | Ga0501047_0062927 | Ga0501047_0062927_606_1439 | 277 |
| 1585 | 3300049581 | Ga0501047_0066505 | Ga0501047_0066505_2556_3392 | 277 |
| 1586 | 3300049586 | Ga0501070_0002902 | Ga0501070_0002902_8836_9675 | 277 |
| 1587 | 3300049586 | Ga0501070_0117439 | Ga0501070_0117439_907_1743 | 277 |
| 1588 | 3300049586 | Ga0501070_0136045 | Ga0501070_0136045_140_976 | 277 |
| 1589 | 3300049587 | Ga0501071_0025714 | Ga0501071_0025714_2777_3613 | 277 |
| 1590 | 3300049671 | Ga0501238_002164 | Ga0501238_002164_52_888 | 277 |
| 1591 | 3300049742 | Ga0501080_0057050 | Ga0501080_0057050_387_1223 | 277 |
| 1592 | 3300049744 | Ga0501083_0022018 | Ga0501083_0022018_777_1610 | 277 |
| 1593 | 3300049744 | Ga0501083_0124686 | Ga0501083_0124686_100_936 | 277 |
| 1594 | 3300049822 | Ga0501035_0000833 | Ga0501035_0000833_13903_14742 | 277 |
| 1595 | 3300049822 | Ga0501035_0411605 | Ga0501035_0411605_83_919 | 277 |
| 1596 | 3300049823 | Ga0501044_0001065 | Ga0501044_0001065_13903_14742 | 277 |
| 1597 | 3300049823 | Ga0501044_0032749 | Ga0501044_0032749_62_916 | 277 |
| 1598 | 3300049823 | Ga0501044_0141041 | Ga0501044_0141041_402_1238 | 277 |
| 1599 | 3300049823 | Ga0501044_0642997 | Ga0501044_0642997_42_875 | 277 |
| 1600 | 3300049824 | Ga0501045_0144011 | Ga0501045_0144011_345_1181 | 277 |
| 1601 | 3300050489 | nmdc:mga03683_160722_c1 | nmdc:mga03683_160722_c1_94_942 | 277 |
| 1602 | 3300050489 | nmdc:mga03683_2237_c1 | nmdc:mga03683_2237_c1_230_1066 | 277 |
| 1603 | 3300050489 | nmdc:mga03683_23744_c1 | nmdc:mga03683_23744_c1_1137_1985 | 277 |
| 1604 | 3300050490 | nmdc:mga03n38_4361_c1 | nmdc:mga03n38_4361_c1_3086_3922 | 277 |
| 1605 | 3300050490 | nmdc:mga03n38_74341_c1 | nmdc:mga03n38_74341_c1_89_925 | 277 |
| 1606 | 3300050491 | nmdc:mga00v17_2539_c1 | nmdc:mga00v17_2539_c1_7476_8309 | 277 |
| 1607 | 3300050491 | nmdc:mga00v17_327499_c1 | nmdc:mga00v17_327499_c1_76_912 | 277 |
| 1608 | 3300050491 | nmdc:mga00v17_4_c1 | nmdc:mga00v17_4_c1_35574_36410 | 277 |
| 1609 | 3300050491 | nmdc:mga00v17_7500_c1 | nmdc:mga00v17_7500_c1_1486_2337 | 277 |
| 1610 | 3300050491 | nmdc:mga00v17_78_c2 | nmdc:mga00v17_78_c2_5103_5951 | 277 |
| 1611 | 3300050492 | nmdc:mga0yw44_199_c1 | nmdc:mga0yw44_199_c1_4713_5549 | 277 |
| 1612 | 3300050493 | nmdc:mga0k408_196002_c1 | nmdc:mga0k408_196002_c1_253_1104 | 277 |
| 1613 | 3300050493 | nmdc:mga0k408_98378_c1 | nmdc:mga0k408_98378_c1_272_1105 | 277 |
| 1614 | 3300050494 | nmdc:mga06z11_54842_c1 | nmdc:mga06z11_54842_c1_316_1149 | 277 |
| 1615 | 3300050495 | nmdc:mga04h51_62340_c1 | nmdc:mga04h51_62340_c1_397_1230 | 277 |
| 1616 | 3300050496 | nmdc:mga07m45_40409_c1 | nmdc:mga07m45_40409_c1_1277_2110 | 277 |
| 1617 | 3300050496 | nmdc:mga07m45_85171_c1 | nmdc:mga07m45_85171_c1_675_1508 | 277 |
| 1618 | 3300050516 | nmdc:mga0sz30_2210_c1 | nmdc:mga0sz30_2210_c1_5183_6019 | 277 |
| 1619 | 3300053087 | Ga0500643_004113 | Ga0500643_004113_3140_3973 | 277 |
| 1620 | 3300053100 | Ga0500660_077223 | Ga0500660_077223_124_972 | 277 |
| 1621 | 3300053103 | Ga0500555_001270 | Ga0500555_001270_7142_7981 | 277 |
| 1622 | 3300053107 | Ga0500560_002524 | Ga0500560_002524_2003_2839 | 277 |
| 1623 | 3300053109 | Ga0500569_013290 | Ga0500569_013290_707_1540 | 277 |
| 1624 | 3300053111 | Ga0500572_005742 | Ga0500572_005742_1694_2527 | 277 |
| 1625 | 3300053117 | Ga0500593_000456 | Ga0500593_000456_5141_5989 | 277 |
| 1626 | 3300053125 | Ga0500618_000171 | Ga0500618_000171_44491_45327 | 277 |
| 1627 | 3300053125 | Ga0500618_001171 | Ga0500618_001171_4798_5634 | 277 |
| 1628 | 3300053129 | Ga0500628_012658 | Ga0500628_012658_500_1348 | 277 |
| 1629 | 3300053134 | Ga0500658_0001109 | Ga0500658_0001109_2097_2930 | 277 |
| 1630 | 3300053134 | Ga0500658_0002691 | Ga0500658_0002691_1733_2566 | 277 |
| 1631 | 3300053140 | Ga0500573_0001489 | Ga0500573_0001489_6827_7660 | 277 |
| 1632 | 3300053151 | Ga0500604_0038371 | Ga0500604_0038371_567_1418 | 277 |
| 1633 | 3300053153 | Ga0500616_0000402 | Ga0500616_0000402_19506_20339 | 277 |
| 1634 | 3300053153 | Ga0500616_0024890 | Ga0500616_0024890_2169_3002 | 277 |
| 1635 | 3300053155 | Ga0500620_000147 | Ga0500620_000147_10054_10887 | 277 |
| 1636 | 3300053156 | Ga0500622_0000726 | Ga0500622_0000726_9030_9863 | 277 |
| 1637 | 3300053157 | Ga0500624_000410 | Ga0500624_000410_9542_10378 | 277 |
| 1638 | 3300053161 | Ga0500634_0003689 | Ga0500634_0003689_3638_4471 | 277 |
| 1639 | 3300053177 | Ga0500636_0000005 | Ga0500636_0000005_194753_195589 | 277 |
| 1640 | 3300053730 | Ga0500645_000042 | Ga0500645_000042_106073_106921 | 277 |
| 1641 | 3300053730 | Ga0500645_002276 | Ga0500645_002276_4633_5481 | 277 |
| 1642 | 3300053730 | Ga0500645_029267 | Ga0500645_029267_743_1591 | 277 |
| 1643 | 3300055283 | Ga0500661_000314 | Ga0500661_000314_519_1367 | 277 |
| 1644 | iso_pu_bacteria | 2503198000 | 2503198049 | 277 |
| 1645 | iso_pu_bacteria | 2508501123 | 2509113640 | 277 |
| 1646 | iso_pu_bacteria | 2509276018 | 2509370586 | 277 |
| 1647 | iso_pu_bacteria | 2510065059 | 2510314395 | 277 |
| 1648 | iso_pu_bacteria | 2510917026 | 2511170197 | 277 |
| 1649 | iso_pu_bacteria | 2511231002 | 2511245293 | 277 |
| 1650 | iso_pu_bacteria | 2512875024 | 2512962814 | 277 |
| 1651 | iso_pu_bacteria | 2513237164 | 2514037513 | 277 |
| 1652 | iso_pu_bacteria | 2585427633 | 2585997277 | 277 |
| 1653 | iso_pu_bacteria | 2585427634 | 2586001886 | 277 |
| 1654 | iso_pu_bacteria | 2600254933 | 2600373534 | 277 |
| 1655 | iso_pu_bacteria | 2643221568 | 2643853692 | 277 |
| 1656 | iso_pu_bacteria | 2671180139 | 2671694320 | 277 |
| 1657 | iso_pu_bacteria | 2687453392 | 2688595362 | 277 |
| 1658 | iso_pu_bacteria | 2756170246 | 2756674564 | 277 |
| 1659 | iso_pu_bacteria | 2818991461 | 2819686560 | 277 |
| 1660 | iso_pu_bacteria | 2821123053 | 2821126286 | 277 |
| 1661 | iso_pu_bacteria | 2844009547 | 2844010084 | 277 |
| 1662 | iso_pu_bacteria | 2847670302 | 2847672954 | 277 |
| 1663 | iso_pu_bacteria | 2847686936 | 2847689436 | 277 |
| 1664 | iso_pu_bacteria | 2854896431 | 2854897399 | 277 |
| 1665 | iso_pu_bacteria | 2854916844 | 2854921467 | 277 |
| 1666 | iso_pu_bacteria | 2856314179 | 2856320014 | 277 |
| 1667 | iso_pu_bacteria | 2856328259 | 2856332045 | 277 |
| 1668 | iso_pu_bacteria | 2856334872 | 2856334889 | 277 |
| 1669 | iso_pu_bacteria | 2856349417 | 2856353167 | 277 |
| 1670 | iso_pu_bacteria | 2857367948 | 2857374102 | 277 |
| 1671 | iso_pu_bacteria | 2857531043 | 2857532847 | 277 |
| 1672 | iso_pu_bacteria | 2869169390 | 2869172316 | 277 |
| 1673 | iso_pu_bacteria | 2869242130 | 2869246523 | 277 |
| 1674 | iso_pu_bacteria | 2869249662 | 2869252029 | 277 |
| 1675 | iso_pu_bacteria | 2869256925 | 2869261206 | 277 |
| 1676 | iso_pu_bacteria | 2869264136 | 2869264367 | 277 |
| 1677 | iso_pu_bacteria | 2869271264 | 2869274705 | 277 |
| 1678 | iso_pu_bacteria | 2869278585 | 2869279821 | 277 |
| 1679 | iso_pu_bacteria | 2871451962 | 2871459244 | 277 |
| 1680 | iso_pu_bacteria | 2871459585 | 2871460094 | 277 |
| 1681 | iso_pu_bacteria | 2871466892 | 2871467726 | 277 |
| 1682 | iso_pu_bacteria | 2871481445 | 2871484482 | 277 |
| 1683 | iso_pu_bacteria | 2871488783 | 2871490801 | 277 |
| 1684 | iso_pu_bacteria | 2871495908 | 2871499375 | 277 |
| 1685 | iso_pu_bacteria | 2874116593 | 2874117815 | 277 |
| 1686 | iso_pu_bacteria | 2874139085 | 2874145686 | 277 |
| 1687 | iso_pu_bacteria | 2874162495 | 2874162571 | 277 |
| 1688 | iso_pu_bacteria | 2876369609 | 2876370240 | 277 |
| 1689 | iso_pu_bacteria | 2876386047 | 2876391963 | 277 |
| 1690 | iso_pu_bacteria | 2876392853 | 2876392927 | 277 |
| 1691 | iso_pu_bacteria | 2876399893 | 2876405090 | 277 |
| 1692 | iso_pu_bacteria | 2876406927 | 2876411102 | 277 |
| 1693 | iso_pu_bacteria | 2876420981 | 2876422628 | 277 |
| 1694 | iso_pu_bacteria | 2878035449 | 2878035562 | 277 |
| 1695 | iso_pu_bacteria | 2878738818 | 2878740336 | 277 |
| 1696 | iso_pu_bacteria | 2878753008 | 2878755205 | 277 |
| 1697 | iso_pu_bacteria | 2878760144 | 2878763565 | 277 |
| 1698 | iso_pu_bacteria | 2878767105 | 2878770563 | 277 |
| 1699 | iso_pu_bacteria | 2878774303 | 2878775245 | 277 |
| 1700 | iso_pu_bacteria | 2878781027 | 2878782221 | 277 |
| 1701 | iso_pu_bacteria | 2881147464 | 2881147615 | 277 |
| 1702 | iso_pu_bacteria | 2881155292 | 2881158715 | 277 |
| 1703 | iso_pu_bacteria | 2881161766 | 2881164390 | 277 |
| 1704 | iso_pu_bacteria | 2881845957 | 2881849665 | 277 |
| 1705 | iso_pu_bacteria | 2881853255 | 2881854196 | 277 |
| 1706 | iso_pu_bacteria | 2881861095 | 2881866271 | 277 |
| 1707 | iso_pu_bacteria | 2882912400 | 2882913662 | 277 |
| 1708 | iso_pu_bacteria | 2885305155 | 2885306251 | 277 |
| 1709 | iso_pu_bacteria | 2885326080 | 2885329320 | 277 |
| 1710 | iso_pu_bacteria | 2885334103 | 2885336016 | 277 |
| 1711 | iso_pu_bacteria | 2885342637 | 2885345736 | 277 |
| 1712 | iso_pu_bacteria | 2885350715 | 2885357108 | 277 |
| 1713 | iso_pu_bacteria | 2888337043 | 2888342697 | 277 |
| 1714 | iso_pu_bacteria | 2903492973 | 2903499315 | 277 |
| 1715 | iso_pu_bacteria | 2903540706 | 2903544180 | 277 |
| 1716 | iso_pu_bacteria | 2904659560 | 2904659633 | 277 |
| 1717 | iso_pu_bacteria | 2906328253 | 2906334553 | 277 |
| 1718 | iso_pu_bacteria | 2906363423 | 2906365553 | 277 |
| 1719 | iso_pu_bacteria | 2906370794 | 2906374474 | 277 |
| 1720 | iso_pu_bacteria | 2906378014 | 2906381290 | 277 |
| 1721 | iso_pu_bacteria | 2906386501 | 2906390715 | 277 |
| 1722 | iso_pu_bacteria | 2906393657 | 2906400591 | 277 |
| 1723 | iso_pu_bacteria | 2906401398 | 2906404640 | 277 |
| 1724 | iso_pu_bacteria | 2906408224 | 2906412488 | 277 |
| 1725 | iso_pu_bacteria | 2906414383 | 2906420790 | 277 |
| 1726 | iso_pu_bacteria | 2919166419 | 2919168121 | 277 |
| 1727 | iso_pu_bacteria | 2919171160 | 2919173573 | 277 |
| 1728 | iso_pu_bacteria | 2922151315 | 2922158339 | 277 |
| 1729 | iso_pu_bacteria | 2922158528 | 2922165038 | 277 |
| 1730 | iso_pu_bacteria | 2922172374 | 2922173397 | 277 |
| 1731 | iso_pu_bacteria | 2922178524 | 2922182411 | 277 |
| 1732 | iso_pu_bacteria | 2924718760 | 2924719565 | 277 |
| 1733 | iso_pu_bacteria | 2924726620 | 2924732864 | 277 |
| 1734 | iso_pu_bacteria | 2924741084 | 2924741787 | 277 |
| 1735 | iso_pu_bacteria | 2924748358 | 2924751521 | 277 |
| 1736 | iso_pu_bacteria | 2924762789 | 2924767697 | 277 |
| 1737 | iso_pu_bacteria | 2924776078 | 2924777937 | 277 |
| 1738 | iso_pu_bacteria | 2924784321 | 2924791426 | 277 |
| 1739 | iso_pu_bacteria | 2937861824 | 2937863305 | 277 |
| 1740 | iso_pu_bacteria | 2937868953 | 2937873761 | 277 |
| 1741 | iso_pu_bacteria | 2937877337 | 2937884499 | 277 |
| 1742 | iso_pu_bacteria | 2937891427 | 2937896000 | 277 |
| 1743 | iso_pu_bacteria | 2937972304 | 2937980522 | 277 |
| 1744 | iso_pu_bacteria | 2937980651 | 2937980922 | 277 |
| 1745 | iso_pu_bacteria | 2937994558 | 2937998024 | 277 |
| 1746 | iso_pu_bacteria | 2958034702 | 2958035689 | 277 |
| 1747 | iso_pu_bacteria | 2958041894 | 2958044720 | 277 |
| 1748 | iso_pu_bacteria | 2958064165 | 2958066723 | 277 |
| 1749 | iso_pu_bacteria | 2958084443 | 2958091810 | 277 |
| 1750 | iso_pu_bacteria | 2958108152 | 2958109877 | 277 |
| 1751 | iso_pu_bacteria | 2958115193 | 2958119676 | 277 |
| 1752 | iso_pu_bacteria | 2958122699 | 2958129238 | 277 |
| 1753 | iso_pu_bacteria | 2958137437 | 2958142400 | 277 |
| 1754 | iso_pu_bacteria | 2958144490 | 2958146519 | 277 |
| 1755 | iso_pu_bacteria | 2958158011 | 2958159240 | 277 |
| 1756 | iso_pu_bacteria | 2958165035 | 2958168499 | 277 |
| 1757 | iso_pu_bacteria | 2961114664 | 2961114958 | 277 |
| 1758 | iso_pu_bacteria | 2961127735 | 2961131916 | 277 |
| 1759 | iso_pu_bacteria | 2961163497 | 2961166963 | 277 |
| 1760 | iso_pu_bacteria | 2961170736 | 2961176753 | 277 |
| 1761 | iso_pu_bacteria | 2961183825 | 2961189628 | 277 |
| 1762 | iso_pu_bacteria | 2965018300 | 2965021787 | 277 |
| 1763 | iso_pu_bacteria | 2965025482 | 2965028853 | 277 |
| 1764 | iso_pu_bacteria | 2965032056 | 2965035237 | 277 |
| 1765 | iso_pu_bacteria | 2965040258 | 2965045247 | 277 |
| 1766 | iso_pu_bacteria | 2965047637 | 2965052298 | 277 |
| 1767 | iso_pu_bacteria | 2965062239 | 2965064610 | 277 |
| 1768 | iso_pu_bacteria | 2965089291 | 2965090688 | 277 |
| 1769 | iso_pu_bacteria | 2965102966 | 2965107747 | 277 |
| 1770 | iso_pu_bacteria | 2965110997 | 2965113305 | 277 |
| 1771 | iso_pu_bacteria | 2967996073 | 2968001138 | 277 |
| 1772 | iso_pu_bacteria | 2968003550 | 2968007191 | 277 |
| 1773 | iso_pu_bacteria | 2968016561 | 2968021622 | 277 |
| 1774 | iso_pu_bacteria | 2968091066 | 2968094100 | 277 |
| 1775 | iso_pu_bacteria | 2968097103 | 2968100691 | 277 |
| 1776 | iso_pu_bacteria | 2968110612 | 2968110686 | 277 |
| 1777 | iso_pu_bacteria | 2968128360 | 2968131307 | 277 |
| 1778 | iso_pu_bacteria | 2968138860 | 2968143550 | 277 |
| 1779 | iso_pu_bacteria | 2968171901 | 2968175369 | 277 |
| 1780 | iso_pu_bacteria | 2970469710 | 2970476699 | 277 |
| 1781 | iso_pu_bacteria | 2970489779 | 2970494156 | 277 |
| 1782 | iso_pu_bacteria | 2970503327 | 2970509426 | 277 |
| 1783 | iso_pu_bacteria | 2970524798 | 2970525509 | 277 |
| 1784 | iso_pu_bacteria | 2970532167 | 2970533715 | 277 |
| 1785 | iso_pu_bacteria | 2970540015 | 2970543537 | 277 |
| 1786 | iso_pu_bacteria | 2970547951 | 2970553786 | 277 |
| 1787 | iso_pu_bacteria | 2970554993 | 2970558407 | 277 |
| 1788 | iso_pu_bacteria | 2970593180 | 2970594421 | 277 |
| 1789 | iso_pu_bacteria | 2970619444 | 2970622549 | 277 |
| 1790 | iso_pu_bacteria | 2970627176 | 2970629229 | 277 |
| 1791 | iso_pu_bacteria | 2977821940 | 2977824345 | 277 |
| 1792 | iso_pu_bacteria | 2977828996 | 2977830329 | 277 |
| 1793 | iso_pu_bacteria | 2977851361 | 2977855068 | 277 |
| 1794 | iso_pu_bacteria | 2977858184 | 2977858384 | 277 |
| 1795 | iso_pu_bacteria | 2977872689 | 2977879994 | 277 |
| 1796 | iso_pu_bacteria | 2977907340 | 2977909692 | 277 |
| 1797 | iso_pu_bacteria | 2977915119 | 2977916362 | 277 |
| 1798 | iso_pu_bacteria | 2977935797 | 2977940498 | 277 |
| 1799 | iso_pu_bacteria | 2977950692 | 2977953084 | 277 |
| 1800 | iso_pu_bacteria | 2977957713 | 2977961378 | 277 |
| 1801 | iso_pu_bacteria | 2978969890 | 2978970795 | 277 |
| 1802 | iso_pu_bacteria | 2979764755 | 2979767585 | 277 |
| 1803 | iso_pu_bacteria | 2979772303 | 2979779248 | 277 |
| 1804 | iso_pu_bacteria | 2979779861 | 2979784632 | 277 |
| 1805 | iso_pu_bacteria | 2979793036 | 2979795799 | 277 |
| 1806 | iso_pu_bacteria | 2979808191 | 2979814213 | 277 |
| 1807 | iso_pu_bacteria | 2984587000 | 2984587903 | 277 |
| 1808 | iso_pu_bacteria | 2987645492 | 2987652015 | 277 |
| 1809 | iso_pu_bacteria | 2987659509 | 2987662975 | 277 |
| 1810 | iso_pu_bacteria | 2987666974 | 2987668404 | 277 |
| 1811 | iso_pu_bacteria | 2987673487 | 2987680081 | 277 |
| 1812 | iso_pu_bacteria | 2996341866 | 2996346131 | 277 |
| 1813 | iso_pu_bacteria | 2996348954 | 2996356122 | 277 |
| 1814 | iso_pu_bacteria | 3004167301 | 3004172538 | 277 |
| 1815 | iso_pu_bacteria | 3004188549 | 3004192027 | 277 |
| 1816 | iso_pu_bacteria | 3004195979 | 3004196335 | 277 |
| 1817 | iso_pu_bacteria | 3004239961 | 3004241120 | 277 |
| 1818 | iso_pu_bacteria | 3004248173 | 3004255433 | 277 |
| 1819 | iso_pu_bacteria | 3004268573 | 3004269518 | 277 |
| 1820 | iso_pu_bacteria | 3004275668 | 3004282436 | 277 |
| 1821 | iso_pu_bacteria | 3004289098 | 3004294180 | 277 |
| 1822 | iso_pu_bacteria | 649633066 | 649869922 | 277 |
| 1823 | iso_pu_bacteria | 8004300914 | 8004307125 | 277 |
| 1824 | iso_pu_bacteria | 8004312739 | 8004319612 | 277 |
| 1825 | iso_pu_bacteria | 8004361976 | 8004365369 | 277 |
| 1826 | iso_pu_bacteria | 8004374579 | 8004376784 | 277 |
| 1827 | iso_pu_bacteria | 8004445564 | 8004449738 | 277 |
| 1828 | iso_pu_bacteria | 8004695233 | 8004698297 | 277 |
| 1829 | iso_pu_bacteria | 8004703790 | 8004707260 | 277 |
| 1830 | iso_pu_bacteria | 8004727605 | 8004729310 | 277 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xu1-assembly1.cif.gz_B | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9239 | 2 | 235 |
| 6z67-assembly3.cif.gz_E | ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution | 0.9186 | 3 | 238 |
| 4yer-assembly1.cif.gz_A | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.917 | 1 | 243 |
| 4fwi-assembly1.cif.gz_B | crystal structure of the nucleotide-binding domain of a dipeptide abc transporter | 0.9153 | 2 | 261 |
| 8hps-assembly1.cif.gz_D | lpqy-sugabc in state 5 | 0.9149 | 5 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQJ5_2_332_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9745 | 2 | 263 | 3.40.50.300 |
| af_P75796_10_305_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9726 | 3 | 260 | 3.40.50.300 |
| af_Q2FZR1_3_327_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9682 | 2 | 272 | 3.40.50.300 |
| af_P77268_3_327_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9651 | 2 | 272 | 3.40.50.300 |
| af_Q2FZR5_3_331_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9647 | 3 | 273 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S1TSN0-F1-model_v4 | deleted | 0.9971 | 2 | 248 |
|
| AF-A0A7V8TTF3-F1-model_v4 | ABC-type dipeptide transporter (EC 7.4.2.9) | 0.9752 | 3 | 262 |
GO:0005524
GO:0005886 GO:0015833 GO:0016887 |
| AF-A0A0L8EX25-F1-model_v4 | deleted | 0.9751 | 3 | 272 |
|
| AF-A0A0R2R2M8-F1-model_v4 | Glutathione ABC transporter ATP-binding protein | 0.9729 | 1 | 262 |
GO:0005524
GO:0016887 |
| AF-A0A3D2X4T8-F1-model_v4 | ABC transporter ATP-binding protein | 0.9727 | 2 | 253 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar