F495829

General Info

Members Datasets Scaffolds Average Seq Length
1830 1264 946 277

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100052380|Ga0070667_1000523802
Length 308
Sequence MSAAGPPQGTRPLGGAARSAVRGEHSDSRIPEPMLVVDDLRVSFPNRDGGMTEAVRGVSFVLGRERLGIVGESGSGKTQTGRAILGLTAPEGRVSARRLAFNGVDLLHCPPRQRRELRGGRIAMVLQDPKFSLNPVMSIGDQIVETLRAHSRVSARDARARALASLEAVRIDDPRRVYKLYPHEVSGGMGQRAMIAMMLIANPDLLIADEPTSALDVTVQLQVLAILDELVTRRGMGLIFVSHDLRLVSTFCDRILVMYAGRVVEEVEAGNLAAARHPYTRGLVECLPRLGEDRHPLPTLDRQPEWAE

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
4 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
5 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
6 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
7 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
8 2509276019 Ensifer aridi TW10 Isolate Nodule
9 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
10 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
11 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
12 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
13 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
14 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
15 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
16 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
17 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
18 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
19 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
20 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
21 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
22 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
23 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
24 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
25 2512875024 Mesorhizobium loti R88b Isolate Nodule
26 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
27 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
28 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
29 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
30 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
31 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
32 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
33 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
34 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
35 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
36 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
37 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
38 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
39 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
40 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
41 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
42 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
43 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
44 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
45 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
46 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
47 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
48 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
49 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
50 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
51 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
52 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
53 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
54 2516143018 Ensifer sp. BR816 Isolate Nodule
55 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
56 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
57 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
58 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
59 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
60 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
61 2519899620 Rhizobium sp. Pop5 Isolate Nodule
62 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
63 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
64 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
65 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
66 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
67 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
68 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
69 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
70 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
71 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
72 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
73 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
74 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
75 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
76 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
77 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
78 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
79 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
80 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
81 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
82 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
83 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
84 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
85 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
86 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
87 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
88 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
89 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
90 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
91 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
92 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
93 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
94 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
95 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
96 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
97 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
98 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
99 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
100 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
101 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
102 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
103 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
104 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
105 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
106 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
107 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
108 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
109 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
110 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
111 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
112 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
113 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
114 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
115 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
116 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
117 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
118 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
119 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
120 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
121 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
122 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
123 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
124 2643221557 Ensifer sp. Root558 Isolate Unclassified
125 2643221558 Rhizobium sp. Root149 Isolate Unclassified
126 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
127 2643221568 Rhizobium sp. Root564 Isolate Unclassified
128 2643221582 Rhizobium sp. Root651 Isolate Unclassified
129 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
130 2643221599 Rhizobium sp. Root708 Isolate Unclassified
131 2643221607 Rhizobium sp. Root73 Isolate Unclassified
132 2643221610 Ensifer sp. Root74 Isolate Unclassified
133 2643221618 Ensifer sp. Root231 Isolate Unclassified
134 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
135 2643221626 Ensifer sp. Root31 Isolate Unclassified
136 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
137 2643221629 Devosia sp. Root105 Isolate Unclassified
138 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
139 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
140 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
141 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
142 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
143 2643221655 Ensifer sp. Root1252 Isolate Unclassified
144 2643221659 Ensifer sp. Root127 Isolate Unclassified
145 2643221662 Devosia sp. Root413D1 Isolate Unclassified
146 2643221668 Ensifer sp. Root423 Isolate Unclassified
147 2643221675 Ensifer sp. Root1298 Isolate Unclassified
148 2643221680 Ensifer sp. Root1312 Isolate Unclassified
149 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
150 2643221688 Rhizobium sp. Root482 Isolate Unclassified
151 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
152 2643221693 Rhizobium sp. Root491 Isolate Unclassified
153 2643221698 Ensifer sp. Root142 Isolate Unclassified
154 2643221712 Ensifer sp. Root258 Isolate Unclassified
155 2643221718 Rhizobium sp. Root268 Isolate Unclassified
156 2643221719 Rhizobium sp. Root274 Isolate Unclassified
157 2643221723 Ensifer sp. Root278 Isolate Unclassified
158 2643221726 Ensifer sp. Root954 Isolate Unclassified
159 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
160 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
161 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
162 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
163 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
164 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
165 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
166 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
167 2718217882 Rhizobium sp. N741 Isolate Nodule
168 2718217927 Rhizobium sp. N324 Isolate Nodule
169 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
170 2718218009 Rhizobium sp. N561 Isolate Nodule
171 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
172 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
173 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
174 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
175 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
176 2718218363 Rhizobium sp. N113 Isolate Nodule
177 2718218365 Rhizobium sp. N731 Isolate Nodule
178 2718218366 Rhizobium sp. N621 Isolate Nodule
179 2718218423 Rhizobium sp. N941 Isolate Nodule
180 2721755514 Rhizobium sp. N6212 Isolate Nodule
181 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
182 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
183 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
184 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
185 2721755809 Rhizobium sp. N541 Isolate Nodule
186 2721755810 Rhizobium sp. N871 Isolate Nodule
187 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
188 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
189 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
190 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
191 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
192 2728369365 Rhizobium sp. N1341 Isolate Nodule
193 2728369397 Rhizobium sp. N1314 Isolate Nodule
194 2738541293 Rhizobium sp. GV031 Isolate Unclassified
195 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
196 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
197 2738543024 Aminobacter sp. AP02 Isolate Unclassified
198 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
199 2751185800 Brucella pituitosa AA2 Isolate Unclassified
200 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
201 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
202 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
203 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
204 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
205 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
206 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
207 2773857925 Microvirga vignae BR3299 Isolate Unclassified
208 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
209 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
210 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
211 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
212 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
213 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
214 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
215 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
216 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
217 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
218 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
219 2791355256 Rhizobium sp. M10 Isolate Nodule
220 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
221 2791355260 Rhizobium sp. L9 Isolate Nodule
222 2791355261 Rhizobium sp. J15 Isolate Nodule
223 2791355262 Rhizobium sp. M1 Isolate Nodule
224 2791355263 Rhizobium chutanense C5 Isolate Nodule
225 2791355264 Rhizobium sp. S9 Isolate Nodule
226 2791355265 Rhizobium sp. H4 Isolate Nodule
227 2791355266 Rhizobium sp. L43 Isolate Nodule
228 2791355267 Rhizobium sp. L18 Isolate Nodule
229 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
230 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
231 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
232 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
233 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
234 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
235 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
236 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
237 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
238 2802429633 Rhizobium anhuiense J3 Isolate Nodule
239 2802429634 Rhizobium anhuiense S10 Isolate Nodule
240 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
241 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
242 2802429637 Rhizobium anhuiense C15 Isolate Nodule
243 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
244 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
245 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
246 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
247 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
248 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
249 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
250 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
251 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
252 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
253 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
254 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
255 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
256 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
257 2838048938 Rhizobium pisi 27/80 Isolate Nodule
258 2838061910 Rhizobium phaseoli L15 Isolate Nodule
259 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
260 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
261 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
262 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
263 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
264 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
265 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
266 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
267 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
268 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
269 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
270 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
271 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
272 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
273 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
274 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
275 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
276 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
277 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
278 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
279 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
280 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
281 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
282 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
283 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
284 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
285 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
286 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
287 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
288 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
289 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
290 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
291 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
292 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
293 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
294 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
295 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
296 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
297 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
298 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
299 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
300 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
301 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
302 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
303 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
304 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
305 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
306 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
307 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
308 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
309 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
310 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
311 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
312 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
313 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
314 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
315 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
316 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
317 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
318 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
319 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
320 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
321 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
322 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
323 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
324 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
325 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
326 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
327 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
328 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
329 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
330 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
331 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
332 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
333 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
334 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
335 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
336 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
337 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
338 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
339 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
340 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
341 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
342 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
343 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
344 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
345 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
346 2844163670 Ensifer sp. 1H6 Isolate Unclassified
347 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
348 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
349 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
350 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
351 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
352 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
353 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
354 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
355 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
356 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
357 2854911287 Brucella lupini LUP21 Isolate Unclassified
358 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
359 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
360 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
361 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
362 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
363 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
364 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
365 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
366 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
367 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
368 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
369 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
370 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
371 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
372 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
373 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
374 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
375 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
376 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
377 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
378 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
379 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
380 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
381 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
382 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
383 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
384 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
385 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
386 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
387 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
388 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
389 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
390 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
391 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
392 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
393 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
394 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
395 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
396 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
397 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
398 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
399 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
400 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
401 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
402 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
403 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
404 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
405 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
406 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
407 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
408 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
409 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
410 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
411 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
412 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
413 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
414 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
415 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
416 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
417 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
418 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
419 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
420 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
421 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
422 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
423 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
424 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
425 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
426 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
427 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
428 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
429 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
430 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
431 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
432 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
433 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
434 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
435 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
436 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
437 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
438 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
439 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
440 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
441 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
442 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
443 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
444 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
445 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
446 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
447 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
448 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
449 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
450 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
451 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
452 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
453 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
454 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
455 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
456 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
457 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
458 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
459 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
460 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
461 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
462 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
463 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
464 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
465 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
466 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
467 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
468 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
469 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
470 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
471 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
472 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
473 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
474 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
475 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
476 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
477 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
478 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
479 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
480 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
481 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
482 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
483 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
484 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
485 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
486 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
487 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
488 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
489 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
490 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
491 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
492 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
493 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
494 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
495 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
496 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
497 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
498 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
499 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
500 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
501 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
502 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
503 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
504 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
505 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
506 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
507 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
508 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
509 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
510 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
511 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
512 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
513 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
514 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
515 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
516 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
517 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
518 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
519 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
520 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
521 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
522 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
523 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
524 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
525 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
526 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
527 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
528 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
529 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
530 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
531 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
532 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
533 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
534 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
535 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
536 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
537 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
538 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
539 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
540 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
541 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
542 2933599457 Rhizobium phaseoli M3 Isolate Nodule
543 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
544 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
545 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
546 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
547 2936381700 Rhizobium chutanense C16 Isolate Unclassified
548 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
549 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
550 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
551 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
552 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
553 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
554 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
555 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
556 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
557 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
558 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
559 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
560 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
561 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
562 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
563 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
564 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
565 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
566 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
567 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
568 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
569 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
570 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
571 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
572 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
573 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
574 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
575 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
576 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
577 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
578 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
579 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
580 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
581 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
582 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
583 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
584 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
585 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
586 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
587 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
588 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
589 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
590 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
591 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
592 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
593 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
594 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
595 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
596 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
597 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
598 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
599 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
600 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
601 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
602 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
603 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
604 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
605 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
606 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
607 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
608 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
609 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
610 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
611 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
612 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
613 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
614 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
615 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
616 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
617 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
618 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
619 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
620 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
621 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
622 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
623 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
624 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
625 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
626 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
627 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
628 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
629 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
630 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
631 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
632 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
633 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
634 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
635 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
636 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
637 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
638 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
639 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
640 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
641 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
642 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
643 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
644 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
645 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
646 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
647 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
648 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
649 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
650 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
651 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
652 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
653 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
654 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
655 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
656 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
657 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
658 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
659 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
660 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
661 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
662 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
663 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
664 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
665 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
666 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
667 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
668 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
669 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
670 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
671 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
672 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
673 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
674 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
675 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
676 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
677 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
678 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
679 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
680 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
681 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
682 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
683 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
684 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
685 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
686 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
687 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
688 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
689 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
690 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
691 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
692 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
693 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
694 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
695 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
696 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
697 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
698 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
699 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
700 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
701 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
702 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
703 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
704 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
705 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
706 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
707 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
708 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
709 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
710 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
711 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
712 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
713 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
714 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
715 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
716 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
717 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
718 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
719 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
720 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
721 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
722 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
723 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
724 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
725 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
726 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
727 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
728 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
729 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
730 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
731 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
732 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
733 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
734 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
735 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
736 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
737 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
738 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
739 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
740 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
741 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
742 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
743 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
744 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
745 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
746 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
747 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
748 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
749 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
750 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
751 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
752 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
753 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
754 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
755 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
756 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
757 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
758 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
759 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
760 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
761 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
762 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
763 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
764 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
765 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
766 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
767 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
768 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
769 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
770 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
771 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
772 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
773 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
774 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
775 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
776 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
777 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
778 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
779 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
780 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
781 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
782 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
783 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
784 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
785 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
786 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
787 2996887358 Rhizobium sp. R711 Isolate Nodule
788 2996893221 Rhizobium sp. R635 Isolate Nodule
789 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
790 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
791 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
792 3004167301 Mesorhizobium loti 582 Isolate Unclassified
793 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
794 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
795 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
796 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
797 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
798 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
799 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
800 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
801 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
802 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
803 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
804 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
805 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
806 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
807 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
808 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
809 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
810 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
811 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
812 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
813 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
814 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
815 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
816 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
817 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
818 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
819 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
820 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
821 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
822 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
823 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
824 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
825 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
826 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
827 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
828 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
829 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
830 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
831 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
832 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
833 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
834 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
835 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
836 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
837 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
838 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
839 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
840 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
841 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
842 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
843 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
844 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
845 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
846 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
847 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
848 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
849 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
850 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
851 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
852 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
853 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
854 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
855 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
856 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
857 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
858 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
859 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
860 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
861 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
862 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
863 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
864 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
865 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
866 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
867 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
868 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
869 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
870 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
871 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
872 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
873 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
874 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
875 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
876 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
877 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
878 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
879 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
880 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
881 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
882 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
883 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
884 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
885 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
886 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
887 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
888 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
889 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
890 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
891 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
892 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
893 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
894 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
895 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
896 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
897 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
898 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
899 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
900 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
901 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
902 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
903 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
904 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
905 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
906 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
907 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
908 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
909 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
910 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
911 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
912 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
913 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
914 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
915 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
916 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
917 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
918 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
919 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
920 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
921 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
922 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
923 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
924 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
925 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
926 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
927 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
928 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
929 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
930 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
931 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
932 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
933 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
934 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
935 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
936 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
937 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
938 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
939 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
940 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
941 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
942 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
943 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
944 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
945 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
946 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
947 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
948 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
949 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
950 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
951 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
952 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
953 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
954 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
955 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
956 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
957 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
958 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
959 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
960 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
961 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
962 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
963 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
964 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
965 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
966 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
967 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
968 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
969 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
970 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
971 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
972 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
973 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
974 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
975 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
976 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
977 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
978 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
979 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
980 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
981 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
982 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
983 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
984 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
985 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
986 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
987 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
988 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
989 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
990 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
991 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
992 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
993 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
994 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
995 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
996 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
997 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
998 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
999 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1000 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1001 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1002 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
1003 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
1004 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
1005 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
1006 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
1007 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
1008 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
1009 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
1010 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
1011 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
1012 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
1013 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
1014 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
1015 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
1016 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
1017 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
1018 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
1019 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
1020 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
1021 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
1022 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
1023 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
1024 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
1025 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
1026 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
1027 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
1028 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
1029 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
1030 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
1031 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
1032 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1033 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1034 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1035 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1036 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
1037 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1038 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
1039 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
1040 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
1041 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
1042 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
1043 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
1044 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
1045 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
1046 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
1047 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
1048 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
1049 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
1050 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
1051 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
1052 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
1053 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
1054 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
1055 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
1056 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
1057 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
1058 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
1059 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
1060 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
1061 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
1062 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
1063 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
1064 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
1065 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
1066 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
1067 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
1068 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1069 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1070 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1071 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
1072 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
1073 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1074 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
1075 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
1076 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
1077 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1078 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
1079 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1080 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
1081 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1082 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1083 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
1084 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1085 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1086 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
1087 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
1088 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1089 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
1090 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1091 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1092 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
1093 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1094 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
1095 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
1096 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
1097 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1098 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
1099 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1100 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
1101 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
1102 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1103 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1116 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1117 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1118 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1119 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1120 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1123 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1125 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1127 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
1128 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1142 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1144 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
1145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1150 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1151 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1152 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1156 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
1160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1162 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1164 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1165 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1166 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
1167 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1168 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
1169 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
1170 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
1171 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
1172 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
1173 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
1174 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
1175 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1176 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
1177 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1178 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1179 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1180 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1181 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
1182 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
1183 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1184 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1185 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
1186 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1187 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1188 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1189 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1190 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
1191 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1192 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
1193 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
1194 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
1195 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
1196 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1197 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1198 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1199 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1200 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1201 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1202 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1203 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1204 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1205 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1206 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1207 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1208 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1209 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1210 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1211 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1212 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1213 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1214 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1215 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1216 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1217 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1218 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1219 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1220 8005258706 Rhizobium sp. R693 Isolate Nodule
1221 8005275841 Rhizobium sp. N4311 Isolate Nodule
1222 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1223 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1224 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1225 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1226 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1227 8005321885 Rhizobium sp. R72 Isolate Nodule
1228 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1229 8005382845 Rhizobium sp. R634 Isolate Nodule
1230 8005395548 Rhizobium sp. R339 Isolate Nodule
1231 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1232 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1233 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1234 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1235 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1236 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1237 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1238 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1239 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1240 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1241 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1242 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1243 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1244 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1245 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1246 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1247 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1248 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1249 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1250 8018176218 Rhizobium sp. N122 Isolate Nodule
1251 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1252 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1253 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1254 8024501048 Rhizobium sp. H4 Isolate Nodule
1255 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1256 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1257 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1258 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1259 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1260 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1261 8056382006 Rhizobium croatiense 13T Isolate Nodule
1262 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1263 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1264 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 51.64
Metatranscriptomes 0.05
Isolates 48.31

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 16.5
Nodule 37.16
Rhizoplane 1.69
Rhizosphere 28.8
Stem 0
Stem Tuber 0
Unclassified 15.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10028962 3300001979 Bacteria 1823
2 JGI24740J21852_10045024 3300001979 Bacteria 1305
3 JGI24739J22299_10005813 3300001989 Bacteria 4671
4 JGI25155J39150_1000004 3300002704 Bacteria 269098
5 JGI25155J39150_1000323 3300002704 Bacteria 16055
6 JGI25156J39149_1000015 3300002705 Bacteria 181949
7 JGI25156J39149_1000897 3300002705 Bacteria 14652
8 JGI25162J39368_1000199 3300002737 Bacteria 63139
9 JGI25154J39366_1000026 3300002738 Bacteria 200613
10 JGI25154J39366_1000657 3300002738 Bacteria 16151
11 JGI25158J39367_1003398 3300002739 Bacteria 2461
12 JGI25157J39369_1000005 3300002741 Bacteria 269089
13 JGI25157J39369_1000791 3300002741 Bacteria 16148
14 JGI25157J39369_1001657 3300002741 Bacteria 7623
15 JGI25152J39213_1002516 3300002773 Bacteria 6916
16 JGI25152J39213_1004259 3300002773 Bacteria 4571
17 JGI25152J39213_1008325 3300002773 Bacteria 2583
18 JGI25150J39212_1000018 3300002774 Bacteria 146535
19 JGI25150J39212_1006657 3300002774 Bacteria 2367
20 JGI25150J39212_1008418 3300002774 Bacteria 2019
21 JGI25150J39212_1009168 3300002774 Bacteria 1901
22 JGI25159J45721_1000008 3300002987 Bacteria 172667
23 JGI25159J45721_1000079 3300002987 Bacteria 46703
24 JGI25159J45721_1000407 3300002987 Bacteria 19965
25 JGI25159J45721_1001232 3300002987 Bacteria 10832
26 JGI25159J45721_1011617 3300002987 Bacteria 2146
27 JGI25159J45721_1024023 3300002987 Bacteria 1093
28 JGI25151J46595_10000034 3300003187 Bacteria 192271
29 JGI25151J46595_10000143 3300003187 Bacteria 95160
30 JGI25151J46595_10001127 3300003187 Bacteria 19435
31 JGI25151J46595_10002080 3300003187 Bacteria 12469
32 JGI25151J46595_10009811 3300003187 Bacteria 4504
33 JGI25151J46595_10010876 3300003187 Bacteria 4210
34 JGI25151J46595_10013943 3300003187 Bacteria 3599
35 JGI25151J46595_10015475 3300003187 Bacteria 3359
36 JGI25151J46595_10017735 3300003187 Bacteria 3077
37 JGI25151J46595_10039673 3300003187 Bacteria 1735
38 JGI25151J46595_10049082 3300003187 Bacteria 1451
39 JGI25165J46597_1000019 3300003214 Bacteria 371528
40 JGI25165J46597_1000307 3300003214 Bacteria 59794
41 JGI25153J46596_10004405 3300003215 Bacteria 7600
42 JGI25153J46596_10006553 3300003215 Bacteria 5870
43 JGI25153J46596_10022201 3300003215 Bacteria 2346
44 JGI25153J46596_10022839 3300003215 Bacteria 2295
45 JGI25160J50197_1000033 3300003354 Bacteria 172667
46 JGI25160J50197_1000109 3300003354 Bacteria 77318
47 JGI25160J50197_1000172 3300003354 Bacteria 55781
48 JGI25160J50197_1002009 3300003354 Bacteria 9705
49 JGI25160J50197_1005531 3300003354 Bacteria 5243
50 JGI25161J50226_1000007 3300003374 Bacteria 256181
51 JGI25161J50226_1000011 3300003374 Bacteria 210140
52 JGI25161J50226_1000038 3300003374 Bacteria 131804
53 JGI25161J50226_1000079 3300003374 Bacteria 83375
54 JGI25161J50226_1000357 3300003374 Bacteria 23707
55 JGI25161J50226_1010655 3300003374 Bacteria 1211
56 Ga0006562J51391_1045286 3300003578 Bacteria 1470
57 Ga0055525_1000053 3300003759 Bacteria 218067
58 Ga0055542_1000625 3300003762 Bacteria 29738
59 Ga0055526_1000361 3300003771 Bacteria 36774
60 Ga0055526_1001066 3300003771 Bacteria 20046
61 Ga0055526_1002672 3300003771 Bacteria 11909
62 Ga0055526_1002681 3300003771 Bacteria 11889
63 Ga0055526_1003358 3300003771 Bacteria 10218
64 Ga0055526_1003566 3300003771 Bacteria 9799
65 Ga0055526_1014546 3300003771 Bacteria 3228
66 Ga0055537_1000356 3300003773 Bacteria 31055
67 Ga0055524_1000213 3300003775 Bacteria 61225
68 Ga0055524_1001146 3300003775 Bacteria 15972
69 Ga0055524_1001370 3300003775 Bacteria 14145
70 Ga0055524_1001377 3300003775 Bacteria 14116
71 Ga0055524_1002351 3300003775 Bacteria 9835
72 Ga0055524_1020238 3300003775 Bacteria 2249
73 Ga0055524_1026321 3300003775 Bacteria 1800
74 Ga0055536_1001937 3300003781 Bacteria 11944
75 Ga0055536_1003918 3300003781 Bacteria 7806
76 Ga0055536_1005157 3300003781 Bacteria 6459
77 Ga0055534_1008979 3300003784 Bacteria 2214
78 Ga0055528_1000433 3300003790 Bacteria 33610
79 Ga0055528_1001020 3300003790 Bacteria 18582
80 Ga0055528_1001206 3300003790 Bacteria 16585
81 Ga0055528_1001875 3300003790 Bacteria 11973
82 Ga0055528_1004586 3300003790 Bacteria 6618
83 Ga0055528_1005560 3300003790 Bacteria 5837
84 Ga0055528_1008511 3300003790 Bacteria 4387
85 Ga0055528_1028327 3300003790 Bacteria 1548
86 Ga0055530_10000763 3300003791 Bacteria 26793
87 Ga0055530_10001299 3300003791 Bacteria 18844
88 Ga0055530_10011055 3300003791 Bacteria 3274
89 Ga0055540_1000324 3300003792 Bacteria 41825
90 Ga0055540_1000504 3300003792 Bacteria 29761
91 Ga0055540_1003695 3300003792 Bacteria 7251
92 Ga0055540_1010512 3300003792 Bacteria 3074
93 Ga0055540_1016977 3300003792 Bacteria 2047
94 Ga0055531_10004306 3300003794 Bacteria 8724
95 Ga0055531_10004903 3300003794 Bacteria 7961
96 Ga0055531_10005891 3300003794 Bacteria 7071
97 Ga0058692_1002714 3300003856 Bacteria 5822
98 Ga0058692_1005559 3300003856 Bacteria 3577
99 Ga0058692_1008272 3300003856 Bacteria 2692
100 Ga0055543_1000026 3300004625 Bacteria 136177
101 Ga0055543_1000071 3300004625 Bacteria 91797
102 Ga0055543_1000106 3300004625 Bacteria 73351
103 Ga0065165_1000135 3300005262 Bacteria 127785
104 Ga0065165_1000178 3300005262 Bacteria 113319
105 Ga0065165_1007140 3300005262 Bacteria 5593
106 Ga0065165_1018011 3300005262 Bacteria 2577
107 Ga0070658_10166017 3300005327 Bacteria 1853
108 Ga0070676_10134497 3300005328 Bacteria 1567
109 Ga0070676_10156017 3300005328 Bacteria 1465
110 Ga0070670_100000061 3300005331 Bacteria 113254
111 Ga0070670_100002139 3300005331 Bacteria 16217
112 Ga0070670_100004009 3300005331 Bacteria 12288
113 Ga0070670_100004917 3300005331 Bacteria 11246
114 Ga0070670_100024623 3300005331 Bacteria 5176
115 Ga0070670_100071595 3300005331 Bacteria 2977
116 Ga0070670_100546630 3300005331 Bacteria 1033
117 Ga0070677_10089624 3300005333 Bacteria 1335
118 Ga0068869_100000007 3300005334 Bacteria 78820
119 Ga0068869_100011980 3300005334 Bacteria 5708
120 Ga0070666_10138111 3300005335 Bacteria 1697
121 Ga0070689_100143158 3300005340 Bacteria 1924
122 Ga0070668_100010303 3300005347 Bacteria 6941
123 Ga0070669_100009394 3300005353 Bacteria 6964
124 Ga0070669_100012984 3300005353 Bacteria 5915
125 Ga0070669_100031327 3300005353 Bacteria 3842
126 Ga0070669_100306936 3300005353 Bacteria 1278
127 Ga0070675_100008830 3300005354 Bacteria 7832
128 Ga0070675_100008944 3300005354 Bacteria 7781
129 Ga0070675_100273768 3300005354 Bacteria 1482
130 Ga0070671_100012661 3300005355 Bacteria 6799
131 Ga0070671_100304582 3300005355 Bacteria 1357
132 Ga0070674_100002629 3300005356 Bacteria 9934
133 Ga0070674_100023406 3300005356 Bacteria 3998
134 Ga0070673_100044158 3300005364 Bacteria 3449
135 Ga0070673_100115291 3300005364 Bacteria 2234
136 Ga0070667_100001939 3300005367 Bacteria 18351
137 Ga0070667_100028382 3300005367 Bacteria 4658
138 Ga0070667_100033931 3300005367 Bacteria 4269
139 Ga0070667_100052380 3300005367 Bacteria 3444
140 Ga0070667_100393191 3300005367 Bacteria 1261
141 Ga0070701_10109495 3300005438 Bacteria 1541
142 Ga0070663_100123092 3300005455 Bacteria 1961
143 Ga0070678_100159653 3300005456 Bacteria 1825
144 Ga0070678_100287784 3300005456 Bacteria 1392
145 Ga0070662_100032281 3300005457 Bacteria 3680
146 Ga0070662_100066591 3300005457 Bacteria 2643
147 Ga0068867_100038765 3300005459 Bacteria 3470
148 Ga0068867_100103872 3300005459 Bacteria 2174
149 Ga0068867_100189789 3300005459 Bacteria 1639
150 Ga0068867_100448275 3300005459 Bacteria 1099
151 Ga0070707_100077038 3300005468 Bacteria 3217
152 Ga0070698_100156871 3300005471 Bacteria 2222
153 Ga0070698_100265986 3300005471 Bacteria 1647
154 Ga0068853_100103622 3300005539 Bacteria 2518
155 Ga0070672_100024379 3300005543 Bacteria 4470
156 Ga0070672_100144065 3300005543 Bacteria 1968
157 Ga0070665_100038392 3300005548 Bacteria 4814
158 Ga0070665_100187873 3300005548 Bacteria 2067
159 Ga0070665_100190852 3300005548 Bacteria 2050
160 Ga0070665_100299133 3300005548 Bacteria 1612
161 Ga0070665_100468584 3300005548 Bacteria 1270
162 Ga0068855_100158526 3300005563 Bacteria 2570
163 Ga0068855_100653813 3300005563 Bacteria 1129
164 Ga0068857_100000676 3300005577 Bacteria 25307
165 Ga0068856_100173944 3300005614 Bacteria 2166
166 Ga0068856_100261907 3300005614 Bacteria 1744
167 Ga0068856_100423633 3300005614 Bacteria 1351
168 Ga0068852_100316193 3300005616 Bacteria 1515
169 Ga0068852_100509436 3300005616 Bacteria 1199
170 Ga0068859_100003514 3300005617 Bacteria 15961
171 Ga0068864_100001466 3300005618 Bacteria 19448
172 Ga0068864_100018957 3300005618 Bacteria 5752
173 Ga0068864_100031537 3300005618 Bacteria 4497
174 Ga0068864_100305512 3300005618 Bacteria 1490
175 Ga0068861_100001688 3300005719 Bacteria 14166
176 Ga0068861_100005778 3300005719 Bacteria 8395
177 Ga0068861_100075375 3300005719 Bacteria 2626
178 Ga0068863_100001574 3300005841 Bacteria 22566
179 Ga0068863_100010047 3300005841 Bacteria 9211
180 Ga0068863_100078212 3300005841 Bacteria 3132
181 Ga0068858_100013010 3300005842 Bacteria 7847
182 Ga0068858_100135039 3300005842 Bacteria 2314
183 Ga0068860_100005878 3300005843 Bacteria 12351
184 Ga0068860_100073368 3300005843 Bacteria 3253
185 Ga0068860_100140560 3300005843 Bacteria 2320
186 Ga0068862_100002922 3300005844 Bacteria 14933
187 Ga0068862_100018133 3300005844 Bacteria 5861
188 Ga0068862_100021865 3300005844 Bacteria 5348
189 Ga0068862_100072758 3300005844 Bacteria 2970
190 Ga0068862_100159767 3300005844 Bacteria 2011
191 Ga0081455_10102813 3300005937 Bacteria 2289
192 Ga0081538_10006847 3300005981 Bacteria 9934
193 Ga0081540_1082712 3300005983 Bacteria 1439
194 Ga0075365_10002874 3300006038 Bacteria 8664
195 Ga0075365_10003514 3300006038 Bacteria 8101
196 Ga0075368_10001283 3300006042 Bacteria 7960
197 Ga0075368_10057189 3300006042 Bacteria 1557
198 Ga0075368_10061687 3300006042 Bacteria 1502
199 Ga0075363_100030258 3300006048 Bacteria 2801
200 Ga0075363_100104619 3300006048 Bacteria 1569
201 Ga0075363_100106804 3300006048 Bacteria 1553
202 Ga0075364_10000074 3300006051 Bacteria 38784
203 Ga0075364_10007527 3300006051 Bacteria 6472
204 Ga0075364_10033083 3300006051 Bacteria 3326
205 Ga0075364_10087480 3300006051 Bacteria 2065
206 Ga0075364_10152919 3300006051 Bacteria 1555
207 Ga0075362_10052148 3300006177 Bacteria 1832
208 Ga0075362_10066958 3300006177 Bacteria 1633
209 Ga0075367_10010987 3300006178 Bacteria 4773
210 Ga0075367_10155514 3300006178 Bacteria 1420
211 Ga0075367_10183470 3300006178 Bacteria 1305
212 Ga0075367_10247910 3300006178 Bacteria 1117
213 Ga0075367_10261283 3300006178 Bacteria 1087
214 Ga0075369_10134910 3300006186 Bacteria 1123
215 Ga0075366_10031674 3300006195 Bacteria 3113
216 Ga0097621_100011117 3300006237 Bacteria 6621
217 Ga0068871_100236521 3300006358 Bacteria 1587
218 Ga0075428_100154157 3300006844 Bacteria 2496
219 Ga0068865_100015032 3300006881 Bacteria 4929
220 Ga0068865_100028929 3300006881 Bacteria 3672
221 Ga0097620_100003514 3300006931 Bacteria 15961
222 Ga0079104_1000063 3300006946 Bacteria 159519
223 Ga0079104_1003309 3300006946 Bacteria 7646
224 Ga0079104_1003311 3300006946 Bacteria 7645
225 Ga0079104_1020326 3300006946 Bacteria 1832
226 Ga0099826_10000045 3300006948 Bacteria 75912
227 Ga0105244_10014754 3300009036 Bacteria 4506
228 Ga0105240_10000013 3300009093 Bacteria 483458
229 Ga0111539_10000300 3300009094 Bacteria 59922
230 Ga0105247_10138500 3300009101 Bacteria 1592
231 Ga0105247_10151109 3300009101 Bacteria 1530
232 Ga0114129_10483459 3300009147 Bacteria 1620
233 Ga0105243_10059067 3300009148 Bacteria 3059
234 Ga0105243_10231444 3300009148 Bacteria 1640
235 Ga0105241_10152731 3300009174 Bacteria 1890
236 Ga0105248_10001664 3300009177 Bacteria 24713
237 Ga0105248_10049509 3300009177 Bacteria 4713
238 Ga0105248_10049981 3300009177 Bacteria 4688
239 Ga0105248_10157139 3300009177 Bacteria 2566
240 Ga0105237_10009556 3300009545 Bacteria 10382
241 Ga0105237_10025658 3300009545 Bacteria 6024
242 Ga0105237_10764993 3300009545 Bacteria 972
243 Ga0105238_10002270 3300009551 Bacteria 19365
244 Ga0105249_10104647 3300009553 Bacteria 2667
245 Ga0123341_1000218 3300009765 Bacteria 30001
246 Ga0123342_1025427 3300009766 Bacteria 3569
247 Ga0105239_10006528 3300010375 Bacteria 13515
248 Ga0105239_10012124 3300010375 Bacteria 9611
249 Ga0105239_10059347 3300010375 Bacteria 4198
250 Ga0105246_10404112 3300011119 Bacteria 1135
251 Ga0157314_1001166 3300012500 Bacteria 1950
252 Ga0157326_1005231 3300012513 Bacteria 1368
253 Ga0157373_10044853 3300013100 Bacteria 3156
254 Ga0157371_10000031 3300013102 Bacteria 230441
255 Ga0157371_10078481 3300013102 Bacteria 2339
256 Ga0157370_10000836 3300013104 Bacteria 39048
257 Ga0157370_10004414 3300013104 Bacteria 16121
258 Ga0157369_10141283 3300013105 Bacteria 2548
259 Ga0157369_10442365 3300013105 Bacteria 1346
260 Ga0171463_1007 3300013249 Bacteria 301198
261 Ga0157378_10061358 3300013297 Bacteria 3355
262 Ga0157378_10499879 3300013297 Bacteria 1214
263 Ga0163162_10045639 3300013306 Bacteria 4390
264 Ga0163162_10125421 3300013306 Bacteria 2673
265 Ga0163162_10665787 3300013306 Bacteria 1164
266 Ga0157375_10001469 3300013308 Bacteria 20277
267 Ga0157375_10255482 3300013308 Bacteria 1914
268 Ga0157375_10306556 3300013308 Bacteria 1752
269 Ga0157375_10366068 3300013308 Bacteria 1608
270 Ga0163163_10001547 3300014325 Bacteria 19382
271 Ga0163163_10036645 3300014325 Bacteria 4766
272 Ga0163163_10253799 3300014325 Bacteria 1809
273 Ga0157380_10195657 3300014326 Bacteria 1789
274 Ga0157380_10231296 3300014326 Bacteria 1660
275 Ga0157380_10452536 3300014326 Bacteria 1233
276 Ga0157380_10585573 3300014326 Bacteria 1101
277 Ga0182008_10015519 3300014497 Bacteria 3973
278 Ga0157379_10000142 3300014968 Bacteria 51727
279 Ga0157379_10471952 3300014968 Bacteria 1160
280 Ga0157376_10029249 3300014969 Bacteria 4389
281 Ga0157376_10261079 3300014969 Bacteria 1623
282 Ga0182007_10007442 3300015262 Bacteria 4590
283 Ga0182005_1000640 3300015265 Bacteria 16664
284 Ga0183365_10112 3300015684 Bacteria 2038
285 Ga0183363_1138 3300015690 Bacteria 18553
286 Ga0214544_1000010 3300021320 Bacteria 270164
287 Ga0214542_1000023 3300021321 Bacteria 191557
288 Ga0214542_1019691 3300021321 Bacteria 5217
289 Ga0214543_1000019 3300021327 Bacteria 267908
290 Ga0214543_1000022 3300021327 Bacteria 241930
291 Ga0213872_10000023 3300021361 Bacteria 157443
292 Ga0213875_10009112 3300021388 Bacteria 5041
293 Ga0228711_1000017 3300022739 Bacteria 121084
294 Ga0228710_1000005 3300022740 Bacteria 233531
295 Ga0209435_100009 3300025206 Bacteria 476614
296 Ga0209435_100019 3300025206 Bacteria 260989
297 Ga0209436_100045 3300025208 Bacteria 69503
298 Ga0209436_101207 3300025208 Bacteria 9430
299 Ga0209563_100014 3300025230 Bacteria 940582
300 Ga0209437_100182 3300025233 Bacteria 130514
301 Ga0209437_100204 3300025233 Bacteria 115781
302 Ga0207425_1000035 3300025245 Bacteria 225942
303 Ga0207425_1001535 3300025245 Bacteria 9474
304 Ga0207425_1001851 3300025245 Bacteria 8164
305 Ga0207425_1030933 3300025245 Bacteria 1069
306 Ga0209646_1000018 3300025246 Bacteria 476716
307 Ga0209646_1000038 3300025246 Bacteria 353982
308 Ga0209646_1004669 3300025246 Bacteria 2471
309 Ga0209026_1000013 3300025250 Bacteria 415633
310 Ga0209026_1000043 3300025250 Bacteria 269142
311 Ga0209026_1000048 3300025250 Bacteria 257264
312 Ga0209677_100728 3300025253 Bacteria 16757
313 Ga0209148_1000032 3300025254 Bacteria 557660
314 Ga0209148_1000349 3300025254 Bacteria 59964
315 Ga0209759_1000007 3300025256 Bacteria 476614
316 Ga0209759_1000038 3300025256 Bacteria 257264
317 Ga0209759_1000058 3300025256 Bacteria 203580
318 Ga0209129_1000029 3300025258 Bacteria 401149
319 Ga0209129_1000050 3300025258 Bacteria 267408
320 Ga0209129_1000623 3300025258 Bacteria 23785
321 Ga0209129_1000807 3300025258 Bacteria 19792
322 Ga0209129_1001333 3300025258 Bacteria 13956
323 Ga0209129_1004423 3300025258 Bacteria 5484
324 Ga0209129_1011796 3300025258 Bacteria 2060
325 Ga0209233_1000034 3300025261 Bacteria 578898
326 Ga0209233_1000231 3300025261 Bacteria 97534
327 Ga0209233_1000280 3300025261 Bacteria 70793
328 Ga0209233_1000388 3300025261 Bacteria 37536
329 Ga0209233_1005717 3300025261 Bacteria 4099
330 Ga0209565_1000041 3300025263 Bacteria 251081
331 Ga0209565_1000333 3300025263 Bacteria 42094
332 Ga0209565_1016313 3300025263 Bacteria 1655
333 Ga0209565_1019493 3300025263 Bacteria 1448
334 Ga0209455_1000098 3300025272 Bacteria 213890
335 Ga0209455_1000872 3300025272 Bacteria 15986
336 Ga0209455_1019769 3300025272 Bacteria 1351
337 Ga0209673_1000033 3300025273 Bacteria 335369
338 Ga0209673_1000050 3300025273 Bacteria 285287
339 Ga0209673_1000052 3300025273 Bacteria 279795
340 Ga0209673_1000364 3300025273 Bacteria 81319
341 Ga0209673_1001686 3300025273 Bacteria 18856
342 Ga0209673_1006199 3300025273 Bacteria 5841
343 Ga0209673_1016436 3300025273 Bacteria 2767
344 Ga0209673_1024925 3300025273 Bacteria 2000
345 Ga0209130_1000009 3300025284 Bacteria 498952
346 Ga0209130_1000017 3300025284 Bacteria 388431
347 Ga0209130_1000058 3300025284 Bacteria 210250
348 Ga0209130_1000160 3300025284 Bacteria 100965
349 Ga0209130_1000245 3300025284 Bacteria 68668
350 Ga0209130_1000708 3300025284 Bacteria 29740
351 Ga0209130_1005012 3300025284 Bacteria 4767
352 Ga0209675_1003873 3300025291 Bacteria 6883
353 Ga0209675_1004149 3300025291 Bacteria 6578
354 Ga0209676_1000013 3300025292 Bacteria 816080
355 Ga0209676_1002248 3300025292 Bacteria 14263
356 Ga0209676_1002662 3300025292 Bacteria 12128
357 Ga0209676_1003354 3300025292 Bacteria 9980
358 Ga0209676_1004193 3300025292 Bacteria 8182
359 Ga0209676_1021737 3300025292 Bacteria 2144
360 Ga0209676_1033837 3300025292 Bacteria 1517
361 Ga0209025_1000132 3300025294 Bacteria 197432
362 Ga0209025_1000153 3300025294 Bacteria 170548
363 Ga0209025_1000227 3300025294 Bacteria 132244
364 Ga0209025_1000299 3300025294 Bacteria 110988
365 Ga0209025_1001158 3300025294 Bacteria 37312
366 Ga0209025_1001511 3300025294 Bacteria 29888
367 Ga0209025_1004718 3300025294 Bacteria 11627
368 Ga0209025_1006680 3300025294 Bacteria 8858
369 Ga0209025_1009265 3300025294 Bacteria 6894
370 Ga0209025_1010428 3300025294 Bacteria 6294
371 Ga0209025_1020559 3300025294 Bacteria 3604
372 Ga0209025_1033375 3300025294 Bacteria 2379
373 Ga0209025_1035476 3300025294 Bacteria 2253
374 Ga0209025_1041425 3300025294 Bacteria 1973
375 Ga0209025_1081078 3300025294 Bacteria 1101
376 Ga0209564_1000013 3300025295 Bacteria 775755
377 Ga0209564_1000236 3300025295 Bacteria 120648
378 Ga0209564_1000795 3300025295 Bacteria 43436
379 Ga0209564_1000875 3300025295 Bacteria 40039
380 Ga0209564_1001920 3300025295 Bacteria 18579
381 Ga0209564_1002543 3300025295 Bacteria 14056
382 Ga0209564_1021554 3300025295 Bacteria 2312
383 Ga0209564_1030732 3300025295 Bacteria 1658
384 Ga0209758_1000105 3300025297 Bacteria 221415
385 Ga0209758_1000299 3300025297 Bacteria 97367
386 Ga0209758_1000672 3300025297 Bacteria 51157
387 Ga0209758_1002015 3300025297 Bacteria 21863
388 Ga0209758_1003869 3300025297 Bacteria 13112
389 Ga0209758_1006091 3300025297 Bacteria 8861
390 Ga0209758_1006131 3300025297 Bacteria 8811
391 Ga0209758_1039062 3300025297 Bacteria 1811
392 Ga0209758_1048222 3300025297 Bacteria 1516
393 Ga0209050_1000008 3300025298 Bacteria 1144179
394 Ga0209050_1001244 3300025298 Bacteria 29472
395 Ga0209050_1007330 3300025298 Bacteria 6215
396 Ga0209050_1009958 3300025298 Bacteria 4767
397 Ga0209050_1014517 3300025298 Bacteria 3385
398 Ga0209050_1015111 3300025298 Bacteria 3270
399 Ga0209050_1026031 3300025298 Bacteria 1970
400 Ga0209256_1000003 3300025299 Bacteria 1661127
401 Ga0209256_1000211 3300025299 Bacteria 110131
402 Ga0209256_1000250 3300025299 Bacteria 95262
403 Ga0209256_1000279 3300025299 Bacteria 89712
404 Ga0209256_1000563 3300025299 Bacteria 53065
405 Ga0209256_1002290 3300025299 Bacteria 16100
406 Ga0209256_1003062 3300025299 Bacteria 12310
407 Ga0209256_1021436 3300025299 Bacteria 1983
408 Ga0209256_1038815 3300025299 Bacteria 1230
409 Ga0207426_1000006 3300025302 Bacteria 1025969
410 Ga0207426_1000041 3300025302 Bacteria 433536
411 Ga0207426_1000070 3300025302 Bacteria 331559
412 Ga0207426_1000091 3300025302 Bacteria 280561
413 Ga0207426_1000098 3300025302 Bacteria 264264
414 Ga0207426_1000131 3300025302 Bacteria 210250
415 Ga0207426_1001967 3300025302 Bacteria 14592
416 Ga0209051_1000005 3300025303 Bacteria 1142353
417 Ga0209051_1000118 3300025303 Bacteria 149426
418 Ga0209051_1001915 3300025303 Bacteria 16158
419 Ga0209051_1003142 3300025303 Bacteria 11108
420 Ga0209051_1005999 3300025303 Bacteria 6945
421 Ga0209051_1017785 3300025303 Bacteria 3167
422 Ga0209051_1026475 3300025303 Bacteria 2336
423 Ga0209051_1033218 3300025303 Bacteria 1954
424 Ga0209257_1000048 3300025304 Bacteria 455536
425 Ga0209257_1000407 3300025304 Bacteria 83438
426 Ga0209257_1002408 3300025304 Bacteria 18693
427 Ga0209257_1002982 3300025304 Bacteria 15409
428 Ga0209257_1003928 3300025304 Bacteria 12083
429 Ga0209257_1005759 3300025304 Bacteria 8468
430 Ga0209257_1011541 3300025304 Bacteria 4237
431 Ga0209257_1015344 3300025304 Bacteria 3198
432 Ga0207642_10050764 3300025899 Bacteria 1873
433 Ga0207647_10034917 3300025904 Bacteria 3207
434 Ga0207645_10009537 3300025907 Bacteria 6709
435 Ga0207645_10066091 3300025907 Bacteria 2312
436 Ga0207645_10085566 3300025907 Bacteria 2024
437 Ga0207643_10091362 3300025908 Bacteria 1775
438 Ga0207695_10000044 3300025913 Bacteria 440819
439 Ga0207695_10068039 3300025913 Bacteria 3650
440 Ga0207671_10000043 3300025914 Bacteria 206915
441 Ga0207671_10164400 3300025914 Bacteria 1720
442 Ga0207657_10026933 3300025919 Bacteria 5272
443 Ga0207657_10074778 3300025919 Bacteria 2860
444 Ga0207646_10368222 3300025922 Bacteria 1298
445 Ga0207681_10021049 3300025923 Bacteria 4140
446 Ga0207694_10013279 3300025924 Bacteria 6201
447 Ga0207650_10000207 3300025925 Bacteria 67267
448 Ga0207650_10054175 3300025925 Bacteria 2975
449 Ga0207650_10095453 3300025925 Bacteria 2279
450 Ga0207650_10139975 3300025925 Bacteria 1901
451 Ga0207659_10016896 3300025926 Bacteria 4758
452 Ga0207659_10254334 3300025926 Bacteria 1426
453 Ga0207644_10080691 3300025931 Bacteria 2403
454 Ga0207644_10104340 3300025931 Bacteria 2134
455 Ga0207644_10324825 3300025931 Bacteria 1245
456 Ga0207690_10081354 3300025932 Bacteria 2263
457 Ga0207706_10008309 3300025933 Bacteria 9570
458 Ga0207706_10047586 3300025933 Bacteria 3794
459 Ga0207709_10169285 3300025935 Bacteria 1531
460 Ga0207709_10215432 3300025935 Bacteria 1381
461 Ga0207709_10324441 3300025935 Bacteria 1154
462 Ga0207670_10107346 3300025936 Bacteria 2004
463 Ga0207669_10005604 3300025937 Bacteria 5654
464 Ga0207669_10313464 3300025937 Bacteria 1197
465 Ga0207704_10033798 3300025938 Bacteria 2912
466 Ga0207691_10000111 3300025940 Bacteria 72961
467 Ga0207691_10016814 3300025940 Bacteria 6943
468 Ga0207711_10009821 3300025941 Bacteria 7959
469 Ga0207711_10037209 3300025941 Bacteria 4132
470 Ga0207711_10041717 3300025941 Bacteria 3909
471 Ga0207711_10054634 3300025941 Bacteria 3428
472 Ga0207711_10122206 3300025941 Bacteria 2326
473 Ga0207689_10000142 3300025942 Bacteria 61457
474 Ga0207689_10026848 3300025942 Bacteria 4820
475 Ga0207689_10271511 3300025942 Bacteria 1404
476 Ga0207689_10473176 3300025942 Bacteria 1048
477 Ga0207651_10008045 3300025960 Bacteria 5658
478 Ga0207651_10060537 3300025960 Bacteria 2629
479 Ga0207651_10255704 3300025960 Bacteria 1435
480 Ga0207712_10263753 3300025961 Bacteria 1398
481 Ga0207668_10013845 3300025972 Bacteria 4980
482 Ga0207668_10015772 3300025972 Bacteria 4701
483 Ga0207668_10141713 3300025972 Bacteria 1850
484 Ga0207668_10420134 3300025972 Bacteria 1135
485 Ga0207658_10040270 3300025986 Bacteria 3377
486 Ga0207658_10117353 3300025986 Bacteria 2115
487 Ga0207658_10229732 3300025986 Bacteria 1565
488 Ga0207703_10000195 3300026035 Bacteria 70480
489 Ga0207703_10255494 3300026035 Bacteria 1582
490 Ga0207639_10061117 3300026041 Bacteria 2908
491 Ga0207639_10160953 3300026041 Bacteria 1891
492 Ga0207639_10270663 3300026041 Bacteria 1490
493 Ga0207708_10111582 3300026075 Bacteria 2123
494 Ga0207641_10006316 3300026088 Bacteria 10019
495 Ga0207641_10018427 3300026088 Bacteria 5724
496 Ga0207641_10761890 3300026088 Bacteria 956
497 Ga0207648_10005172 3300026089 Bacteria 13215
498 Ga0207648_10016833 3300026089 Bacteria 6666
499 Ga0207648_10147107 3300026089 Bacteria 2078
500 Ga0207648_10215624 3300026089 Bacteria 1705
501 Ga0207676_10001696 3300026095 Bacteria 16247
502 Ga0207676_10002462 3300026095 Bacteria 13209
503 Ga0207676_10177500 3300026095 Bacteria 1862
504 Ga0207676_10321138 3300026095 Bacteria 1421
505 Ga0207674_10002098 3300026116 Bacteria 25266
506 Ga0207675_100004037 3300026118 Bacteria 14223
507 Ga0207675_100005489 3300026118 Bacteria 12147
508 Ga0207675_100262624 3300026118 Bacteria 1674
509 Ga0207675_100531298 3300026118 Bacteria 1174
510 Ga0207683_10026873 3300026121 Bacteria 4972
511 Ga0207683_10224210 3300026121 Bacteria 1713
512 Ga0207683_10709857 3300026121 Bacteria 932
513 Ga0207698_10107153 3300026142 Bacteria 2332
514 Ga0207698_10251386 3300026142 Bacteria 1618
515 Ga0207698_10490349 3300026142 Bacteria 1194
516 Ga0207698_10800667 3300026142 Bacteria 944
517 Ga0209281_1000082 3300027111 Bacteria 257684
518 Ga0209281_1000110 3300027111 Bacteria 215631
519 Ga0209281_1001180 3300027111 Bacteria 18042
520 Ga0209371_1000003 3300027312 Bacteria 1122971
521 Ga0209371_1000283 3300027312 Bacteria 58483
522 Ga0209371_1004798 3300027312 Bacteria 5684
523 Ga0209282_1000006 3300027666 Bacteria 276998
524 Ga0209282_1000210 3300027666 Bacteria 31123
525 Ga0207428_10000050 3300027907 Bacteria 177286
526 Ga0268266_10008596 3300028379 Bacteria 9069
527 Ga0268266_10044304 3300028379 Bacteria 3804
528 Ga0268266_10066625 3300028379 Bacteria 3115
529 Ga0268266_10125430 3300028379 Bacteria 2290
530 Ga0268266_10318960 3300028379 Bacteria 1454
531 Ga0268265_10002425 3300028380 Bacteria 14080
532 Ga0268265_10008132 3300028380 Bacteria 7089
533 Ga0268265_10021422 3300028380 Bacteria 4528
534 Ga0268265_10171638 3300028380 Bacteria 1854
535 Ga0268264_10000606 3300028381 Bacteria 43164
536 Ga0268264_10057162 3300028381 Bacteria 3262
537 Ga0268264_10248685 3300028381 Bacteria 1650
538 Ga0307515_10000017 3300028794 Bacteria 550465
539 Ga0307515_10001299 3300028794 Bacteria 56720
540 Ga0307515_10003849 3300028794 Bacteria 31385
541 Ga0307515_10019285 3300028794 Bacteria 12293
542 Ga0307515_10057315 3300028794 Bacteria 5640
543 Ga0307515_10061360 3300028794 Bacteria 5336
544 Ga0265338_10256126 3300028800 Bacteria 1289
545 Ga0268256_1000004 3300030500 Bacteria 1122967
546 Ga0268256_1001389 3300030500 Bacteria 14698
547 Ga0268256_1005352 3300030500 Bacteria 5061
548 Ga0307512_10097469 3300030522 Bacteria 2011
549 Ga0307512_10196894 3300030522 Bacteria 1099
550 Ga0265330_10048954 3300031235 Bacteria 1858
551 Ga0265327_10024986 3300031251 Bacteria 3493
552 Ga0307513_10000206 3300031456 Bacteria 85338
553 Ga0307513_10002736 3300031456 Bacteria 24255
554 Ga0307513_10011846 3300031456 Bacteria 10805
555 Ga0307513_10397732 3300031456 Bacteria 1113
556 Ga0307509_10316479 3300031507 Bacteria 1300
557 Ga0307408_100021734 3300031548 Bacteria 4346
558 Ga0307408_100213063 3300031548 Bacteria 1571
559 Ga0265313_10035166 3300031595 Bacteria 2526
560 Ga0307514_10004553 3300031649 Bacteria 12734
561 Ga0265314_10082126 3300031711 Bacteria 2121
562 Ga0265342_10102778 3300031712 Bacteria 1626
563 Ga0307405_10000125 3300031731 Bacteria 30390
564 Ga0307405_10253710 3300031731 Bacteria 1310
565 Ga0307405_10371062 3300031731 Bacteria 1111
566 Ga0307405_10417700 3300031731 Bacteria 1055
567 Ga0307413_10362456 3300031824 Bacteria 1123
568 Ga0307410_10195697 3300031852 Bacteria 1540
569 Ga0307406_10034901 3300031901 Bacteria 3088
570 Ga0307412_10000786 3300031911 Bacteria 18336
571 Ga0307412_10143313 3300031911 Bacteria 1753
572 Ga0307412_10305232 3300031911 Bacteria 1260
573 Ga0315914_1000003 3300031967 Bacteria 314370
574 Ga0307416_100374461 3300032002 Bacteria 1451
575 Ga0307411_10081872 3300032005 Bacteria 2224
576 Ga0315913_1000001 3300033430 Bacteria 284459
577 Ga0315915_1000008 3300033464 Bacteria 258517
578 Ga0373955_0238927 3300035172 Bacteria 1088
579 Ga0373931_0069965 3300035691 Bacteria 1913
580 Ga0373935_0257134 3300035692 Bacteria 1224
581 Ga0373927_0000412 3300035695 Bacteria 32914
582 Ga0373947_0145929 3300035725 Bacteria 1521
583 Ga0373937_0138393 3300036401 Bacteria 2277
584 Ga0373925_0001026 3300037068 Bacteria 25273
585 Ga0395899_0000589 3300037312 Bacteria 38294
586 Ga0395900_0000375 3300037418 Bacteria 64534
587 Ga0395900_0011818 3300037418 Bacteria 8928
588 Ga0395898_0000629 3300037466 Bacteria 64534
589 Ga0395905_0000361 3300037471 Bacteria 64517
590 Ga0395905_0015961 3300037471 Bacteria 7138
591 Ga0395905_0109369 3300037471 Bacteria 2595
592 Ga0395905_0131670 3300037471 Bacteria 2352
593 Ga0436364_0174941 3300037853 Bacteria 14119
594 Ga0395901_0000273 3300038443 Bacteria 64425
595 Ga0395901_0074295 3300038443 Bacteria 3546
596 Ga0400483_171274 3300039062 Bacteria 2690
597 Ga0436361_0060434 3300039447 Bacteria 165633
598 Ga0439436_0003871 3300041404 Bacteria 4583
599 Ga0439436_0061503 3300041404 Bacteria 1051
600 Ga0439466_0015456 3300041411 Bacteria 2772
601 Ga0439466_0048103 3300041411 Bacteria 1404
602 Ga0439465_0015623 3300041413 Bacteria 2368
603 Ga0451800_0608245 3300041459 Bacteria 825
604 Ga0451807_1468043 3300041486 Bacteria 979
605 Ga0451833_1239942 3300041491 Bacteria 1212
606 Ga0451835_0200957 3300041492 Bacteria 3844
607 Ga0451835_0892570 3300041492 Bacteria 1143
608 Ga0451837_1046754 3300041494 Bacteria 2687
609 Ga0451845_0285704 3300041501 Bacteria 3513
610 Ga0451847_0217734 3300041503 Bacteria 2993
611 Ga0451849_0065926 3300041505 Bacteria 1417
612 Ga0451851_0226558 3300041507 Bacteria 3332
613 Ga0451843_0603985 3300041509 Bacteria 1705
614 Ga0451855_0216231 3300041511 Bacteria 1297
615 Ga0439449_0083621 3300042007 Bacteria 1177
616 Ga0450920_004815 3300042122 Bacteria 2386
617 Ga0450907_024445 3300042146 Bacteria 1021
618 Ga0450909_016064 3300042185 Bacteria 1105
619 Ga0466972_0100113 3300044658 Bacteria 1372
620 Ga0453683_0014712 3300044673 Bacteria 5077
621 Ga0466965_0090576 3300044683 Bacteria 1556
622 Ga0466963_0217153 3300044694 Bacteria 1339
623 Ga0453684_0350884 3300044712 Bacteria 1664
624 Ga0453684_0362447 3300044712 Bacteria 1631
625 Ga0466968_0116997 3300044735 Bacteria 1203
626 Ga0466970_0173567 3300044765 Bacteria 1195
627 Ga0466970_0215394 3300044765 Bacteria 1071
628 Ga0451576_0037377 3300045051 Bacteria 5143
629 Ga0451576_0157735 3300045051 Bacteria 2367
630 Ga0451576_0191525 3300045051 Bacteria 2136
631 Ga0495627_027745 3300046453 Bacteria 1814
632 Ga0495590_0096732 3300046457 Bacteria 1047
633 Ga0495629_0175228 3300046459 Bacteria 1487
634 Ga0495638_0000634 3300046460 Bacteria 38683
635 Ga0495638_0241188 3300046460 Bacteria 1001
636 Ga0495605_0016147 3300046474 Bacteria 4046
637 Ga0495639_0130758 3300046475 Bacteria 1202
638 Ga0495662_0002911 3300046476 Bacteria 8646
639 Ga0495585_0002182 3300046492 Bacteria 14212
640 Ga0495585_0032209 3300046492 Bacteria 2970
641 Ga0495585_0053063 3300046492 Bacteria 2244
642 Ga0495585_0080926 3300046492 Bacteria 1760
643 Ga0495607_0078139 3300046501 Bacteria 1826
644 Ga0495583_0002088 3300046506 Bacteria 18023
645 Ga0495583_0006812 3300046506 Bacteria 7377
646 Ga0495606_0008031 3300046507 Bacteria 9266
647 Ga0495606_0033446 3300046507 Bacteria 3546
648 Ga0495610_0004788 3300046512 Bacteria 9879
649 Ga0495610_0048628 3300046512 Bacteria 2081
650 Ga0495610_0064304 3300046512 Bacteria 1735
651 Ga0495610_0099345 3300046512 Bacteria 1306
652 Ga0495620_0009481 3300046515 Bacteria 5175
653 Ga0495620_0092922 3300046515 Bacteria 1208
654 Ga0495631_0016767 3300046518 Bacteria 3482
655 Ga0495632_0061726 3300046519 Bacteria 1819
656 Ga0495632_0065342 3300046519 Bacteria 1757
657 Ga0495643_0009505 3300046522 Bacteria 6040
658 Ga0495643_0040962 3300046522 Bacteria 2527
659 Ga0495643_0151207 3300046522 Bacteria 1149
660 Ga0495648_0073693 3300046524 Bacteria 1970
661 Ga0495652_0176058 3300046529 Bacteria 1647
662 Ga0495654_0000121 3300046530 Bacteria 86743
663 Ga0495654_0003858 3300046530 Bacteria 9057
664 Ga0495587_0106087 3300046536 Bacteria 1616
665 Ga0495609_0074646 3300046538 Bacteria 1487
666 Ga0495609_0099492 3300046538 Bacteria 1261
667 Ga0495645_0129862 3300046543 Bacteria 1767
668 Ga0495633_0037299 3300046558 Bacteria 2325
669 Ga0495656_0263350 3300046615 Bacteria 874
670 Ga0495668_0020510 3300046616 Bacteria 3802
671 Ga0495668_0041859 3300046616 Bacteria 2551
672 Ga0495668_0105978 3300046616 Bacteria 1537
673 Ga0495625_0034062 3300046660 Bacteria 3760
674 Ga0495625_0109913 3300046660 Bacteria 1885
675 Ga0495625_0137971 3300046660 Bacteria 1647
676 Ga0495625_0196946 3300046660 Bacteria 1332
677 Ga0495661_0136083 3300046665 Bacteria 1341
678 Ga0495588_0000403 3300046674 Bacteria 24269
679 Ga0495657_0043948 3300046675 Bacteria 3043
680 Ga0495670_0034654 3300046691 Bacteria 2515
681 Ga0495670_0077759 3300046691 Bacteria 1687
682 Ga0495649_0007419 3300046694 Bacteria 6684
683 Ga0495600_0008229 3300046809 Bacteria 6403
684 Ga0495660_0033073 3300046810 Bacteria 2902
685 Ga0495604_0042947 3300047317 Bacteria 3541
686 Ga0495683_0079008 3300047323 Bacteria 1607
687 Ga0495673_0043370 3300047469 Bacteria 2014
688 Ga0495673_0106801 3300047469 Bacteria 1124
689 Ga0495681_0009787 3300047470 Bacteria 5866
690 Ga0495681_0024616 3300047470 Bacteria 3165
691 Ga0495686_0001023 3300047472 Bacteria 33801
692 Ga0495686_0131029 3300047472 Bacteria 1487
693 Ga0496100_0037004 3300048903 Bacteria 3082
694 Ga0496101_0116995 3300048904 Bacteria 2012
695 Ga0496102_0020537 3300048905 Bacteria 5836
696 Ga0496102_0425485 3300048905 Bacteria 1247
697 Ga0496102_0610531 3300048905 Bacteria 1014
698 Ga0496103_0022451 3300048906 Bacteria 3800
699 Ga0496106_0005081 3300048909 Bacteria 9739
700 Ga0496107_0193890 3300048910 Bacteria 1510
701 Ga0496109_0038003 3300048912 Bacteria 4351
702 Ga0496111_0001276 3300048914 Bacteria 14109
703 Ga0496111_0338320 3300048914 Bacteria 1114
704 Ga0496112_0024574 3300048915 Bacteria 5773
705 Ga0496112_0192983 3300048915 Bacteria 1998
706 Ga0496113_0014581 3300048916 Bacteria 5367
707 Ga0496113_0340259 3300048916 Bacteria 1203
708 Ga0496114_0731784 3300048917 Bacteria 866
709 Ga0496115_0157399 3300048918 Bacteria 1877
710 Ga0496116_0000135 3300048919 Bacteria 153165
711 Ga0496116_0001063 3300048919 Bacteria 33168
712 Ga0496116_0008500 3300048919 Bacteria 8898
713 Ga0496116_0017944 3300048919 Bacteria 5472
714 Ga0496116_0030619 3300048919 Bacteria 3862
715 Ga0496116_0034781 3300048919 Bacteria 3548
716 Ga0496116_0074355 3300048919 Bacteria 2138
717 Ga0496116_0119594 3300048919 Bacteria 1528
718 Ga0496117_0000030 3300048920 Bacteria 389141
719 Ga0496117_0015059 3300048920 Bacteria 6623
720 Ga0496117_0015836 3300048920 Bacteria 6398
721 Ga0496117_0028078 3300048920 Bacteria 4362
722 Ga0496117_0031765 3300048920 Bacteria 4025
723 Ga0496117_0074188 3300048920 Bacteria 2266
724 Ga0496117_0097863 3300048920 Bacteria 1867
725 Ga0496117_0116420 3300048920 Bacteria 1652
726 Ga0496117_0144445 3300048920 Bacteria 1419
727 Ga0496118_0001480 3300048921 Bacteria 35175
728 Ga0496118_0014815 3300048921 Bacteria 7273
729 Ga0496118_0016479 3300048921 Bacteria 6777
730 Ga0496118_0017008 3300048921 Bacteria 6642
731 Ga0496118_0028329 3300048921 Bacteria 4719
732 Ga0496118_0094049 3300048921 Bacteria 2051
733 Ga0496118_0190246 3300048921 Bacteria 1228
734 Ga0496119_0004719 3300048922 Bacteria 13399
735 Ga0496119_0028509 3300048922 Bacteria 3807
736 Ga0496119_0030888 3300048922 Bacteria 3603
737 Ga0496120_0000047 3300048923 Bacteria 190569
738 Ga0496120_0004732 3300048923 Bacteria 11183
739 Ga0496120_0016612 3300048923 Bacteria 4805
740 Ga0496120_0023341 3300048923 Bacteria 3872
741 Ga0496120_0036634 3300048923 Bacteria 2917
742 Ga0496120_0039500 3300048923 Bacteria 2783
743 Ga0496120_0061971 3300048923 Bacteria 2085
744 Ga0496120_0134113 3300048923 Bacteria 1265
745 Ga0496121_0000003 3300048924 Bacteria 1191431
746 Ga0496121_0000180 3300048924 Bacteria 141128
747 Ga0496121_0021428 3300048924 Bacteria 6328
748 Ga0496121_0028286 3300048924 Bacteria 5222
749 Ga0496121_0033506 3300048924 Bacteria 4647
750 Ga0496121_0094049 3300048924 Bacteria 2332
751 Ga0496121_0097455 3300048924 Bacteria 2279
752 Ga0496121_0229919 3300048924 Bacteria 1300
753 Ga0496121_0254992 3300048924 Bacteria 1214
754 Ga0496122_0000076 3300048925 Bacteria 218690
755 Ga0496122_0000107 3300048925 Bacteria 193163
756 Ga0496122_0011537 3300048925 Bacteria 8935
757 Ga0496122_0016039 3300048925 Bacteria 7120
758 Ga0496122_0021667 3300048925 Bacteria 5743
759 Ga0496122_0028970 3300048925 Bacteria 4682
760 Ga0496122_0054177 3300048925 Bacteria 3015
761 Ga0496122_0054210 3300048925 Bacteria 3014
762 Ga0496122_0062302 3300048925 Bacteria 2731
763 Ga0496122_0107495 3300048925 Bacteria 1843
764 Ga0496122_0128635 3300048925 Bacteria 1615
765 Ga0496122_0160986 3300048925 Bacteria 1368
766 Ga0496123_0000023 3300048926 Bacteria 346894
767 Ga0496123_0000063 3300048926 Bacteria 216072
768 Ga0496123_0014544 3300048926 Bacteria 6514
769 Ga0496123_0021425 3300048926 Bacteria 5024
770 Ga0496123_0025149 3300048926 Bacteria 4498
771 Ga0496123_0119937 3300048926 Bacteria 1482
772 Ga0496123_0184079 3300048926 Bacteria 1087
773 Ga0496124_0000239 3300048927 Bacteria 106633
774 Ga0496124_0000951 3300048927 Bacteria 46191
775 Ga0496124_0005130 3300048927 Bacteria 14908
776 Ga0496124_0026109 3300048927 Bacteria 5273
777 Ga0496124_0030519 3300048927 Bacteria 4783
778 Ga0496124_0064780 3300048927 Bacteria 3050
779 Ga0496124_0065263 3300048927 Bacteria 3036
780 Ga0496124_0084208 3300048927 Bacteria 2608
781 Ga0496124_0099829 3300048927 Bacteria 2353
782 Ga0496124_0115510 3300048927 Bacteria 2153
783 Ga0496124_0269696 3300048927 Bacteria 1247
784 Ga0496125_0000200 3300048928 Bacteria 126369
785 Ga0496125_0010291 3300048928 Bacteria 9472
786 Ga0496125_0032868 3300048928 Bacteria 4601
787 Ga0496125_0058346 3300048928 Bacteria 3118
788 Ga0496125_0063816 3300048928 Bacteria 2933
789 Ga0496125_0112647 3300048928 Bacteria 1965
790 Ga0496125_0288286 3300048928 Bacteria 1012
791 Ga0496126_0000129 3300048929 Bacteria 174059
792 Ga0496126_0000965 3300048929 Bacteria 49314
793 Ga0496126_0037901 3300048929 Bacteria 4490
794 Ga0496126_0059556 3300048929 Bacteria 3439
795 Ga0496126_0107840 3300048929 Bacteria 2429
796 Ga0496126_0300887 3300048929 Bacteria 1323
797 Ga0496126_0309726 3300048929 Bacteria 1300
798 Ga0496126_0357054 3300048929 Bacteria 1194
799 Ga0495678_030868 3300049459 Bacteria 2239
800 Ga0495678_040302 3300049459 Bacteria 1878
801 Ga0495678_040389 3300049459 Bacteria 1876
802 Ga0495678_100858 3300049459 Bacteria 1000
803 Ga0501031_0000218 3300049568 Bacteria 32961
804 Ga0501031_0075315 3300049568 Bacteria 2197
805 Ga0501032_0000457 3300049569 Bacteria 32961
806 Ga0501032_0265117 3300049569 Bacteria 1113
807 Ga0501033_0000612 3300049570 Bacteria 33054
808 Ga0501033_0006558 3300049570 Bacteria 9105
809 Ga0501033_0016076 3300049570 Bacteria 5667
810 Ga0501033_0048133 3300049570 Bacteria 3167
811 Ga0501033_0099576 3300049570 Bacteria 2122
812 Ga0501033_0252792 3300049570 Bacteria 1248
813 Ga0501034_0001364 3300049571 Bacteria 32961
814 Ga0501034_0038350 3300049571 Bacteria 4851
815 Ga0501034_0049448 3300049571 Bacteria 4242
816 Ga0501034_0061166 3300049571 Bacteria 3783
817 Ga0501034_0063834 3300049571 Bacteria 3697
818 Ga0501034_0074936 3300049571 Bacteria 3391
819 Ga0501034_0092703 3300049571 Bacteria 3017
820 Ga0501034_0121215 3300049571 Bacteria 2601
821 Ga0501034_0576456 3300049571 Bacteria 1032
822 Ga0501036_0000335 3300049572 Bacteria 32961
823 Ga0501036_0123992 3300049572 Bacteria 2182
824 Ga0501036_0168513 3300049572 Bacteria 1845
825 Ga0501036_0336208 3300049572 Bacteria 1261
826 Ga0501036_0354756 3300049572 Bacteria 1225
827 Ga0501037_0000468 3300049573 Bacteria 32961
828 Ga0501037_0039495 3300049573 Bacteria 3474
829 Ga0501037_0083375 3300049573 Bacteria 2316
830 Ga0501037_0099956 3300049573 Bacteria 2095
831 Ga0501038_0000557 3300049574 Bacteria 32961
832 Ga0501038_0040126 3300049574 Bacteria 4091
833 Ga0501038_0058174 3300049574 Bacteria 3315
834 Ga0501038_0113492 3300049574 Bacteria 2242
835 Ga0501038_0113718 3300049574 Bacteria 2240
836 Ga0501038_0116545 3300049574 Bacteria 2207
837 Ga0501039_0000689 3300049575 Bacteria 24309
838 Ga0501039_0041520 3300049575 Bacteria 3553
839 Ga0501040_0005022 3300049576 Bacteria 8550
840 Ga0501043_0004029 3300049579 Bacteria 12015
841 Ga0501043_0022353 3300049579 Bacteria 4961
842 Ga0501043_0077095 3300049579 Bacteria 2618
843 Ga0501043_0162739 3300049579 Bacteria 1743
844 Ga0501043_0217300 3300049579 Bacteria 1480
845 Ga0501047_0003732 3300049581 Bacteria 14344
846 Ga0501047_0062927 3300049581 Bacteria 3579
847 Ga0501047_0066505 3300049581 Bacteria 3474
848 Ga0501047_0268538 3300049581 Bacteria 1552
849 Ga0501047_0506694 3300049581 Bacteria 1033
850 Ga0501069_0011784 3300049585 Bacteria 4636
851 Ga0501070_0000227 3300049586 Bacteria 53051
852 Ga0501070_0002902 3300049586 Bacteria 14938
853 Ga0501070_0059818 3300049586 Bacteria 3158
854 Ga0501070_0077896 3300049586 Bacteria 2743
855 Ga0501070_0117439 3300049586 Bacteria 2197
856 Ga0501070_0136045 3300049586 Bacteria 2029
857 Ga0501071_0025714 3300049587 Bacteria 4125
858 Ga0501071_0313549 3300049587 Bacteria 1190
859 Ga0501073_0005747 3300049589 Bacteria 9274
860 Ga0501074_0020802 3300049590 Bacteria 4767
861 Ga0501238_002164 3300049671 Bacteria 2324
862 Ga0501080_0003478 3300049742 Bacteria 13869
863 Ga0501080_0057050 3300049742 Bacteria 3636
864 Ga0501083_0008800 3300049744 Bacteria 7127
865 Ga0501083_0022018 3300049744 Bacteria 4425
866 Ga0501083_0047441 3300049744 Bacteria 2902
867 Ga0501083_0124686 3300049744 Bacteria 1689
868 Ga0501035_0000833 3300049822 Bacteria 32961
869 Ga0501035_0005626 3300049822 Bacteria 11835
870 Ga0501035_0411605 3300049822 Bacteria 1123
871 Ga0501044_0001065 3300049823 Bacteria 32961
872 Ga0501044_0032749 3300049823 Bacteria 5463
873 Ga0501044_0113991 3300049823 Bacteria 2709
874 Ga0501044_0141041 3300049823 Bacteria 2398
875 Ga0501044_0642997 3300049823 Bacteria 950
876 Ga0501045_0144011 3300049824 Bacteria 1772
877 nmdc:mga03683_160722_c1 3300050489 Bacteria 1017
878 nmdc:mga03683_2237_c1 3300050489 Bacteria 5970
879 nmdc:mga03683_23744_c1 3300050489 Bacteria 2392
880 nmdc:mga03n38_4361_c1 3300050490 Bacteria 4678
881 nmdc:mga03n38_74341_c1 3300050490 Bacteria 1580
882 nmdc:mga00v17_2539_c1 3300050491 Bacteria 9344
883 nmdc:mga00v17_327499_c1 3300050491 Bacteria 995
884 nmdc:mga00v17_4_c1 3300050491 Bacteria 238758
885 nmdc:mga00v17_7500_c1 3300050491 Bacteria 5823
886 nmdc:mga00v17_78_c2 3300050491 Bacteria 19083
887 nmdc:mga00v17_94859_c1 3300050491 Bacteria 1877
888 nmdc:mga0yw44_155727_c1 3300050492 Bacteria 1493
889 nmdc:mga0yw44_199_c1 3300050492 Bacteria 21228
890 nmdc:mga0yw44_232528_c1 3300050492 Bacteria 1224
891 nmdc:mga0k408_155389_c1 3300050493 Bacteria 1362
892 nmdc:mga0k408_196002_c1 3300050493 Bacteria 1205
893 nmdc:mga0k408_98378_c1 3300050493 Bacteria 1724
894 nmdc:mga06z11_54842_c1 3300050494 Bacteria 2056
895 nmdc:mga04h51_62340_c1 3300050495 Bacteria 1281
896 nmdc:mga07m45_40409_c1 3300050496 Bacteria 2610
897 nmdc:mga07m45_85171_c1 3300050496 Bacteria 1807
898 nmdc:mga05p37_185934_c1 3300050507 Bacteria 2526
899 nmdc:mga09592_231954_c1 3300050508 Bacteria 1599
900 nmdc:mga06r32_970943_c1 3300050510 Bacteria 803
901 nmdc:mga08y16_315_c1 3300050511 Bacteria 43782
902 nmdc:mga0sz30_2210_c1 3300050516 Bacteria 6955
903 Ga0495619_0012995 3300053085 Bacteria 5246
904 Ga0500578_0064397 3300053086 Bacteria 2338
905 Ga0500643_004113 3300053087 Bacteria 6699
906 Ga0500646_0004016 3300053090 Bacteria 3741
907 Ga0500651_0021798 3300053093 Bacteria 3998
908 Ga0500660_077223 3300053100 Bacteria 1539
909 Ga0500555_001270 3300053103 Bacteria 8083
910 Ga0500560_002524 3300053107 Bacteria 3515
911 Ga0500562_053643 3300053108 Bacteria 1080
912 Ga0500569_013290 3300053109 Bacteria 2012
913 Ga0500572_005742 3300053111 Bacteria 2822
914 Ga0500593_000456 3300053117 Bacteria 16197
915 Ga0500618_000171 3300053125 Bacteria 54421
916 Ga0500618_001171 3300053125 Bacteria 12670
917 Ga0500628_012658 3300053129 Bacteria 1558
918 Ga0500642_0004355 3300053130 Bacteria 4422
919 Ga0500658_0001109 3300053134 Bacteria 11024
920 Ga0500658_0002691 3300053134 Bacteria 6832
921 Ga0500568_0000116 3300053139 Bacteria 71883
922 Ga0500568_0000543 3300053139 Bacteria 27846
923 Ga0500568_0040675 3300053139 Bacteria 1870
924 Ga0500568_0043745 3300053139 Bacteria 1789
925 Ga0500573_0001489 3300053140 Bacteria 11252
926 Ga0500588_0060600 3300053146 Bacteria 1211
927 Ga0500590_000074 3300053148 Bacteria 25195
928 Ga0500604_0006180 3300053151 Bacteria 3164
929 Ga0500604_0019009 3300053151 Bacteria 1920
930 Ga0500604_0038371 3300053151 Bacteria 1437
931 Ga0500616_0000402 3300053153 Bacteria 59210
932 Ga0500616_0024890 3300053153 Bacteria 3321
933 Ga0500620_000147 3300053155 Bacteria 14180
934 Ga0500622_0000726 3300053156 Bacteria 28807
935 Ga0500622_0024581 3300053156 Bacteria 3186
936 Ga0500624_000410 3300053157 Bacteria 13225
937 Ga0500634_0003689 3300053161 Bacteria 6894
938 Ga0500636_0000005 3300053177 Bacteria 197561
939 Ga0500611_014440 3300053727 Bacteria 1378
940 Ga0500645_000042 3300053730 Bacteria 110470
941 Ga0500645_002276 3300053730 Bacteria 8718
942 Ga0500645_029267 3300053730 Bacteria 1663
943 Ga0500609_000889 3300053731 Bacteria 4484
944 Ga0500599_008922 3300053736 Bacteria 1307
945 Ga0500661_000314 3300055283 Bacteria 8843
946 Ga0590074_021251 3300059423 Bacteria 1118

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041492 Ga0451835_0200957 Ga0451835_0200957_34_735 224
2 3300050510 nmdc:mga06r32_970943_c1 nmdc:mga06r32_970943_c1_17_754 243
3 iso_pu_bacteria 2874102143 2874109046 249
4 iso_pu_bacteria 2874131515 2874133818 249
5 iso_pu_bacteria 3004232784 3004237280 250
6 3300005328 Ga0070676_10134497 Ga0070676_101344972 251
7 3300005331 Ga0070670_100546630 Ga0070670_1005466301 251
8 3300005354 Ga0070675_100273768 Ga0070675_1002737681 251
9 3300005842 Ga0068858_100135039 Ga0068858_1001350392 251
10 3300025907 Ga0207645_10085566 Ga0207645_100855663 251
11 3300025942 Ga0207689_10271511 Ga0207689_102715111 251
12 3300005367 Ga0070667_100393191 Ga0070667_1003931912 254
13 3300035172 Ga0373955_0238927 Ga0373955_0238927_10_774 254
14 3300005471 Ga0070698_100156871 Ga0070698_1001568712 255
15 3300048917 Ga0496114_0731784 Ga0496114_0731784_76_852 257
16 3300041459 Ga0451800_0608245 Ga0451800_0608245_29_805 258
17 3300046512 Ga0495610_0099345 Ga0495610_0099345_219_1055 258
18 3300046615 Ga0495656_0263350 Ga0495656_0263350_88_864 258
19 3300048919 Ga0496116_0119594 Ga0496116_0119594_19_795 258
20 3300049459 Ga0495678_030868 Ga0495678_030868_10_786 258
21 3300053156 Ga0500622_0024581 Ga0500622_0024581_2388_3164 258
22 3300042185 Ga0450909_016064 Ga0450909_016064_249_1085 259
23 3300046512 Ga0495610_0048628 Ga0495610_0048628_1099_1935 259
24 iso_pu_bacteria 2885318864 2885324013 260
25 3300003187 JGI25151J46595_10000143 JGI25151J46595_1000014325 261
26 3300005367 Ga0070667_100028382 Ga0070667_1000283822 261
27 3300005983 Ga0081540_1082712 Ga0081540_10827122 261
28 3300006048 Ga0075363_100106804 Ga0075363_1001068042 261
29 3300025294 Ga0209025_1000299 Ga0209025_100029982 261
30 3300025297 Ga0209758_1006131 Ga0209758_10061317 261
31 3300025972 Ga0207668_10141713 Ga0207668_101417132 261
32 3300025986 Ga0207658_10040270 Ga0207658_100402704 261
33 3300026118 Ga0207675_100531298 Ga0207675_1005312982 261
34 3300002987 JGI25159J45721_1024023 JGI25159J45721_10240231 262
35 3300003354 JGI25160J50197_1002009 JGI25160J50197_10020097 262
36 3300025284 Ga0209130_1000160 Ga0209130_100016063 262
37 3300025302 Ga0207426_1000098 Ga0207426_100009867 262
38 3300044694 Ga0466963_0217153 Ga0466963_0217153_365_1159 262
39 3300032002 Ga0307416_100374461 Ga0307416_1003744612 264
40 3300032005 Ga0307411_10081872 Ga0307411_100818722 264
41 3300039062 Ga0400483_171274 Ga0400483_171274_1693_2490 264
42 3300028800 Ga0265338_10256126 Ga0265338_102561262 265
43 3300031235 Ga0265330_10048954 Ga0265330_100489542 265
44 3300031251 Ga0265327_10024986 Ga0265327_100249862 265
45 3300031712 Ga0265342_10102778 Ga0265342_101027782 265
46 3300049570 Ga0501033_0006558 Ga0501033_0006558_3304_4161 265
47 3300049571 Ga0501034_0063834 Ga0501034_0063834_1717_2574 265
48 3300049572 Ga0501036_0354756 Ga0501036_0354756_49_906 265
49 3300049585 Ga0501069_0011784 Ga0501069_0011784_3298_4155 265
50 3300049586 Ga0501070_0000227 Ga0501070_0000227_24412_25269 265
51 3300049590 Ga0501074_0020802 Ga0501074_0020802_1257_2114 265
52 3300049742 Ga0501080_0003478 Ga0501080_0003478_9256_10113 265
53 3300049822 Ga0501035_0005626 Ga0501035_0005626_5718_6575 265
54 3300026095 Ga0207676_10321138 Ga0207676_103211382 266
55 3300035692 Ga0373935_0257134 Ga0373935_0257134_344_1147 266
56 iso_pu_bacteria 2856320880 2856327870 267
57 3300046660 Ga0495625_0137971 Ga0495625_0137971_283_1089 268
58 iso_pu_bacteria 2516143018 2516207912 269
59 iso_pu_bacteria 2791355091 2792619782 269
60 iso_pu_bacteria 2791355092 2792627556 269
61 iso_pu_bacteria 2854681122 2854682370 269
62 iso_pu_bacteria 2582581299 2585228178 270
63 iso_pu_bacteria 2751185821 2753461459 270
64 iso_pu_bacteria 2844533157 2844536384 271
65 iso_pu_bacteria 3000017691 3000021045 271
66 3300049573 Ga0501037_0083375 Ga0501037_0083375_804_1646 272
67 3300049589 Ga0501073_0005747 Ga0501073_0005747_429_1271 272
68 3300049744 Ga0501083_0008800 Ga0501083_0008800_3440_4282 272
69 3300053151 Ga0500604_0006180 Ga0500604_0006180_13_849 272
70 iso_pu_bacteria 2821443989 2821449724 272
71 iso_pu_bacteria 2920760137 2920761205 272
72 3300003374 JGI25161J50226_1000079 JGI25161J50226_100007925 273
73 3300005353 Ga0070669_100012984 Ga0070669_1000129842 273
74 3300005356 Ga0070674_100002629 Ga0070674_1000026298 273
75 3300005459 Ga0068867_100448275 Ga0068867_1004482751 273
76 3300005719 Ga0068861_100005778 Ga0068861_1000057784 273
77 3300005844 Ga0068862_100021865 Ga0068862_1000218655 273
78 3300005981 Ga0081538_10006847 Ga0081538_100068472 273
79 3300006844 Ga0075428_100154157 Ga0075428_1001541573 273
80 3300006881 Ga0068865_100015032 Ga0068865_1000150325 273
81 3300009094 Ga0111539_10000300 Ga0111539_1000030023 273
82 3300009147 Ga0114129_10483459 Ga0114129_104834592 273
83 3300009545 Ga0105237_10764993 Ga0105237_107649931 273
84 3300013105 Ga0157369_10442365 Ga0157369_104423652 273
85 3300014326 Ga0157380_10231296 Ga0157380_102312962 273
86 3300014326 Ga0157380_10585573 Ga0157380_105855732 273
87 3300025254 Ga0209148_1000349 Ga0209148_100034954 273
88 3300025272 Ga0209455_1000872 Ga0209455_100087213 273
89 3300025292 Ga0209676_1033837 Ga0209676_10338372 273
90 3300025298 Ga0209050_1014517 Ga0209050_10145172 273
91 3300025304 Ga0209257_1000407 Ga0209257_100040710 273
92 3300025937 Ga0207669_10005604 Ga0207669_100056043 273
93 3300026118 Ga0207675_100005489 Ga0207675_1000054895 273
94 3300027907 Ga0207428_10000050 Ga0207428_1000005098 273
95 3300028380 Ga0268265_10008132 Ga0268265_100081324 273
96 3300030522 Ga0307512_10097469 Ga0307512_100974693 273
97 3300031456 Ga0307513_10397732 Ga0307513_103977321 273
98 3300041411 Ga0439466_0048103 Ga0439466_0048103_548_1375 273
99 3300041492 Ga0451835_0892570 Ga0451835_0892570_10_834 273
100 3300045051 Ga0451576_0191525 Ga0451576_0191525_793_1632 273
101 3300046492 Ga0495585_0080926 Ga0495585_0080926_592_1416 273
102 3300046506 Ga0495583_0002088 Ga0495583_0002088_11212_12036 273
103 3300046660 Ga0495625_0196946 Ga0495625_0196946_34_873 273
104 3300047469 Ga0495673_0043370 Ga0495673_0043370_391_1215 273
105 3300048919 Ga0496116_0000135 Ga0496116_0000135_133058_133879 273
106 3300048925 Ga0496122_0107495 Ga0496122_0107495_629_1450 273
107 3300048929 Ga0496126_0000129 Ga0496126_0000129_78928_79749 273
108 3300049581 Ga0501047_0268538 Ga0501047_0268538_364_1200 273
109 3300049586 Ga0501070_0059818 Ga0501070_0059818_2014_2850 273
110 3300049587 Ga0501071_0313549 Ga0501071_0313549_139_987 273
111 3300049744 Ga0501083_0047441 Ga0501083_0047441_1384_2220 273
112 3300050507 nmdc:mga05p37_185934_c1 nmdc:mga05p37_185934_c1_822_1661 273
113 3300050508 nmdc:mga09592_231954_c1 nmdc:mga09592_231954_c1_429_1262 273
114 3300050511 nmdc:mga08y16_315_c1 nmdc:mga08y16_315_c1_38553_39395 273
115 3300053090 Ga0500646_0004016 Ga0500646_0004016_616_1455 273
116 3300053093 Ga0500651_0021798 Ga0500651_0021798_2197_3033 273
117 3300053130 Ga0500642_0004355 Ga0500642_0004355_429_1268 273
118 3300053146 Ga0500588_0060600 Ga0500588_0060600_37_876 273
119 3300053151 Ga0500604_0019009 Ga0500604_0019009_154_993 273
120 3300053731 Ga0500609_000889 Ga0500609_000889_127_966 273
121 3300053736 Ga0500599_008922 Ga0500599_008922_310_1149 273
122 iso_pu_bacteria 2508501122 2509108065 273
123 iso_pu_bacteria 2508501127 2509140284 273
124 iso_pu_bacteria 2509276019 2509376756 273
125 iso_pu_bacteria 2509276021 2509389312 273
126 iso_pu_bacteria 2509276033 2509446296 273
127 iso_pu_bacteria 2510065019 2510135346 273
128 iso_pu_bacteria 2510065057 2510305344 273
129 iso_pu_bacteria 2510461069 2510841582 273
130 iso_pu_bacteria 2510461076 2510896800 273
131 iso_pu_bacteria 2510917022 2511133178 273
132 iso_pu_bacteria 2510917028 2511185253 273
133 iso_pu_bacteria 2510917030 2511199432 273
134 iso_pu_bacteria 2511231027 2511389039 273
135 iso_pu_bacteria 2511231052 2511502482 273
136 iso_pu_bacteria 2512047086 2512533858 273
137 iso_pu_bacteria 2512875026 2512970385 273
138 iso_pu_bacteria 2513237084 2513573614 273
139 iso_pu_bacteria 2513237085 2513578777 273
140 iso_pu_bacteria 2513237086 2513588409 273
141 iso_pu_bacteria 2513237088 2513597874 273
142 iso_pu_bacteria 2513237089 2513601449 273
143 iso_pu_bacteria 2513237091 2513619538 273
144 iso_pu_bacteria 2513237093 2513634995 273
145 iso_pu_bacteria 2513237103 2513711446 273
146 iso_pu_bacteria 2513237138 2513865154 273
147 iso_pu_bacteria 2513237140 2513887164 273
148 iso_pu_bacteria 2513237143 2513904507 273
149 iso_pu_bacteria 2513237144 2513912647 273
150 iso_pu_bacteria 2513237146 2513928603 273
151 iso_pu_bacteria 2513237156 2513983647 273
152 iso_pu_bacteria 2513237159 2513997596 273
153 iso_pu_bacteria 2513237160 2514003104 273
154 iso_pu_bacteria 2513237162 2514019511 273
155 iso_pu_bacteria 2513237351 2514587038 273
156 iso_pu_bacteria 2515075009 2515114514 273
157 iso_pu_bacteria 2515154107 2515609275 273
158 iso_pu_bacteria 2515154113 2515635066 273
159 iso_pu_bacteria 2515154114 2515644372 273
160 iso_pu_bacteria 2515154116 2515657550 273
161 iso_pu_bacteria 2515154134 2515741698 273
162 iso_pu_bacteria 2516143018 2516206094 273
163 iso_pu_bacteria 2516653046 2516893857 273
164 iso_pu_bacteria 2516653077 2517038156 273
165 iso_pu_bacteria 2516653085 2517078437 273
166 iso_pu_bacteria 2517093000 2517097175 273
167 iso_pu_bacteria 2517287029 2517408437 273
168 iso_pu_bacteria 2517487022 2517570577 273
169 iso_pu_bacteria 2519899620 2520379738 273
170 iso_pu_bacteria 2523231067 2523466740 273
171 iso_pu_bacteria 2524023207 2524448317 273
172 iso_pu_bacteria 2524023209 2524458689 273
173 iso_pu_bacteria 2529292951 2530647261 273
174 iso_pu_bacteria 2534681796 2535519187 273
175 iso_pu_bacteria 2551306084 2551675711 273
176 iso_pu_bacteria 2551306085 2551688775 273
177 iso_pu_bacteria 2551306086 2551694922 273
178 iso_pu_bacteria 2551306087 2551698928 273
179 iso_pu_bacteria 2551306089 2551710612 273
180 iso_pu_bacteria 2551306090 2551720127 273
181 iso_pu_bacteria 2551306091 2551731286 273
182 iso_pu_bacteria 2551306093 2551744550 273
183 iso_pu_bacteria 2558860100 2558865886 273
184 iso_pu_bacteria 2558860983 2561467996 273
185 iso_pu_bacteria 2582581283 2585167531 273
186 iso_pu_bacteria 2582581294 2585201578 273
187 iso_pu_bacteria 2582581298 2585224031 273
188 iso_pu_bacteria 2582581299 2585231898 273
189 iso_pu_bacteria 2582581304 2585257200 273
190 iso_pu_bacteria 2582581306 2585265757 273
191 iso_pu_bacteria 2582581307 2585271914 273
192 iso_pu_bacteria 2582581308 2585279726 273
193 iso_pu_bacteria 2582581315 2585327562 273
194 iso_pu_bacteria 2582581316 2585333896 273
195 iso_pu_bacteria 2582581865 2585389003 273
196 iso_pu_bacteria 2582581866 2585395150 273
197 iso_pu_bacteria 2582581867 2585399915 273
198 iso_pu_bacteria 2585427526 2585525936 273
199 iso_pu_bacteria 2585427527 2585531871 273
200 iso_pu_bacteria 2585427528 2585540880 273
201 iso_pu_bacteria 2585427529 2585549731 273
202 iso_pu_bacteria 2585427530 2585551182 273
203 iso_pu_bacteria 2585427531 2585563720 273
204 iso_pu_bacteria 2585427590 2585821004 273
205 iso_pu_bacteria 2585427593 2585839149 273
206 iso_pu_bacteria 2585427594 2585845037 273
207 iso_pu_bacteria 2585427608 2585897081 273
208 iso_pu_bacteria 2585427609 2585907058 273
209 iso_pu_bacteria 2585428125 2587982948 273
210 iso_pu_bacteria 2597489875 2597810134 273
211 iso_pu_bacteria 2599185156 2599332072 273
212 iso_pu_bacteria 2599185170 2599420045 273
213 iso_pu_bacteria 2599185352 2600196101 273
214 iso_pu_bacteria 2615840624 2616296279 273
215 iso_pu_bacteria 2615840626 2616306515 273
216 iso_pu_bacteria 2615840698 2616551778 273
217 iso_pu_bacteria 2617270742 2617383941 273
218 iso_pu_bacteria 2643221551 2643777657 273
219 iso_pu_bacteria 2643221555 2643796105 273
220 iso_pu_bacteria 2643221557 2643804358 273
221 iso_pu_bacteria 2643221558 2643813348 273
222 iso_pu_bacteria 2643221595 2643985006 273
223 iso_pu_bacteria 2643221599 2644002603 273
224 iso_pu_bacteria 2643221607 2644050126 273
225 iso_pu_bacteria 2643221610 2644065129 273
226 iso_pu_bacteria 2643221618 2644105424 273
227 iso_pu_bacteria 2643221623 2644130693 273
228 iso_pu_bacteria 2643221626 2644145758 273
229 iso_pu_bacteria 2643221627 2644154064 273
230 iso_pu_bacteria 2643221629 2644168773 273
231 iso_pu_bacteria 2643221634 2644194675 273
232 iso_pu_bacteria 2643221636 2644204815 273
233 iso_pu_bacteria 2643221637 2644208719 273
234 iso_pu_bacteria 2643221643 2644240362 273
235 iso_pu_bacteria 2643221653 2644299347 273
236 iso_pu_bacteria 2643221655 2644311349 273
237 iso_pu_bacteria 2643221659 2644331252 273
238 iso_pu_bacteria 2643221662 2644347321 273
239 iso_pu_bacteria 2643221668 2644377538 273
240 iso_pu_bacteria 2643221675 2644416801 273
241 iso_pu_bacteria 2643221680 2644449841 273
242 iso_pu_bacteria 2643221686 2644483047 273
243 iso_pu_bacteria 2643221688 2644494234 273
244 iso_pu_bacteria 2643221689 2644497713 273
245 iso_pu_bacteria 2643221698 2644544653 273
246 iso_pu_bacteria 2643221712 2644617023 273
247 iso_pu_bacteria 2643221718 2644652249 273
248 iso_pu_bacteria 2643221719 2644657575 273
249 iso_pu_bacteria 2643221723 2644672806 273
250 iso_pu_bacteria 2643221726 2644689975 273
251 iso_pu_bacteria 2657244999 2657684883 273
252 iso_pu_bacteria 2667528174 2671113274 273
253 iso_pu_bacteria 2687453129 2687578954 273
254 iso_pu_bacteria 2690316117 2692315201 273
255 iso_pu_bacteria 2718217882 2719182995 273
256 iso_pu_bacteria 2718217927 2719387774 273
257 iso_pu_bacteria 2718217997 2719667343 273
258 iso_pu_bacteria 2718218009 2719733712 273
259 iso_pu_bacteria 2718218199 2720493763 273
260 iso_pu_bacteria 2718218232 2720615219 273
261 iso_pu_bacteria 2718218233 2720622012 273
262 iso_pu_bacteria 2718218235 2720633362 273
263 iso_pu_bacteria 2718218269 2720777060 273
264 iso_pu_bacteria 2718218363 2721149107 273
265 iso_pu_bacteria 2718218365 2721160505 273
266 iso_pu_bacteria 2718218366 2721165920 273
267 iso_pu_bacteria 2718218423 2721401407 273
268 iso_pu_bacteria 2721755514 2722842090 273
269 iso_pu_bacteria 2721755556 2723028659 273
270 iso_pu_bacteria 2721755684 2723562272 273
271 iso_pu_bacteria 2721755685 2723568965 273
272 iso_pu_bacteria 2721755809 2724040221 273
273 iso_pu_bacteria 2721755810 2724046468 273
274 iso_pu_bacteria 2721755819 2724091667 273
275 iso_pu_bacteria 2721755822 2724106230 273
276 iso_pu_bacteria 2721755823 2724112035 273
277 iso_pu_bacteria 2724679232 2725945704 273
278 iso_pu_bacteria 2728369352 2730109595 273
279 iso_pu_bacteria 2728369365 2730166230 273
280 iso_pu_bacteria 2728369397 2730300137 273
281 iso_pu_bacteria 2738541293 2738801048 273
282 iso_pu_bacteria 2738541333 2739038518 273
283 iso_pu_bacteria 2738543024 2739305989 273
284 iso_pu_bacteria 2738543031 2739347191 273
285 iso_pu_bacteria 2738543031 2739351061 273
286 iso_pu_bacteria 2751185800 2753359629 273
287 iso_pu_bacteria 2751185821 2753463378 273
288 iso_pu_bacteria 2757320392 2757569802 273
289 iso_pu_bacteria 2758568016 2758641888 273
290 iso_pu_bacteria 2765235802 2765463879 273
291 iso_pu_bacteria 2765235942 2766064161 273
292 iso_pu_bacteria 2767802442 2770197912 273
293 iso_pu_bacteria 2775506902 2776269011 273
294 iso_pu_bacteria 2775506904 2776283852 273
295 iso_pu_bacteria 2775507049 2776914687 273
296 iso_pu_bacteria 2775507266 2778179111 273
297 iso_pu_bacteria 2791355082 2792581518 273
298 iso_pu_bacteria 2791355091 2792620502 273
299 iso_pu_bacteria 2791355092 2792625861 273
300 iso_pu_bacteria 2791355094 2792638802 273
301 iso_pu_bacteria 2791355123 2792746558 273
302 iso_pu_bacteria 2791355253 2793280468 273
303 iso_pu_bacteria 2791355256 2793295594 273
304 iso_pu_bacteria 2791355259 2793317645 273
305 iso_pu_bacteria 2791355260 2793320757 273
306 iso_pu_bacteria 2791355261 2793327383 273
307 iso_pu_bacteria 2791355262 2793332271 273
308 iso_pu_bacteria 2791355263 2793338914 273
309 iso_pu_bacteria 2791355264 2793346632 273
310 iso_pu_bacteria 2791355265 2793353828 273
311 iso_pu_bacteria 2791355266 2793359300 273
312 iso_pu_bacteria 2791355267 2793365995 273
313 iso_pu_bacteria 2802428858 2802716742 273
314 iso_pu_bacteria 2802428859 2802725553 273
315 iso_pu_bacteria 2802428860 2802730355 273
316 iso_pu_bacteria 2802428861 2802737674 273
317 iso_pu_bacteria 2802428862 2802742937 273
318 iso_pu_bacteria 2802428863 2802750361 273
319 iso_pu_bacteria 2802429268 2804752989 273
320 iso_pu_bacteria 2802429605 2805926248 273
321 iso_pu_bacteria 2802429606 2805933974 273
322 iso_pu_bacteria 2802429633 2806049101 273
323 iso_pu_bacteria 2802429634 2806054325 273
324 iso_pu_bacteria 2802429635 2806060091 273
325 iso_pu_bacteria 2802429636 2806068705 273
326 iso_pu_bacteria 2802429637 2806076311 273
327 iso_pu_bacteria 2818991272 2819243920 273
328 iso_pu_bacteria 2818991448 2819611705 273
329 iso_pu_bacteria 2818991453 2819638613 273
330 iso_pu_bacteria 2838016132 2838018298 273
331 iso_pu_bacteria 2838022645 2838023975 273
332 iso_pu_bacteria 2838029111 2838034276 273
333 iso_pu_bacteria 2838035591 2838040254 273
334 iso_pu_bacteria 2838042994 2838046673 273
335 iso_pu_bacteria 2838048938 2838050842 273
336 iso_pu_bacteria 2838061910 2838062610 273
337 iso_pu_bacteria 2838068647 2838072159 273
338 iso_pu_bacteria 2838074704 2838079696 273
339 iso_pu_bacteria 2838661181 2838667070 273
340 iso_pu_bacteria 2838668709 2838672197 273
341 iso_pu_bacteria 2838680041 2838683787 273
342 iso_pu_bacteria 2838686498 2838690417 273
343 iso_pu_bacteria 2838694306 2838698315 273
344 iso_pu_bacteria 2838701080 2838704933 273
345 iso_pu_bacteria 2838707686 2838711430 273
346 iso_pu_bacteria 2838729681 2838732175 273
347 iso_pu_bacteria 2838742623 2838745071 273
348 iso_pu_bacteria 2839993093 2839993832 273
349 iso_pu_bacteria 2840764183 2840766836 273
350 iso_pu_bacteria 2841734538 2841735829 273
351 iso_pu_bacteria 2841851746 2841856130 273
352 iso_pu_bacteria 2841864319 2841867662 273
353 iso_pu_bacteria 2842077413 2842081231 273
354 iso_pu_bacteria 2842110456 2842116516 273
355 iso_pu_bacteria 2842118031 2842121992 273
356 iso_pu_bacteria 2842146304 2842148831 273
357 iso_pu_bacteria 2842156927 2842161298 273
358 iso_pu_bacteria 2842163707 2842166804 273
359 iso_pu_bacteria 2842180545 2842184915 273
360 iso_pu_bacteria 2842192696 2842194849 273
361 iso_pu_bacteria 2842198810 2842201568 273
362 iso_pu_bacteria 2842205361 2842207453 273
363 iso_pu_bacteria 2842217011 2842221879 273
364 iso_pu_bacteria 2842229732 2842232497 273
365 iso_pu_bacteria 2842237096 2842241006 273
366 iso_pu_bacteria 2842243621 2842246913 273
367 iso_pu_bacteria 2842250916 2842254614 273
368 iso_pu_bacteria 2842257432 2842260986 273
369 iso_pu_bacteria 2842264693 2842269673 273
370 iso_pu_bacteria 2842271015 2842274437 273
371 iso_pu_bacteria 2842278818 2842280836 273
372 iso_pu_bacteria 2842285085 2842288553 273
373 iso_pu_bacteria 2842291075 2842294888 273
374 iso_pu_bacteria 2842298080 2842300048 273
375 iso_pu_bacteria 2842304105 2842305721 273
376 iso_pu_bacteria 2842311132 2842311448 273
377 iso_pu_bacteria 2842317721 2842321144 273
378 iso_pu_bacteria 2842341865 2842346791 273
379 iso_pu_bacteria 2842357229 2842358959 273
380 iso_pu_bacteria 2842363717 2842366176 273
381 iso_pu_bacteria 2842370503 2842375094 273
382 iso_pu_bacteria 2842377471 2842381287 273
383 iso_pu_bacteria 2842384541 2842388357 273
384 iso_pu_bacteria 2842395702 2842395844 273
385 iso_pu_bacteria 2842402390 2842406101 273
386 iso_pu_bacteria 2842409023 2842412686 273
387 iso_pu_bacteria 2842415677 2842419435 273
388 iso_pu_bacteria 2842422224 2842425791 273
389 iso_pu_bacteria 2842428310 2842433565 273
390 iso_pu_bacteria 2842434925 2842439893 273
391 iso_pu_bacteria 2842441272 2842446522 273
392 iso_pu_bacteria 2842447887 2842448743 273
393 iso_pu_bacteria 2842462802 2842467969 273
394 iso_pu_bacteria 2842469257 2842474502 273
395 iso_pu_bacteria 2842475841 2842481022 273
396 iso_pu_bacteria 2842482326 2842485170 273
397 iso_pu_bacteria 2842489311 2842491197 273
398 iso_pu_bacteria 2842495871 2842498535 273
399 iso_pu_bacteria 2842502639 2842507633 273
400 iso_pu_bacteria 2842509118 2842511474 273
401 iso_pu_bacteria 2842521101 2842522161 273
402 iso_pu_bacteria 2842871566 2842873444 273
403 iso_pu_bacteria 2842922631 2842924425 273
404 iso_pu_bacteria 2844002411 2844004125 273
405 iso_pu_bacteria 2844163670 2844163920 273
406 iso_pu_bacteria 2844454524 2844456883 273
407 iso_pu_bacteria 2847417321 2847419742 273
408 iso_pu_bacteria 2848992105 2848994759 273
409 iso_pu_bacteria 2850079185 2850081758 273
410 iso_pu_bacteria 2852387548 2852391987 273
411 iso_pu_bacteria 2854911287 2854912248 273
412 iso_pu_bacteria 2855825444 2855826583 273
413 iso_pu_bacteria 2855839649 2855841973 273
414 iso_pu_bacteria 2855872281 2855877258 273
415 iso_pu_bacteria 2856342000 2856345430 273
416 iso_pu_bacteria 2857516855 2857519681 273
417 iso_pu_bacteria 2858800743 2858802647 273
418 iso_pu_bacteria 2869162929 2869168726 273
419 iso_pu_bacteria 2869234852 2869236046 273
420 iso_pu_bacteria 2871435913 2871436146 273
421 iso_pu_bacteria 2871474448 2871475465 273
422 iso_pu_bacteria 2874109183 2874115536 273
423 iso_pu_bacteria 2874123672 2874129521 273
424 iso_pu_bacteria 2874168670 2874171756 273
425 iso_pu_bacteria 2878730984 2878735054 273
426 iso_pu_bacteria 2878788777 2878796021 273
427 iso_pu_bacteria 2882632389 2882632775 273
428 iso_pu_bacteria 2885312484 2885314700 273
429 iso_pu_bacteria 2888343758 2888343803 273
430 iso_pu_bacteria 2894652903 2894653238 273
431 iso_pu_bacteria 2896384573 2896391193 273
432 iso_pu_bacteria 2899803654 2899804126 273
433 iso_pu_bacteria 2903513507 2903517200 273
434 iso_pu_bacteria 2904578770 2904579480 273
435 iso_pu_bacteria 2913295892 2913299140 273
436 iso_pu_bacteria 2915650412 2915653019 273
437 iso_pu_bacteria 2915980308 2915982854 273
438 iso_pu_bacteria 2915986958 2915989266 273
439 iso_pu_bacteria 2915993759 2915999060 273
440 iso_pu_bacteria 2916000859 2916005024 273
441 iso_pu_bacteria 2916007675 2916012690 273
442 iso_pu_bacteria 2916014648 2916018982 273
443 iso_pu_bacteria 2916021584 2916022995 273
444 iso_pu_bacteria 2916028427 2916033834 273
445 iso_pu_bacteria 2916041962 2916044352 273
446 iso_pu_bacteria 2916048683 2916050400 273
447 iso_pu_bacteria 2916055098 2916060312 273
448 iso_pu_bacteria 2916061851 2916065490 273
449 iso_pu_bacteria 2916068649 2916073867 273
450 iso_pu_bacteria 2916076590 2916078343 273
451 iso_pu_bacteria 2919100787 2919105496 273
452 iso_pu_bacteria 2919119836 2919120853 273
453 iso_pu_bacteria 2919408235 2919411266 273
454 iso_pu_bacteria 2920822456 2920825598 273
455 iso_pu_bacteria 2921201388 2921205742 273
456 iso_pu_bacteria 2921208531 2921212535 273
457 iso_pu_bacteria 2921237296 2921243967 273
458 iso_pu_bacteria 2921244191 2921244508 273
459 iso_pu_bacteria 2921250672 2921253707 273
460 iso_pu_bacteria 2921257292 2921257844 273
461 iso_pu_bacteria 2921263974 2921269434 273
462 iso_pu_bacteria 2921289301 2921291103 273
463 iso_pu_bacteria 2923556063 2923559998 273
464 iso_pu_bacteria 2924144063 2924150341 273
465 iso_pu_bacteria 2924150972 2924156507 273
466 iso_pu_bacteria 2924158325 2924159862 273
467 iso_pu_bacteria 2924165586 2924167491 273
468 iso_pu_bacteria 2924172951 2924178452 273
469 iso_pu_bacteria 2924179722 2924183523 273
470 iso_pu_bacteria 2924186466 2924187697 273
471 iso_pu_bacteria 2924193448 2924196416 273
472 iso_pu_bacteria 2924200457 2924203866 273
473 iso_pu_bacteria 2924207177 2924210777 273
474 iso_pu_bacteria 2924214083 2924216852 273
475 iso_pu_bacteria 2924221636 2924225611 273
476 iso_pu_bacteria 2924228884 2924233295 273
477 iso_pu_bacteria 2924710171 2924715466 273
478 iso_pu_bacteria 2924733363 2924734294 273
479 iso_pu_bacteria 2924754689 2924756115 273
480 iso_pu_bacteria 2928521798 2928522281 273
481 iso_pu_bacteria 2929138655 2929141453 273
482 iso_pu_bacteria 2933016740 2933018640 273
483 iso_pu_bacteria 2933570622 2933572227 273
484 iso_pu_bacteria 2933586486 2933592877 273
485 iso_pu_bacteria 2933599457 2933602988 273
486 iso_pu_bacteria 2935894831 2935898033 273
487 iso_pu_bacteria 2935901341 2935903524 273
488 iso_pu_bacteria 2936367885 2936369988 273
489 iso_pu_bacteria 2936375103 2936379174 273
490 iso_pu_bacteria 2936381700 2936381848 273
491 iso_pu_bacteria 2936996657 2937002737 273
492 iso_pu_bacteria 2937002841 2937005298 273
493 iso_pu_bacteria 2937009748 2937012834 273
494 iso_pu_bacteria 2937016420 2937021901 273
495 iso_pu_bacteria 2937023124 2937027309 273
496 iso_pu_bacteria 2937029754 2937033360 273
497 iso_pu_bacteria 2937036028 2937038462 273
498 iso_pu_bacteria 2937042894 2937048491 273
499 iso_pu_bacteria 2937049772 2937052819 273
500 iso_pu_bacteria 2937056579 2937062892 273
501 iso_pu_bacteria 2937063883 2937068721 273
502 iso_pu_bacteria 2937071275 2937075902 273
503 iso_pu_bacteria 2937078374 2937080670 273
504 iso_pu_bacteria 2937084907 2937087980 273
505 iso_pu_bacteria 2937091812 2937097462 273
506 iso_pu_bacteria 2937098957 2937100045 273
507 iso_pu_bacteria 2937106411 2937110186 273
508 iso_pu_bacteria 2937113482 2937117708 273
509 iso_pu_bacteria 2937119839 2937124541 273
510 iso_pu_bacteria 2937126314 2937132264 273
511 iso_pu_bacteria 2937836603 2937839122 273
512 iso_pu_bacteria 2941499720 2941504635 273
513 iso_pu_bacteria 2954011201 2954014294 273
514 iso_pu_bacteria 2957375807 2957380717 273
515 iso_pu_bacteria 2957382221 2957387294 273
516 iso_pu_bacteria 2957388812 2957389534 273
517 iso_pu_bacteria 2957395598 2957397226 273
518 iso_pu_bacteria 2957402308 2957408289 273
519 iso_pu_bacteria 2957408893 2957412955 273
520 iso_pu_bacteria 2957415311 2957418911 273
521 iso_pu_bacteria 2957422303 2957428443 273
522 iso_pu_bacteria 2957430029 2957435849 273
523 iso_pu_bacteria 2957437181 2957440674 273
524 iso_pu_bacteria 2957443900 2957450211 273
525 iso_pu_bacteria 2957450854 2957455748 273
526 iso_pu_bacteria 2957457609 2957460482 273
527 iso_pu_bacteria 2957464669 2957468788 273
528 iso_pu_bacteria 2957478035 2957483138 273
529 iso_pu_bacteria 2957484790 2957489210 273
530 iso_pu_bacteria 2957491536 2957495164 273
531 iso_pu_bacteria 2957498199 2957498974 273
532 iso_pu_bacteria 2957505466 2957507085 273
533 iso_pu_bacteria 2958071322 2958076306 273
534 iso_pu_bacteria 2960584000 2960589860 273
535 iso_pu_bacteria 2960591022 2960594041 273
536 iso_pu_bacteria 2960597568 2960602137 273
537 iso_pu_bacteria 2960603979 2960610240 273
538 iso_pu_bacteria 2960610863 2960613130 273
539 iso_pu_bacteria 2960617483 2960617965 273
540 iso_pu_bacteria 2960624210 2960629749 273
541 iso_pu_bacteria 2960631154 2960635606 273
542 iso_pu_bacteria 2960645483 2960647425 273
543 iso_pu_bacteria 2960652885 2960655069 273
544 iso_pu_bacteria 2960660292 2960667059 273
545 iso_pu_bacteria 2960667422 2960670695 273
546 iso_pu_bacteria 2960674078 2960680556 273
547 iso_pu_bacteria 2960680706 2960680833 273
548 iso_pu_bacteria 2960687367 2960688174 273
549 iso_pu_bacteria 2960693952 2960697290 273
550 iso_pu_bacteria 2964607997 2964614412 273
551 iso_pu_bacteria 2964615318 2964618146 273
552 iso_pu_bacteria 2964621998 2964628065 273
553 iso_pu_bacteria 2964628898 2964634237 273
554 iso_pu_bacteria 2964636051 2964639174 273
555 iso_pu_bacteria 2964643177 2964646218 273
556 iso_pu_bacteria 2964649959 2964651279 273
557 iso_pu_bacteria 2964656573 2964656930 273
558 iso_pu_bacteria 2964663802 2964667696 273
559 iso_pu_bacteria 2964670856 2964675082 273
560 iso_pu_bacteria 2964678106 2964682696 273
561 iso_pu_bacteria 2964685014 2964689251 273
562 iso_pu_bacteria 2964691889 2964694773 273
563 iso_pu_bacteria 2964698721 2964704533 273
564 iso_pu_bacteria 2964712639 2964718831 273
565 iso_pu_bacteria 2964719344 2964722640 273
566 iso_pu_bacteria 2967664464 2967667688 273
567 iso_pu_bacteria 2967671571 2967677753 273
568 iso_pu_bacteria 2967678726 2967685792 273
569 iso_pu_bacteria 2967686174 2967689304 273
570 iso_pu_bacteria 2967693043 2967698669 273
571 iso_pu_bacteria 2967699805 2967700037 273
572 iso_pu_bacteria 2967706974 2967711451 273
573 iso_pu_bacteria 2967714385 2967720356 273
574 iso_pu_bacteria 2967721400 2967727210 273
575 iso_pu_bacteria 2967728569 2967729471 273
576 iso_pu_bacteria 2967735183 2967739832 273
577 iso_pu_bacteria 2967742019 2967745277 273
578 iso_pu_bacteria 2967748971 2967754233 273
579 iso_pu_bacteria 2967755722 2967759682 273
580 iso_pu_bacteria 2967762386 2967764021 273
581 iso_pu_bacteria 2967769361 2967772671 273
582 iso_pu_bacteria 2967775926 2967778123 273
583 iso_pu_bacteria 2970019648 2970024349 273
584 iso_pu_bacteria 2970026789 2970028038 273
585 iso_pu_bacteria 2970033650 2970035950 273
586 iso_pu_bacteria 2970040964 2970045232 273
587 iso_pu_bacteria 2970047711 2970051496 273
588 iso_pu_bacteria 2970054988 2970056194 273
589 iso_pu_bacteria 2970061556 2970065470 273
590 iso_pu_bacteria 2970068827 2970070959 273
591 iso_pu_bacteria 2970076120 2970079389 273
592 iso_pu_bacteria 2970082768 2970084642 273
593 iso_pu_bacteria 2970088815 2970094301 273
594 iso_pu_bacteria 2970095765 2970099939 273
595 iso_pu_bacteria 2970102677 2970103999 273
596 iso_pu_bacteria 2970109326 2970111927 273
597 iso_pu_bacteria 2970116247 2970120527 273
598 iso_pu_bacteria 2970122695 2970126069 273
599 iso_pu_bacteria 2970129317 2970134665 273
600 iso_pu_bacteria 2970136068 2970141753 273
601 iso_pu_bacteria 2970143518 2970147234 273
602 iso_pu_bacteria 2970149975 2970152424 273
603 iso_pu_bacteria 2970156795 2970162233 273
604 iso_pu_bacteria 2970164137 2970168244 273
605 iso_pu_bacteria 2970170962 2970175962 273
606 iso_pu_bacteria 2970177841 2970181137 273
607 iso_pu_bacteria 2970184632 2970186212 273
608 iso_pu_bacteria 2970191845 2970192569 273
609 iso_pu_bacteria 2977516862 2977519040 273
610 iso_pu_bacteria 2977523885 2977528113 273
611 iso_pu_bacteria 2977530762 2977536422 273
612 iso_pu_bacteria 2977537788 2977543369 273
613 iso_pu_bacteria 2977544691 2977550513 273
614 iso_pu_bacteria 2977551784 2977552993 273
615 iso_pu_bacteria 2977558990 2977564126 273
616 iso_pu_bacteria 2977565890 2977568789 273
617 iso_pu_bacteria 2977572785 2977574119 273
618 iso_pu_bacteria 2977579622 2977585977 273
619 iso_pu_bacteria 2977898635 2977903664 273
620 iso_pu_bacteria 2989349275 2989351217 273
621 iso_pu_bacteria 2989776772 2989780452 273
622 iso_pu_bacteria 2996310559 2996315618 273
623 iso_pu_bacteria 2996336353 2996341246 273
624 iso_pu_bacteria 2996386984 2996388498 273
625 iso_pu_bacteria 2996887358 2996890431 273
626 iso_pu_bacteria 2996893221 2996896099 273
627 iso_pu_bacteria 3000135777 3000135930 273
628 iso_pu_bacteria 3002141150 3002142259 273
629 iso_pu_bacteria 3004334049 3004338066 273
630 iso_pu_bacteria 3005409236 3005415892 273
631 iso_pu_bacteria 3005416602 3005421418 273
632 iso_pu_bacteria 3005445848 3005449769 273
633 iso_pu_bacteria 639633055 639650524 273
634 iso_pu_bacteria 643692032 643826637 273
635 iso_pu_bacteria 648276728 648739472 273
636 iso_pu_bacteria 8002285264 8002291901 273
637 iso_pu_bacteria 8003992118 8003994409 273
638 iso_pu_bacteria 8003999396 8004002114 273
639 iso_pu_bacteria 8004395343 8004401446 273
640 iso_pu_bacteria 8004633249 8004638721 273
641 iso_pu_bacteria 8005246636 8005248234 273
642 iso_pu_bacteria 8005258706 8005262618 273
643 iso_pu_bacteria 8005275841 8005282531 273
644 iso_pu_bacteria 8005282627 8005286714 273
645 iso_pu_bacteria 8005289223 8005295116 273
646 iso_pu_bacteria 8005301065 8005305993 273
647 iso_pu_bacteria 8005307578 8005313810 273
648 iso_pu_bacteria 8005314921 8005319877 273
649 iso_pu_bacteria 8005321885 8005324958 273
650 iso_pu_bacteria 8005376324 8005381471 273
651 iso_pu_bacteria 8005382845 8005387680 273
652 iso_pu_bacteria 8005395548 8005400711 273
653 iso_pu_bacteria 8005430974 8005431139 273
654 iso_pu_bacteria 8005460587 8005465208 273
655 iso_pu_bacteria 8005484373 8005486898 273
656 iso_pu_bacteria 8005497431 8005497723 273
657 iso_pu_bacteria 8005542996 8005546843 273
658 iso_pu_bacteria 8005556819 8005561272 273
659 iso_pu_bacteria 8005563573 8005565895 273
660 iso_pu_bacteria 8005570704 8005571944 273
661 iso_pu_bacteria 8005619151 8005623440 273
662 iso_pu_bacteria 8005626139 8005630978 273
663 iso_pu_bacteria 8005645114 8005647148 273
664 iso_pu_bacteria 8005658619 8005661682 273
665 iso_pu_bacteria 8005668836 8005669128 273
666 iso_pu_bacteria 8005682033 8005687076 273
667 iso_pu_bacteria 8005688590 8005694308 273
668 iso_pu_bacteria 8005695170 8005695901 273
669 iso_pu_bacteria 8018127388 8018128947 273
670 iso_pu_bacteria 8018150411 8018154655 273
671 iso_pu_bacteria 8018163183 8018164990 273
672 iso_pu_bacteria 8018176218 8018177568 273
673 iso_pu_bacteria 8023680758 8023686653 273
674 iso_pu_bacteria 8024479707 8024484469 273
675 iso_pu_bacteria 8024486573 8024490944 273
676 iso_pu_bacteria 8024501048 8024502042 273
677 iso_pu_bacteria 8046767195 8046767473 273
678 iso_pu_bacteria 8049293176 8049295599 273
679 iso_pu_bacteria 8055431914 8055431959 273
680 iso_pu_bacteria 8055617313 8055617359 273
681 iso_pu_bacteria 8056375014 8056380506 273
682 iso_pu_bacteria 8056382006 8056385277 273
683 iso_pu_bacteria 8056875544 8056876275 273
684 iso_pu_bacteria 8057575449 8057581864 273
685 iso_pu_bacteria 8057874678 8057879389 273
686 3300003187 JGI25151J46595_10001127 JGI25151J46595_1000112713 274
687 3300003771 Ga0055526_1001066 Ga0055526_10010668 274
688 3300003775 Ga0055524_1001370 Ga0055524_10013707 274
689 3300009101 Ga0105247_10151109 Ga0105247_101511091 274
690 3300009177 Ga0105248_10001664 Ga0105248_1000166418 274
691 3300009177 Ga0105248_10049509 Ga0105248_100495093 274
692 3300009177 Ga0105248_10049981 Ga0105248_100499814 274
693 3300009553 Ga0105249_10104647 Ga0105249_101046471 274
694 3300013297 Ga0157378_10499879 Ga0157378_104998791 274
695 3300013306 Ga0163162_10045639 Ga0163162_100456394 274
696 3300013308 Ga0157375_10001469 Ga0157375_1000146910 274
697 3300013308 Ga0157375_10255482 Ga0157375_102554821 274
698 3300014325 Ga0163163_10036645 Ga0163163_100366453 274
699 3300014325 Ga0163163_10253799 Ga0163163_102537992 274
700 3300014326 Ga0157380_10195657 Ga0157380_101956572 274
701 3300014326 Ga0157380_10452536 Ga0157380_104525362 274
702 3300014968 Ga0157379_10000142 Ga0157379_1000014252 274
703 3300025941 Ga0207711_10009821 Ga0207711_100098213 274
704 3300025960 Ga0207651_10008045 Ga0207651_100080451 274
705 3300041486 Ga0451807_1468043 Ga0451807_1468043_16_843 274
706 3300041511 Ga0451855_0216231 Ga0451855_0216231_302_1135 274
707 3300044673 Ga0453683_0014712 Ga0453683_0014712_1998_2825 274
708 3300045051 Ga0451576_0037377 Ga0451576_0037377_3535_4362 274
709 3300046459 Ga0495629_0175228 Ga0495629_0175228_457_1281 274
710 3300046460 Ga0495638_0000634 Ga0495638_0000634_16154_16978 274
711 3300046474 Ga0495605_0016147 Ga0495605_0016147_436_1260 274
712 3300046476 Ga0495662_0002911 Ga0495662_0002911_1919_2743 274
713 3300046507 Ga0495606_0008031 Ga0495606_0008031_4699_5523 274
714 3300046519 Ga0495632_0061726 Ga0495632_0061726_744_1568 274
715 3300046524 Ga0495648_0073693 Ga0495648_0073693_65_889 274
716 3300046529 Ga0495652_0176058 Ga0495652_0176058_627_1451 274
717 3300046536 Ga0495587_0106087 Ga0495587_0106087_597_1421 274
718 3300046538 Ga0495609_0074646 Ga0495609_0074646_496_1320 274
719 3300046616 Ga0495668_0105978 Ga0495668_0105978_507_1331 274
720 3300046660 Ga0495625_0109913 Ga0495625_0109913_828_1652 274
721 3300046675 Ga0495657_0043948 Ga0495657_0043948_2103_2927 274
722 3300046691 Ga0495670_0077759 Ga0495670_0077759_517_1341 274
723 3300046809 Ga0495600_0008229 Ga0495600_0008229_891_1715 274
724 3300046810 Ga0495660_0033073 Ga0495660_0033073_1646_2470 274
725 3300047317 Ga0495604_0042947 Ga0495604_0042947_2683_3507 274
726 3300047323 Ga0495683_0079008 Ga0495683_0079008_457_1281 274
727 3300048905 Ga0496102_0020537 Ga0496102_0020537_15_842 274
728 3300048906 Ga0496103_0022451 Ga0496103_0022451_726_1553 274
729 3300048910 Ga0496107_0193890 Ga0496107_0193890_398_1225 274
730 3300048912 Ga0496109_0038003 Ga0496109_0038003_326_1153 274
731 3300048914 Ga0496111_0338320 Ga0496111_0338320_51_878 274
732 3300048924 Ga0496121_0097455 Ga0496121_0097455_120_944 274
733 3300048927 Ga0496124_0026109 Ga0496124_0026109_1534_2358 274
734 3300053085 Ga0495619_0012995 Ga0495619_0012995_1157_1981 274
735 3300053086 Ga0500578_0064397 Ga0500578_0064397_880_1704 274
736 3300053139 Ga0500568_0000543 Ga0500568_0000543_20797_21621 274
737 3300053148 Ga0500590_000074 Ga0500590_000074_6146_6970 274
738 iso_pu_bacteria 2508501050 2508727659 274
739 iso_pu_bacteria 2508501114 2509077361 274
740 iso_pu_bacteria 2512875016 2512934468 274
741 iso_pu_bacteria 2513237090 2513609511 274
742 iso_pu_bacteria 2513237305 2514422093 274
743 iso_pu_bacteria 2537561587 2537876396 274
744 iso_pu_bacteria 2554235003 2554244582 274
745 iso_pu_bacteria 2558860242 2559297578 274
746 iso_pu_bacteria 2588253730 2588520638 274
747 iso_pu_bacteria 2599185210 2599604886 274
748 iso_pu_bacteria 2599185236 2599719981 274
749 iso_pu_bacteria 2600255279 2601612879 274
750 iso_pu_bacteria 2600255308 2601749608 274
751 iso_pu_bacteria 2643221564 2643839603 274
752 iso_pu_bacteria 2643221582 2643922171 274
753 iso_pu_bacteria 2643221693 2644523220 274
754 iso_pu_bacteria 2693429783 2694628509 274
755 iso_pu_bacteria 2693429784 2694640592 274
756 iso_pu_bacteria 2721755686 2723572580 274
757 iso_pu_bacteria 2738541317 2738944600 274
758 iso_pu_bacteria 2773857925 2774869155 274
759 iso_pu_bacteria 2775506901 2776258387 274
760 iso_pu_bacteria 2808606387 2808989934 274
761 iso_pu_bacteria 2818991439 2819557621 274
762 iso_pu_bacteria 2835312727 2835317457 274
763 iso_pu_bacteria 2838675328 2838678844 274
764 iso_pu_bacteria 2838714209 2838717795 274
765 iso_pu_bacteria 2838719591 2838723141 274
766 iso_pu_bacteria 2838724970 2838728512 274
767 iso_pu_bacteria 2841846520 2841849925 274
768 iso_pu_bacteria 2841859092 2841863728 274
769 iso_pu_bacteria 2842124991 2842128397 274
770 iso_pu_bacteria 2842130223 2842134005 274
771 iso_pu_bacteria 2842152218 2842155731 274
772 iso_pu_bacteria 2842170452 2842174041 274
773 iso_pu_bacteria 2842175837 2842179619 274
774 iso_pu_bacteria 2842187318 2842191140 274
775 iso_pu_bacteria 2842211629 2842215455 274
776 iso_pu_bacteria 2842224351 2842227906 274
777 iso_pu_bacteria 2842515876 2842520510 274
778 iso_pu_bacteria 2856364286 2856371242 274
779 iso_pu_bacteria 2857349434 2857354338 274
780 iso_pu_bacteria 2869285874 2869292465 274
781 iso_pu_bacteria 2871429161 2871429280 274
782 iso_pu_bacteria 2874146452 2874154186 274
783 iso_pu_bacteria 2874155637 2874161688 274
784 iso_pu_bacteria 2876363079 2876363270 274
785 iso_pu_bacteria 2876377896 2876379931 274
786 iso_pu_bacteria 2876413966 2876419870 274
787 iso_pu_bacteria 2878745973 2878752808 274
788 iso_pu_bacteria 2882456835 2882457615 274
789 iso_pu_bacteria 2884298095 2884301216 274
790 iso_pu_bacteria 2888350351 2888352276 274
791 iso_pu_bacteria 2889016732 2889021029 274
792 iso_pu_bacteria 2894232714 2894236160 274
793 iso_pu_bacteria 2899792073 2899793791 274
794 iso_pu_bacteria 2899845264 2899847624 274
795 iso_pu_bacteria 2903448605 2903454655 274
796 iso_pu_bacteria 2903492973 2903494907 274
797 iso_pu_bacteria 2903521522 2903525220 274
798 iso_pu_bacteria 2903528002 2903532035 274
799 iso_pu_bacteria 2906308376 2906315199 274
800 iso_pu_bacteria 2906321335 2906321455 274
801 iso_pu_bacteria 2906354277 2906354988 274
802 iso_pu_bacteria 2913308742 2913309221 274
803 iso_pu_bacteria 2919114240 2919118075 274
804 iso_pu_bacteria 2922130491 2922136777 274
805 iso_pu_bacteria 2926754445 2926757840 274
806 iso_pu_bacteria 2926760298 2926764536 274
807 iso_pu_bacteria 2933006813 2933006838 274
808 iso_pu_bacteria 2933011516 2933012063 274
809 iso_pu_bacteria 2933594066 2933597323 274
810 iso_pu_bacteria 2937813078 2937821741 274
811 iso_pu_bacteria 2937822353 2937826016 274
812 iso_pu_bacteria 2937848649 2937849836 274
813 iso_pu_bacteria 2938014810 2938016932 274
814 iso_pu_bacteria 2958100919 2958101452 274
815 iso_pu_bacteria 2958130278 2958136865 274
816 iso_pu_bacteria 2958172287 2958173747 274
817 iso_pu_bacteria 2958179912 2958186748 274
818 iso_pu_bacteria 2961077736 2961085249 274
819 iso_pu_bacteria 2963644680 2963644730 274
820 iso_pu_bacteria 2965119406 2965122422 274
821 iso_pu_bacteria 2968083720 2968088994 274
822 iso_pu_bacteria 2977843712 2977850034 274
823 iso_pu_bacteria 2977922695 2977925380 274
824 iso_pu_bacteria 2977971508 2977977363 274
825 iso_pu_bacteria 2977986579 2977987349 274
826 iso_pu_bacteria 2979089926 2979090358 274
827 iso_pu_bacteria 2979095461 2979095884 274
828 iso_pu_bacteria 2979100975 2979102663 274
829 iso_pu_bacteria 2979710463 2979712339 274
830 iso_pu_bacteria 2979742915 2979745168 274
831 iso_pu_bacteria 2984509177 2984509451 274
832 iso_pu_bacteria 2984518228 2984519849 274
833 iso_pu_bacteria 2984537506 2984537785 274
834 iso_pu_bacteria 2984601300 2984604527 274
835 iso_pu_bacteria 2987636660 2987642253 274
836 iso_pu_bacteria 2987652177 2987656385 274
837 iso_pu_bacteria 3004211236 3004216699 274
838 iso_pu_bacteria 3004218560 3004219732 274
839 iso_pu_bacteria 637000159 637077639 274
840 iso_pu_bacteria 650716007 650844017 274
841 iso_pu_bacteria 8003570095 8003574462 274
842 iso_pu_bacteria 8004387939 8004395139 274
843 iso_pu_bacteria 8004640170 8004646919 274
844 iso_pu_bacteria 8004714634 8004721460 274
845 iso_pu_bacteria 8054460903 8054463549 274
846 3300001979 JGI24740J21852_10045024 JGI24740J21852_100450242 275
847 3300003762 Ga0055542_1000625 Ga0055542_10006254 275
848 3300005459 Ga0068867_100103872 Ga0068867_1001038722 275
849 3300005616 Ga0068852_100509436 Ga0068852_1005094362 275
850 3300006048 Ga0075363_100104619 Ga0075363_1001046192 275
851 3300006051 Ga0075364_10033083 Ga0075364_100330834 275
852 3300009174 Ga0105241_10152731 Ga0105241_101527312 275
853 3300014969 Ga0157376_10261079 Ga0157376_102610792 275
854 3300021361 Ga0213872_10000023 Ga0213872_1000002348 275
855 3300025254 Ga0209148_1000032 Ga0209148_100003249 275
856 3300025272 Ga0209455_1000098 Ga0209455_1000098140 275
857 3300025907 Ga0207645_10066091 Ga0207645_100660913 275
858 3300025919 Ga0207657_10074778 Ga0207657_100747782 275
859 3300025935 Ga0207709_10324441 Ga0207709_103244412 275
860 3300026089 Ga0207648_10147107 Ga0207648_101471072 275
861 3300026089 Ga0207648_10215624 Ga0207648_102156242 275
862 3300026142 Ga0207698_10107153 Ga0207698_101071533 275
863 3300028379 Ga0268266_10125430 Ga0268266_101254302 275
864 3300039447 Ga0436361_0060434 Ga0436361_0060434_116266_117099 275
865 3300046460 Ga0495638_0241188 Ga0495638_0241188_49_885 275
866 3300046660 Ga0495625_0034062 Ga0495625_0034062_86_922 275
867 3300047472 Ga0495686_0131029 Ga0495686_0131029_402_1238 275
868 3300048924 Ga0496121_0000180 Ga0496121_0000180_76023_76859 275
869 3300050491 nmdc:mga00v17_94859_c1 nmdc:mga00v17_94859_c1_666_1499 275
870 3300050492 nmdc:mga0yw44_155727_c1 nmdc:mga0yw44_155727_c1_30_863 275
871 3300050492 nmdc:mga0yw44_232528_c1 nmdc:mga0yw44_232528_c1_309_1145 275
872 3300053139 Ga0500568_0040675 Ga0500568_0040675_671_1504 275
873 3300053727 Ga0500611_014440 Ga0500611_014440_532_1368 275
874 3300059423 Ga0590074_021251 Ga0590074_021251_97_942 275
875 iso_pu_bacteria 2599185301 2599935748 275
876 iso_pu_bacteria 2687453129 2687580809 275
877 iso_pu_bacteria 2838736955 2838737238 275
878 iso_pu_bacteria 2841840854 2841842393 275
879 iso_pu_bacteria 2842140634 2842142173 275
880 iso_pu_bacteria 2889010040 2889014266 275
881 iso_pu_bacteria 2968117919 2968121588 275
882 iso_pu_bacteria 2977942078 2977943647 275
883 iso_pu_bacteria 3004203850 3004210339 275
884 3300001989 JGI24739J22299_10005813 JGI24739J22299_100058135 276
885 3300003771 Ga0055526_1003358 Ga0055526_10033586 276
886 3300003773 Ga0055537_1000356 Ga0055537_10003569 276
887 3300003775 Ga0055524_1000213 Ga0055524_100021324 276
888 3300003784 Ga0055534_1008979 Ga0055534_10089792 276
889 3300003790 Ga0055528_1004586 Ga0055528_10045865 276
890 3300005327 Ga0070658_10166017 Ga0070658_101660172 276
891 3300005331 Ga0070670_100000061 Ga0070670_10000006150 276
892 3300005356 Ga0070674_100023406 Ga0070674_1000234063 276
893 3300005539 Ga0068853_100103622 Ga0068853_1001036222 276
894 3300005563 Ga0068855_100653813 Ga0068855_1006538132 276
895 3300005614 Ga0068856_100261907 Ga0068856_1002619072 276
896 3300005616 Ga0068852_100316193 Ga0068852_1003161932 276
897 3300009545 Ga0105237_10009556 Ga0105237_100095565 276
898 3300009551 Ga0105238_10002270 Ga0105238_1000227011 276
899 3300010375 Ga0105239_10012124 Ga0105239_100121247 276
900 3300010375 Ga0105239_10059347 Ga0105239_100593472 276
901 3300013105 Ga0157369_10141283 Ga0157369_101412833 276
902 3300025263 Ga0209565_1000041 Ga0209565_100004128 276
903 3300025273 Ga0209673_1000364 Ga0209673_100036419 276
904 3300025291 Ga0209675_1004149 Ga0209675_10041497 276
905 3300025295 Ga0209564_1000875 Ga0209564_100087510 276
906 3300025297 Ga0209758_1003869 Ga0209758_10038692 276
907 3300025299 Ga0209256_1000003 Ga0209256_1000003138 276
908 3300025904 Ga0207647_10034917 Ga0207647_100349174 276
909 3300025913 Ga0207695_10068039 Ga0207695_100680392 276
910 3300025914 Ga0207671_10164400 Ga0207671_101644002 276
911 3300025919 Ga0207657_10026933 Ga0207657_100269333 276
912 3300025924 Ga0207694_10013279 Ga0207694_100132792 276
913 3300025925 Ga0207650_10000207 Ga0207650_1000020716 276
914 3300025932 Ga0207690_10081354 Ga0207690_100813542 276
915 3300025937 Ga0207669_10313464 Ga0207669_103134642 276
916 3300025938 Ga0207704_10033798 Ga0207704_100337982 276
917 3300025940 Ga0207691_10016814 Ga0207691_100168143 276
918 3300025960 Ga0207651_10060537 Ga0207651_100605372 276
919 3300025972 Ga0207668_10420134 Ga0207668_104201342 276
920 3300026041 Ga0207639_10061117 Ga0207639_100611173 276
921 3300026142 Ga0207698_10251386 Ga0207698_102513862 276
922 3300026142 Ga0207698_10800667 Ga0207698_108006671 276
923 3300046543 Ga0495645_0129862 Ga0495645_0129862_637_1473 276
924 3300048922 Ga0496119_0030888 Ga0496119_0030888_2052_2888 276
925 3300048923 Ga0496120_0004732 Ga0496120_0004732_840_1676 276
926 3300048924 Ga0496121_0229919 Ga0496121_0229919_144_992 276
927 3300048929 Ga0496126_0059556 Ga0496126_0059556_700_1548 276
928 3300048929 Ga0496126_0107840 Ga0496126_0107840_1153_1989 276
929 3300049570 Ga0501033_0099576 Ga0501033_0099576_982_1824 276
930 3300049571 Ga0501034_0038350 Ga0501034_0038350_2577_3419 276
931 3300049571 Ga0501034_0061166 Ga0501034_0061166_2078_2908 276
932 3300049571 Ga0501034_0092703 Ga0501034_0092703_1939_2784 276
933 3300049571 Ga0501034_0121215 Ga0501034_0121215_21_863 276
934 3300049574 Ga0501038_0040126 Ga0501038_0040126_1332_2174 276
935 3300049575 Ga0501039_0041520 Ga0501039_0041520_46_888 276
936 3300049579 Ga0501043_0077095 Ga0501043_0077095_1631_2473 276
937 3300049581 Ga0501047_0506694 Ga0501047_0506694_41_883 276
938 3300049586 Ga0501070_0077896 Ga0501070_0077896_1640_2482 276
939 3300049823 Ga0501044_0113991 Ga0501044_0113991_117_959 276
940 3300050493 nmdc:mga0k408_155389_c1 nmdc:mga0k408_155389_c1_221_1069 276
941 3300053108 Ga0500562_053643 Ga0500562_053643_177_1019 276
942 3300053139 Ga0500568_0000116 Ga0500568_0000116_58587_59417 276
943 3300053139 Ga0500568_0043745 Ga0500568_0043745_800_1645 276
944 iso_pu_bacteria 2977864932 2977868316 276
945 3300001979 JGI24740J21852_10028962 JGI24740J21852_100289622 277
946 3300002704 JGI25155J39150_1000004 JGI25155J39150_1000004202 277
947 3300002704 JGI25155J39150_1000323 JGI25155J39150_10003239 277
948 3300002705 JGI25156J39149_1000015 JGI25156J39149_1000015118 277
949 3300002705 JGI25156J39149_1000897 JGI25156J39149_10008976 277
950 3300002737 JGI25162J39368_1000199 JGI25162J39368_100019935 277
951 3300002738 JGI25154J39366_1000026 JGI25154J39366_1000026130 277
952 3300002738 JGI25154J39366_1000657 JGI25154J39366_10006577 277
953 3300002739 JGI25158J39367_1003398 JGI25158J39367_10033983 277
954 3300002741 JGI25157J39369_1000005 JGI25157J39369_100000561 277
955 3300002741 JGI25157J39369_1000791 JGI25157J39369_10007917 277
956 3300002741 JGI25157J39369_1001657 JGI25157J39369_10016576 277
957 3300002773 JGI25152J39213_1002516 JGI25152J39213_10025166 277
958 3300002773 JGI25152J39213_1004259 JGI25152J39213_10042594 277
959 3300002773 JGI25152J39213_1008325 JGI25152J39213_10083251 277
960 3300002774 JGI25150J39212_1000018 JGI25150J39212_100001885 277
961 3300002774 JGI25150J39212_1006657 JGI25150J39212_10066573 277
962 3300002774 JGI25150J39212_1008418 JGI25150J39212_10084182 277
963 3300002774 JGI25150J39212_1009168 JGI25150J39212_10091682 277
964 3300002987 JGI25159J45721_1000008 JGI25159J45721_1000008139 277
965 3300002987 JGI25159J45721_1000079 JGI25159J45721_100007923 277
966 3300002987 JGI25159J45721_1000407 JGI25159J45721_10004077 277
967 3300002987 JGI25159J45721_1001232 JGI25159J45721_10012326 277
968 3300002987 JGI25159J45721_1011617 JGI25159J45721_10116172 277
969 3300003187 JGI25151J46595_10000034 JGI25151J46595_1000003493 277
970 3300003187 JGI25151J46595_10002080 JGI25151J46595_100020806 277
971 3300003187 JGI25151J46595_10009811 JGI25151J46595_100098114 277
972 3300003187 JGI25151J46595_10010876 JGI25151J46595_100108764 277
973 3300003187 JGI25151J46595_10013943 JGI25151J46595_100139433 277
974 3300003187 JGI25151J46595_10015475 JGI25151J46595_100154752 277
975 3300003187 JGI25151J46595_10017735 JGI25151J46595_100177352 277
976 3300003187 JGI25151J46595_10039673 JGI25151J46595_100396732 277
977 3300003187 JGI25151J46595_10049082 JGI25151J46595_100490822 277
978 3300003214 JGI25165J46597_1000019 JGI25165J46597_1000019211 277
979 3300003214 JGI25165J46597_1000307 JGI25165J46597_100030714 277
980 3300003215 JGI25153J46596_10004405 JGI25153J46596_100044056 277
981 3300003215 JGI25153J46596_10006553 JGI25153J46596_100065536 277
982 3300003215 JGI25153J46596_10022201 JGI25153J46596_100222012 277
983 3300003215 JGI25153J46596_10022839 JGI25153J46596_100228393 277
984 3300003354 JGI25160J50197_1000033 JGI25160J50197_100003336 277
985 3300003354 JGI25160J50197_1000109 JGI25160J50197_100010924 277
986 3300003354 JGI25160J50197_1000172 JGI25160J50197_100017243 277
987 3300003354 JGI25160J50197_1005531 JGI25160J50197_10055315 277
988 3300003374 JGI25161J50226_1000007 JGI25161J50226_100000786 277
989 3300003374 JGI25161J50226_1000011 JGI25161J50226_100001124 277
990 3300003374 JGI25161J50226_1000038 JGI25161J50226_100003888 277
991 3300003374 JGI25161J50226_1000357 JGI25161J50226_100035721 277
992 3300003374 JGI25161J50226_1010655 JGI25161J50226_10106551 277
993 3300003578 Ga0006562J51391_1045286 Ga0006562J51391_10452861 277
994 3300003759 Ga0055525_1000053 Ga0055525_1000053163 277
995 3300003771 Ga0055526_1000361 Ga0055526_100036125 277
996 3300003771 Ga0055526_1002672 Ga0055526_10026726 277
997 3300003771 Ga0055526_1002681 Ga0055526_10026815 277
998 3300003771 Ga0055526_1003566 Ga0055526_10035665 277
999 3300003771 Ga0055526_1014546 Ga0055526_10145463 277
1000 3300003775 Ga0055524_1001146 Ga0055524_10011465 277
1001 3300003775 Ga0055524_1001377 Ga0055524_100137712 277
1002 3300003775 Ga0055524_1002351 Ga0055524_10023518 277
1003 3300003775 Ga0055524_1020238 Ga0055524_10202382 277
1004 3300003775 Ga0055524_1026321 Ga0055524_10263211 277
1005 3300003781 Ga0055536_1001937 Ga0055536_10019376 277
1006 3300003781 Ga0055536_1003918 Ga0055536_10039182 277
1007 3300003781 Ga0055536_1005157 Ga0055536_10051577 277
1008 3300003790 Ga0055528_1000433 Ga0055528_100043314 277
1009 3300003790 Ga0055528_1001020 Ga0055528_10010203 277
1010 3300003790 Ga0055528_1001206 Ga0055528_10012068 277
1011 3300003790 Ga0055528_1001875 Ga0055528_10018755 277
1012 3300003790 Ga0055528_1005560 Ga0055528_10055604 277
1013 3300003790 Ga0055528_1008511 Ga0055528_10085116 277
1014 3300003790 Ga0055528_1028327 Ga0055528_10283272 277
1015 3300003791 Ga0055530_10000763 Ga0055530_100007634 277
1016 3300003791 Ga0055530_10001299 Ga0055530_100012997 277
1017 3300003791 Ga0055530_10011055 Ga0055530_100110552 277
1018 3300003792 Ga0055540_1000324 Ga0055540_100032430 277
1019 3300003792 Ga0055540_1000504 Ga0055540_100050425 277
1020 3300003792 Ga0055540_1003695 Ga0055540_10036953 277
1021 3300003792 Ga0055540_1010512 Ga0055540_10105122 277
1022 3300003792 Ga0055540_1016977 Ga0055540_10169772 277
1023 3300003794 Ga0055531_10004306 Ga0055531_100043067 277
1024 3300003794 Ga0055531_10004903 Ga0055531_100049036 277
1025 3300003794 Ga0055531_10005891 Ga0055531_100058914 277
1026 3300003856 Ga0058692_1002714 Ga0058692_10027145 277
1027 3300003856 Ga0058692_1005559 Ga0058692_10055592 277
1028 3300003856 Ga0058692_1008272 Ga0058692_10082722 277
1029 3300004625 Ga0055543_1000026 Ga0055543_1000026104 277
1030 3300004625 Ga0055543_1000071 Ga0055543_100007166 277
1031 3300004625 Ga0055543_1000106 Ga0055543_100010635 277
1032 3300005262 Ga0065165_1000135 Ga0065165_100013524 277
1033 3300005262 Ga0065165_1000178 Ga0065165_100017836 277
1034 3300005262 Ga0065165_1007140 Ga0065165_10071406 277
1035 3300005262 Ga0065165_1018011 Ga0065165_10180112 277
1036 3300005328 Ga0070676_10156017 Ga0070676_101560171 277
1037 3300005331 Ga0070670_100002139 Ga0070670_1000021397 277
1038 3300005331 Ga0070670_100004009 Ga0070670_10000400912 277
1039 3300005331 Ga0070670_100004917 Ga0070670_1000049173 277
1040 3300005331 Ga0070670_100024623 Ga0070670_1000246233 277
1041 3300005331 Ga0070670_100071595 Ga0070670_1000715953 277
1042 3300005333 Ga0070677_10089624 Ga0070677_100896241 277
1043 3300005334 Ga0068869_100000007 Ga0068869_10000000713 277
1044 3300005334 Ga0068869_100011980 Ga0068869_1000119802 277
1045 3300005335 Ga0070666_10138111 Ga0070666_101381112 277
1046 3300005340 Ga0070689_100143158 Ga0070689_1001431582 277
1047 3300005347 Ga0070668_100010303 Ga0070668_1000103038 277
1048 3300005353 Ga0070669_100009394 Ga0070669_1000093941 277
1049 3300005353 Ga0070669_100031327 Ga0070669_1000313273 277
1050 3300005353 Ga0070669_100306936 Ga0070669_1003069362 277
1051 3300005354 Ga0070675_100008830 Ga0070675_1000088303 277
1052 3300005354 Ga0070675_100008944 Ga0070675_1000089444 277
1053 3300005355 Ga0070671_100012661 Ga0070671_1000126618 277
1054 3300005355 Ga0070671_100304582 Ga0070671_1003045821 277
1055 3300005364 Ga0070673_100044158 Ga0070673_1000441582 277
1056 3300005364 Ga0070673_100115291 Ga0070673_1001152912 277
1057 3300005367 Ga0070667_100001939 Ga0070667_1000019398 277
1058 3300005367 Ga0070667_100033931 Ga0070667_1000339314 277
1059 3300005367 Ga0070667_100052380 Ga0070667_1000523802 277
1060 3300005438 Ga0070701_10109495 Ga0070701_101094952 277
1061 3300005455 Ga0070663_100123092 Ga0070663_1001230922 277
1062 3300005456 Ga0070678_100159653 Ga0070678_1001596532 277
1063 3300005456 Ga0070678_100287784 Ga0070678_1002877842 277
1064 3300005457 Ga0070662_100032281 Ga0070662_1000322812 277
1065 3300005457 Ga0070662_100066591 Ga0070662_1000665913 277
1066 3300005459 Ga0068867_100038765 Ga0068867_1000387651 277
1067 3300005459 Ga0068867_100189789 Ga0068867_1001897891 277
1068 3300005468 Ga0070707_100077038 Ga0070707_1000770383 277
1069 3300005471 Ga0070698_100265986 Ga0070698_1002659862 277
1070 3300005543 Ga0070672_100024379 Ga0070672_1000243792 277
1071 3300005543 Ga0070672_100144065 Ga0070672_1001440652 277
1072 3300005548 Ga0070665_100038392 Ga0070665_1000383922 277
1073 3300005548 Ga0070665_100187873 Ga0070665_1001878732 277
1074 3300005548 Ga0070665_100190852 Ga0070665_1001908521 277
1075 3300005548 Ga0070665_100299133 Ga0070665_1002991332 277
1076 3300005548 Ga0070665_100468584 Ga0070665_1004685842 277
1077 3300005563 Ga0068855_100158526 Ga0068855_1001585262 277
1078 3300005577 Ga0068857_100000676 Ga0068857_10000067619 277
1079 3300005614 Ga0068856_100173944 Ga0068856_1001739442 277
1080 3300005614 Ga0068856_100423633 Ga0068856_1004236332 277
1081 3300005617 Ga0068859_100003514 Ga0068859_10000351411 277
1082 3300005618 Ga0068864_100001466 Ga0068864_10000146617 277
1083 3300005618 Ga0068864_100018957 Ga0068864_1000189573 277
1084 3300005618 Ga0068864_100031537 Ga0068864_1000315374 277
1085 3300005618 Ga0068864_100305512 Ga0068864_1003055122 277
1086 3300005719 Ga0068861_100001688 Ga0068861_10000168812 277
1087 3300005719 Ga0068861_100075375 Ga0068861_1000753753 277
1088 3300005841 Ga0068863_100001574 Ga0068863_10000157422 277
1089 3300005841 Ga0068863_100010047 Ga0068863_10001004712 277
1090 3300005841 Ga0068863_100078212 Ga0068863_1000782123 277
1091 3300005842 Ga0068858_100013010 Ga0068858_1000130106 277
1092 3300005843 Ga0068860_100005878 Ga0068860_10000587810 277
1093 3300005843 Ga0068860_100073368 Ga0068860_1000733682 277
1094 3300005843 Ga0068860_100140560 Ga0068860_1001405602 277
1095 3300005844 Ga0068862_100002922 Ga0068862_10000292210 277
1096 3300005844 Ga0068862_100018133 Ga0068862_1000181337 277
1097 3300005844 Ga0068862_100072758 Ga0068862_1000727582 277
1098 3300005844 Ga0068862_100159767 Ga0068862_1001597672 277
1099 3300005937 Ga0081455_10102813 Ga0081455_101028132 277
1100 3300006038 Ga0075365_10002874 Ga0075365_100028744 277
1101 3300006038 Ga0075365_10003514 Ga0075365_100035146 277
1102 3300006042 Ga0075368_10001283 Ga0075368_100012832 277
1103 3300006042 Ga0075368_10057189 Ga0075368_100571892 277
1104 3300006042 Ga0075368_10061687 Ga0075368_100616872 277
1105 3300006048 Ga0075363_100030258 Ga0075363_1000302582 277
1106 3300006051 Ga0075364_10000074 Ga0075364_1000007435 277
1107 3300006051 Ga0075364_10007527 Ga0075364_100075274 277
1108 3300006051 Ga0075364_10087480 Ga0075364_100874802 277
1109 3300006051 Ga0075364_10152919 Ga0075364_101529192 277
1110 3300006177 Ga0075362_10052148 Ga0075362_100521482 277
1111 3300006177 Ga0075362_10066958 Ga0075362_100669582 277
1112 3300006178 Ga0075367_10010987 Ga0075367_100109872 277
1113 3300006178 Ga0075367_10155514 Ga0075367_101555142 277
1114 3300006178 Ga0075367_10183470 Ga0075367_101834702 277
1115 3300006178 Ga0075367_10247910 Ga0075367_102479102 277
1116 3300006178 Ga0075367_10261283 Ga0075367_102612832 277
1117 3300006186 Ga0075369_10134910 Ga0075369_101349102 277
1118 3300006195 Ga0075366_10031674 Ga0075366_100316743 277
1119 3300006237 Ga0097621_100011117 Ga0097621_1000111173 277
1120 3300006358 Ga0068871_100236521 Ga0068871_1002365212 277
1121 3300006881 Ga0068865_100028929 Ga0068865_1000289292 277
1122 3300006931 Ga0097620_100003514 Ga0097620_10000351411 277
1123 3300006946 Ga0079104_1000063 Ga0079104_100006334 277
1124 3300006946 Ga0079104_1003309 Ga0079104_10033097 277
1125 3300006946 Ga0079104_1003311 Ga0079104_10033118 277
1126 3300006946 Ga0079104_1020326 Ga0079104_10203262 277
1127 3300006948 Ga0099826_10000045 Ga0099826_1000004553 277
1128 3300009036 Ga0105244_10014754 Ga0105244_100147545 277
1129 3300009093 Ga0105240_10000013 Ga0105240_10000013433 277
1130 3300009101 Ga0105247_10138500 Ga0105247_101385002 277
1131 3300009148 Ga0105243_10059067 Ga0105243_100590672 277
1132 3300009148 Ga0105243_10231444 Ga0105243_102314442 277
1133 3300009177 Ga0105248_10157139 Ga0105248_101571392 277
1134 3300009545 Ga0105237_10025658 Ga0105237_100256582 277
1135 3300009765 Ga0123341_1000218 Ga0123341_100021817 277
1136 3300009766 Ga0123342_1025427 Ga0123342_10254274 277
1137 3300010375 Ga0105239_10006528 Ga0105239_100065284 277
1138 3300011119 Ga0105246_10404112 Ga0105246_104041122 277
1139 3300012500 Ga0157314_1001166 Ga0157314_10011662 277
1140 3300012513 Ga0157326_1005231 Ga0157326_10052312 277
1141 3300013100 Ga0157373_10044853 Ga0157373_100448533 277
1142 3300013102 Ga0157371_10000031 Ga0157371_10000031187 277
1143 3300013102 Ga0157371_10078481 Ga0157371_100784812 277
1144 3300013104 Ga0157370_10000836 Ga0157370_1000083622 277
1145 3300013104 Ga0157370_10004414 Ga0157370_1000441412 277
1146 3300013249 Ga0171463_1007 Ga0171463_1007160 277
1147 3300013297 Ga0157378_10061358 Ga0157378_100613584 277
1148 3300013306 Ga0163162_10125421 Ga0163162_101254212 277
1149 3300013306 Ga0163162_10665787 Ga0163162_106657872 277
1150 3300013308 Ga0157375_10306556 Ga0157375_103065562 277
1151 3300013308 Ga0157375_10366068 Ga0157375_103660682 277
1152 3300014325 Ga0163163_10001547 Ga0163163_1000154712 277
1153 3300014497 Ga0182008_10015519 Ga0182008_100155191 277
1154 3300014968 Ga0157379_10471952 Ga0157379_104719522 277
1155 3300014969 Ga0157376_10029249 Ga0157376_100292493 277
1156 3300015262 Ga0182007_10007442 Ga0182007_100074424 277
1157 3300015265 Ga0182005_1000640 Ga0182005_10006405 277
1158 3300015684 Ga0183365_10112 Ga0183365_101122 277
1159 3300015690 Ga0183363_1138 Ga0183363_11383 277
1160 3300021320 Ga0214544_1000010 Ga0214544_1000010102 277
1161 3300021321 Ga0214542_1000023 Ga0214542_1000023150 277
1162 3300021321 Ga0214542_1019691 Ga0214542_10196913 277
1163 3300021327 Ga0214543_1000019 Ga0214543_1000019225 277
1164 3300021327 Ga0214543_1000022 Ga0214543_1000022179 277
1165 3300021388 Ga0213875_10009112 Ga0213875_100091124 277
1166 3300022739 Ga0228711_1000017 Ga0228711_1000017120 277
1167 3300022740 Ga0228710_1000005 Ga0228710_1000005133 277
1168 3300025206 Ga0209435_100009 Ga0209435_10000960 277
1169 3300025206 Ga0209435_100019 Ga0209435_100019125 277
1170 3300025208 Ga0209436_100045 Ga0209436_10004536 277
1171 3300025208 Ga0209436_101207 Ga0209436_1012072 277
1172 3300025230 Ga0209563_100014 Ga0209563_100014825 277
1173 3300025233 Ga0209437_100182 Ga0209437_10018264 277
1174 3300025233 Ga0209437_100204 Ga0209437_10020458 277
1175 3300025245 Ga0207425_1000035 Ga0207425_1000035116 277
1176 3300025245 Ga0207425_1001535 Ga0207425_10015357 277
1177 3300025245 Ga0207425_1001851 Ga0207425_10018519 277
1178 3300025245 Ga0207425_1030933 Ga0207425_10309331 277
1179 3300025246 Ga0209646_1000018 Ga0209646_100001860 277
1180 3300025246 Ga0209646_1000038 Ga0209646_1000038126 277
1181 3300025246 Ga0209646_1004669 Ga0209646_10046694 277
1182 3300025250 Ga0209026_1000013 Ga0209026_1000013184 277
1183 3300025250 Ga0209026_1000043 Ga0209026_100004360 277
1184 3300025250 Ga0209026_1000048 Ga0209026_1000048125 277
1185 3300025253 Ga0209677_100728 Ga0209677_1007285 277
1186 3300025256 Ga0209759_1000007 Ga0209759_100000760 277
1187 3300025256 Ga0209759_1000038 Ga0209759_1000038119 277
1188 3300025256 Ga0209759_1000058 Ga0209759_1000058132 277
1189 3300025258 Ga0209129_1000029 Ga0209129_1000029116 277
1190 3300025258 Ga0209129_1000050 Ga0209129_1000050224 277
1191 3300025258 Ga0209129_1000623 Ga0209129_10006237 277
1192 3300025258 Ga0209129_1000807 Ga0209129_100080722 277
1193 3300025258 Ga0209129_1001333 Ga0209129_10013338 277
1194 3300025258 Ga0209129_1004423 Ga0209129_10044234 277
1195 3300025258 Ga0209129_1011796 Ga0209129_10117962 277
1196 3300025261 Ga0209233_1000034 Ga0209233_1000034395 277
1197 3300025261 Ga0209233_1000231 Ga0209233_100023151 277
1198 3300025261 Ga0209233_1000280 Ga0209233_100028019 277
1199 3300025261 Ga0209233_1000388 Ga0209233_100038822 277
1200 3300025261 Ga0209233_1005717 Ga0209233_10057172 277
1201 3300025263 Ga0209565_1000333 Ga0209565_10003338 277
1202 3300025263 Ga0209565_1016313 Ga0209565_10163132 277
1203 3300025263 Ga0209565_1019493 Ga0209565_10194932 277
1204 3300025272 Ga0209455_1019769 Ga0209455_10197692 277
1205 3300025273 Ga0209673_1000033 Ga0209673_1000033140 277
1206 3300025273 Ga0209673_1000050 Ga0209673_1000050117 277
1207 3300025273 Ga0209673_1000052 Ga0209673_1000052255 277
1208 3300025273 Ga0209673_1001686 Ga0209673_10016865 277
1209 3300025273 Ga0209673_1006199 Ga0209673_10061992 277
1210 3300025273 Ga0209673_1016436 Ga0209673_10164362 277
1211 3300025273 Ga0209673_1024925 Ga0209673_10249252 277
1212 3300025284 Ga0209130_1000009 Ga0209130_1000009157 277
1213 3300025284 Ga0209130_1000017 Ga0209130_1000017141 277
1214 3300025284 Ga0209130_1000058 Ga0209130_1000058166 277
1215 3300025284 Ga0209130_1000245 Ga0209130_10002457 277
1216 3300025284 Ga0209130_1000708 Ga0209130_100070824 277
1217 3300025284 Ga0209130_1005012 Ga0209130_10050122 277
1218 3300025291 Ga0209675_1003873 Ga0209675_10038734 277
1219 3300025292 Ga0209676_1000013 Ga0209676_1000013263 277
1220 3300025292 Ga0209676_1002248 Ga0209676_10022486 277
1221 3300025292 Ga0209676_1002662 Ga0209676_10026626 277
1222 3300025292 Ga0209676_1003354 Ga0209676_10033544 277
1223 3300025292 Ga0209676_1004193 Ga0209676_10041937 277
1224 3300025292 Ga0209676_1021737 Ga0209676_10217372 277
1225 3300025294 Ga0209025_1000132 Ga0209025_100013290 277
1226 3300025294 Ga0209025_1000153 Ga0209025_100015334 277
1227 3300025294 Ga0209025_1000227 Ga0209025_100022759 277
1228 3300025294 Ga0209025_1001158 Ga0209025_10011588 277
1229 3300025294 Ga0209025_1001511 Ga0209025_100151117 277
1230 3300025294 Ga0209025_1004718 Ga0209025_10047182 277
1231 3300025294 Ga0209025_1006680 Ga0209025_10066805 277
1232 3300025294 Ga0209025_1009265 Ga0209025_10092653 277
1233 3300025294 Ga0209025_1010428 Ga0209025_10104284 277
1234 3300025294 Ga0209025_1020559 Ga0209025_10205593 277
1235 3300025294 Ga0209025_1033375 Ga0209025_10333752 277
1236 3300025294 Ga0209025_1035476 Ga0209025_10354763 277
1237 3300025294 Ga0209025_1041425 Ga0209025_10414252 277
1238 3300025294 Ga0209025_1081078 Ga0209025_10810781 277
1239 3300025295 Ga0209564_1000013 Ga0209564_1000013590 277
1240 3300025295 Ga0209564_1000236 Ga0209564_100023618 277
1241 3300025295 Ga0209564_1000795 Ga0209564_10007955 277
1242 3300025295 Ga0209564_1001920 Ga0209564_10019201 277
1243 3300025295 Ga0209564_1002543 Ga0209564_10025435 277
1244 3300025295 Ga0209564_1021554 Ga0209564_10215543 277
1245 3300025295 Ga0209564_1030732 Ga0209564_10307322 277
1246 3300025297 Ga0209758_1000105 Ga0209758_100010584 277
1247 3300025297 Ga0209758_1000299 Ga0209758_100029969 277
1248 3300025297 Ga0209758_1000672 Ga0209758_100067214 277
1249 3300025297 Ga0209758_1002015 Ga0209758_10020158 277
1250 3300025297 Ga0209758_1006091 Ga0209758_10060914 277
1251 3300025297 Ga0209758_1039062 Ga0209758_10390622 277
1252 3300025297 Ga0209758_1048222 Ga0209758_10482222 277
1253 3300025298 Ga0209050_1000008 Ga0209050_1000008263 277
1254 3300025298 Ga0209050_1001244 Ga0209050_10012444 277
1255 3300025298 Ga0209050_1007330 Ga0209050_10073304 277
1256 3300025298 Ga0209050_1009958 Ga0209050_10099583 277
1257 3300025298 Ga0209050_1015111 Ga0209050_10151113 277
1258 3300025298 Ga0209050_1026031 Ga0209050_10260312 277
1259 3300025299 Ga0209256_1000211 Ga0209256_100021181 277
1260 3300025299 Ga0209256_1000250 Ga0209256_100025064 277
1261 3300025299 Ga0209256_1000279 Ga0209256_100027962 277
1262 3300025299 Ga0209256_1000563 Ga0209256_100056329 277
1263 3300025299 Ga0209256_1002290 Ga0209256_100229016 277
1264 3300025299 Ga0209256_1003062 Ga0209256_10030624 277
1265 3300025299 Ga0209256_1021436 Ga0209256_10214362 277
1266 3300025299 Ga0209256_1038815 Ga0209256_10388152 277
1267 3300025302 Ga0207426_1000006 Ga0207426_1000006140 277
1268 3300025302 Ga0207426_1000041 Ga0207426_100004195 277
1269 3300025302 Ga0207426_1000070 Ga0207426_1000070250 277
1270 3300025302 Ga0207426_1000091 Ga0207426_1000091133 277
1271 3300025302 Ga0207426_1000131 Ga0207426_1000131166 277
1272 3300025302 Ga0207426_1001967 Ga0207426_10019676 277
1273 3300025303 Ga0209051_1000005 Ga0209051_1000005263 277
1274 3300025303 Ga0209051_1000118 Ga0209051_1000118107 277
1275 3300025303 Ga0209051_1001915 Ga0209051_10019153 277
1276 3300025303 Ga0209051_1003142 Ga0209051_100314212 277
1277 3300025303 Ga0209051_1005999 Ga0209051_10059995 277
1278 3300025303 Ga0209051_1017785 Ga0209051_10177852 277
1279 3300025303 Ga0209051_1026475 Ga0209051_10264753 277
1280 3300025303 Ga0209051_1033218 Ga0209051_10332182 277
1281 3300025304 Ga0209257_1000048 Ga0209257_1000048263 277
1282 3300025304 Ga0209257_1002408 Ga0209257_10024085 277
1283 3300025304 Ga0209257_1002982 Ga0209257_100298217 277
1284 3300025304 Ga0209257_1003928 Ga0209257_10039287 277
1285 3300025304 Ga0209257_1005759 Ga0209257_10057592 277
1286 3300025304 Ga0209257_1011541 Ga0209257_10115411 277
1287 3300025304 Ga0209257_1015344 Ga0209257_10153443 277
1288 3300025899 Ga0207642_10050764 Ga0207642_100507642 277
1289 3300025907 Ga0207645_10009537 Ga0207645_100095376 277
1290 3300025908 Ga0207643_10091362 Ga0207643_100913622 277
1291 3300025913 Ga0207695_10000044 Ga0207695_10000044390 277
1292 3300025914 Ga0207671_10000043 Ga0207671_1000004398 277
1293 3300025922 Ga0207646_10368222 Ga0207646_103682222 277
1294 3300025923 Ga0207681_10021049 Ga0207681_100210494 277
1295 3300025925 Ga0207650_10054175 Ga0207650_100541754 277
1296 3300025925 Ga0207650_10095453 Ga0207650_100954533 277
1297 3300025925 Ga0207650_10139975 Ga0207650_101399753 277
1298 3300025926 Ga0207659_10016896 Ga0207659_100168963 277
1299 3300025926 Ga0207659_10254334 Ga0207659_102543342 277
1300 3300025931 Ga0207644_10080691 Ga0207644_100806912 277
1301 3300025931 Ga0207644_10104340 Ga0207644_101043403 277
1302 3300025931 Ga0207644_10324825 Ga0207644_103248252 277
1303 3300025933 Ga0207706_10008309 Ga0207706_1000830910 277
1304 3300025933 Ga0207706_10047586 Ga0207706_100475864 277
1305 3300025935 Ga0207709_10169285 Ga0207709_101692852 277
1306 3300025935 Ga0207709_10215432 Ga0207709_102154322 277
1307 3300025936 Ga0207670_10107346 Ga0207670_101073462 277
1308 3300025940 Ga0207691_10000111 Ga0207691_1000011138 277
1309 3300025941 Ga0207711_10037209 Ga0207711_100372094 277
1310 3300025941 Ga0207711_10041717 Ga0207711_100417174 277
1311 3300025941 Ga0207711_10054634 Ga0207711_100546343 277
1312 3300025941 Ga0207711_10122206 Ga0207711_101222062 277
1313 3300025942 Ga0207689_10000142 Ga0207689_1000014231 277
1314 3300025942 Ga0207689_10026848 Ga0207689_100268482 277
1315 3300025942 Ga0207689_10473176 Ga0207689_104731762 277
1316 3300025960 Ga0207651_10255704 Ga0207651_102557042 277
1317 3300025961 Ga0207712_10263753 Ga0207712_102637531 277
1318 3300025972 Ga0207668_10013845 Ga0207668_100138454 277
1319 3300025972 Ga0207668_10015772 Ga0207668_100157722 277
1320 3300025986 Ga0207658_10117353 Ga0207658_101173532 277
1321 3300025986 Ga0207658_10229732 Ga0207658_102297322 277
1322 3300026035 Ga0207703_10000195 Ga0207703_100001954 277
1323 3300026035 Ga0207703_10255494 Ga0207703_102554942 277
1324 3300026041 Ga0207639_10160953 Ga0207639_101609532 277
1325 3300026041 Ga0207639_10270663 Ga0207639_102706632 277
1326 3300026075 Ga0207708_10111582 Ga0207708_101115822 277
1327 3300026088 Ga0207641_10006316 Ga0207641_100063162 277
1328 3300026088 Ga0207641_10018427 Ga0207641_100184274 277
1329 3300026088 Ga0207641_10761890 Ga0207641_107618901 277
1330 3300026089 Ga0207648_10005172 Ga0207648_1000517213 277
1331 3300026089 Ga0207648_10016833 Ga0207648_100168335 277
1332 3300026095 Ga0207676_10001696 Ga0207676_100016969 277
1333 3300026095 Ga0207676_10002462 Ga0207676_100024628 277
1334 3300026095 Ga0207676_10177500 Ga0207676_101775002 277
1335 3300026116 Ga0207674_10002098 Ga0207674_1000209823 277
1336 3300026118 Ga0207675_100004037 Ga0207675_10000403711 277
1337 3300026118 Ga0207675_100262624 Ga0207675_1002626242 277
1338 3300026121 Ga0207683_10026873 Ga0207683_100268732 277
1339 3300026121 Ga0207683_10224210 Ga0207683_102242102 277
1340 3300026121 Ga0207683_10709857 Ga0207683_107098571 277
1341 3300026142 Ga0207698_10490349 Ga0207698_104903492 277
1342 3300027111 Ga0209281_1000082 Ga0209281_100008281 277
1343 3300027111 Ga0209281_1000110 Ga0209281_100011035 277
1344 3300027111 Ga0209281_1001180 Ga0209281_100118024 277
1345 3300027312 Ga0209371_1000003 Ga0209371_1000003351 277
1346 3300027312 Ga0209371_1000283 Ga0209371_10002837 277
1347 3300027312 Ga0209371_1004798 Ga0209371_10047982 277
1348 3300027666 Ga0209282_1000006 Ga0209282_1000006103 277
1349 3300027666 Ga0209282_1000210 Ga0209282_100021019 277
1350 3300028379 Ga0268266_10008596 Ga0268266_100085968 277
1351 3300028379 Ga0268266_10044304 Ga0268266_100443043 277
1352 3300028379 Ga0268266_10066625 Ga0268266_100666253 277
1353 3300028379 Ga0268266_10318960 Ga0268266_103189602 277
1354 3300028380 Ga0268265_10002425 Ga0268265_100024259 277
1355 3300028380 Ga0268265_10021422 Ga0268265_100214222 277
1356 3300028380 Ga0268265_10171638 Ga0268265_101716382 277
1357 3300028381 Ga0268264_10000606 Ga0268264_1000060625 277
1358 3300028381 Ga0268264_10057162 Ga0268264_100571622 277
1359 3300028381 Ga0268264_10248685 Ga0268264_102486852 277
1360 3300028794 Ga0307515_10000017 Ga0307515_10000017182 277
1361 3300028794 Ga0307515_10001299 Ga0307515_1000129925 277
1362 3300028794 Ga0307515_10003849 Ga0307515_1000384917 277
1363 3300028794 Ga0307515_10019285 Ga0307515_100192853 277
1364 3300028794 Ga0307515_10057315 Ga0307515_100573154 277
1365 3300028794 Ga0307515_10061360 Ga0307515_100613605 277
1366 3300030500 Ga0268256_1000004 Ga0268256_1000004700 277
1367 3300030500 Ga0268256_1001389 Ga0268256_10013893 277
1368 3300030500 Ga0268256_1005352 Ga0268256_10053522 277
1369 3300030522 Ga0307512_10196894 Ga0307512_101968942 277
1370 3300031456 Ga0307513_10000206 Ga0307513_1000020612 277
1371 3300031456 Ga0307513_10002736 Ga0307513_100027365 277
1372 3300031456 Ga0307513_10011846 Ga0307513_100118464 277
1373 3300031507 Ga0307509_10316479 Ga0307509_103164792 277
1374 3300031548 Ga0307408_100021734 Ga0307408_1000217344 277
1375 3300031548 Ga0307408_100213063 Ga0307408_1002130632 277
1376 3300031595 Ga0265313_10035166 Ga0265313_100351662 277
1377 3300031649 Ga0307514_10004553 Ga0307514_100045539 277
1378 3300031711 Ga0265314_10082126 Ga0265314_100821262 277
1379 3300031731 Ga0307405_10000125 Ga0307405_100001252 277
1380 3300031731 Ga0307405_10253710 Ga0307405_102537101 277
1381 3300031731 Ga0307405_10371062 Ga0307405_103710622 277
1382 3300031731 Ga0307405_10417700 Ga0307405_104177002 277
1383 3300031824 Ga0307413_10362456 Ga0307413_103624561 277
1384 3300031852 Ga0307410_10195697 Ga0307410_101956972 277
1385 3300031901 Ga0307406_10034901 Ga0307406_100349013 277
1386 3300031911 Ga0307412_10000786 Ga0307412_1000078612 277
1387 3300031911 Ga0307412_10143313 Ga0307412_101433132 277
1388 3300031911 Ga0307412_10305232 Ga0307412_103052322 277
1389 3300031967 Ga0315914_1000003 Ga0315914_1000003158 277
1390 3300033430 Ga0315913_1000001 Ga0315913_1000001109 277
1391 3300033464 Ga0315915_1000008 Ga0315915_1000008178 277
1392 3300035691 Ga0373931_0069965 Ga0373931_0069965_376_1215 277
1393 3300035695 Ga0373927_0000412 Ga0373927_0000412_23315_24160 277
1394 3300035725 Ga0373947_0145929 Ga0373947_0145929_211_1056 277
1395 3300036401 Ga0373937_0138393 Ga0373937_0138393_1335_2174 277
1396 3300037068 Ga0373925_0001026 Ga0373925_0001026_7611_8456 277
1397 3300037312 Ga0395899_0000589 Ga0395899_0000589_34064_34897 277
1398 3300037418 Ga0395900_0000375 Ga0395900_0000375_47798_48631 277
1399 3300037418 Ga0395900_0011818 Ga0395900_0011818_1769_2608 277
1400 3300037466 Ga0395898_0000629 Ga0395898_0000629_15904_16737 277
1401 3300037471 Ga0395905_0000361 Ga0395905_0000361_15887_16720 277
1402 3300037471 Ga0395905_0015961 Ga0395905_0015961_5268_6107 277
1403 3300037471 Ga0395905_0109369 Ga0395905_0109369_1350_2186 277
1404 3300037471 Ga0395905_0131670 Ga0395905_0131670_1174_2013 277
1405 3300037853 Ga0436364_0174941 Ga0436364_0174941_4567_5418 277
1406 3300038443 Ga0395901_0000273 Ga0395901_0000273_15812_16645 277
1407 3300038443 Ga0395901_0074295 Ga0395901_0074295_1922_2761 277
1408 3300041404 Ga0439436_0003871 Ga0439436_0003871_3472_4305 277
1409 3300041404 Ga0439436_0061503 Ga0439436_0061503_181_1014 277
1410 3300041411 Ga0439466_0015456 Ga0439466_0015456_1668_2501 277
1411 3300041413 Ga0439465_0015623 Ga0439465_0015623_1440_2273 277
1412 3300041491 Ga0451833_1239942 Ga0451833_1239942_171_1004 277
1413 3300041494 Ga0451837_1046754 Ga0451837_1046754_1318_2151 277
1414 3300041501 Ga0451845_0285704 Ga0451845_0285704_2075_2908 277
1415 3300041503 Ga0451847_0217734 Ga0451847_0217734_1778_2611 277
1416 3300041505 Ga0451849_0065926 Ga0451849_0065926_28_861 277
1417 3300041507 Ga0451851_0226558 Ga0451851_0226558_1958_2791 277
1418 3300041509 Ga0451843_0603985 Ga0451843_0603985_714_1547 277
1419 3300042007 Ga0439449_0083621 Ga0439449_0083621_123_956 277
1420 3300042122 Ga0450920_004815 Ga0450920_004815_228_1061 277
1421 3300042146 Ga0450907_024445 Ga0450907_024445_62_895 277
1422 3300044658 Ga0466972_0100113 Ga0466972_0100113_58_894 277
1423 3300044683 Ga0466965_0090576 Ga0466965_0090576_619_1452 277
1424 3300044712 Ga0453684_0350884 Ga0453684_0350884_340_1179 277
1425 3300044712 Ga0453684_0362447 Ga0453684_0362447_263_1120 277
1426 3300044735 Ga0466968_0116997 Ga0466968_0116997_17_856 277
1427 3300044765 Ga0466970_0173567 Ga0466970_0173567_103_963 277
1428 3300044765 Ga0466970_0215394 Ga0466970_0215394_181_1017 277
1429 3300045051 Ga0451576_0157735 Ga0451576_0157735_1007_1846 277
1430 3300046453 Ga0495627_027745 Ga0495627_027745_157_990 277
1431 3300046457 Ga0495590_0096732 Ga0495590_0096732_93_926 277
1432 3300046475 Ga0495639_0130758 Ga0495639_0130758_84_917 277
1433 3300046492 Ga0495585_0002182 Ga0495585_0002182_75_908 277
1434 3300046492 Ga0495585_0032209 Ga0495585_0032209_194_1027 277
1435 3300046492 Ga0495585_0053063 Ga0495585_0053063_880_1713 277
1436 3300046501 Ga0495607_0078139 Ga0495607_0078139_345_1178 277
1437 3300046506 Ga0495583_0006812 Ga0495583_0006812_4430_5263 277
1438 3300046507 Ga0495606_0033446 Ga0495606_0033446_226_1059 277
1439 3300046512 Ga0495610_0004788 Ga0495610_0004788_2964_3797 277
1440 3300046512 Ga0495610_0064304 Ga0495610_0064304_264_1097 277
1441 3300046515 Ga0495620_0009481 Ga0495620_0009481_4246_5079 277
1442 3300046515 Ga0495620_0092922 Ga0495620_0092922_85_918 277
1443 3300046518 Ga0495631_0016767 Ga0495631_0016767_1964_2797 277
1444 3300046519 Ga0495632_0065342 Ga0495632_0065342_714_1547 277
1445 3300046522 Ga0495643_0009505 Ga0495643_0009505_1942_2775 277
1446 3300046522 Ga0495643_0040962 Ga0495643_0040962_423_1256 277
1447 3300046522 Ga0495643_0151207 Ga0495643_0151207_281_1114 277
1448 3300046530 Ga0495654_0000121 Ga0495654_0000121_9057_9908 277
1449 3300046530 Ga0495654_0003858 Ga0495654_0003858_3055_3894 277
1450 3300046538 Ga0495609_0099492 Ga0495609_0099492_409_1242 277
1451 3300046558 Ga0495633_0037299 Ga0495633_0037299_1432_2265 277
1452 3300046616 Ga0495668_0020510 Ga0495668_0020510_995_1828 277
1453 3300046616 Ga0495668_0041859 Ga0495668_0041859_767_1630 277
1454 3300046665 Ga0495661_0136083 Ga0495661_0136083_476_1309 277
1455 3300046674 Ga0495588_0000403 Ga0495588_0000403_9999_10835 277
1456 3300046691 Ga0495670_0034654 Ga0495670_0034654_981_1814 277
1457 3300046694 Ga0495649_0007419 Ga0495649_0007419_4119_4952 277
1458 3300047469 Ga0495673_0106801 Ga0495673_0106801_228_1061 277
1459 3300047470 Ga0495681_0009787 Ga0495681_0009787_1217_2053 277
1460 3300047470 Ga0495681_0024616 Ga0495681_0024616_1398_2231 277
1461 3300047472 Ga0495686_0001023 Ga0495686_0001023_11535_12368 277
1462 3300048903 Ga0496100_0037004 Ga0496100_0037004_1074_1907 277
1463 3300048904 Ga0496101_0116995 Ga0496101_0116995_719_1552 277
1464 3300048905 Ga0496102_0425485 Ga0496102_0425485_88_933 277
1465 3300048905 Ga0496102_0610531 Ga0496102_0610531_59_892 277
1466 3300048909 Ga0496106_0005081 Ga0496106_0005081_3890_4723 277
1467 3300048914 Ga0496111_0001276 Ga0496111_0001276_10671_11522 277
1468 3300048915 Ga0496112_0024574 Ga0496112_0024574_3108_3953 277
1469 3300048915 Ga0496112_0192983 Ga0496112_0192983_580_1446 277
1470 3300048916 Ga0496113_0014581 Ga0496113_0014581_1241_2077 277
1471 3300048916 Ga0496113_0340259 Ga0496113_0340259_66_905 277
1472 3300048918 Ga0496115_0157399 Ga0496115_0157399_595_1428 277
1473 3300048919 Ga0496116_0001063 Ga0496116_0001063_31347_32180 277
1474 3300048919 Ga0496116_0008500 Ga0496116_0008500_1918_2751 277
1475 3300048919 Ga0496116_0017944 Ga0496116_0017944_2623_3456 277
1476 3300048919 Ga0496116_0030619 Ga0496116_0030619_1385_2218 277
1477 3300048919 Ga0496116_0034781 Ga0496116_0034781_65_901 277
1478 3300048919 Ga0496116_0074355 Ga0496116_0074355_949_1785 277
1479 3300048920 Ga0496117_0000030 Ga0496117_0000030_177441_178277 277
1480 3300048920 Ga0496117_0015059 Ga0496117_0015059_1428_2261 277
1481 3300048920 Ga0496117_0015836 Ga0496117_0015836_2656_3489 277
1482 3300048920 Ga0496117_0028078 Ga0496117_0028078_16_849 277
1483 3300048920 Ga0496117_0031765 Ga0496117_0031765_1828_2661 277
1484 3300048920 Ga0496117_0074188 Ga0496117_0074188_476_1309 277
1485 3300048920 Ga0496117_0097863 Ga0496117_0097863_57_890 277
1486 3300048920 Ga0496117_0116420 Ga0496117_0116420_11_844 277
1487 3300048920 Ga0496117_0144445 Ga0496117_0144445_51_887 277
1488 3300048921 Ga0496118_0001480 Ga0496118_0001480_1855_2691 277
1489 3300048921 Ga0496118_0014815 Ga0496118_0014815_2880_3713 277
1490 3300048921 Ga0496118_0016479 Ga0496118_0016479_4509_5342 277
1491 3300048921 Ga0496118_0017008 Ga0496118_0017008_2640_3473 277
1492 3300048921 Ga0496118_0028329 Ga0496118_0028329_93_929 277
1493 3300048921 Ga0496118_0094049 Ga0496118_0094049_505_1338 277
1494 3300048921 Ga0496118_0190246 Ga0496118_0190246_65_901 277
1495 3300048922 Ga0496119_0004719 Ga0496119_0004719_3142_3975 277
1496 3300048922 Ga0496119_0028509 Ga0496119_0028509_1531_2364 277
1497 3300048923 Ga0496120_0000047 Ga0496120_0000047_171226_172062 277
1498 3300048923 Ga0496120_0016612 Ga0496120_0016612_882_1715 277
1499 3300048923 Ga0496120_0023341 Ga0496120_0023341_1316_2149 277
1500 3300048923 Ga0496120_0036634 Ga0496120_0036634_244_1089 277
1501 3300048923 Ga0496120_0039500 Ga0496120_0039500_521_1357 277
1502 3300048923 Ga0496120_0061971 Ga0496120_0061971_239_1072 277
1503 3300048923 Ga0496120_0134113 Ga0496120_0134113_56_889 277
1504 3300048924 Ga0496121_0000003 Ga0496121_0000003_1081109_1081942 277
1505 3300048924 Ga0496121_0021428 Ga0496121_0021428_1333_2166 277
1506 3300048924 Ga0496121_0028286 Ga0496121_0028286_732_1565 277
1507 3300048924 Ga0496121_0033506 Ga0496121_0033506_1707_2558 277
1508 3300048924 Ga0496121_0094049 Ga0496121_0094049_856_1689 277
1509 3300048924 Ga0496121_0254992 Ga0496121_0254992_57_890 277
1510 3300048925 Ga0496122_0000076 Ga0496122_0000076_209883_210719 277
1511 3300048925 Ga0496122_0000107 Ga0496122_0000107_161949_162797 277
1512 3300048925 Ga0496122_0011537 Ga0496122_0011537_1020_1856 277
1513 3300048925 Ga0496122_0016039 Ga0496122_0016039_2378_3211 277
1514 3300048925 Ga0496122_0021667 Ga0496122_0021667_2662_3495 277
1515 3300048925 Ga0496122_0028970 Ga0496122_0028970_1259_2092 277
1516 3300048925 Ga0496122_0054177 Ga0496122_0054177_94_927 277
1517 3300048925 Ga0496122_0054210 Ga0496122_0054210_1124_1975 277
1518 3300048925 Ga0496122_0062302 Ga0496122_0062302_895_1728 277
1519 3300048925 Ga0496122_0128635 Ga0496122_0128635_95_928 277
1520 3300048925 Ga0496122_0160986 Ga0496122_0160986_66_899 277
1521 3300048926 Ga0496123_0000023 Ga0496123_0000023_136176_137012 277
1522 3300048926 Ga0496123_0000063 Ga0496123_0000063_30312_31160 277
1523 3300048926 Ga0496123_0014544 Ga0496123_0014544_3889_4722 277
1524 3300048926 Ga0496123_0021425 Ga0496123_0021425_4104_4955 277
1525 3300048926 Ga0496123_0025149 Ga0496123_0025149_1237_2070 277
1526 3300048926 Ga0496123_0119937 Ga0496123_0119937_24_857 277
1527 3300048926 Ga0496123_0184079 Ga0496123_0184079_10_846 277
1528 3300048927 Ga0496124_0000239 Ga0496124_0000239_32291_33127 277
1529 3300048927 Ga0496124_0000951 Ga0496124_0000951_18069_18902 277
1530 3300048927 Ga0496124_0005130 Ga0496124_0005130_11376_12209 277
1531 3300048927 Ga0496124_0030519 Ga0496124_0030519_1390_2223 277
1532 3300048927 Ga0496124_0064780 Ga0496124_0064780_345_1196 277
1533 3300048927 Ga0496124_0065263 Ga0496124_0065263_1540_2373 277
1534 3300048927 Ga0496124_0084208 Ga0496124_0084208_1315_2148 277
1535 3300048927 Ga0496124_0099829 Ga0496124_0099829_1317_2153 277
1536 3300048927 Ga0496124_0115510 Ga0496124_0115510_422_1255 277
1537 3300048927 Ga0496124_0269696 Ga0496124_0269696_227_1078 277
1538 3300048928 Ga0496125_0000200 Ga0496125_0000200_108227_109060 277
1539 3300048928 Ga0496125_0010291 Ga0496125_0010291_181_1014 277
1540 3300048928 Ga0496125_0032868 Ga0496125_0032868_2553_3386 277
1541 3300048928 Ga0496125_0058346 Ga0496125_0058346_388_1221 277
1542 3300048928 Ga0496125_0063816 Ga0496125_0063816_1079_1912 277
1543 3300048928 Ga0496125_0112647 Ga0496125_0112647_592_1428 277
1544 3300048928 Ga0496125_0288286 Ga0496125_0288286_34_870 277
1545 3300048929 Ga0496126_0000965 Ga0496126_0000965_25826_26662 277
1546 3300048929 Ga0496126_0037901 Ga0496126_0037901_3370_4203 277
1547 3300048929 Ga0496126_0300887 Ga0496126_0300887_367_1200 277
1548 3300048929 Ga0496126_0309726 Ga0496126_0309726_441_1274 277
1549 3300048929 Ga0496126_0357054 Ga0496126_0357054_249_1082 277
1550 3300049459 Ga0495678_040302 Ga0495678_040302_925_1758 277
1551 3300049459 Ga0495678_040389 Ga0495678_040389_694_1530 277
1552 3300049459 Ga0495678_100858 Ga0495678_100858_74_907 277
1553 3300049568 Ga0501031_0000218 Ga0501031_0000218_18220_19059 277
1554 3300049568 Ga0501031_0075315 Ga0501031_0075315_195_1031 277
1555 3300049569 Ga0501032_0000457 Ga0501032_0000457_18220_19059 277
1556 3300049569 Ga0501032_0265117 Ga0501032_0265117_83_919 277
1557 3300049570 Ga0501033_0000612 Ga0501033_0000612_18220_19059 277
1558 3300049570 Ga0501033_0016076 Ga0501033_0016076_296_1150 277
1559 3300049570 Ga0501033_0048133 Ga0501033_0048133_1744_2577 277
1560 3300049570 Ga0501033_0252792 Ga0501033_0252792_218_1054 277
1561 3300049571 Ga0501034_0001364 Ga0501034_0001364_18220_19059 277
1562 3300049571 Ga0501034_0049448 Ga0501034_0049448_3285_4118 277
1563 3300049571 Ga0501034_0074936 Ga0501034_0074936_2170_3006 277
1564 3300049571 Ga0501034_0576456 Ga0501034_0576456_163_996 277
1565 3300049572 Ga0501036_0000335 Ga0501036_0000335_18220_19059 277
1566 3300049572 Ga0501036_0123992 Ga0501036_0123992_130_963 277
1567 3300049572 Ga0501036_0168513 Ga0501036_0168513_815_1651 277
1568 3300049572 Ga0501036_0336208 Ga0501036_0336208_302_1135 277
1569 3300049573 Ga0501037_0000468 Ga0501037_0000468_18220_19059 277
1570 3300049573 Ga0501037_0039495 Ga0501037_0039495_83_919 277
1571 3300049573 Ga0501037_0099956 Ga0501037_0099956_18_851 277
1572 3300049574 Ga0501038_0000557 Ga0501038_0000557_13903_14742 277
1573 3300049574 Ga0501038_0058174 Ga0501038_0058174_2233_3066 277
1574 3300049574 Ga0501038_0113492 Ga0501038_0113492_1150_1983 277
1575 3300049574 Ga0501038_0113718 Ga0501038_0113718_1236_2093 277
1576 3300049574 Ga0501038_0116545 Ga0501038_0116545_205_1041 277
1577 3300049575 Ga0501039_0000689 Ga0501039_0000689_18220_19059 277
1578 3300049576 Ga0501040_0005022 Ga0501040_0005022_6742_7581 277
1579 3300049579 Ga0501043_0004029 Ga0501043_0004029_4694_5533 277
1580 3300049579 Ga0501043_0022353 Ga0501043_0022353_2758_3594 277
1581 3300049579 Ga0501043_0162739 Ga0501043_0162739_607_1440 277
1582 3300049579 Ga0501043_0217300 Ga0501043_0217300_54_887 277
1583 3300049581 Ga0501047_0003732 Ga0501047_0003732_1069_1908 277
1584 3300049581 Ga0501047_0062927 Ga0501047_0062927_606_1439 277
1585 3300049581 Ga0501047_0066505 Ga0501047_0066505_2556_3392 277
1586 3300049586 Ga0501070_0002902 Ga0501070_0002902_8836_9675 277
1587 3300049586 Ga0501070_0117439 Ga0501070_0117439_907_1743 277
1588 3300049586 Ga0501070_0136045 Ga0501070_0136045_140_976 277
1589 3300049587 Ga0501071_0025714 Ga0501071_0025714_2777_3613 277
1590 3300049671 Ga0501238_002164 Ga0501238_002164_52_888 277
1591 3300049742 Ga0501080_0057050 Ga0501080_0057050_387_1223 277
1592 3300049744 Ga0501083_0022018 Ga0501083_0022018_777_1610 277
1593 3300049744 Ga0501083_0124686 Ga0501083_0124686_100_936 277
1594 3300049822 Ga0501035_0000833 Ga0501035_0000833_13903_14742 277
1595 3300049822 Ga0501035_0411605 Ga0501035_0411605_83_919 277
1596 3300049823 Ga0501044_0001065 Ga0501044_0001065_13903_14742 277
1597 3300049823 Ga0501044_0032749 Ga0501044_0032749_62_916 277
1598 3300049823 Ga0501044_0141041 Ga0501044_0141041_402_1238 277
1599 3300049823 Ga0501044_0642997 Ga0501044_0642997_42_875 277
1600 3300049824 Ga0501045_0144011 Ga0501045_0144011_345_1181 277
1601 3300050489 nmdc:mga03683_160722_c1 nmdc:mga03683_160722_c1_94_942 277
1602 3300050489 nmdc:mga03683_2237_c1 nmdc:mga03683_2237_c1_230_1066 277
1603 3300050489 nmdc:mga03683_23744_c1 nmdc:mga03683_23744_c1_1137_1985 277
1604 3300050490 nmdc:mga03n38_4361_c1 nmdc:mga03n38_4361_c1_3086_3922 277
1605 3300050490 nmdc:mga03n38_74341_c1 nmdc:mga03n38_74341_c1_89_925 277
1606 3300050491 nmdc:mga00v17_2539_c1 nmdc:mga00v17_2539_c1_7476_8309 277
1607 3300050491 nmdc:mga00v17_327499_c1 nmdc:mga00v17_327499_c1_76_912 277
1608 3300050491 nmdc:mga00v17_4_c1 nmdc:mga00v17_4_c1_35574_36410 277
1609 3300050491 nmdc:mga00v17_7500_c1 nmdc:mga00v17_7500_c1_1486_2337 277
1610 3300050491 nmdc:mga00v17_78_c2 nmdc:mga00v17_78_c2_5103_5951 277
1611 3300050492 nmdc:mga0yw44_199_c1 nmdc:mga0yw44_199_c1_4713_5549 277
1612 3300050493 nmdc:mga0k408_196002_c1 nmdc:mga0k408_196002_c1_253_1104 277
1613 3300050493 nmdc:mga0k408_98378_c1 nmdc:mga0k408_98378_c1_272_1105 277
1614 3300050494 nmdc:mga06z11_54842_c1 nmdc:mga06z11_54842_c1_316_1149 277
1615 3300050495 nmdc:mga04h51_62340_c1 nmdc:mga04h51_62340_c1_397_1230 277
1616 3300050496 nmdc:mga07m45_40409_c1 nmdc:mga07m45_40409_c1_1277_2110 277
1617 3300050496 nmdc:mga07m45_85171_c1 nmdc:mga07m45_85171_c1_675_1508 277
1618 3300050516 nmdc:mga0sz30_2210_c1 nmdc:mga0sz30_2210_c1_5183_6019 277
1619 3300053087 Ga0500643_004113 Ga0500643_004113_3140_3973 277
1620 3300053100 Ga0500660_077223 Ga0500660_077223_124_972 277
1621 3300053103 Ga0500555_001270 Ga0500555_001270_7142_7981 277
1622 3300053107 Ga0500560_002524 Ga0500560_002524_2003_2839 277
1623 3300053109 Ga0500569_013290 Ga0500569_013290_707_1540 277
1624 3300053111 Ga0500572_005742 Ga0500572_005742_1694_2527 277
1625 3300053117 Ga0500593_000456 Ga0500593_000456_5141_5989 277
1626 3300053125 Ga0500618_000171 Ga0500618_000171_44491_45327 277
1627 3300053125 Ga0500618_001171 Ga0500618_001171_4798_5634 277
1628 3300053129 Ga0500628_012658 Ga0500628_012658_500_1348 277
1629 3300053134 Ga0500658_0001109 Ga0500658_0001109_2097_2930 277
1630 3300053134 Ga0500658_0002691 Ga0500658_0002691_1733_2566 277
1631 3300053140 Ga0500573_0001489 Ga0500573_0001489_6827_7660 277
1632 3300053151 Ga0500604_0038371 Ga0500604_0038371_567_1418 277
1633 3300053153 Ga0500616_0000402 Ga0500616_0000402_19506_20339 277
1634 3300053153 Ga0500616_0024890 Ga0500616_0024890_2169_3002 277
1635 3300053155 Ga0500620_000147 Ga0500620_000147_10054_10887 277
1636 3300053156 Ga0500622_0000726 Ga0500622_0000726_9030_9863 277
1637 3300053157 Ga0500624_000410 Ga0500624_000410_9542_10378 277
1638 3300053161 Ga0500634_0003689 Ga0500634_0003689_3638_4471 277
1639 3300053177 Ga0500636_0000005 Ga0500636_0000005_194753_195589 277
1640 3300053730 Ga0500645_000042 Ga0500645_000042_106073_106921 277
1641 3300053730 Ga0500645_002276 Ga0500645_002276_4633_5481 277
1642 3300053730 Ga0500645_029267 Ga0500645_029267_743_1591 277
1643 3300055283 Ga0500661_000314 Ga0500661_000314_519_1367 277
1644 iso_pu_bacteria 2503198000 2503198049 277
1645 iso_pu_bacteria 2508501123 2509113640 277
1646 iso_pu_bacteria 2509276018 2509370586 277
1647 iso_pu_bacteria 2510065059 2510314395 277
1648 iso_pu_bacteria 2510917026 2511170197 277
1649 iso_pu_bacteria 2511231002 2511245293 277
1650 iso_pu_bacteria 2512875024 2512962814 277
1651 iso_pu_bacteria 2513237164 2514037513 277
1652 iso_pu_bacteria 2585427633 2585997277 277
1653 iso_pu_bacteria 2585427634 2586001886 277
1654 iso_pu_bacteria 2600254933 2600373534 277
1655 iso_pu_bacteria 2643221568 2643853692 277
1656 iso_pu_bacteria 2671180139 2671694320 277
1657 iso_pu_bacteria 2687453392 2688595362 277
1658 iso_pu_bacteria 2756170246 2756674564 277
1659 iso_pu_bacteria 2818991461 2819686560 277
1660 iso_pu_bacteria 2821123053 2821126286 277
1661 iso_pu_bacteria 2844009547 2844010084 277
1662 iso_pu_bacteria 2847670302 2847672954 277
1663 iso_pu_bacteria 2847686936 2847689436 277
1664 iso_pu_bacteria 2854896431 2854897399 277
1665 iso_pu_bacteria 2854916844 2854921467 277
1666 iso_pu_bacteria 2856314179 2856320014 277
1667 iso_pu_bacteria 2856328259 2856332045 277
1668 iso_pu_bacteria 2856334872 2856334889 277
1669 iso_pu_bacteria 2856349417 2856353167 277
1670 iso_pu_bacteria 2857367948 2857374102 277
1671 iso_pu_bacteria 2857531043 2857532847 277
1672 iso_pu_bacteria 2869169390 2869172316 277
1673 iso_pu_bacteria 2869242130 2869246523 277
1674 iso_pu_bacteria 2869249662 2869252029 277
1675 iso_pu_bacteria 2869256925 2869261206 277
1676 iso_pu_bacteria 2869264136 2869264367 277
1677 iso_pu_bacteria 2869271264 2869274705 277
1678 iso_pu_bacteria 2869278585 2869279821 277
1679 iso_pu_bacteria 2871451962 2871459244 277
1680 iso_pu_bacteria 2871459585 2871460094 277
1681 iso_pu_bacteria 2871466892 2871467726 277
1682 iso_pu_bacteria 2871481445 2871484482 277
1683 iso_pu_bacteria 2871488783 2871490801 277
1684 iso_pu_bacteria 2871495908 2871499375 277
1685 iso_pu_bacteria 2874116593 2874117815 277
1686 iso_pu_bacteria 2874139085 2874145686 277
1687 iso_pu_bacteria 2874162495 2874162571 277
1688 iso_pu_bacteria 2876369609 2876370240 277
1689 iso_pu_bacteria 2876386047 2876391963 277
1690 iso_pu_bacteria 2876392853 2876392927 277
1691 iso_pu_bacteria 2876399893 2876405090 277
1692 iso_pu_bacteria 2876406927 2876411102 277
1693 iso_pu_bacteria 2876420981 2876422628 277
1694 iso_pu_bacteria 2878035449 2878035562 277
1695 iso_pu_bacteria 2878738818 2878740336 277
1696 iso_pu_bacteria 2878753008 2878755205 277
1697 iso_pu_bacteria 2878760144 2878763565 277
1698 iso_pu_bacteria 2878767105 2878770563 277
1699 iso_pu_bacteria 2878774303 2878775245 277
1700 iso_pu_bacteria 2878781027 2878782221 277
1701 iso_pu_bacteria 2881147464 2881147615 277
1702 iso_pu_bacteria 2881155292 2881158715 277
1703 iso_pu_bacteria 2881161766 2881164390 277
1704 iso_pu_bacteria 2881845957 2881849665 277
1705 iso_pu_bacteria 2881853255 2881854196 277
1706 iso_pu_bacteria 2881861095 2881866271 277
1707 iso_pu_bacteria 2882912400 2882913662 277
1708 iso_pu_bacteria 2885305155 2885306251 277
1709 iso_pu_bacteria 2885326080 2885329320 277
1710 iso_pu_bacteria 2885334103 2885336016 277
1711 iso_pu_bacteria 2885342637 2885345736 277
1712 iso_pu_bacteria 2885350715 2885357108 277
1713 iso_pu_bacteria 2888337043 2888342697 277
1714 iso_pu_bacteria 2903492973 2903499315 277
1715 iso_pu_bacteria 2903540706 2903544180 277
1716 iso_pu_bacteria 2904659560 2904659633 277
1717 iso_pu_bacteria 2906328253 2906334553 277
1718 iso_pu_bacteria 2906363423 2906365553 277
1719 iso_pu_bacteria 2906370794 2906374474 277
1720 iso_pu_bacteria 2906378014 2906381290 277
1721 iso_pu_bacteria 2906386501 2906390715 277
1722 iso_pu_bacteria 2906393657 2906400591 277
1723 iso_pu_bacteria 2906401398 2906404640 277
1724 iso_pu_bacteria 2906408224 2906412488 277
1725 iso_pu_bacteria 2906414383 2906420790 277
1726 iso_pu_bacteria 2919166419 2919168121 277
1727 iso_pu_bacteria 2919171160 2919173573 277
1728 iso_pu_bacteria 2922151315 2922158339 277
1729 iso_pu_bacteria 2922158528 2922165038 277
1730 iso_pu_bacteria 2922172374 2922173397 277
1731 iso_pu_bacteria 2922178524 2922182411 277
1732 iso_pu_bacteria 2924718760 2924719565 277
1733 iso_pu_bacteria 2924726620 2924732864 277
1734 iso_pu_bacteria 2924741084 2924741787 277
1735 iso_pu_bacteria 2924748358 2924751521 277
1736 iso_pu_bacteria 2924762789 2924767697 277
1737 iso_pu_bacteria 2924776078 2924777937 277
1738 iso_pu_bacteria 2924784321 2924791426 277
1739 iso_pu_bacteria 2937861824 2937863305 277
1740 iso_pu_bacteria 2937868953 2937873761 277
1741 iso_pu_bacteria 2937877337 2937884499 277
1742 iso_pu_bacteria 2937891427 2937896000 277
1743 iso_pu_bacteria 2937972304 2937980522 277
1744 iso_pu_bacteria 2937980651 2937980922 277
1745 iso_pu_bacteria 2937994558 2937998024 277
1746 iso_pu_bacteria 2958034702 2958035689 277
1747 iso_pu_bacteria 2958041894 2958044720 277
1748 iso_pu_bacteria 2958064165 2958066723 277
1749 iso_pu_bacteria 2958084443 2958091810 277
1750 iso_pu_bacteria 2958108152 2958109877 277
1751 iso_pu_bacteria 2958115193 2958119676 277
1752 iso_pu_bacteria 2958122699 2958129238 277
1753 iso_pu_bacteria 2958137437 2958142400 277
1754 iso_pu_bacteria 2958144490 2958146519 277
1755 iso_pu_bacteria 2958158011 2958159240 277
1756 iso_pu_bacteria 2958165035 2958168499 277
1757 iso_pu_bacteria 2961114664 2961114958 277
1758 iso_pu_bacteria 2961127735 2961131916 277
1759 iso_pu_bacteria 2961163497 2961166963 277
1760 iso_pu_bacteria 2961170736 2961176753 277
1761 iso_pu_bacteria 2961183825 2961189628 277
1762 iso_pu_bacteria 2965018300 2965021787 277
1763 iso_pu_bacteria 2965025482 2965028853 277
1764 iso_pu_bacteria 2965032056 2965035237 277
1765 iso_pu_bacteria 2965040258 2965045247 277
1766 iso_pu_bacteria 2965047637 2965052298 277
1767 iso_pu_bacteria 2965062239 2965064610 277
1768 iso_pu_bacteria 2965089291 2965090688 277
1769 iso_pu_bacteria 2965102966 2965107747 277
1770 iso_pu_bacteria 2965110997 2965113305 277
1771 iso_pu_bacteria 2967996073 2968001138 277
1772 iso_pu_bacteria 2968003550 2968007191 277
1773 iso_pu_bacteria 2968016561 2968021622 277
1774 iso_pu_bacteria 2968091066 2968094100 277
1775 iso_pu_bacteria 2968097103 2968100691 277
1776 iso_pu_bacteria 2968110612 2968110686 277
1777 iso_pu_bacteria 2968128360 2968131307 277
1778 iso_pu_bacteria 2968138860 2968143550 277
1779 iso_pu_bacteria 2968171901 2968175369 277
1780 iso_pu_bacteria 2970469710 2970476699 277
1781 iso_pu_bacteria 2970489779 2970494156 277
1782 iso_pu_bacteria 2970503327 2970509426 277
1783 iso_pu_bacteria 2970524798 2970525509 277
1784 iso_pu_bacteria 2970532167 2970533715 277
1785 iso_pu_bacteria 2970540015 2970543537 277
1786 iso_pu_bacteria 2970547951 2970553786 277
1787 iso_pu_bacteria 2970554993 2970558407 277
1788 iso_pu_bacteria 2970593180 2970594421 277
1789 iso_pu_bacteria 2970619444 2970622549 277
1790 iso_pu_bacteria 2970627176 2970629229 277
1791 iso_pu_bacteria 2977821940 2977824345 277
1792 iso_pu_bacteria 2977828996 2977830329 277
1793 iso_pu_bacteria 2977851361 2977855068 277
1794 iso_pu_bacteria 2977858184 2977858384 277
1795 iso_pu_bacteria 2977872689 2977879994 277
1796 iso_pu_bacteria 2977907340 2977909692 277
1797 iso_pu_bacteria 2977915119 2977916362 277
1798 iso_pu_bacteria 2977935797 2977940498 277
1799 iso_pu_bacteria 2977950692 2977953084 277
1800 iso_pu_bacteria 2977957713 2977961378 277
1801 iso_pu_bacteria 2978969890 2978970795 277
1802 iso_pu_bacteria 2979764755 2979767585 277
1803 iso_pu_bacteria 2979772303 2979779248 277
1804 iso_pu_bacteria 2979779861 2979784632 277
1805 iso_pu_bacteria 2979793036 2979795799 277
1806 iso_pu_bacteria 2979808191 2979814213 277
1807 iso_pu_bacteria 2984587000 2984587903 277
1808 iso_pu_bacteria 2987645492 2987652015 277
1809 iso_pu_bacteria 2987659509 2987662975 277
1810 iso_pu_bacteria 2987666974 2987668404 277
1811 iso_pu_bacteria 2987673487 2987680081 277
1812 iso_pu_bacteria 2996341866 2996346131 277
1813 iso_pu_bacteria 2996348954 2996356122 277
1814 iso_pu_bacteria 3004167301 3004172538 277
1815 iso_pu_bacteria 3004188549 3004192027 277
1816 iso_pu_bacteria 3004195979 3004196335 277
1817 iso_pu_bacteria 3004239961 3004241120 277
1818 iso_pu_bacteria 3004248173 3004255433 277
1819 iso_pu_bacteria 3004268573 3004269518 277
1820 iso_pu_bacteria 3004275668 3004282436 277
1821 iso_pu_bacteria 3004289098 3004294180 277
1822 iso_pu_bacteria 649633066 649869922 277
1823 iso_pu_bacteria 8004300914 8004307125 277
1824 iso_pu_bacteria 8004312739 8004319612 277
1825 iso_pu_bacteria 8004361976 8004365369 277
1826 iso_pu_bacteria 8004374579 8004376784 277
1827 iso_pu_bacteria 8004445564 8004449738 277
1828 iso_pu_bacteria 8004695233 8004698297 277
1829 iso_pu_bacteria 8004703790 8004707260 277
1830 iso_pu_bacteria 8004727605 8004729310 277

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

55

213

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9239 2 235
6z67-assembly3.cif.gz_E ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9186 3 238
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.917 1 243
4fwi-assembly1.cif.gz_B crystal structure of the nucleotide-binding domain of a dipeptide abc transporter 0.9153 2 261
8hps-assembly1.cif.gz_D lpqy-sugabc in state 5 0.9149 5 252
ID Description Score Start End Superfamily
af_P9WQJ5_2_332_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9745 2 263 3.40.50.300
af_P75796_10_305_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9726 3 260 3.40.50.300
af_Q2FZR1_3_327_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9682 2 272 3.40.50.300
af_P77268_3_327_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9651 2 272 3.40.50.300
af_Q2FZR5_3_331_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9647 3 273 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3S1TSN0-F1-model_v4 deleted 0.9971 2 248
AF-A0A7V8TTF3-F1-model_v4 ABC-type dipeptide transporter (EC 7.4.2.9) 0.9752 3 262 GO:0005524
GO:0005886
GO:0015833
GO:0016887
AF-A0A0L8EX25-F1-model_v4 deleted 0.9751 3 272
AF-A0A0R2R2M8-F1-model_v4 Glutathione ABC transporter ATP-binding protein 0.9729 1 262 GO:0005524
GO:0016887
AF-A0A3D2X4T8-F1-model_v4 ABC transporter ATP-binding protein 0.9727 2 253 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
93.26 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map