F495813

General Info

Members Datasets Scaffolds Average Seq Length
1826 665 1691 383

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10296049|Ga0105239_102960491
Length 445
Sequence MASNPRIVRRAVWKDWKPPIRGIGRLTRKILWAFGWRPALQKSEVADAPTLEPTMLNDAPLPAQAAIRTDLGAIFVSMELSRRTWLITSLSPGAGEKMSKHSVPASDVPGLLHRFAELKRKAAARSGRDFPIIVIQEAGLDGFWIHRVLQSEGIESHVVDPASILTSRRARRAKTDRIDGETLVRTLMAFKRGEPRVCSMARAPTPQEEDRRRVCRERRILVGERVRHVNRIKGLLFAQGIFGYEPLRKCRRERLEDLRTGDGRPLPVHLKAQIIRELDRLELVLAQLKAVAAERDTLLKTASDEMPAPPAMLVQLKGIGPEIAAVLWSEGLFRRFDNRRQVAAYAGLAPTPWQSGSIDHEQGVSKAGNPRLRTTMVELAWLWLRNQPTSALSLWFHERVQSLSGRMRKTIIVALARKLLVALWRYMTAGVVIEGAVMKPASATI

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
4 2508501050 Microvirga lupini Lut6 Isolate Nodule
5 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
6 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
9 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
10 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
11 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
12 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
13 2516143018 Ensifer sp. BR816 Isolate Nodule
14 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
15 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
16 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
17 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
18 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
19 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
20 2643221618 Ensifer sp. Root231 Isolate Unclassified
21 2643221655 Ensifer sp. Root1252 Isolate Unclassified
22 2643221659 Ensifer sp. Root127 Isolate Unclassified
23 2643221712 Ensifer sp. Root258 Isolate Unclassified
24 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
25 2718217882 Rhizobium sp. N741 Isolate Nodule
26 2718218009 Rhizobium sp. N561 Isolate Nodule
27 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
28 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
29 2718218363 Rhizobium sp. N113 Isolate Nodule
30 2718218365 Rhizobium sp. N731 Isolate Nodule
31 2718218366 Rhizobium sp. N621 Isolate Nodule
32 2721755514 Rhizobium sp. N6212 Isolate Nodule
33 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
34 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
35 2721755810 Rhizobium sp. N871 Isolate Nodule
36 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
37 2728369365 Rhizobium sp. N1341 Isolate Nodule
38 2728369397 Rhizobium sp. N1314 Isolate Nodule
39 2751185800 Brucella pituitosa AA2 Isolate Unclassified
40 2773857925 Microvirga vignae BR3299 Isolate Unclassified
41 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
42 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
43 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
44 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
45 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
46 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
47 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
48 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
49 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
50 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
51 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
52 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
53 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
54 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
55 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
56 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
57 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
58 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
59 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
60 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
61 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
62 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
63 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
64 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
65 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
66 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
67 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
68 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
69 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
70 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
71 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
72 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
73 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
74 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
75 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
76 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
77 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
78 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
79 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
80 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
81 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
82 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
83 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
84 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
85 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
86 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
87 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
88 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
89 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
90 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
91 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
92 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
93 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
94 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
95 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
96 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
97 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
98 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
99 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
100 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
101 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
102 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
103 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
104 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
105 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
106 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
107 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
108 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
109 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
110 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
111 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
112 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
113 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
114 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
115 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
116 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
117 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
118 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
119 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
120 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
121 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
122 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
123 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
124 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
125 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
126 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
127 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
128 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
129 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
130 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
131 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
132 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
133 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
134 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
135 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
136 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
137 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
138 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
139 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
140 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
141 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
142 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
143 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
144 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
145 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
146 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
147 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
148 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
149 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
150 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
151 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
152 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
153 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
154 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
155 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
156 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
157 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
158 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
159 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
160 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
161 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
162 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
163 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
164 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
165 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
166 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
167 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
168 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
169 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
170 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
171 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
172 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
173 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
174 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
175 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
176 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
177 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
178 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
179 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
180 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
181 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
182 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
183 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
184 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
185 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
186 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
187 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
188 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
189 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
190 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
191 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
192 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
193 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
194 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
195 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
196 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
197 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
198 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
199 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
200 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
201 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
202 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
203 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
204 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
205 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
206 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
207 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
208 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
209 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
210 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
211 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
212 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
213 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
214 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
215 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
216 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
217 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
218 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
219 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
220 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
221 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
222 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
223 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
224 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
225 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
226 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
227 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
228 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
229 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
230 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
231 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
232 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
233 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
234 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
235 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
236 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
237 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
238 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
239 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
240 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
241 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
242 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
243 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
244 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
245 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
246 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
247 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
248 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
249 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
250 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
251 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
252 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
253 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
254 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
255 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
256 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
257 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
258 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
259 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
260 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
261 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
262 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
263 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
264 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
265 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
266 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
267 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
268 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
269 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
270 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
271 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
272 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
273 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
274 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
275 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
276 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
277 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
278 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
279 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
280 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
281 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
282 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
283 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
284 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
285 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
286 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
287 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
288 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
289 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
291 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
292 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
293 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
294 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
295 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
296 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
297 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
298 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
299 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
300 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
366 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
367 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
370 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
374 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
375 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
376 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
380 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
381 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
382 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
383 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
384 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
385 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
386 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
387 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
388 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
389 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
390 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
391 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
392 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
393 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
394 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
395 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
396 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
397 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
398 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
399 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
400 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
401 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
402 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
403 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
404 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
405 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
406 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
407 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
408 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
409 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
410 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
411 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
412 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
413 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
414 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
415 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
416 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
417 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
418 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
419 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
420 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
421 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
422 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
423 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
424 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
425 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
426 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
427 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
428 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
429 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
430 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
431 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
432 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
433 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
434 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
435 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
436 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
437 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
438 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
439 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
440 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
441 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
442 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
443 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
444 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
445 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
446 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
447 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
448 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
449 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
450 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
451 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
452 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
453 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
454 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
455 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
456 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
457 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
458 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
459 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
460 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
461 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
462 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
463 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
464 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
465 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
466 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
467 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
468 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
469 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
470 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
471 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
472 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
473 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
474 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
475 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
476 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
477 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
478 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
479 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
480 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
481 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
482 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
483 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
484 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
485 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
486 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
487 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
488 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
489 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
490 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
491 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
492 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
493 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
494 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
495 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
496 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
497 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
498 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
499 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
500 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
501 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
502 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
503 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
504 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
505 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
506 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
507 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
508 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
509 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
510 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
511 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
512 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
513 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
514 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
515 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
516 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
517 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
518 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
519 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
520 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
521 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
522 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
523 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
524 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
525 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
526 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
527 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
528 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
529 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
530 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
531 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
532 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
533 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
534 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
535 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
536 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
537 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
538 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
539 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
540 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
541 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
542 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
543 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
544 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
545 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
546 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
547 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
548 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
549 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
550 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
551 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
552 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
553 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
554 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
555 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
556 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
557 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
558 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
559 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
560 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
561 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
562 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
563 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
564 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
565 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
566 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
567 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
568 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
569 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
570 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
571 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
572 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
573 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
574 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
575 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
576 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
577 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
578 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
579 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
580 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
581 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
582 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
583 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
584 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
585 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
586 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
587 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
588 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
589 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
590 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
591 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
592 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
593 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
594 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
595 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
596 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
597 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
598 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
599 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
600 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
601 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
602 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
603 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
604 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
605 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
606 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
607 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
608 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
609 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
610 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
611 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
612 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
613 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
614 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
615 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
616 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
617 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
618 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
619 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
620 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
621 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
622 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
623 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
624 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
625 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
626 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
627 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
628 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
629 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
630 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
631 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
632 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
633 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
634 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
635 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
636 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
637 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
638 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
639 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
640 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
641 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
642 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
643 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
644 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
645 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
646 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
647 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
648 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
649 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
650 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
651 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
652 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
653 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
654 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
655 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
656 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
657 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
658 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
659 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
660 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
661 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
662 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
663 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
664 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
665 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.44
Metatranscriptomes 0.16
Isolates 7.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.16
Nodule 5.42
Rhizoplane 3.89
Rhizosphere 81.71
Stem 0
Stem Tuber 0
Unclassified 4.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_901166 2162886006 Bacteria 1580
2 SwRhRL2b_contig_3722764 2162886007 Bacteria 1637
3 JGI24746J21847_1008261 3300001977 Bacteria 1574
4 JGI24746J21847_1012047 3300001977 Bacteria 1267
5 JGI24747J21853_1001542 3300001978 Bacteria 1746
6 JGI24747J21853_1003876 3300001978 Bacteria 1311
7 JGI24740J21852_10027188 3300001979 Bacteria 1906
8 JGI24740J21852_10041322 3300001979 Bacteria 1390
9 JGI24740J21852_10044782 3300001979 Bacteria 1310
10 JGI24739J22299_10000445 3300001989 Bacteria 14396
11 JGI24739J22299_10036364 3300001989 Bacteria 1664
12 JGI24739J22299_10041017 3300001989 Bacteria 1542
13 JGI24737J22298_10013530 3300001990 Bacteria 2655
14 JGI24743J22301_10001747 3300001991 Bacteria 3111
15 JGI24743J22301_10003049 3300001991 Bacteria 2605
16 JGI24743J22301_10009186 3300001991 Bacteria 1748
17 JGI24735J21928_10029427 3300002067 Bacteria 1635
18 JGI24735J21928_10040336 3300002067 Bacteria 1363
19 JGI24750J21931_1001808 3300002070 Bacteria 2608
20 JGI24750J21931_1005003 3300002070 Bacteria 1621
21 JGI24745J21846_1002341 3300002073 Bacteria 1928
22 JGI24745J21846_1002996 3300002073 Bacteria 1751
23 JGI24748J21848_1003907 3300002074 Bacteria 1707
24 JGI24748J21848_1004181 3300002074 Bacteria 1653
25 JGI24738J21930_10007082 3300002075 Bacteria 2604
26 JGI24738J21930_10012844 3300002075 Bacteria 1823
27 JGI24749J21850_1002463 3300002076 Bacteria 2604
28 JGI24749J21850_1007154 3300002076 Bacteria 1552
29 JGI24744J21845_10003722 3300002077 Bacteria 3147
30 JGI24744J21845_10011910 3300002077 Bacteria 1771
31 JGI24744J21845_10017976 3300002077 Bacteria 1403
32 JGI24033J26618_1003691 3300002155 Bacteria 1624
33 JGI24034J26672_10002224 3300002239 Bacteria 2644
34 JGI24034J26672_10002409 3300002239 Bacteria 2572
35 JGI24742J22300_10009063 3300002244 Bacteria 1641
36 JGI25155J39150_1001521 3300002704 Bacteria 1581
37 JGI25156J39149_1014887 3300002705 Bacteria 1581
38 JGI25154J39366_1007017 3300002738 Bacteria 1581
39 JGI25158J39367_1000017 3300002739 Bacteria 42066
40 JGI25157J39369_1007435 3300002741 Bacteria 1581
41 JGI25159J45721_1000239 3300002987 Bacteria 25945
42 JGI25151J46595_10009973 3300003187 Bacteria 4453
43 JGI25151J46595_10039500 3300003187 Bacteria 1741
44 JGI25406J46586_10020029 3300003203 Bacteria 2715
45 JGI25406J46586_10036361 3300003203 Bacteria 1787
46 rootH1_10173562 3300003316 Bacteria 1389
47 rootH1_10177097 3300003316 Unclassified 1394
48 rootL2_10312573 3300003322 Bacteria 2133
49 JGI25160J50197_1000513 3300003354 Bacteria 22892
50 JGI25407J50210_10016431 3300003373 Bacteria 1917
51 JGI25407J50210_10020924 3300003373 Bacteria 1701
52 JGI25407J50210_10023927 3300003373 Bacteria 1586
53 JGI25161J50226_1000102 3300003374 Bacteria 67971
54 JGI25404J52841_10017148 3300003659 Bacteria 1570
55 Ga0055524_1005219 3300003775 Bacteria 5843
56 Ga0055524_1005861 3300003775 Bacteria 5421
57 Ga0055540_1021203 3300003792 Bacteria 1695
58 Ga0055540_1026271 3300003792 Bacteria 1411
59 JGI25405J52794_10012956 3300003911 Bacteria 1611
60 Ga0055543_1000016 3300004625 Bacteria 176117
61 Ga0065165_1001457 3300005262 Bacteria 25562
62 Ga0065714_10099650 3300005288 Bacteria 1682
63 Ga0065704_10013137 3300005289 Unclassified 2378
64 Ga0065704_10022000 3300005289 Unclassified 2134
65 Ga0065712_10125824 3300005290 Bacteria 1609
66 Ga0065715_10013205 3300005293 Bacteria 1911
67 Ga0065715_10024588 3300005293 Bacteria 1449
68 Ga0065707_10005105 3300005295 Bacteria 2954
69 Ga0065707_10013210 3300005295 Unclassified 1636
70 Ga0065707_10026835 3300005295 Bacteria 2425
71 Ga0065707_10133766 3300005295 Bacteria 1871
72 Ga0065707_10142377 3300005295 Bacteria 1756
73 Ga0065707_10143099 3300005295 Bacteria 1747
74 Ga0065707_10153706 3300005295 Bacteria 1631
75 Ga0070658_10160378 3300005327 Bacteria 1886
76 Ga0070676_10051561 3300005328 Bacteria 2416
77 Ga0070676_10111479 3300005328 Bacteria 1704
78 Ga0070683_100158682 3300005329 Bacteria 2145
79 Ga0070683_100196421 3300005329 Bacteria 1916
80 Ga0070683_100230827 3300005329 Unclassified 1759
81 Ga0070690_100039305 3300005330 Bacteria 2989
82 Ga0070690_100193583 3300005330 Bacteria 1411
83 Ga0070670_100046887 3300005331 Bacteria 3717
84 Ga0070670_100093751 3300005331 Bacteria 2582
85 Ga0070670_100132265 3300005331 Bacteria 2155
86 Ga0070670_100307627 3300005331 Bacteria 1387
87 Ga0070677_10041932 3300005333 Bacteria 1809
88 Ga0068869_100092415 3300005334 Bacteria 2277
89 Ga0070666_10104035 3300005335 Bacteria 1959
90 Ga0070666_10137316 3300005335 Bacteria 1702
91 Ga0070666_10141490 3300005335 Bacteria 1676
92 Ga0070680_100076817 3300005336 Bacteria 2750
93 Ga0070680_100161604 3300005336 Bacteria 1882
94 Ga0070682_100052096 3300005337 Bacteria 2560
95 Ga0070682_100085558 3300005337 Bacteria 2051
96 Ga0070682_100097005 3300005337 Bacteria 1939
97 Ga0068868_100056503 3300005338 Bacteria 3099
98 Ga0068868_100061274 3300005338 Bacteria 2980
99 Ga0068868_100098812 3300005338 Bacteria 2360
100 Ga0068868_100126253 3300005338 Bacteria 2090
101 Ga0070660_100065696 3300005339 Bacteria 2823
102 Ga0070660_100095957 3300005339 Bacteria 2344
103 Ga0070660_100121771 3300005339 Bacteria 2082
104 Ga0070660_100199812 3300005339 Bacteria 1621
105 Ga0070660_100228539 3300005339 Bacteria 1513
106 Ga0070689_100054700 3300005340 Plasmid 3090
107 Ga0070689_100114354 3300005340 Bacteria 2150
108 Ga0070689_100162589 3300005340 Bacteria 1805
109 Ga0070689_100167805 3300005340 Bacteria 1777
110 Ga0070689_100178328 3300005340 Bacteria 1724
111 Ga0070691_10024936 3300005341 Bacteria 2782
112 Ga0070691_10094421 3300005341 Bacteria 1478
113 Ga0070687_100027481 3300005343 Plasmid 2750
114 Ga0070687_100037081 3300005343 Bacteria 2434
115 Ga0070687_100070198 3300005343 Bacteria 1878
116 Ga0070687_100118645 3300005343 Bacteria 1509
117 Ga0070661_100019619 3300005344 Unclassified 4818
118 Ga0070661_100030428 3300005344 Bacteria 3900
119 Ga0070661_100168746 3300005344 Bacteria 1661
120 Ga0070692_10081101 3300005345 Bacteria 1747
121 Ga0070692_10081430 3300005345 Bacteria 1744
122 Ga0070668_100069633 3300005347 Bacteria 2737
123 Ga0070668_100090504 3300005347 Bacteria 2411
124 Ga0070668_100091334 3300005347 Bacteria 2400
125 Ga0070668_100132943 3300005347 Bacteria 1998
126 Ga0070668_100133316 3300005347 Unclassified 1995
127 Ga0070669_100060312 3300005353 Bacteria 2787
128 Ga0070669_100113286 3300005353 Bacteria 2060
129 Ga0070669_100139391 3300005353 Bacteria 1868
130 Ga0070675_100093991 3300005354 Bacteria 2515
131 Ga0070671_100182528 3300005355 Bacteria 1777
132 Ga0070671_100211370 3300005355 Bacteria 1645
133 Ga0070671_100216550 3300005355 Bacteria 1625
134 Ga0070674_100052849 3300005356 Bacteria 2803
135 Ga0070674_100068515 3300005356 Bacteria 2500
136 Ga0070674_100140269 3300005356 Bacteria 1813
137 Ga0070674_100157563 3300005356 Bacteria 1719
138 Ga0070673_100039577 3300005364 Bacteria 3609
139 Ga0070673_100170657 3300005364 Bacteria 1856
140 Ga0070688_100049876 3300005365 Bacteria 2606
141 Ga0070688_100142056 3300005365 Bacteria 1632
142 Ga0070688_100213407 3300005365 Bacteria 1356
143 Ga0070659_100090289 3300005366 Bacteria 2455
144 Ga0070667_100106704 3300005367 Bacteria 2424
145 Ga0070703_10020473 3300005406 Unclassified 1925
146 Ga0070703_10026842 3300005406 Bacteria 1713
147 Ga0070703_10030498 3300005406 Bacteria 1624
148 Ga0070709_10079394 3300005434 Bacteria 2137
149 Ga0070709_10095920 3300005434 Unclassified 1965
150 Ga0070709_10113157 3300005434 Bacteria 1827
151 Ga0070709_10126851 3300005434 Bacteria 1737
152 Ga0070714_100124646 3300005435 Bacteria 2295
153 Ga0070714_100134109 3300005435 Bacteria 2215
154 Ga0070714_100170228 3300005435 Bacteria 1976
155 Ga0070714_100181083 3300005435 Unclassified 1917
156 Ga0070714_100199214 3300005435 Bacteria 1831
157 Ga0070713_100170128 3300005436 Bacteria 1951
158 Ga0070713_100182758 3300005436 Bacteria 1885
159 Ga0070713_100187871 3300005436 Bacteria 1860
160 Ga0070713_100235794 3300005436 Bacteria 1665
161 Ga0070710_10053386 3300005437 Bacteria 2276
162 Ga0070710_10087246 3300005437 Bacteria 1833
163 Ga0070710_10152923 3300005437 Bacteria 1424
164 Ga0070701_10065497 3300005438 Bacteria 1928
165 Ga0070701_10068120 3300005438 Bacteria 1895
166 Ga0070701_10107151 3300005438 Bacteria 1556
167 Ga0070711_100036660 3300005439 Bacteria 3286
168 Ga0070711_100150655 3300005439 Bacteria 1753
169 Ga0070711_100183368 3300005439 Bacteria 1603
170 Ga0070711_100186894 3300005439 Bacteria 1589
171 Ga0070705_100029518 3300005440 Bacteria 3018
172 Ga0070705_100089861 3300005440 Bacteria 1910
173 Ga0070705_100121711 3300005440 Bacteria 1686
174 Ga0070700_100052392 3300005441 Bacteria 2544
175 Ga0070700_100060121 3300005441 Bacteria 2394
176 Ga0070700_100098785 3300005441 Unclassified 1919
177 Ga0070700_100105665 3300005441 Bacteria 1862
178 Ga0070700_100132409 3300005441 Bacteria 1684
179 Ga0070700_100152800 3300005441 Bacteria 1580
180 Ga0070700_100167191 3300005441 Bacteria 1520
181 Ga0070694_100070545 3300005444 Bacteria 2406
182 Ga0070694_100198382 3300005444 Bacteria 1494
183 Ga0070708_100043267 3300005445 Plasmid 3956
184 Ga0070708_100065075 3300005445 Bacteria 3268
185 Ga0070708_100114882 3300005445 Bacteria 2477
186 Ga0070708_100122022 3300005445 Bacteria 2405
187 Ga0070708_100248458 3300005445 Unclassified 1671
188 Ga0070663_100090232 3300005455 Bacteria 2269
189 Ga0070663_100150145 3300005455 Bacteria 1786
190 Ga0070663_100152263 3300005455 Unclassified 1774
191 Ga0070663_100173340 3300005455 Bacteria 1669
192 Ga0070678_100041137 3300005456 Bacteria 3274
193 Ga0070678_100140384 3300005456 Bacteria 1932
194 Ga0070678_100200651 3300005456 Bacteria 1646
195 Ga0070678_100233602 3300005456 Bacteria 1534
196 Ga0070678_100289976 3300005456 Bacteria 1387
197 Ga0070662_100085487 3300005457 Bacteria 2357
198 Ga0070662_100117232 3300005457 Bacteria 2036
199 Ga0070662_100117374 3300005457 Bacteria 2035
200 Ga0070662_100132161 3300005457 Bacteria 1925
201 Ga0070662_100167397 3300005457 Bacteria 1723
202 Ga0070681_10244983 3300005458 Bacteria 1705
203 Ga0068867_100027947 3300005459 Bacteria 4058
204 Ga0068867_100064341 3300005459 Bacteria 2726
205 Ga0068867_100177894 3300005459 Bacteria 1689
206 Ga0068867_100322214 3300005459 Bacteria 1281
207 Ga0070685_10044018 3300005466 Bacteria 2554
208 Ga0070706_100022952 3300005467 Bacteria 5746
209 Ga0070706_100082644 3300005467 Bacteria 2975
210 Ga0070706_100087796 3300005467 Bacteria 2883
211 Ga0070706_100116852 3300005467 Unclassified 2484
212 Ga0070706_100183782 3300005467 Bacteria 1953
213 Ga0070706_100212671 3300005467 Bacteria 1805
214 Ga0070706_100282702 3300005467 Bacteria 1548
215 Ga0070707_100093518 3300005468 Bacteria 2911
216 Ga0070707_100149799 3300005468 Bacteria 2271
217 Ga0070707_100197891 3300005468 Bacteria 1959
218 Ga0070707_100276087 3300005468 Bacteria 1634
219 Ga0070698_100039155 3300005471 Bacteria 4881
220 Ga0070698_100041662 3300005471 Plasmid 4714
221 Ga0070698_100089376 3300005471 Bacteria 3064
222 Ga0070698_100224098 3300005471 Bacteria 1813
223 Ga0070698_100224479 3300005471 Bacteria 1812
224 Ga0070698_100238024 3300005471 Bacteria 1754
225 Ga0070698_100250645 3300005471 Bacteria 1703
226 Ga0070699_100141087 3300005518 Bacteria 2128
227 Ga0070699_100144774 3300005518 Bacteria 2099
228 Ga0070699_100188767 3300005518 Bacteria 1830
229 Ga0070699_100196855 3300005518 Bacteria 1791
230 Ga0070699_100198739 3300005518 Bacteria 1782
231 Ga0070699_100250383 3300005518 Bacteria 1582
232 Ga0070679_100097033 3300005530 Bacteria 2935
233 Ga0070679_100298246 3300005530 Bacteria 1562
234 Ga0070684_100036812 3300005535 Bacteria 4194
235 Ga0070684_100042691 3300005535 Unclassified 3916
236 Ga0070684_100093032 3300005535 Bacteria 2683
237 Ga0070684_100140765 3300005535 Bacteria 2182
238 Ga0070684_100147199 3300005535 Bacteria 2132
239 Ga0070684_100295794 3300005535 Bacteria 1485
240 Ga0070697_100064431 3300005536 Plasmid 2993
241 Ga0070697_100207462 3300005536 Bacteria 1667
242 Ga0070697_100270405 3300005536 Bacteria 1457
243 Ga0068853_100072271 3300005539 Bacteria 3006
244 Ga0068853_100146627 3300005539 Bacteria 2121
245 Ga0068853_100244220 3300005539 Bacteria 1646
246 Ga0070672_100063166 3300005543 Bacteria 2924
247 Ga0070672_100134215 3300005543 Bacteria 2037
248 Ga0070672_100153541 3300005543 Bacteria 1906
249 Ga0070686_100005670 3300005544 Bacteria 6916
250 Ga0070686_100021748 3300005544 Plasmid 3818
251 Ga0070686_100029194 3300005544 Plasmid 3352
252 Ga0070686_100052466 3300005544 Bacteria 2600
253 Ga0070686_100059901 3300005544 Bacteria 2454
254 Ga0070686_100109627 3300005544 Bacteria 1878
255 Ga0070686_100126765 3300005544 Bacteria 1760
256 Ga0070695_100027876 3300005545 Bacteria 3502
257 Ga0070695_100126396 3300005545 Bacteria 1756
258 Ga0070696_100057457 3300005546 Bacteria 2716
259 Ga0070696_100088711 3300005546 Bacteria 2199
260 Ga0070693_100032304 3300005547 Bacteria 2877
261 Ga0070693_100035389 3300005547 Bacteria 2769
262 Ga0070693_100072847 3300005547 Bacteria 2027
263 Ga0070693_100096992 3300005547 Bacteria 1788
264 Ga0070693_100132237 3300005547 Bacteria 1561
265 Ga0070665_100170538 3300005548 Bacteria 2177
266 Ga0070665_100173567 3300005548 Bacteria 2156
267 Ga0070665_100256282 3300005548 Bacteria 1750
268 Ga0070665_100282284 3300005548 Bacteria 1662
269 Ga0070704_100062100 3300005549 Bacteria 2677
270 Ga0070704_100063790 3300005549 Plasmid 2645
271 Ga0070704_100161089 3300005549 Bacteria 1774
272 Ga0070704_100188625 3300005549 Bacteria 1655
273 Ga0068855_100125369 3300005563 Bacteria 2937
274 Ga0068855_100200293 3300005563 Bacteria 2248
275 Ga0068855_100208482 3300005563 Bacteria 2197
276 Ga0068855_100347677 3300005563 Bacteria 1634
277 Ga0070664_100056268 3300005564 Unclassified 3342
278 Ga0070664_100063426 3300005564 Bacteria 3151
279 Ga0070664_100113082 3300005564 Bacteria 2371
280 Ga0070664_100158082 3300005564 Bacteria 2004
281 Ga0070664_100170704 3300005564 Unclassified 1929
282 Ga0070664_100238007 3300005564 Bacteria 1633
283 Ga0068857_100000670 3300005577 Bacteria 25389
284 Ga0068857_100121975 3300005577 Bacteria 2347
285 Ga0068857_100179001 3300005577 Unclassified 1929
286 Ga0068857_100337153 3300005577 Bacteria 1395
287 Ga0068854_100077788 3300005578 Bacteria 2442
288 Ga0068854_100154959 3300005578 Bacteria 1769
289 Ga0068854_100171959 3300005578 Bacteria 1686
290 Ga0068854_100213748 3300005578 Bacteria 1522
291 Ga0068856_100127785 3300005614 Bacteria 2545
292 Ga0068856_100204652 3300005614 Bacteria 1988
293 Ga0068856_100362757 3300005614 Bacteria 1467
294 Ga0070702_100048757 3300005615 Unclassified 2412
295 Ga0070702_100074057 3300005615 Bacteria 2019
296 Ga0070702_100119008 3300005615 Bacteria 1650
297 Ga0068852_100079887 3300005616 Bacteria 2898
298 Ga0068852_100148474 3300005616 Unclassified 2177
299 Ga0068852_100180404 3300005616 Bacteria 1985
300 Ga0068852_100294680 3300005616 Bacteria 1568
301 Ga0068859_100049640 3300005617 Bacteria 4214
302 Ga0068859_100147472 3300005617 Unclassified 2428
303 Ga0068859_100201378 3300005617 Bacteria 2075
304 Ga0068859_100214114 3300005617 Bacteria 2014
305 Ga0068859_100458018 3300005617 Bacteria 1371
306 Ga0068864_100046780 3300005618 Bacteria 3714
307 Ga0068864_100084529 3300005618 Bacteria 2788
308 Ga0068864_100219732 3300005618 Bacteria 1753
309 Ga0068864_100223167 3300005618 Bacteria 1739
310 Ga0068864_100293770 3300005618 Bacteria 1519
311 Ga0068866_10017550 3300005718 Bacteria 3220
312 Ga0068866_10023944 3300005718 Bacteria 2846
313 Ga0068866_10037987 3300005718 Bacteria 2368
314 Ga0068861_100050731 3300005719 Bacteria 3147
315 Ga0068861_100059763 3300005719 Bacteria 2919
316 Ga0068861_100069458 3300005719 Bacteria 2725
317 Ga0068861_100069897 3300005719 Bacteria 2717
318 Ga0068861_100074288 3300005719 Bacteria 2643
319 Ga0068861_100147153 3300005719 Bacteria 1929
320 Ga0068861_100158170 3300005719 Bacteria 1866
321 Ga0068851_10029329 3300005834 Bacteria 2723
322 Ga0068851_10080757 3300005834 Bacteria 1698
323 Ga0068870_10089223 3300005840 Bacteria 1720
324 Ga0068870_10123059 3300005840 Bacteria 1497
325 Ga0068863_100200631 3300005841 Bacteria 1919
326 Ga0068863_100233521 3300005841 Bacteria 1774
327 Ga0068863_100302161 3300005841 Bacteria 1553
328 Ga0068863_100371986 3300005841 Bacteria 1395
329 Ga0068858_100043420 3300005842 Bacteria 4168
330 Ga0068858_100194365 3300005842 Bacteria 1917
331 Ga0068858_100220666 3300005842 Bacteria 1795
332 Ga0068858_100246762 3300005842 Bacteria 1695
333 Ga0068858_100250383 3300005842 Bacteria 1683
334 Ga0068858_100278195 3300005842 Unclassified 1593
335 Ga0068858_100444856 3300005842 Bacteria 1248
336 Ga0068860_100097671 3300005843 Bacteria 2800
337 Ga0068860_100199421 3300005843 Bacteria 1939
338 Ga0068860_100259413 3300005843 Bacteria 1694
339 Ga0068860_100272084 3300005843 Bacteria 1653
340 Ga0068860_100313241 3300005843 Unclassified 1539
341 Ga0068860_100443086 3300005843 Bacteria 1290
342 Ga0068862_100051072 3300005844 Bacteria 3536
343 Ga0068862_100094868 3300005844 Bacteria 2602
344 Ga0068862_100155612 3300005844 Bacteria 2037
345 Ga0068862_100240574 3300005844 Bacteria 1646
346 Ga0068862_100301795 3300005844 Bacteria 1473
347 Ga0081455_10034693 3300005937 Bacteria 4517
348 Ga0081455_10037468 3300005937 Bacteria 4306
349 Ga0081455_10046581 3300005937 Bacteria 3760
350 Ga0081455_10060963 3300005937 Bacteria 3177
351 Ga0081455_10077244 3300005937 Bacteria 2740
352 Ga0081455_10148560 3300005937 Unclassified 1809
353 Ga0081538_10022883 3300005981 Plasmid 4510
354 Ga0081538_10037462 3300005981 Plasmid 3145
355 Ga0081538_10042022 3300005981 Bacteria 2891
356 Ga0081538_10076313 3300005981 Bacteria 1812
357 Ga0081540_1012755 3300005983 Bacteria 5504
358 Ga0081540_1019794 3300005983 Plasmid 4075
359 Ga0081540_1020402 3300005983 Bacteria 3987
360 Ga0081540_1032803 3300005983 Bacteria 2829
361 Ga0081539_10023650 3300005985 Plasmid 4017
362 Ga0081539_10029182 3300005985 Bacteria 3453
363 Ga0081539_10033365 3300005985 Plasmid 3136
364 Ga0081539_10071648 3300005985 Unclassified 1855
365 Ga0081539_10074538 3300005985 Unclassified 1807
366 Ga0070717_10028590 3300006028 Bacteria 4464
367 Ga0070717_10173475 3300006028 Bacteria 1876
368 Ga0075365_10000237 3300006038 Bacteria 18850
369 Ga0070715_10065874 3300006163 Bacteria 1604
370 Ga0070715_10092648 3300006163 Bacteria 1393
371 Ga0070715_10110393 3300006163 Bacteria 1296
372 Ga0070716_100055988 3300006173 Bacteria 2259
373 Ga0070716_100086094 3300006173 Bacteria 1889
374 Ga0070712_100023822 3300006175 Bacteria 4048
375 Ga0070712_100104009 3300006175 Bacteria 2106
376 Ga0070712_100118513 3300006175 Bacteria 1988
377 Ga0070712_100139273 3300006175 Bacteria 1849
378 Ga0070712_100273002 3300006175 Unclassified 1359
379 Ga0075362_10027549 3300006177 Bacteria 2434
380 Ga0075367_10058594 3300006178 Bacteria 2292
381 Ga0075367_10082312 3300006178 Bacteria 1949
382 Ga0075369_10044288 3300006186 Bacteria 1911
383 Ga0075427_10009009 3300006194 Bacteria 1483
384 Ga0075366_10098877 3300006195 Unclassified 1750
385 Ga0097621_100155150 3300006237 Bacteria 1965
386 Ga0097621_100175799 3300006237 Bacteria 1848
387 Ga0097621_100236899 3300006237 Bacteria 1594
388 Ga0097621_100369276 3300006237 Bacteria 1280
389 Ga0075370_10033927 3300006353 Bacteria 2860
390 Ga0068871_100064536 3300006358 Bacteria 2998
391 Ga0068871_100188192 3300006358 Bacteria 1777
392 Ga0068871_100239595 3300006358 Bacteria 1577
393 Ga0075428_100028486 3300006844 Bacteria 6180
394 Ga0075428_100037503 3300006844 Bacteria 5336
395 Ga0075428_100044076 3300006844 Plasmid 4903
396 Ga0075428_100056233 3300006844 Unclassified 4310
397 Ga0075428_100113539 3300006844 Bacteria 2951
398 Ga0075428_100153628 3300006844 Bacteria 2500
399 Ga0075428_100178206 3300006844 Unclassified 2301
400 Ga0075428_100238891 3300006844 Unclassified 1960
401 Ga0075428_100240881 3300006844 Bacteria 1951
402 Ga0075428_100269056 3300006844 Bacteria 1834
403 Ga0075430_100104083 3300006846 Bacteria 2369
404 Ga0075430_100128178 3300006846 Unclassified 2115
405 Ga0075430_100136375 3300006846 Bacteria 2044
406 Ga0075430_100143877 3300006846 Unclassified 1986
407 Ga0075430_100155888 3300006846 Bacteria 1901
408 Ga0075430_100189928 3300006846 Unclassified 1707
409 Ga0075431_100016082 3300006847 Bacteria 7592
410 Ga0075431_100068694 3300006847 Plasmid 3656
411 Ga0075431_100090552 3300006847 Bacteria 3157
412 Ga0075431_100134752 3300006847 Bacteria 2546
413 Ga0075431_100170922 3300006847 Unclassified 2233
414 Ga0075431_100172878 3300006847 Bacteria 2220
415 Ga0075431_100176238 3300006847 Bacteria 2196
416 Ga0075431_100262655 3300006847 Unclassified 1752
417 Ga0075431_100321829 3300006847 Bacteria 1559
418 Ga0075431_100323032 3300006847 Bacteria 1556
419 Ga0075431_100354974 3300006847 Bacteria 1473
420 Ga0075433_10105382 3300006852 Bacteria 2498
421 Ga0075433_10113421 3300006852 Unclassified 2404
422 Ga0075433_10168083 3300006852 Bacteria 1952
423 Ga0075433_10218347 3300006852 Bacteria 1694
424 Ga0075434_100111690 3300006871 Bacteria 2744
425 Ga0075434_100117323 3300006871 Bacteria 2674
426 Ga0075434_100139403 3300006871 Bacteria 2444
427 Ga0075434_100144371 3300006871 Unclassified 2400
428 Ga0075434_100172584 3300006871 Bacteria 2182
429 Ga0075434_100186892 3300006871 Unclassified 2092
430 Ga0075434_100239939 3300006871 Bacteria 1833
431 Ga0075434_100247405 3300006871 Bacteria 1802
432 Ga0075434_100256741 3300006871 Bacteria 1766
433 Ga0075429_100030455 3300006880 Plasmid 4688
434 Ga0075429_100089551 3300006880 Bacteria 2682
435 Ga0075429_100139350 3300006880 Bacteria 2123
436 Ga0075429_100195909 3300006880 Bacteria 1770
437 Ga0068865_100105700 3300006881 Bacteria 2068
438 Ga0068865_100234443 3300006881 Bacteria 1441
439 Ga0075436_100057442 3300006914 Bacteria 2688
440 Ga0075436_100083840 3300006914 Bacteria 2212
441 Ga0097620_100049638 3300006931 Bacteria 4214
442 Ga0097620_100147457 3300006931 Unclassified 2428
443 Ga0097620_100201376 3300006931 Bacteria 2075
444 Ga0097620_100214115 3300006931 Bacteria 2014
445 Ga0097620_100458013 3300006931 Bacteria 1371
446 Ga0079104_1021380 3300006946 Bacteria 1762
447 Ga0075435_100113724 3300007076 Bacteria 2253
448 Ga0099794_10013814 3300007265 Bacteria 3523
449 Ga0099794_10021704 3300007265 Bacteria 2920
450 Ga0099794_10037080 3300007265 Bacteria 2307
451 Ga0099794_10055581 3300007265 Bacteria 1913
452 Ga0099794_10066185 3300007265 Bacteria 1763
453 Ga0099795_10014397 3300007788 Bacteria 2452
454 Ga0099795_10047541 3300007788 Bacteria 1551
455 Ga0105244_10067882 3300009036 Bacteria 1783
456 Ga0105250_10036507 3300009092 Bacteria 1972
457 Ga0105240_10318397 3300009093 Bacteria 1774
458 Ga0105240_10362693 3300009093 Bacteria 1641
459 Ga0111539_10092223 3300009094 Bacteria 3559
460 Ga0111539_10198932 3300009094 Bacteria 2337
461 Ga0111539_10256727 3300009094 Bacteria 2035
462 Ga0111539_10259598 3300009094 Bacteria 2023
463 Ga0105245_10119969 3300009098 Unclassified 2455
464 Ga0105245_10133327 3300009098 Bacteria 2332
465 Ga0105245_10209572 3300009098 Bacteria 1875
466 Ga0105245_10224149 3300009098 Bacteria 1815
467 Ga0105245_10259206 3300009098 Bacteria 1692
468 Ga0105245_10328610 3300009098 Unclassified 1508
469 Ga0105245_10439836 3300009098 Unclassified 1310
470 Ga0105247_10066308 3300009101 Unclassified 2248
471 Ga0105247_10112449 3300009101 Bacteria 1754
472 Ga0105247_10124936 3300009101 Bacteria 1671
473 Ga0105247_10153492 3300009101 Bacteria 1519
474 Ga0114129_10059733 3300009147 Bacteria 5330
475 Ga0114129_10103518 3300009147 Bacteria 3936
476 Ga0114129_10153380 3300009147 Bacteria 3152
477 Ga0114129_10180619 3300009147 Plasmid 2871
478 Ga0114129_10238572 3300009147 Bacteria 2445
479 Ga0114129_10250180 3300009147 Bacteria 2379
480 Ga0114129_10256015 3300009147 Bacteria 2348
481 Ga0114129_10318742 3300009147 Unclassified 2067
482 Ga0114129_10392504 3300009147 Unclassified 1830
483 Ga0114129_10407221 3300009147 Bacteria 1792
484 Ga0105243_10075494 3300009148 Bacteria 2736
485 Ga0105243_10154633 3300009148 Bacteria 1971
486 Ga0105243_10160804 3300009148 Bacteria 1936
487 Ga0105241_10116136 3300009174 Bacteria 2149
488 Ga0105241_10177138 3300009174 Bacteria 1766
489 Ga0105241_10200440 3300009174 Bacteria 1667
490 Ga0105241_10259302 3300009174 Bacteria 1477
491 Ga0105242_10042694 3300009176 Bacteria 3664
492 Ga0105242_10136604 3300009176 Bacteria 2123
493 Ga0105248_10191085 3300009177 Bacteria 2307
494 Ga0105248_10265291 3300009177 Bacteria 1933
495 Ga0105237_10186964 3300009545 Bacteria 2072
496 Ga0105237_10254204 3300009545 Bacteria 1759
497 Ga0105237_10276888 3300009545 Unclassified 1680
498 Ga0105238_10001089 3300009551 Bacteria 27423
499 Ga0105238_10155951 3300009551 Bacteria 2258
500 Ga0105238_10464613 3300009551 Bacteria 1263
501 Ga0105249_10065134 3300009553 Bacteria 3352
502 Ga0105249_10065964 3300009553 Bacteria 3332
503 Ga0105249_10073156 3300009553 Plasmid 3170
504 Ga0105249_10087969 3300009553 Bacteria 2900
505 Ga0105249_10106865 3300009553 Bacteria 2641
506 Ga0105249_10131083 3300009553 Bacteria 2393
507 Ga0105249_10161943 3300009553 Bacteria 2163
508 Ga0105249_10261650 3300009553 Bacteria 1719
509 Ga0105249_10362762 3300009553 Bacteria 1471
510 Ga0099796_10031997 3300010159 Bacteria 1720
511 Ga0099796_10043800 3300010159 Bacteria 1526
512 Ga0105239_10114091 3300010375 Plasmid 2997
513 Ga0105239_10296049 3300010375 Bacteria 1822
514 Ga0105239_10315092 3300010375 Bacteria 1763
515 Ga0105239_10350117 3300010375 Bacteria 1668
516 Ga0105239_10353954 3300010375 Bacteria 1658
517 Ga0105239_10447305 3300010375 Bacteria 1465
518 Ga0105246_10072021 3300011119 Unclassified 2435
519 Ga0105246_10112013 3300011119 Bacteria 2006
520 Ga0105246_10113782 3300011119 Bacteria 1993
521 Ga0105246_10152185 3300011119 Bacteria 1752
522 Ga0105246_10179428 3300011119 Bacteria 1629
523 Ga0105246_10335028 3300011119 Unclassified 1234
524 Ga0157336_1000317 3300012477 Bacteria 2141
525 Ga0157341_1000641 3300012494 Unclassified 1842
526 Ga0157345_1000645 3300012498 Bacteria 2912
527 Ga0157314_1001201 3300012500 Unclassified 1913
528 Ga0157342_1001050 3300012507 Bacteria 1926
529 Ga0157373_10139260 3300013100 Bacteria 1706
530 Ga0157373_10147401 3300013100 Bacteria 1656
531 Ga0157371_10135552 3300013102 Bacteria 1753
532 Ga0157371_10138482 3300013102 Bacteria 1734
533 Ga0157370_10000266 3300013104 Bacteria 66475
534 Ga0157369_10001890 3300013105 Bacteria 25252
535 Ga0157369_10034157 3300013105 Bacteria 5583
536 Ga0157369_10194162 3300013105 Bacteria 2132
537 Ga0157374_10209188 3300013296 Bacteria 1912
538 Ga0157374_10226799 3300013296 Bacteria 1835
539 Ga0157378_10226928 3300013297 Bacteria 1778
540 Ga0163162_10048215 3300013306 Bacteria 4268
541 Ga0163162_10123215 3300013306 Bacteria 2697
542 Ga0163162_10164747 3300013306 Bacteria 2340
543 Ga0163162_10216164 3300013306 Unclassified 2047
544 Ga0163162_10226462 3300013306 Bacteria 1999
545 Ga0163162_10259820 3300013306 Bacteria 1868
546 Ga0163162_10287604 3300013306 Bacteria 1776
547 Ga0163162_10350063 3300013306 Archaea 1610
548 Ga0157372_10439058 3300013307 Bacteria 1521
549 Ga0157375_10059926 3300013308 Bacteria 3773
550 Ga0157375_10199452 3300013308 Bacteria 2156
551 Ga0157375_10212999 3300013308 Bacteria 2090
552 Ga0157375_10226460 3300013308 Bacteria 2028
553 Ga0157375_10229889 3300013308 Bacteria 2014
554 Ga0157375_10287252 3300013308 Bacteria 1808
555 Ga0157375_10301794 3300013308 Bacteria 1765
556 Ga0163163_10268039 3300014325 Bacteria 1759
557 Ga0163163_10346828 3300014325 Bacteria 1540
558 Ga0157380_10066469 3300014326 Bacteria 2900
559 Ga0157380_10108833 3300014326 Bacteria 2324
560 Ga0157380_10346207 3300014326 Bacteria 1389
561 Ga0182008_10063362 3300014497 Bacteria 1821
562 Ga0157377_10056938 3300014745 Bacteria 2221
563 Ga0157379_10049084 3300014968 Bacteria 3768
564 Ga0157379_10089881 3300014968 Bacteria 2755
565 Ga0157379_10112357 3300014968 Bacteria 2448
566 Ga0157379_10121942 3300014968 Bacteria 2345
567 Ga0157379_10127797 3300014968 Bacteria 2287
568 Ga0157379_10166146 3300014968 Bacteria 1992
569 Ga0157379_10199057 3300014968 Bacteria 1811
570 Ga0157379_10234219 3300014968 Bacteria 1665
571 Ga0157376_10125198 3300014969 Bacteria 2284
572 Ga0157376_10168647 3300014969 Bacteria 1991
573 Ga0157376_10192738 3300014969 Bacteria 1870
574 Ga0157376_10269995 3300014969 Bacteria 1597
575 Ga0157376_10493120 3300014969 Bacteria 1202
576 Ga0182006_1037985 3300015261 Bacteria 1906
577 Ga0163161_10028056 3300017792 Plasmid 3996
578 Ga0163161_10047094 3300017792 Bacteria 3113
579 Ga0163161_10091201 3300017792 Unclassified 2255
580 Ga0163161_10095234 3300017792 Bacteria 2208
581 Ga0163161_10134010 3300017792 Bacteria 1871
582 Ga0163161_10182136 3300017792 Bacteria 1611
583 Ga0163161_10190241 3300017792 Bacteria 1577
584 Ga0213873_10005426 3300021358 Bacteria 2446
585 Ga0213872_10023647 3300021361 Bacteria 2827
586 Ga0213872_10046034 3300021361 Bacteria 1985
587 Ga0213874_10003712 3300021377 Bacteria 3416
588 Ga0213874_10012407 3300021377 Bacteria 2185
589 Ga0213874_10022298 3300021377 Bacteria 1755
590 Ga0213876_10013980 3300021384 Bacteria 4253
591 Ga0213876_10061021 3300021384 Bacteria 1989
592 Ga0213876_10074413 3300021384 Bacteria 1794
593 Ga0213871_10015465 3300021441 Bacteria 1825
594 Ga0213871_10016699 3300021441 Bacteria 1773
595 Ga0228598_1011746 3300024227 Bacteria 1741
596 Ga0228598_1016767 3300024227 Bacteria 1446
597 Ga0209435_104472 3300025206 Bacteria 1581
598 Ga0209436_100003 3300025208 Bacteria 220530
599 Ga0207672_1001655 3300025223 Bacteria 1583
600 Ga0209646_1009087 3300025246 Bacteria 1581
601 Ga0209026_1011565 3300025250 Bacteria 1581
602 Ga0209759_1019831 3300025256 Bacteria 1581
603 Ga0209673_1000638 3300025273 Bacteria 52958
604 Ga0209673_1002243 3300025273 Bacteria 13955
605 Ga0209130_1000051 3300025284 Bacteria 220482
606 Ga0209025_1000392 3300025294 Bacteria 90826
607 Ga0209564_1000881 3300025295 Bacteria 39731
608 Ga0209564_1001097 3300025295 Bacteria 32207
609 Ga0209256_1000578 3300025299 Bacteria 52169
610 Ga0209256_1000915 3300025299 Bacteria 36110
611 Ga0209256_1017981 3300025299 Bacteria 2320
612 Ga0207426_1000043 3300025302 Bacteria 432827
613 Ga0209051_1004206 3300025303 Bacteria 8980
614 Ga0209051_1013113 3300025303 Bacteria 3963
615 Ga0207697_10050798 3300025315 Bacteria 1713
616 Ga0207697_10057659 3300025315 Bacteria 1612
617 Ga0207697_10067500 3300025315 Bacteria 1495
618 Ga0207697_10072691 3300025315 Bacteria 1442
619 Ga0207656_10018708 3300025321 Bacteria 2730
620 Ga0207656_10020468 3300025321 Bacteria 2630
621 Ga0207696_1030230 3300025711 Bacteria 1648
622 Ga0207653_10007395 3300025885 Unclassified 3423
623 Ga0207653_10010653 3300025885 Bacteria 2870
624 Ga0207653_10013116 3300025885 Plasmid 2593
625 Ga0207653_10026461 3300025885 Bacteria 1860
626 Ga0207653_10040725 3300025885 Bacteria 1524
627 Ga0207682_10012714 3300025893 Bacteria 3283
628 Ga0207682_10044128 3300025893 Bacteria 1827
629 Ga0207692_10017649 3300025898 Bacteria 3186
630 Ga0207692_10023051 3300025898 Bacteria 2874
631 Ga0207692_10087156 3300025898 Bacteria 1684
632 Ga0207642_10036628 3300025899 Bacteria 2107
633 Ga0207642_10037397 3300025899 Bacteria 2091
634 Ga0207642_10054676 3300025899 Bacteria 1822
635 Ga0207710_10068229 3300025900 Bacteria 1626
636 Ga0207710_10078683 3300025900 Bacteria 1526
637 Ga0207710_10098478 3300025900 Bacteria 1377
638 Ga0207688_10006342 3300025901 Bacteria 6437
639 Ga0207688_10058297 3300025901 Bacteria 2173
640 Ga0207688_10063796 3300025901 Bacteria 2078
641 Ga0207688_10141090 3300025901 Bacteria 1418
642 Ga0207680_10124285 3300025903 Bacteria 1692
643 Ga0207680_10141499 3300025903 Bacteria 1595
644 Ga0207647_10024961 3300025904 Bacteria 3935
645 Ga0207647_10042567 3300025904 Bacteria 2848
646 Ga0207685_10025557 3300025905 Bacteria 2041
647 Ga0207685_10090782 3300025905 Bacteria 1286
648 Ga0207699_10026756 3300025906 Bacteria 3184
649 Ga0207699_10038640 3300025906 Bacteria 2737
650 Ga0207699_10178134 3300025906 Bacteria 1427
651 Ga0207645_10082311 3300025907 Bacteria 2063
652 Ga0207645_10111662 3300025907 Bacteria 1770
653 Ga0207645_10121052 3300025907 Bacteria 1699
654 Ga0207643_10085144 3300025908 Bacteria 1836
655 Ga0207643_10102932 3300025908 Bacteria 1676
656 Ga0207643_10115584 3300025908 Bacteria 1584
657 Ga0207684_10052991 3300025910 Plasmid 3444
658 Ga0207684_10065341 3300025910 Bacteria 3089
659 Ga0207684_10070992 3300025910 Bacteria 2959
660 Ga0207684_10123089 3300025910 Bacteria 2224
661 Ga0207684_10152673 3300025910 Bacteria 1987
662 Ga0207684_10330982 3300025910 Unclassified 1312
663 Ga0207654_10076110 3300025911 Bacteria 2008
664 Ga0207654_10127439 3300025911 Bacteria 1607
665 Ga0207654_10128375 3300025911 Bacteria 1602
666 Ga0207654_10134631 3300025911 Bacteria 1568
667 Ga0207695_10181228 3300025913 Bacteria 2027
668 Ga0207695_10238628 3300025913 Bacteria 1720
669 Ga0207671_10069987 3300025914 Bacteria 2615
670 Ga0207671_10183097 3300025914 Bacteria 1631
671 Ga0207671_10183867 3300025914 Bacteria 1628
672 Ga0207693_10050815 3300025915 Bacteria 3254
673 Ga0207693_10054163 3300025915 Bacteria 3147
674 Ga0207693_10219567 3300025915 Unclassified 1493
675 Ga0207693_10224793 3300025915 Bacteria 1474
676 Ga0207663_10089821 3300025916 Bacteria 2035
677 Ga0207663_10106052 3300025916 Unclassified 1898
678 Ga0207663_10162719 3300025916 Bacteria 1577
679 Ga0207663_10169279 3300025916 Bacteria 1550
680 Ga0207663_10171566 3300025916 Bacteria 1541
681 Ga0207662_10037067 3300025918 Bacteria 2853
682 Ga0207662_10047126 3300025918 Bacteria 2552
683 Ga0207662_10098498 3300025918 Bacteria 1809
684 Ga0207662_10105905 3300025918 Bacteria 1748
685 Ga0207662_10106555 3300025918 Bacteria 1743
686 Ga0207657_10027420 3300025919 Bacteria 5217
687 Ga0207657_10065538 3300025919 Bacteria 3096
688 Ga0207657_10160948 3300025919 Bacteria 1823
689 Ga0207657_10202938 3300025919 Bacteria 1594
690 Ga0207649_10020385 3300025920 Bacteria 3802
691 Ga0207649_10102736 3300025920 Bacteria 1895
692 Ga0207649_10108756 3300025920 Bacteria 1848
693 Ga0207652_10103318 3300025921 Bacteria 2519
694 Ga0207652_10191568 3300025921 Bacteria 1839
695 Ga0207646_10025672 3300025922 Bacteria 5387
696 Ga0207646_10085312 3300025922 Bacteria 2825
697 Ga0207646_10137491 3300025922 Bacteria 2200
698 Ga0207646_10164594 3300025922 Bacteria 2002
699 Ga0207646_10201734 3300025922 Bacteria 1797
700 Ga0207646_10321393 3300025922 Bacteria 1398
701 Ga0207646_10383622 3300025922 Bacteria 1269
702 Ga0207681_10160383 3300025923 Bacteria 1694
703 Ga0207681_10296772 3300025923 Bacteria 1277
704 Ga0207694_10067966 3300025924 Bacteria 2782
705 Ga0207694_10158975 3300025924 Bacteria 1824
706 Ga0207694_10167132 3300025924 Bacteria 1779
707 Ga0207650_10197782 3300025925 Bacteria 1609
708 Ga0207687_10062213 3300025927 Plasmid 2639
709 Ga0207687_10085062 3300025927 Bacteria 2294
710 Ga0207687_10117642 3300025927 Bacteria 1983
711 Ga0207687_10180630 3300025927 Unclassified 1634
712 Ga0207687_10188744 3300025927 Unclassified 1602
713 Ga0207687_10195667 3300025927 Bacteria 1577
714 Ga0207700_10061188 3300025928 Bacteria 2855
715 Ga0207700_10084330 3300025928 Bacteria 2490
716 Ga0207700_10124518 3300025928 Bacteria 2095
717 Ga0207700_10159642 3300025928 Bacteria 1871
718 Ga0207700_10233032 3300025928 Bacteria 1566
719 Ga0207664_10012633 3300025929 Bacteria 6041
720 Ga0207664_10153783 3300025929 Bacteria 1956
721 Ga0207664_10184830 3300025929 Bacteria 1791
722 Ga0207664_10210675 3300025929 Bacteria 1681
723 Ga0207644_10095484 3300025931 Bacteria 2223
724 Ga0207644_10103020 3300025931 Bacteria 2147
725 Ga0207644_10147929 3300025931 Bacteria 1815
726 Ga0207644_10155737 3300025931 Bacteria 1771
727 Ga0207644_10199542 3300025931 Bacteria 1577
728 Ga0207690_10179921 3300025932 Bacteria 1591
729 Ga0207690_10194779 3300025932 Bacteria 1535
730 Ga0207706_10084757 3300025933 Bacteria 2786
731 Ga0207706_10119918 3300025933 Bacteria 2313
732 Ga0207706_10124875 3300025933 Unclassified 2264
733 Ga0207706_10143115 3300025933 Bacteria 2103
734 Ga0207706_10152090 3300025933 Bacteria 2035
735 Ga0207706_10167282 3300025933 Bacteria 1932
736 Ga0207706_10207441 3300025933 Bacteria 1718
737 Ga0207706_10243283 3300025933 Bacteria 1573
738 Ga0207686_10030719 3300025934 Bacteria 3184
739 Ga0207709_10121758 3300025935 Bacteria 1763
740 Ga0207709_10123769 3300025935 Bacteria 1751
741 Ga0207670_10013313 3300025936 Bacteria 4845
742 Ga0207670_10057092 3300025936 Bacteria 2646
743 Ga0207670_10165799 3300025936 Bacteria 1653
744 Ga0207670_10176473 3300025936 Bacteria 1606
745 Ga0207670_10242793 3300025936 Bacteria 1388
746 Ga0207669_10077941 3300025937 Bacteria 2109
747 Ga0207669_10139873 3300025937 Bacteria 1678
748 Ga0207704_10025221 3300025938 Bacteria 3241
749 Ga0207704_10119108 3300025938 Bacteria 1802
750 Ga0207704_10152334 3300025938 Bacteria 1633
751 Ga0207665_10046964 3300025939 Bacteria 2894
752 Ga0207665_10085023 3300025939 Bacteria 2184
753 Ga0207665_10105827 3300025939 Bacteria 1971
754 Ga0207665_10140341 3300025939 Bacteria 1722
755 Ga0207665_10151335 3300025939 Bacteria 1662
756 Ga0207665_10174844 3300025939 Bacteria 1552
757 Ga0207691_10084125 3300025940 Bacteria 2856
758 Ga0207691_10158591 3300025940 Bacteria 1986
759 Ga0207691_10175945 3300025940 Bacteria 1872
760 Ga0207691_10196892 3300025940 Bacteria 1755
761 Ga0207711_10146464 3300025941 Bacteria 2128
762 Ga0207711_10193058 3300025941 Bacteria 1856
763 Ga0207711_10216361 3300025941 Bacteria 1751
764 Ga0207711_10265947 3300025941 Bacteria 1577
765 Ga0207689_10058015 3300025942 Bacteria 3184
766 Ga0207689_10075318 3300025942 Bacteria 2774
767 Ga0207689_10124354 3300025942 Bacteria 2122
768 Ga0207689_10149536 3300025942 Bacteria 1925
769 Ga0207689_10176177 3300025942 Bacteria 1763
770 Ga0207689_10242957 3300025942 Unclassified 1488
771 Ga0207689_10280483 3300025942 Bacteria 1380
772 Ga0207661_10043519 3300025944 Bacteria 3543
773 Ga0207661_10144957 3300025944 Bacteria 2047
774 Ga0207679_10020622 3300025945 Bacteria 4450
775 Ga0207679_10055004 3300025945 Plasmid 2932
776 Ga0207679_10099648 3300025945 Bacteria 2269
777 Ga0207679_10154138 3300025945 Bacteria 1874
778 Ga0207679_10224435 3300025945 Bacteria 1582
779 Ga0207679_10274016 3300025945 Bacteria 1444
780 Ga0207667_10116556 3300025949 Bacteria 2752
781 Ga0207667_10293975 3300025949 Bacteria 1659
782 Ga0207667_10313889 3300025949 Bacteria 1601
783 Ga0207651_10165221 3300025960 Bacteria 1739
784 Ga0207651_10183438 3300025960 Bacteria 1662
785 Ga0207651_10236558 3300025960 Bacteria 1486
786 Ga0207712_10030225 3300025961 Bacteria 3640
787 Ga0207712_10057203 3300025961 Plasmid 2751
788 Ga0207712_10070453 3300025961 Bacteria 2512
789 Ga0207712_10116998 3300025961 Unclassified 2010
790 Ga0207712_10136315 3300025961 Bacteria 1878
791 Ga0207712_10163269 3300025961 Bacteria 1734
792 Ga0207712_10167792 3300025961 Unclassified 1713
793 Ga0207712_10219023 3300025961 Bacteria 1521
794 Ga0207668_10081840 3300025972 Bacteria 2343
795 Ga0207668_10131079 3300025972 Bacteria 1914
796 Ga0207668_10156768 3300025972 Bacteria 1769
797 Ga0207668_10158970 3300025972 Unclassified 1758
798 Ga0207668_10254341 3300025972 Bacteria 1428
799 Ga0207640_10037158 3300025981 Bacteria 3062
800 Ga0207640_10047237 3300025981 Bacteria 2775
801 Ga0207640_10056761 3300025981 Bacteria 2572
802 Ga0207640_10126586 3300025981 Bacteria 1840
803 Ga0207640_10143039 3300025981 Bacteria 1746
804 Ga0207658_10040031 3300025986 Bacteria 3385
805 Ga0207658_10124148 3300025986 Bacteria 2063
806 Ga0207658_10172172 3300025986 Bacteria 1784
807 Ga0207677_10017107 3300026023 Bacteria 4314
808 Ga0207677_10180695 3300026023 Bacteria 1659
809 Ga0207677_10217403 3300026023 Bacteria 1530
810 Ga0207703_10030010 3300026035 Bacteria 4294
811 Ga0207703_10175227 3300026035 Bacteria 1889
812 Ga0207703_10251480 3300026035 Bacteria 1593
813 Ga0207703_10256407 3300026035 Bacteria 1579
814 Ga0207639_10174531 3300026041 Bacteria 1823
815 Ga0207678_10042293 3300026067 Bacteria 3948
816 Ga0207678_10105080 3300026067 Bacteria 2410
817 Ga0207678_10174566 3300026067 Bacteria 1835
818 Ga0207678_10191923 3300026067 Bacteria 1746
819 Ga0207678_10241467 3300026067 Bacteria 1547
820 Ga0207708_10031070 3300026075 Bacteria 4052
821 Ga0207708_10034821 3300026075 Bacteria 3831
822 Ga0207708_10041968 3300026075 Bacteria 3488
823 Ga0207708_10117180 3300026075 Bacteria 2072
824 Ga0207708_10124288 3300026075 Bacteria 2013
825 Ga0207708_10138892 3300026075 Bacteria 1905
826 Ga0207708_10139209 3300026075 Bacteria 1902
827 Ga0207708_10141581 3300026075 Unclassified 1887
828 Ga0207708_10151776 3300026075 Bacteria 1824
829 Ga0207708_10209608 3300026075 Bacteria 1557
830 Ga0207702_10240583 3300026078 Bacteria 1695
831 Ga0207702_10253620 3300026078 Bacteria 1653
832 Ga0207702_10257253 3300026078 Bacteria 1642
833 Ga0207641_10244140 3300026088 Bacteria 1674
834 Ga0207641_10249901 3300026088 Unclassified 1656
835 Ga0207641_10300848 3300026088 Bacteria 1515
836 Ga0207648_10098061 3300026089 Bacteria 2565
837 Ga0207648_10201139 3300026089 Bacteria 1767
838 Ga0207648_10205872 3300026089 Bacteria 1746
839 Ga0207676_10158789 3300026095 Bacteria 1956
840 Ga0207676_10173823 3300026095 Unclassified 1879
841 Ga0207676_10208348 3300026095 Bacteria 1732
842 Ga0207676_10274742 3300026095 Bacteria 1527
843 Ga0207674_10074163 3300026116 Bacteria 3415
844 Ga0207674_10155203 3300026116 Bacteria 2244
845 Ga0207674_10211658 3300026116 Unclassified 1887
846 Ga0207674_10256811 3300026116 Bacteria 1694
847 Ga0207675_100034176 3300026118 Bacteria 4740
848 Ga0207675_100151016 3300026118 Bacteria 2211
849 Ga0207675_100174143 3300026118 Unclassified 2058
850 Ga0207675_100184116 3300026118 Unclassified 2001
851 Ga0207675_100211147 3300026118 Bacteria 1867
852 Ga0207675_100278435 3300026118 Bacteria 1625
853 Ga0207675_100304327 3300026118 Unclassified 1553
854 Ga0207683_10044883 3300026121 Bacteria 3864
855 Ga0207683_10046123 3300026121 Bacteria 3812
856 Ga0207683_10070908 3300026121 Bacteria 3079
857 Ga0207683_10155014 3300026121 Bacteria 2069
858 Ga0207683_10206422 3300026121 Bacteria 1787
859 Ga0207683_10232163 3300026121 Bacteria 1683
860 Ga0207683_10243911 3300026121 Bacteria 1639
861 Ga0207698_10034493 3300026142 Bacteria 3689
862 Ga0207698_10142501 3300026142 Unclassified 2067
863 Ga0207698_10172916 3300026142 Bacteria 1904
864 Ga0207698_10203129 3300026142 Bacteria 1776
865 Ga0209281_1012592 3300027111 Bacteria 1851
866 Ga0209281_1013518 3300027111 Bacteria 1761
867 Ga0209371_1014098 3300027312 Bacteria 2207
868 Ga0209179_1005573 3300027512 Bacteria 1980
869 Ga0209179_1007027 3300027512 Bacteria 1843
870 Ga0209179_1013132 3300027512 Bacteria 1500
871 Ga0209588_1017446 3300027671 Bacteria 2226
872 Ga0209588_1020444 3300027671 Bacteria 2073
873 Ga0209588_1032644 3300027671 Bacteria 1668
874 Ga0209588_1037461 3300027671 Bacteria 1561
875 Ga0209588_1038131 3300027671 Bacteria 1548
876 Ga0207428_10017929 3300027907 Bacteria 6066
877 Ga0207428_10026452 3300027907 Bacteria 4844
878 Ga0207428_10061512 3300027907 Unclassified 2972
879 Ga0207428_10143633 3300027907 Bacteria 1820
880 Ga0207428_10158012 3300027907 Bacteria 1723
881 Ga0207428_10172822 3300027907 Unclassified 1636
882 Ga0207428_10194478 3300027907 Bacteria 1528
883 Ga0207428_10242345 3300027907 Unclassified 1347
884 Ga0268266_10098147 3300028379 Bacteria 2577
885 Ga0268266_10162001 3300028379 Bacteria 2024
886 Ga0268266_10256057 3300028379 Bacteria 1620
887 Ga0268265_10192999 3300028380 Bacteria 1760
888 Ga0268265_10296635 3300028380 Bacteria 1453
889 Ga0268265_10344072 3300028380 Bacteria 1359
890 Ga0268264_10124048 3300028381 Bacteria 2280
891 Ga0268264_10181015 3300028381 Bacteria 1914
892 Ga0268264_10190924 3300028381 Bacteria 1867
893 Ga0268264_10258266 3300028381 Unclassified 1622
894 Ga0307515_10159094 3300028794 Bacteria 2314
895 Ga0307515_10272353 3300028794 Bacteria 1412
896 Ga0265338_10114313 3300028800 Bacteria 2166
897 Ga0268256_1015307 3300030500 Bacteria 2244
898 Ga0265770_1004061 3300030878 Bacteria 1992
899 Ga0265771_1000388 3300031010 Bacteria 1551
900 Ga0265760_10018460 3300031090 Bacteria 2009
901 Ga0265339_10119329 3300031249 Bacteria 1357
902 Ga0265327_10051715 3300031251 Bacteria 2143
903 Ga0307513_10061832 3300031456 Bacteria 3961
904 Ga0307513_10328949 3300031456 Bacteria 1283
905 Ga0307408_100140304 3300031548 Bacteria 1896
906 Ga0307408_100165794 3300031548 Bacteria 1759
907 Ga0307408_100301131 3300031548 Bacteria 1343
908 Ga0316579_10063545 3300031691 Unclassified 1740
909 Ga0265314_10058171 3300031711 Bacteria 2650
910 Ga0316576_10115783 3300031727 Unclassified 2011
911 Ga0316578_10033379 3300031728 Plasmid 2948
912 Ga0307405_10171721 3300031731 Bacteria 1547
913 Ga0316577_10092970 3300031733 Bacteria 1688
914 Ga0307413_10072369 3300031824 Bacteria 2176
915 Ga0307413_10130659 3300031824 Bacteria 1718
916 Ga0307410_10032892 3300031852 Bacteria 3343
917 Ga0307410_10105031 3300031852 Bacteria 2032
918 Ga0307410_10170955 3300031852 Bacteria 1637
919 Ga0307406_10116285 3300031901 Bacteria 1850
920 Ga0307406_10210014 3300031901 Bacteria 1439
921 Ga0307407_10126480 3300031903 Bacteria 1628
922 Ga0307412_10167039 3300031911 Bacteria 1641
923 Ga0307412_10216449 3300031911 Bacteria 1465
924 Ga0307412_10250273 3300031911 Bacteria 1375
925 Ga0307409_100189203 3300031995 Bacteria 1830
926 Ga0307409_100217594 3300031995 Bacteria 1722
927 Ga0307416_100185620 3300032002 Bacteria 1954
928 Ga0307416_100208014 3300032002 Bacteria 1863
929 Ga0307416_100440712 3300032002 Bacteria 1352
930 Ga0307414_10110067 3300032004 Bacteria 2094
931 Ga0307414_10295592 3300032004 Bacteria 1367
932 Ga0307411_10142978 3300032005 Bacteria 1766
933 Ga0307415_100150739 3300032126 Bacteria 1789
934 Ga0307507_10154252 3300033179 Bacteria 1717
935 Ga0307510_10156464 3300033180 Bacteria 1885
936 Ga0373948_0009227 3300034817 Bacteria 1698
937 Ga0373959_0004703 3300034820 Bacteria 2213
938 Ga0373926_0010123 3300035083 Bacteria 3156
939 Ga0373926_0016744 3300035083 Bacteria 2511
940 Ga0373926_0020734 3300035083 Bacteria 2271
941 Ga0373926_0022972 3300035083 Bacteria 2164
942 Ga0373926_0077649 3300035083 Bacteria 1225
943 Ga0373928_0008027 3300035084 Bacteria 2043
944 Ga0373934_0029429 3300035086 Bacteria 2144
945 Ga0373934_0030330 3300035086 Bacteria 2114
946 Ga0373934_0066146 3300035086 Bacteria 1443
947 Ga0373944_0005365 3300035089 Bacteria 3373
948 Ga0373944_0035202 3300035089 Unclassified 1525
949 Ga0373952_0010966 3300035092 Bacteria 1760
950 Ga0373923_0013618 3300035111 Bacteria 3035
951 Ga0373923_0024422 3300035111 Bacteria 2385
952 Ga0373932_0022780 3300035112 Bacteria 1668
953 Ga0373936_0027383 3300035113 Bacteria 2235
954 Ga0373945_0020878 3300035116 Bacteria 2245
955 Ga0373953_0037220 3300035117 Bacteria 1919
956 Ga0373953_0055691 3300035117 Bacteria 1606
957 Ga0373954_0028298 3300035118 Bacteria 2576
958 Ga0373954_0041247 3300035118 Bacteria 2151
959 Ga0373954_0045218 3300035118 Bacteria 2056
960 Ga0373954_0052933 3300035118 Bacteria 1907
961 Ga0373954_0065893 3300035118 Bacteria 1714
962 Ga0373954_0088274 3300035118 Bacteria 1487
963 Ga0373956_0039464 3300035119 Bacteria 2092
964 Ga0373956_0097093 3300035119 Bacteria 1363
965 Ga0373957_0014082 3300035120 Bacteria 2727
966 Ga0373957_0017278 3300035120 Bacteria 2509
967 Ga0373957_0035934 3300035120 Bacteria 1843
968 Ga0373960_0017632 3300035121 Bacteria 1852
969 Ga0373943_0054037 3300035170 Bacteria 1985
970 Ga0373943_0069740 3300035170 Bacteria 1777
971 Ga0373943_0072817 3300035170 Bacteria 1743
972 Ga0373943_0081537 3300035170 Bacteria 1659
973 Ga0373943_0097138 3300035170 Unclassified 1534
974 Ga0373943_0103169 3300035170 Bacteria 1494
975 Ga0373946_0043629 3300035171 Bacteria 1848
976 Ga0373946_0044419 3300035171 Bacteria 1834
977 Ga0373946_0054075 3300035171 Bacteria 1688
978 Ga0373955_0021663 3300035172 Bacteria 3248
979 Ga0373955_0032469 3300035172 Bacteria 2740
980 Ga0373955_0049563 3300035172 Bacteria 2280
981 Ga0373955_0056092 3300035172 Bacteria 2160
982 Ga0373955_0079850 3300035172 Bacteria 1846
983 Ga0373955_0139938 3300035172 Bacteria 1418
984 Ga0373942_0011164 3300035207 Bacteria 2125
985 Ga0373942_0015044 3300035207 Bacteria 1880
986 Ga0316574_0008917 3300035398 Bacteria 5597
987 Ga0373924_0026767 3300035410 Bacteria 2289
988 Ga0373924_0029361 3300035410 Bacteria 2197
989 Ga0373924_0037828 3300035410 Bacteria 1966
990 Ga0373924_0041626 3300035410 Unclassified 1882
991 Ga0373931_0029914 3300035691 Bacteria 2800
992 Ga0373931_0072573 3300035691 Bacteria 1882
993 Ga0373931_0099126 3300035691 Unclassified 1636
994 Ga0373931_0159674 3300035691 Bacteria 1320
995 Ga0373935_0067765 3300035692 Bacteria 2295
996 Ga0373935_0084765 3300035692 Unclassified 2064
997 Ga0373935_0086944 3300035692 Bacteria 2040
998 Ga0373935_0101033 3300035692 Bacteria 1901
999 Ga0373935_0138088 3300035692 Bacteria 1644
1000 Ga0373935_0157701 3300035692 Bacteria 1544
1001 Ga0373935_0160901 3300035692 Bacteria 1530
1002 Ga0373935_0258042 3300035692 Bacteria 1222
1003 Ga0373927_0040745 3300035695 Bacteria 3013
1004 Ga0373927_0054162 3300035695 Bacteria 2594
1005 Ga0373927_0066862 3300035695 Unclassified 2325
1006 Ga0373927_0082080 3300035695 Bacteria 2089
1007 Ga0373927_0119960 3300035695 Bacteria 1716
1008 Ga0373927_0127744 3300035695 Bacteria 1660
1009 Ga0373933_0042382 3300035724 Bacteria 2690
1010 Ga0373933_0062719 3300035724 Bacteria 2245
1011 Ga0373933_0121273 3300035724 Bacteria 1637
1012 Ga0373933_0123095 3300035724 Bacteria 1625
1013 Ga0373933_0182282 3300035724 Bacteria 1339
1014 Ga0373947_0054945 3300035725 Bacteria 2404
1015 Ga0373947_0073976 3300035725 Unclassified 2095
1016 Ga0373947_0079596 3300035725 Bacteria 2025
1017 Ga0373947_0152412 3300035725 Bacteria 1489
1018 Ga0373947_0205775 3300035725 Bacteria 1289
1019 Ga0373937_0165521 3300036401 Bacteria 2073
1020 Ga0373937_0208670 3300036401 Bacteria 1837
1021 Ga0373937_0214034 3300036401 Bacteria 1813
1022 Ga0373937_0220458 3300036401 Unclassified 1785
1023 Ga0373937_0294051 3300036401 Bacteria 1534
1024 Ga0316584_0048002 3300036712 Plasmid 3190
1025 Ga0373925_0113162 3300037068 Bacteria 2098
1026 Ga0373925_0116618 3300037068 Unclassified 2068
1027 Ga0373925_0197552 3300037068 Bacteria 1598
1028 Ga0395899_0151556 3300037312 Bacteria 1643
1029 Ga0395900_0117244 3300037418 Bacteria 2732
1030 Ga0395900_0344792 3300037418 Bacteria 1464
1031 Ga0395900_0464087 3300037418 Unclassified 1221
1032 Ga0395898_0077001 3300037466 Bacteria 3220
1033 Ga0395905_0218948 3300037471 Bacteria 1782
1034 Ga0395905_0245497 3300037471 Bacteria 1673
1035 Ga0436364_0173979 3300037853 Bacteria 2924
1036 Ga0436364_0256259 3300037853 Unclassified 1314
1037 Ga0436364_1405813 3300037853 Bacteria 2096
1038 Ga0395901_0014899 3300038443 Bacteria 7900
1039 Ga0436365_0006810 3300039437 Bacteria 1954
1040 Ga0436365_0053528 3300039437 Bacteria 3434
1041 Ga0436365_0064527 3300039437 Bacteria 32229
1042 Ga0436365_0700849 3300039437 Bacteria 2847
1043 Ga0436365_1132570 3300039437 Bacteria 2507
1044 Ga0436360_0136438 3300039438 Bacteria 1816
1045 Ga0436360_1035749 3300039438 Bacteria 1858
1046 Ga0436360_1069144 3300039438 Bacteria 1330
1047 Ga0436361_0020797 3300039447 Bacteria 1740
1048 Ga0436361_0092328 3300039447 Bacteria 1863
1049 Ga0436361_0242002 3300039447 Bacteria 2893
1050 Ga0436361_0287361 3300039447 Bacteria 2503
1051 Ga0436361_0311593 3300039447 Bacteria 1999
1052 Ga0436361_0448929 3300039447 Bacteria 1971
1053 Ga0436361_0544795 3300039447 Bacteria 1705
1054 Ga0436361_0570546 3300039447 Bacteria 1603
1055 Ga0436361_0770865 3300039447 Bacteria 1686
1056 Ga0436363_0019643 3300039450 Bacteria 4175
1057 Ga0436363_0188199 3300039450 Bacteria 3169
1058 Ga0436363_0953581 3300039450 Bacteria 2508
1059 Ga0436363_1116784 3300039450 Bacteria 1193
1060 Ga0436363_1156995 3300039450 Unclassified 1837
1061 Ga0436362_0228811 3300039453 Bacteria 3756
1062 Ga0436362_0495641 3300039453 Bacteria 1746
1063 Ga0436362_1240782 3300039453 Bacteria 2488
1064 Ga0439465_0031299 3300041413 Bacteria 1694
1065 Ga0451798_0178063 3300041458 Unclassified 1009
1066 Ga0451800_1108730 3300041459 Bacteria 1877
1067 Ga0451800_1597933 3300041459 Bacteria 1892
1068 Ga0451833_1253448 3300041491 Bacteria 2208
1069 Ga0439448_0010142 3300042005 Plasmid 2787
1070 Ga0439448_0012955 3300042005 Bacteria 2502
1071 Ga0439435_0010845 3300042436 Bacteria 2173
1072 Ga0439435_0011464 3300042436 Bacteria 2128
1073 Ga0439444_0014561 3300042437 Unclassified 1317
1074 Ga0439460_0010137 3300042461 Bacteria 2404
1075 Ga0453683_0022403 3300044673 Bacteria 4029
1076 Ga0453683_0063524 3300044673 Unclassified 2308
1077 Ga0466966_0056572 3300044684 Bacteria 2481
1078 Ga0466966_0097323 3300044684 Bacteria 1822
1079 Ga0466963_0101529 3300044694 Bacteria 1969
1080 Ga0451576_0080230 3300045051 Bacteria 3395
1081 Ga0451576_0155383 3300045051 Bacteria 2386
1082 Ga0495617_020661 3300046452 Bacteria 2226
1083 Ga0495592_0032949 3300046454 Bacteria 3908
1084 Ga0495592_0071135 3300046454 Bacteria 2532
1085 Ga0495592_0124571 3300046454 Bacteria 1809
1086 Ga0495592_0131939 3300046454 Bacteria 1746
1087 Ga0495592_0138165 3300046454 Bacteria 1697
1088 Ga0495592_0170690 3300046454 Bacteria 1490
1089 Ga0495603_0070881 3300046455 Bacteria 2048
1090 Ga0495603_0098779 3300046455 Unclassified 1705
1091 Ga0495590_0003911 3300046457 Bacteria 6055
1092 Ga0495590_0043222 3300046457 Bacteria 1571
1093 Ga0495590_0058533 3300046457 Bacteria 1347
1094 Ga0495591_021310 3300046458 Bacteria 2118
1095 Ga0495629_0094978 3300046459 Bacteria 2080
1096 Ga0495629_0097991 3300046459 Bacteria 2045
1097 Ga0495629_0109758 3300046459 Unclassified 1923
1098 Ga0495629_0137539 3300046459 Bacteria 1700
1099 Ga0495638_0053533 3300046460 Bacteria 2511
1100 Ga0495638_0126188 3300046460 Bacteria 1508
1101 Ga0495641_0026586 3300046461 Bacteria 2822
1102 Ga0495641_0081876 3300046461 Bacteria 1445
1103 Ga0495651_0064325 3300046462 Bacteria 2803
1104 Ga0495651_0120157 3300046462 Bacteria 1931
1105 Ga0495651_0204679 3300046462 Unclassified 1378
1106 Ga0495653_0026804 3300046463 Bacteria 4617
1107 Ga0495653_0078075 3300046463 Bacteria 2456
1108 Ga0495653_0101691 3300046463 Bacteria 2081
1109 Ga0495653_0120556 3300046463 Bacteria 1870
1110 Ga0495653_0122689 3300046463 Bacteria 1849
1111 Ga0495580_0098794 3300046472 Bacteria 2030
1112 Ga0495580_0099626 3300046472 Bacteria 2021
1113 Ga0495580_0141829 3300046472 Bacteria 1665
1114 Ga0495580_0152375 3300046472 Bacteria 1601
1115 Ga0495582_0120740 3300046473 Bacteria 1476
1116 Ga0495582_0127731 3300046473 Unclassified 1435
1117 Ga0495605_0050174 3300046474 Bacteria 2036
1118 Ga0495605_0079356 3300046474 Bacteria 1537
1119 Ga0495639_0021368 3300046475 Bacteria 2832
1120 Ga0495639_0045183 3300046475 Bacteria 1992
1121 Ga0495639_0060468 3300046475 Unclassified 1736
1122 Ga0495639_0099888 3300046475 Bacteria 1369
1123 Ga0495662_0059784 3300046476 Bacteria 1840
1124 Ga0495664_0042689 3300046477 Bacteria 2686
1125 Ga0495664_0069996 3300046477 Bacteria 2094
1126 Ga0495664_0091647 3300046477 Bacteria 1827
1127 Ga0495664_0107819 3300046477 Bacteria 1680
1128 Ga0495664_0115512 3300046477 Bacteria 1622
1129 Ga0495584_0012657 3300046491 Bacteria 4306
1130 Ga0495584_0163008 3300046491 Bacteria 1133
1131 Ga0495585_0020518 3300046492 Bacteria 3800
1132 Ga0495585_0047739 3300046492 Bacteria 2383
1133 Ga0495585_0052634 3300046492 Unclassified 2254
1134 Ga0495585_0078038 3300046492 Bacteria 1797
1135 Ga0495594_0088844 3300046499 Unclassified 1730
1136 Ga0495594_0131058 3300046499 Bacteria 1420
1137 Ga0495596_0027703 3300046500 Bacteria 2276
1138 Ga0495596_0051735 3300046500 Bacteria 1609
1139 Ga0495607_0027298 3300046501 Bacteria 3532
1140 Ga0495607_0050153 3300046501 Bacteria 2431
1141 Ga0495607_0071366 3300046501 Bacteria 1936
1142 Ga0495583_0026640 3300046506 Bacteria 2861
1143 Ga0495583_0029184 3300046506 Bacteria 2702
1144 Ga0495583_0046408 3300046506 Bacteria 2003
1145 Ga0495583_0057461 3300046506 Bacteria 1749
1146 Ga0495583_0063724 3300046506 Bacteria 1637
1147 Ga0495583_0083780 3300046506 Bacteria 1382
1148 Ga0495606_0102116 3300046507 Bacteria 1744
1149 Ga0495608_0062185 3300046511 Bacteria 2453
1150 Ga0495608_0075441 3300046511 Bacteria 2197
1151 Ga0495608_0095145 3300046511 Unclassified 1924
1152 Ga0495610_0043752 3300046512 Bacteria 2228
1153 Ga0495616_0000239 3300046513 Bacteria 44698
1154 Ga0495618_0038568 3300046514 Bacteria 3003
1155 Ga0495618_0097831 3300046514 Bacteria 1877
1156 Ga0495618_0106589 3300046514 Bacteria 1794
1157 Ga0495618_0120760 3300046514 Bacteria 1678
1158 Ga0495620_0022767 3300046515 Bacteria 3010
1159 Ga0495620_0041819 3300046515 Bacteria 2007
1160 Ga0495620_0054010 3300046515 Bacteria 1699
1161 Ga0495628_0112734 3300046516 Bacteria 2090
1162 Ga0495628_0116639 3300046516 Bacteria 2050
1163 Ga0495628_0136738 3300046516 Bacteria 1872
1164 Ga0495628_0150437 3300046516 Bacteria 1773
1165 Ga0495628_0172132 3300046516 Bacteria 1641
1166 Ga0495628_0204555 3300046516 Bacteria 1486
1167 Ga0495628_0240164 3300046516 Bacteria 1355
1168 Ga0495630_0037826 3300046517 Bacteria 3608
1169 Ga0495630_0125223 3300046517 Bacteria 1950
1170 Ga0495630_0135063 3300046517 Bacteria 1874
1171 Ga0495630_0140897 3300046517 Bacteria 1833
1172 Ga0495630_0167475 3300046517 Bacteria 1673
1173 Ga0495630_0184487 3300046517 Bacteria 1591
1174 Ga0495630_0255975 3300046517 Bacteria 1337
1175 Ga0495630_0349929 3300046517 Bacteria 1131
1176 Ga0495631_0025174 3300046518 Bacteria 2742
1177 Ga0495631_0047803 3300046518 Bacteria 1877
1178 Ga0495632_0009988 3300046519 Bacteria 5662
1179 Ga0495637_0019012 3300046520 Bacteria 3181
1180 Ga0495637_0021558 3300046520 Bacteria 2953
1181 Ga0495637_0047770 3300046520 Bacteria 1805
1182 Ga0495637_0061368 3300046520 Bacteria 1541
1183 Ga0495643_0003559 3300046522 Bacteria 11328
1184 Ga0495643_0074231 3300046522 Bacteria 1781
1185 Ga0495643_0140647 3300046522 Bacteria 1204
1186 Ga0495644_0019090 3300046523 Bacteria 2617
1187 Ga0495644_0024142 3300046523 Bacteria 2312
1188 Ga0495644_0025041 3300046523 Bacteria 2267
1189 Ga0495644_0055438 3300046523 Bacteria 1489
1190 Ga0495644_0057439 3300046523 Bacteria 1462
1191 Ga0495648_0015268 3300046524 Bacteria 5585
1192 Ga0495663_0007708 3300046525 Bacteria 2977
1193 Ga0495663_0023777 3300046525 Bacteria 1777
1194 Ga0495663_0037518 3300046525 Bacteria 1462
1195 Ga0495663_0049692 3300046525 Bacteria 1295
1196 Ga0495666_0024174 3300046526 Bacteria 3002
1197 Ga0495666_0036384 3300046526 Bacteria 2397
1198 Ga0495666_0077035 3300046526 Bacteria 1580
1199 Ga0495666_0091229 3300046526 Bacteria 1437
1200 Ga0495642_0016786 3300046528 Bacteria 2855
1201 Ga0495652_0113376 3300046529 Bacteria 2176
1202 Ga0495652_0122944 3300046529 Unclassified 2066
1203 Ga0495652_0160158 3300046529 Bacteria 1748
1204 Ga0495665_0066720 3300046531 Bacteria 1898
1205 Ga0495665_0096044 3300046531 Bacteria 1556
1206 Ga0495640_0058489 3300046533 Bacteria 2628
1207 Ga0495640_0062634 3300046533 Bacteria 2522
1208 Ga0495640_0095116 3300046533 Bacteria 1961
1209 Ga0495640_0102247 3300046533 Bacteria 1880
1210 Ga0495640_0112676 3300046533 Bacteria 1776
1211 Ga0495640_0162460 3300046533 Bacteria 1430
1212 Ga0495586_0029501 3300046535 Bacteria 2935
1213 Ga0495586_0052048 3300046535 Unclassified 2216
1214 Ga0495586_0055908 3300046535 Bacteria 2139
1215 Ga0495586_0111999 3300046535 Bacteria 1519
1216 Ga0495586_0163804 3300046535 Bacteria 1254
1217 Ga0495587_0024811 3300046536 Bacteria 3670
1218 Ga0495587_0028844 3300046536 Bacteria 3372
1219 Ga0495587_0047790 3300046536 Bacteria 2536
1220 Ga0495587_0077923 3300046536 Unclassified 1923
1221 Ga0495598_0006567 3300046537 Bacteria 2632
1222 Ga0495598_0008347 3300046537 Bacteria 2409
1223 Ga0495598_0010983 3300046537 Bacteria 2183
1224 Ga0495598_0017098 3300046537 Unclassified 1864
1225 Ga0495598_0021165 3300046537 Bacteria 1726
1226 Ga0495609_0034776 3300046538 Bacteria 2282
1227 Ga0495609_0050774 3300046538 Bacteria 1848
1228 Ga0495621_0014913 3300046539 Bacteria 2469
1229 Ga0495597_0016421 3300046542 Bacteria 3494
1230 Ga0495597_0038306 3300046542 Bacteria 2149
1231 Ga0495597_0055793 3300046542 Bacteria 1731
1232 Ga0495597_0056454 3300046542 Bacteria 1719
1233 Ga0495645_0082066 3300046543 Bacteria 2312
1234 Ga0495645_0125842 3300046543 Unclassified 1800
1235 Ga0495645_0139957 3300046543 Bacteria 1689
1236 Ga0495645_0142999 3300046543 Bacteria 1667
1237 Ga0495645_0335614 3300046543 Unclassified 977
1238 Ga0495633_0012801 3300046558 Bacteria 4445
1239 Ga0495633_0047004 3300046558 Bacteria 2040
1240 Ga0495633_0059276 3300046558 Bacteria 1795
1241 Ga0495633_0095227 3300046558 Unclassified 1383
1242 Ga0495667_0023192 3300046559 Bacteria 4181
1243 Ga0495667_0066165 3300046559 Bacteria 2363
1244 Ga0495667_0070204 3300046559 Bacteria 2285
1245 Ga0495667_0122914 3300046559 Bacteria 1675
1246 Ga0495667_0147364 3300046559 Bacteria 1516
1247 Ga0495656_0010174 3300046615 Bacteria 3410
1248 Ga0495656_0021157 3300046615 Bacteria 2530
1249 Ga0495656_0025244 3300046615 Bacteria 2354
1250 Ga0495656_0035075 3300046615 Bacteria 2059
1251 Ga0495656_0044978 3300046615 Unclassified 1861
1252 Ga0495656_0059704 3300046615 Bacteria 1660
1253 Ga0495656_0074496 3300046615 Unclassified 1516
1254 Ga0495656_0084358 3300046615 Bacteria 1440
1255 Ga0495668_0030783 3300046616 Bacteria 3026
1256 Ga0495634_0070562 3300046642 Bacteria 2302
1257 Ga0495634_0070983 3300046642 Bacteria 2294
1258 Ga0495634_0082615 3300046642 Bacteria 2099
1259 Ga0495634_0118667 3300046642 Bacteria 1695
1260 Ga0495611_0025038 3300046648 Bacteria 2598
1261 Ga0495611_0035303 3300046648 Bacteria 2214
1262 Ga0495611_0038485 3300046648 Bacteria 2127
1263 Ga0495611_0069690 3300046648 Unclassified 1607
1264 Ga0495611_0085431 3300046648 Bacteria 1455
1265 Ga0495625_0009490 3300046660 Bacteria 8136
1266 Ga0495625_0011433 3300046660 Bacteria 7238
1267 Ga0495625_0076778 3300046660 Bacteria 2335
1268 Ga0495625_0112239 3300046660 Bacteria 1862
1269 Ga0495625_0138938 3300046660 Bacteria 1640
1270 Ga0495635_0069964 3300046663 Bacteria 2405
1271 Ga0495635_0117420 3300046663 Bacteria 1815
1272 Ga0495635_0124412 3300046663 Bacteria 1758
1273 Ga0495659_0022665 3300046664 Bacteria 2127
1274 Ga0495659_0034517 3300046664 Unclassified 1779
1275 Ga0495659_0044293 3300046664 Bacteria 1599
1276 Ga0495661_0065872 3300046665 Bacteria 2133
1277 Ga0495661_0087712 3300046665 Bacteria 1778
1278 Ga0495661_0097422 3300046665 Unclassified 1661
1279 Ga0495588_0012534 3300046674 Bacteria 4011
1280 Ga0495588_0035234 3300046674 Bacteria 2535
1281 Ga0495588_0065820 3300046674 Bacteria 1880
1282 Ga0495657_0047518 3300046675 Bacteria 2900
1283 Ga0495657_0097023 3300046675 Bacteria 1882
1284 Ga0495657_0097182 3300046675 Bacteria 1880
1285 Ga0495657_0131603 3300046675 Bacteria 1566
1286 Ga0495599_0087520 3300046678 Bacteria 1944
1287 Ga0495599_0119386 3300046678 Bacteria 1639
1288 Ga0495623_0055331 3300046679 Bacteria 2501
1289 Ga0495623_0058022 3300046679 Bacteria 2434
1290 Ga0495623_0107867 3300046679 Bacteria 1690
1291 Ga0495623_0130625 3300046679 Unclassified 1504
1292 Ga0495646_0018299 3300046680 Bacteria 4438
1293 Ga0495646_0065162 3300046680 Bacteria 2157
1294 Ga0495646_0086273 3300046680 Bacteria 1821
1295 Ga0495646_0090238 3300046680 Bacteria 1771
1296 Ga0495647_0022723 3300046681 Bacteria 2268
1297 Ga0495647_0038784 3300046681 Bacteria 1802
1298 Ga0495647_0042393 3300046681 Bacteria 1737
1299 Ga0495658_0069053 3300046683 Bacteria 2047
1300 Ga0495658_0101588 3300046683 Unclassified 1717
1301 Ga0495669_0026871 3300046684 Bacteria 2515
1302 Ga0495669_0033308 3300046684 Bacteria 2267
1303 Ga0495613_0055351 3300046689 Bacteria 2914
1304 Ga0495613_0104524 3300046689 Bacteria 2044
1305 Ga0495613_0134243 3300046689 Bacteria 1771
1306 Ga0495613_0225731 3300046689 Bacteria 1313
1307 Ga0495624_0051568 3300046690 Bacteria 2602
1308 Ga0495624_0103569 3300046690 Unclassified 1751
1309 Ga0495624_0106133 3300046690 Bacteria 1728
1310 Ga0495624_0106223 3300046690 Bacteria 1727
1311 Ga0495670_0028503 3300046691 Bacteria 2768
1312 Ga0495670_0034258 3300046691 Bacteria 2528
1313 Ga0495670_0058140 3300046691 Unclassified 1941
1314 Ga0495670_0075631 3300046691 Bacteria 1709
1315 Ga0495671_0096186 3300046692 Bacteria 1449
1316 Ga0495649_0003870 3300046694 Bacteria 9910
1317 Ga0495649_0052787 3300046694 Bacteria 2202
1318 Ga0495649_0070073 3300046694 Bacteria 1880
1319 Ga0495600_0043926 3300046809 Bacteria 2915
1320 Ga0495600_0062515 3300046809 Bacteria 2432
1321 Ga0495600_0086625 3300046809 Bacteria 2043
1322 Ga0495660_0034715 3300046810 Bacteria 2820
1323 Ga0495660_0037115 3300046810 Bacteria 2715
1324 Ga0495660_0078778 3300046810 Bacteria 1731
1325 Ga0495581_0110903 3300047315 Bacteria 1595
1326 Ga0495581_0115315 3300047315 Bacteria 1562
1327 Ga0495604_0108434 3300047317 Bacteria 2028
1328 Ga0495604_0110504 3300047317 Bacteria 2005
1329 Ga0495604_0125798 3300047317 Bacteria 1848
1330 Ga0495604_0137112 3300047317 Bacteria 1752
1331 Ga0495604_0139782 3300047317 Bacteria 1731
1332 Ga0495604_0153214 3300047317 Bacteria 1635
1333 Ga0495604_0167957 3300047317 Bacteria 1545
1334 Ga0495636_0071531 3300047318 Bacteria 1481
1335 Ga0495674_0112845 3300047319 Bacteria 2302
1336 Ga0495674_0128953 3300047319 Bacteria 2132
1337 Ga0495674_0166826 3300047319 Bacteria 1839
1338 Ga0495674_0176094 3300047319 Bacteria 1782
1339 Ga0495674_0181556 3300047319 Bacteria 1752
1340 Ga0495674_0222809 3300047319 Bacteria 1558
1341 Ga0495672_0107676 3300047320 Bacteria 1501
1342 Ga0495672_0119634 3300047320 Bacteria 1402
1343 Ga0495676_0079335 3300047321 Bacteria 2496
1344 Ga0495676_0087846 3300047321 Bacteria 2334
1345 Ga0495676_0094852 3300047321 Bacteria 2221
1346 Ga0495676_0109212 3300047321 Bacteria 2033
1347 Ga0495676_0120372 3300047321 Bacteria 1910
1348 Ga0495676_0235006 3300047321 Bacteria 1257
1349 Ga0495680_0116214 3300047322 Unclassified 1978
1350 Ga0495680_0126830 3300047322 Bacteria 1878
1351 Ga0495680_0142090 3300047322 Bacteria 1755
1352 Ga0495680_0180807 3300047322 Bacteria 1522
1353 Ga0495683_0017636 3300047323 Bacteria 3698
1354 Ga0495687_005675 3300047443 Bacteria 7884
1355 Ga0495675_0024019 3300047444 Bacteria 3884
1356 Ga0495675_0070438 3300047444 Bacteria 2207
1357 Ga0495675_0133742 3300047444 Bacteria 1540
1358 Ga0495677_0043066 3300047445 Bacteria 1654
1359 Ga0495679_040661 3300047446 Bacteria 1444
1360 Ga0495685_012989 3300047447 Bacteria 2824
1361 Ga0495685_034146 3300047447 Bacteria 1747
1362 Ga0495673_0000025 3300047469 Bacteria 512352
1363 Ga0495673_0037896 3300047469 Bacteria 2198
1364 Ga0495684_0044248 3300047471 Bacteria 3408
1365 Ga0495684_0107933 3300047471 Bacteria 2102
1366 Ga0495684_0117712 3300047471 Unclassified 2002
1367 Ga0495684_0147549 3300047471 Bacteria 1760
1368 Ga0495686_0032089 3300047472 Bacteria 3401
1369 Ga0495686_0098249 3300047472 Bacteria 1769
1370 Ga0495593_0056823 3300047673 Bacteria 2056
1371 Ga0495593_0080124 3300047673 Bacteria 1689
1372 Ga0495602_0099892 3300048088 Bacteria 2384
1373 Ga0495602_0111996 3300048088 Bacteria 2215
1374 Ga0495602_0145383 3300048088 Bacteria 1871
1375 Ga0495602_0147045 3300048088 Bacteria 1857
1376 Ga0495614_0046798 3300048089 Unclassified 1855
1377 Ga0495614_0075101 3300048089 Bacteria 1460
1378 Ga0495615_0005598 3300048090 Bacteria 2269
1379 Ga0495615_0012105 3300048090 Bacteria 1771
1380 Ga0495626_0035838 3300048091 Bacteria 2367
1381 Ga0496100_0049336 3300048903 Bacteria 2721
1382 Ga0496100_0139096 3300048903 Bacteria 1718
1383 Ga0496100_0165211 3300048903 Bacteria 1589
1384 Ga0496100_0212350 3300048903 Bacteria 1416
1385 Ga0496100_0215467 3300048903 Bacteria 1407
1386 Ga0496101_0062655 3300048904 Bacteria 2704
1387 Ga0496102_0000345 3300048905 Bacteria 56618
1388 Ga0496102_0162272 3300048905 Bacteria 2102
1389 Ga0496102_0198578 3300048905 Bacteria 1890
1390 Ga0496102_0231910 3300048905 Bacteria 1740
1391 Ga0496102_0238395 3300048905 Unclassified 1715
1392 Ga0496102_0297064 3300048905 Bacteria 1522
1393 Ga0496103_0000276 3300048906 Bacteria 48842
1394 Ga0496103_0022814 3300048906 Bacteria 3770
1395 Ga0496103_0079111 3300048906 Bacteria 2065
1396 Ga0496103_0105904 3300048906 Bacteria 1783
1397 Ga0496104_0000056 3300048907 Bacteria 122670
1398 Ga0496104_0036995 3300048907 Bacteria 4564
1399 Ga0496104_0188026 3300048907 Bacteria 1976
1400 Ga0496104_0247250 3300048907 Bacteria 1696
1401 Ga0496104_0310640 3300048907 Unclassified 1489
1402 Ga0496105_0000036 3300048908 Bacteria 122670
1403 Ga0496105_0086155 3300048908 Bacteria 2596
1404 Ga0496105_0183730 3300048908 Bacteria 1711
1405 Ga0496105_0257579 3300048908 Bacteria 1412
1406 Ga0496106_0035659 3300048909 Bacteria 3719
1407 Ga0496106_0184404 3300048909 Bacteria 1657
1408 Ga0496107_0064211 3300048910 Bacteria 2661
1409 Ga0496107_0100574 3300048910 Bacteria 2119
1410 Ga0496107_0140945 3300048910 Bacteria 1782
1411 Ga0496107_0154013 3300048910 Bacteria 1701
1412 Ga0496107_0177593 3300048910 Unclassified 1581
1413 Ga0496108_0082218 3300048911 Bacteria 2730
1414 Ga0496108_0193680 3300048911 Bacteria 1762
1415 Ga0496108_0200568 3300048911 Bacteria 1731
1416 Ga0496108_0227953 3300048911 Bacteria 1619
1417 Ga0496108_0228256 3300048911 Bacteria 1618
1418 Ga0496108_0282702 3300048911 Bacteria 1444
1419 Ga0496108_0308227 3300048911 Bacteria 1379
1420 Ga0496109_0039786 3300048912 Bacteria 4257
1421 Ga0496109_0093101 3300048912 Bacteria 2788
1422 Ga0496109_0176547 3300048912 Bacteria 2005
1423 Ga0496109_0217097 3300048912 Bacteria 1798
1424 Ga0496109_0331669 3300048912 Bacteria 1436
1425 Ga0496109_0339188 3300048912 Bacteria 1419
1426 Ga0496109_0359981 3300048912 Bacteria 1374
1427 Ga0496110_0061683 3300048913 Bacteria 3310
1428 Ga0496110_0089496 3300048913 Bacteria 2751
1429 Ga0496110_0138916 3300048913 Bacteria 2196
1430 Ga0496110_0192969 3300048913 Bacteria 1849
1431 Ga0496110_0216288 3300048913 Bacteria 1742
1432 Ga0496110_0219092 3300048913 Bacteria 1730
1433 Ga0496111_0144157 3300048914 Bacteria 1765
1434 Ga0496111_0171762 3300048914 Bacteria 1610
1435 Ga0496111_0207864 3300048914 Bacteria 1454
1436 Ga0496112_0001860 3300048915 Bacteria 16617
1437 Ga0496112_0015616 3300048915 Bacteria 7091
1438 Ga0496112_0185062 3300048915 Bacteria 2046
1439 Ga0496112_0218055 3300048915 Bacteria 1864
1440 Ga0496112_0228308 3300048915 Bacteria 1816
1441 Ga0496112_0240417 3300048915 Bacteria 1763
1442 Ga0496113_0153181 3300048916 Bacteria 1819
1443 Ga0496113_0170895 3300048916 Bacteria 1721
1444 Ga0496113_0186533 3300048916 Bacteria 1645
1445 Ga0496114_0211286 3300048917 Bacteria 1702
1446 Ga0496114_0223390 3300048917 Bacteria 1653
1447 Ga0496115_0100162 3300048918 Bacteria 2375
1448 Ga0496115_0220924 3300048918 Bacteria 1563
1449 Ga0496116_0038523 3300048919 Bacteria 3317
1450 Ga0496116_0077563 3300048919 Bacteria 2075
1451 Ga0496117_0000633 3300048920 Bacteria 56618
1452 Ga0496117_0030138 3300048920 Bacteria 4169
1453 Ga0496117_0037958 3300048920 Bacteria 3581
1454 Ga0496117_0067819 3300048920 Bacteria 2412
1455 Ga0496118_0000654 3300048921 Bacteria 56618
1456 Ga0496118_0060761 3300048921 Bacteria 2804
1457 Ga0496118_0085174 3300048921 Bacteria 2202
1458 Ga0496119_0032189 3300048922 Bacteria 3499
1459 Ga0496120_0031779 3300048923 Bacteria 3192
1460 Ga0496120_0062457 3300048923 Bacteria 2075
1461 Ga0496120_0083952 3300048923 Bacteria 1718
1462 Ga0496121_0000190 3300048924 Bacteria 136607
1463 Ga0496121_0051976 3300048924 Bacteria 3446
1464 Ga0496121_0118303 3300048924 Bacteria 2006
1465 Ga0496121_0122451 3300048924 Bacteria 1961
1466 Ga0496124_0000664 3300048927 Bacteria 56618
1467 Ga0496125_0124762 3300048928 Bacteria 1827
1468 Ga0496125_0142484 3300048928 Bacteria 1664
1469 Ga0496126_0003079 3300048929 Bacteria 21570
1470 Ga0496126_0133142 3300048929 Bacteria 2146
1471 Ga0495682_0027510 3300049460 Bacteria 2109
1472 Ga0501292_000003 3300049515 Bacteria 161908
1473 Ga0501031_0095830 3300049568 Bacteria 1936
1474 Ga0501031_0128345 3300049568 Bacteria 1656
1475 Ga0501033_0068482 3300049570 Bacteria 2609
1476 Ga0501033_0134394 3300049570 Bacteria 1790
1477 Ga0501034_0063775 3300049571 Bacteria 3698
1478 Ga0501036_0160018 3300049572 Bacteria 1898
1479 Ga0501036_0244249 3300049572 Bacteria 1505
1480 Ga0501036_0288481 3300049572 Bacteria 1373
1481 Ga0501037_0112937 3300049573 Bacteria 1956
1482 Ga0501038_0167446 3300049574 Bacteria 1781
1483 Ga0501038_0176871 3300049574 Bacteria 1724
1484 Ga0501038_0204837 3300049574 Bacteria 1581
1485 Ga0501039_0090528 3300049575 Bacteria 2384
1486 Ga0501039_0148447 3300049575 Bacteria 1842
1487 Ga0501039_0155644 3300049575 Bacteria 1795
1488 Ga0501039_0183910 3300049575 Bacteria 1643
1489 Ga0501040_0080703 3300049576 Bacteria 2253
1490 Ga0501040_0132326 3300049576 Bacteria 1754
1491 Ga0501041_0053540 3300049577 Bacteria 2461
1492 Ga0501041_0069904 3300049577 Bacteria 2154
1493 Ga0501041_0088254 3300049577 Bacteria 1914
1494 Ga0501042_0063897 3300049578 Bacteria 2630
1495 Ga0501042_0096725 3300049578 Bacteria 2121
1496 Ga0501043_0039063 3300049579 Bacteria 3731
1497 Ga0501043_0226910 3300049579 Bacteria 1443
1498 Ga0501046_0048596 3300049580 Unclassified 3359
1499 Ga0501046_0156915 3300049580 Bacteria 1713
1500 Ga0501048_0074358 3300049582 Bacteria 2397
1501 Ga0501048_0116060 3300049582 Bacteria 1891
1502 Ga0501048_0191415 3300049582 Bacteria 1449
1503 Ga0501068_0103069 3300049584 Bacteria 1769
1504 Ga0501070_0200717 3300049586 Bacteria 1638
1505 Ga0501071_0039102 3300049587 Bacteria 3392
1506 Ga0501071_0086328 3300049587 Bacteria 2301
1507 Ga0501071_0153222 3300049587 Bacteria 1720
1508 Ga0501071_0174977 3300049587 Bacteria 1607
1509 Ga0501072_0066312 3300049588 Bacteria 2847
1510 Ga0501072_0073479 3300049588 Bacteria 2703
1511 Ga0501072_0086879 3300049588 Unclassified 2481
1512 Ga0501072_0108894 3300049588 Bacteria 2204
1513 Ga0501072_0247744 3300049588 Bacteria 1419
1514 Ga0501074_0095876 3300049590 Bacteria 2124
1515 Ga0501074_0099528 3300049590 Bacteria 2081
1516 Ga0501075_0033123 3300049591 Bacteria 3842
1517 Ga0501075_0126924 3300049591 Bacteria 1942
1518 Ga0501075_0218899 3300049591 Bacteria 1452
1519 Ga0501076_0019153 3300049592 Bacteria 5225
1520 Ga0501076_0033955 3300049592 Bacteria 3984
1521 Ga0501076_0101102 3300049592 Bacteria 2323
1522 Ga0501076_0296611 3300049592 Bacteria 1325
1523 Ga0501077_0068213 3300049593 Bacteria 2254
1524 Ga0501077_0113968 3300049593 Bacteria 1714
1525 Ga0501077_0119823 3300049593 Bacteria 1667
1526 Ga0501243_008819 3300049675 Bacteria 1560
1527 Ga0501079_0085673 3300049741 Bacteria 2438
1528 Ga0501079_0095478 3300049741 Unclassified 2304
1529 Ga0501079_0119111 3300049741 Bacteria 2052
1530 Ga0501080_0152215 3300049742 Bacteria 2137
1531 Ga0501080_0166416 3300049742 Bacteria 2034
1532 Ga0501080_0320106 3300049742 Bacteria 1404
1533 Ga0501081_0021507 3300049743 Bacteria 4306
1534 Ga0501081_0029345 3300049743 Bacteria 3717
1535 Ga0501081_0037195 3300049743 Bacteria 3320
1536 Ga0501083_0109286 3300049744 Bacteria 1818
1537 Ga0501267_003081 3300049764 Bacteria 1503
1538 Ga0501279_000009 3300049775 Bacteria 117146
1539 Ga0501035_0138353 3300049822 Bacteria 2118
1540 Ga0501035_0160049 3300049822 Bacteria 1949
1541 Ga0501044_0347322 3300049823 Bacteria 1404
1542 Ga0501044_0378058 3300049823 Bacteria 1332
1543 Ga0501045_0089611 3300049824 Bacteria 2272
1544 Ga0501045_0131801 3300049824 Bacteria 1858
1545 Ga0501204_005175 3300049850 Bacteria 1422
1546 nmdc:mga03683_55366_c1 3300050489 Unclassified 1666
1547 nmdc:mga03683_87601_c1 3300050489 Bacteria 1353
1548 nmdc:mga0yw44_51736_c1 3300050492 Bacteria 2488
1549 nmdc:mga06z11_247_c1 3300050494 Bacteria 21101
1550 nmdc:mga06z11_65656_c1 3300050494 Bacteria 1905
1551 nmdc:mga07m45_24001_c1 3300050496 Bacteria 3336
1552 nmdc:mga05p37_109753_c1 3300050507 Unclassified 3394
1553 nmdc:mga05p37_140359_c2 3300050507 Bacteria 2495
1554 nmdc:mga05p37_147962_c1 3300050507 Plasmid 2875
1555 nmdc:mga05p37_18846_c1 3300050507 Bacteria 8342
1556 nmdc:mga05p37_214241_c1 3300050507 Archaea 2327
1557 nmdc:mga05p37_294342_c1 3300050507 Unclassified 1931
1558 nmdc:mga05p37_296795_c1 3300050507 Bacteria 1921
1559 nmdc:mga05p37_315224_c1 3300050507 Bacteria 1853
1560 nmdc:mga05p37_325489_c1 3300050507 Bacteria 1818
1561 nmdc:mga05p37_330387_c1 3300050507 Unclassified 1801
1562 nmdc:mga05p37_343559_c1 3300050507 Bacteria 1759
1563 nmdc:mga05p37_388158_c1 3300050507 Bacteria 1634
1564 nmdc:mga05p37_64130_c1 3300050507 Plasmid 4521
1565 nmdc:mga05p37_71184_c1 3300050507 Bacteria 4278
1566 nmdc:mga05p37_7735_c1 3300050507 Bacteria 12685
1567 nmdc:mga09592_113749_c1 3300050508 Unclassified 2323
1568 nmdc:mga09592_121521_c1 3300050508 Archaea 2244
1569 nmdc:mga09592_14305_c1 3300050508 Bacteria 6478
1570 nmdc:mga09592_176248_c1 3300050508 Bacteria 1849
1571 nmdc:mga09592_198399_c1 3300050508 Bacteria 1738
1572 nmdc:mga09592_232064_c1 3300050508 Unclassified 1599
1573 nmdc:mga09592_23318_c1 3300050508 Bacteria 5112
1574 nmdc:mga09592_250822_c1 3300050508 Unclassified 1534
1575 nmdc:mga09592_287484_c1 3300050508 Bacteria 1426
1576 nmdc:mga09592_294541_c1 3300050508 Bacteria 1407
1577 nmdc:mga09592_91846_c1 3300050508 Bacteria 2595
1578 nmdc:mga0qj67_148234_c1 3300050509 Unclassified 1903
1579 nmdc:mga0qj67_162358_c1 3300050509 Bacteria 1814
1580 nmdc:mga0qj67_171515_c1 3300050509 Unclassified 1762
1581 nmdc:mga0qj67_173935_c1 3300050509 Bacteria 1749
1582 nmdc:mga0qj67_174118_c1 3300050509 Bacteria 1748
1583 nmdc:mga0qj67_85493_c1 3300050509 Bacteria 2530
1584 nmdc:mga06r32_131178_c1 3300050510 Archaea 2478
1585 nmdc:mga06r32_148132_c1 3300050510 Bacteria 2325
1586 nmdc:mga06r32_20735_c1 3300050510 Bacteria 6054
1587 nmdc:mga06r32_241794_c1 3300050510 Unclassified 1793
1588 nmdc:mga06r32_255754_c1 3300050510 Bacteria 1739
1589 nmdc:mga06r32_285044_c1 3300050510 Bacteria 1639
1590 nmdc:mga06r32_339117_c1 3300050510 Bacteria 1488
1591 nmdc:mga06r32_436412_c1 3300050510 Bacteria 1290
1592 nmdc:mga06r32_89715_c1 3300050510 Bacteria 3002
1593 nmdc:mga06r32_90360_c1 3300050510 Plasmid 2992
1594 nmdc:mga06r32_92706_c1 3300050510 Bacteria 2954
1595 nmdc:mga08y16_133291_c1 3300050511 Bacteria 2583
1596 nmdc:mga08y16_134872_c1 3300050511 Unclassified 2566
1597 nmdc:mga08y16_185560_c1 3300050511 Unclassified 2159
1598 nmdc:mga08y16_225389_c1 3300050511 Unclassified 1940
1599 nmdc:mga08y16_268731_c1 3300050511 Bacteria 1761
1600 nmdc:mga08y16_58655_c1 3300050511 Bacteria 4022
1601 nmdc:mga08y16_79815_c1 3300050511 Bacteria 3411
1602 nmdc:mga0n895_142923_c1 3300050512 Bacteria 2422
1603 nmdc:mga0n895_189659_c1 3300050512 Bacteria 2087
1604 nmdc:mga0n895_250694_c1 3300050512 Bacteria 1797
1605 nmdc:mga0n895_274843_c1 3300050512 Bacteria 1709
1606 nmdc:mga0n895_285705_c1 3300050512 Bacteria 1673
1607 nmdc:mga0n895_338057_c1 3300050512 Bacteria 1525
1608 nmdc:mga0n895_362978_c1 3300050512 Bacteria 1466
1609 nmdc:mga0n895_408776_c1 3300050512 Bacteria 1373
1610 nmdc:mga0n895_43653_c1 3300050512 Plasmid 4369
1611 nmdc:mga0n895_93056_c1 3300050512 Plasmid 3018
1612 nmdc:mga0rr50_279023_c1 3300050513 Bacteria 1394
1613 nmdc:mga0rr50_47412_c1 3300050513 Bacteria 3170
1614 nmdc:mga0rr50_57695_c1 3300050513 Bacteria 2905
1615 nmdc:mga08x19_122370_c1 3300050514 Bacteria 1745
1616 nmdc:mga08x19_82878_c1 3300050514 Unclassified 2108
1617 nmdc:mga08x19_89542_c1 3300050514 Bacteria 2030
1618 nmdc:mga0a205_236004_c1 3300050515 Bacteria 1711
1619 nmdc:mga0a205_238460_c1 3300050515 Bacteria 1700
1620 nmdc:mga0a205_260119_c1 3300050515 Bacteria 1613
1621 nmdc:mga0a205_294144_c1 3300050515 Bacteria 1498
1622 nmdc:mga0a205_68006_c1 3300050515 Plasmid 3441
1623 Ga0495601_0077303 3300053077 Bacteria 2131
1624 Ga0495601_0108958 3300053077 Unclassified 1792
1625 Ga0495601_0178508 3300053077 Bacteria 1388
1626 Ga0495601_0192801 3300053077 Bacteria 1332
1627 Ga0495612_0027175 3300053078 Bacteria 2300
1628 Ga0495612_0042479 3300053078 Bacteria 1855
1629 Ga0495612_0051706 3300053078 Bacteria 1689
1630 Ga0495612_0063520 3300053078 Bacteria 1531
1631 Ga0500610_0072123 3300053079 Bacteria 1800
1632 Ga0500610_0081606 3300053079 Bacteria 1685
1633 Ga0500635_0001844 3300053080 Bacteria 5177
1634 Ga0495655_0002509 3300053083 Bacteria 2924
1635 Ga0495655_0009993 3300053083 Bacteria 1859
1636 Ga0495655_0028530 3300053083 Bacteria 1334
1637 Ga0495595_0054233 3300053084 Unclassified 1863
1638 Ga0495619_0053191 3300053085 Bacteria 2677
1639 Ga0495619_0091761 3300053085 Bacteria 2056
1640 Ga0495619_0121574 3300053085 Bacteria 1790
1641 Ga0495619_0125732 3300053085 Bacteria 1759
1642 Ga0495619_0163763 3300053085 Bacteria 1536
1643 Ga0495619_0212567 3300053085 Bacteria 1339
1644 Ga0500644_0054719 3300053088 Bacteria 1382
1645 Ga0500647_0055479 3300053091 Bacteria 1906
1646 Ga0500651_0039906 3300053093 Bacteria 2957
1647 Ga0500566_0096029 3300053094 Bacteria 1632
1648 Ga0500554_021448 3300053102 Bacteria 1791
1649 Ga0500555_002499 3300053103 Bacteria 5314
1650 Ga0500556_0004459 3300053104 Bacteria 3984
1651 Ga0500593_055703 3300053117 Bacteria 1746
1652 Ga0500607_064980 3300053121 Bacteria 1897
1653 Ga0500608_047531 3300053122 Bacteria 2061
1654 Ga0500614_006583 3300053123 Bacteria 2441
1655 Ga0500618_000101 3300053125 Bacteria 69860
1656 Ga0500642_0014056 3300053130 Bacteria 2966
1657 Ga0500642_0016575 3300053130 Bacteria 2803
1658 Ga0500652_027022 3300053131 Bacteria 2215
1659 Ga0500655_007591 3300053133 Bacteria 1952
1660 Ga0500658_0059787 3300053134 Bacteria 1581
1661 Ga0500559_0017669 3300053136 Bacteria 3013
1662 Ga0500559_0037907 3300053136 Bacteria 2091
1663 Ga0500559_0049240 3300053136 Bacteria 1855
1664 Ga0500559_0068892 3300053136 Bacteria 1590
1665 Ga0500559_0088102 3300053136 Bacteria 1418
1666 Ga0500564_063131 3300053138 Bacteria 1677
1667 Ga0500564_108019 3300053138 Bacteria 1224
1668 Ga0500568_0000561 3300053139 Bacteria 27307
1669 Ga0500585_021297 3300053144 Bacteria 2125
1670 Ga0500590_037703 3300053148 Bacteria 2496
1671 Ga0500616_0056185 3300053153 Bacteria 2055
1672 Ga0500619_002763 3300053154 Bacteria 3452
1673 Ga0500619_043774 3300053154 Bacteria 1424
1674 Ga0500638_039815 3300053162 Unclassified 2281
1675 Ga0500638_098532 3300053162 Bacteria 1366
1676 Ga0500636_0070043 3300053177 Bacteria 2035
1677 Ga0500645_014651 3300053730 Bacteria 2495
1678 Ga0500601_001109 3300053737 Plasmid 3048
1679 Ga0501084_0120149 3300054114 Bacteria 2209
1680 Ga0501084_0138029 3300054114 Bacteria 2052
1681 Ga0501084_0186111 3300054114 Bacteria 1752
1682 Ga0590075_016673 3300059424 Bacteria 1807
1683 Ga0590075_024090 3300059424 Bacteria 1527
1684 Ga0501082_0030298 3300060353 Plasmid 4663
1685 Ga0501082_0090664 3300060353 Bacteria 2639
1686 Ga0501082_0214945 3300060353 Bacteria 1672
1687 Ga0501082_0276595 3300060353 Bacteria 1461
1688 Ga0530510_0015761 3300061734 Bacteria 5343
1689 Ga0530510_0030186 3300061734 Plasmid 3892
1690 Ga0530510_0080159 3300061734 Bacteria 2375
1691 Ga0530510_0146364 3300061734 Bacteria 1742

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046491 Ga0495584_0163008 Ga0495584_0163008_123_1079 294
2 3300035118 Ga0373954_0088274 Ga0373954_0088274_17_958 309
3 3300046543 Ga0495645_0335614 Ga0495645_0335614_26_967 309
4 3300039450 Ga0436363_1116784 Ga0436363_1116784_17_964 310
5 3300014969 Ga0157376_10493120 Ga0157376_104931202 312
6 3300049850 Ga0501204_005175 Ga0501204_005175_455_1405 312
7 iso_pu_bacteria 2513237138 2513870703 314
8 3300041458 Ga0451798_0178063 Ga0451798_0178063_17_976 316
9 3300005439 Ga0070711_100150655 Ga0070711_1001506552 318
10 iso_pu_bacteria 3000135777 3000137128 318
11 3300006846 Ga0075430_100189928 Ga0075430_1001899281 321
12 3300050508 nmdc:mga09592_232064_c1 nmdc:mga09592_232064_c1_554_1540 323
13 3300053125 Ga0500618_000101 Ga0500618_000101_15104_16087 323
14 iso_pu_bacteria 2937822353 2937827598 324
15 3300009147 Ga0114129_10250180 Ga0114129_102501801 326
16 3300049764 Ga0501267_003081 Ga0501267_003081_434_1429 326
17 3300050507 nmdc:mga05p37_109753_c1 nmdc:mga05p37_109753_c1_1929_2924 326
18 iso_pu_bacteria 2687453392 2688601095 326
19 3300048911 Ga0496108_0282702 Ga0496108_0282702_50_1045 327
20 3300048912 Ga0496109_0339188 Ga0496109_0339188_412_1407 327
21 3300046457 Ga0495590_0058533 Ga0495590_0058533_263_1321 328
22 3300046522 Ga0495643_0140647 Ga0495643_0140647_23_1081 328
23 3300047320 Ga0495672_0119634 Ga0495672_0119634_332_1390 328
24 3300009098 Ga0105245_10439836 Ga0105245_104398361 329
25 3300013306 Ga0163162_10216164 Ga0163162_102161641 329
26 3300009545 Ga0105237_10276888 Ga0105237_102768881 331
27 3300027907 Ga0207428_10242345 Ga0207428_102423453 331
28 3300046501 Ga0495607_0027298 Ga0495607_0027298_26_1024 331
29 3300046615 Ga0495656_0074496 Ga0495656_0074496_27_1037 331
30 3300047472 Ga0495686_0032089 Ga0495686_0032089_35_1033 331
31 3300050509 nmdc:mga0qj67_162358_c1 nmdc:mga0qj67_162358_c1_792_1802 331
32 3300050511 nmdc:mga08y16_268731_c1 nmdc:mga08y16_268731_c1_486_1496 331
33 3300027907 Ga0207428_10061512 Ga0207428_100615122 336
34 3300035089 Ga0373944_0035202 Ga0373944_0035202_490_1512 337
35 3300046455 Ga0495603_0098779 Ga0495603_0098779_556_1578 337
36 3300046475 Ga0495639_0060468 Ga0495639_0060468_641_1663 337
37 3300046683 Ga0495658_0101588 Ga0495658_0101588_591_1613 337
38 iso_pu_bacteria 2508501122 2509111990 337
39 3300005844 Ga0068862_100240574 Ga0068862_1002405742 340
40 3300026121 Ga0207683_10046123 Ga0207683_100461233 340
41 iso_pu_bacteria 2855839649 2855846219 340
42 iso_pu_bacteria 2916076590 2916081566 340
43 3300035692 Ga0373935_0258042 Ga0373935_0258042_36_1064 341
44 3300053083 Ga0495655_0009993 Ga0495655_0009993_116_1147 341
45 3300001977 JGI24746J21847_1012047 JGI24746J21847_10120471 342
46 3300001979 JGI24740J21852_10041322 JGI24740J21852_100413222 342
47 3300002067 JGI24735J21928_10040336 JGI24735J21928_100403361 342
48 3300002077 JGI24744J21845_10017976 JGI24744J21845_100179761 342
49 3300005293 Ga0065715_10024588 Ga0065715_100245881 342
50 3300005328 Ga0070676_10111479 Ga0070676_101114791 342
51 3300005334 Ga0068869_100092415 Ga0068869_1000924151 342
52 3300005335 Ga0070666_10137316 Ga0070666_101373162 342
53 3300005337 Ga0070682_100052096 Ga0070682_1000520962 342
54 3300005340 Ga0070689_100162589 Ga0070689_1001625893 342
55 3300005367 Ga0070667_100106704 Ga0070667_1001067042 342
56 3300005438 Ga0070701_10107151 Ga0070701_101071512 342
57 3300005441 Ga0070700_100132409 Ga0070700_1001324091 342
58 3300005455 Ga0070663_100090232 Ga0070663_1000902321 342
59 3300044684 Ga0466966_0097323 Ga0466966_0097323_605_1633 342
60 3300046454 Ga0495592_0170690 Ga0495592_0170690_427_1464 344
61 3300046474 Ga0495605_0079356 Ga0495605_0079356_435_1472 344
62 3300002070 JGI24750J21931_1005003 JGI24750J21931_10050032 345
63 3300005445 Ga0070708_100114882 Ga0070708_1001148821 348
64 3300005471 Ga0070698_100089376 Ga0070698_1000893763 348
65 3300048905 Ga0496102_0000345 Ga0496102_0000345_2096_3142 348
66 3300048906 Ga0496103_0000276 Ga0496103_0000276_45720_46766 348
67 3300048919 Ga0496116_0038523 Ga0496116_0038523_184_1230 348
68 3300048920 Ga0496117_0000633 Ga0496117_0000633_53477_54523 348
69 3300048921 Ga0496118_0000654 Ga0496118_0000654_2096_3142 348
70 3300048923 Ga0496120_0031779 Ga0496120_0031779_1840_2886 348
71 3300048927 Ga0496124_0000664 Ga0496124_0000664_2096_3142 348
72 3300050507 nmdc:mga05p37_7735_c1 nmdc:mga05p37_7735_c1_1274_2350 348
73 3300002244 JGI24742J22300_10009063 JGI24742J22300_100090632 350
74 3300005466 Ga0070685_10044018 Ga0070685_100440182 350
75 3300005543 Ga0070672_100153541 Ga0070672_1001535411 350
76 3300005842 Ga0068858_100220666 Ga0068858_1002206661 350
77 3300025940 Ga0207691_10084125 Ga0207691_100841251 350
78 3300026035 Ga0207703_10175227 Ga0207703_101752271 350
79 3300026118 Ga0207675_100151016 Ga0207675_1001510162 350
80 3300049587 Ga0501071_0153222 Ga0501071_0153222_70_1176 350
81 3300049572 Ga0501036_0288481 Ga0501036_0288481_131_1219 351
82 3300049575 Ga0501039_0090528 Ga0501039_0090528_686_1774 351
83 3300049576 Ga0501040_0132326 Ga0501040_0132326_541_1629 351
84 3300049577 Ga0501041_0088254 Ga0501041_0088254_369_1457 351
85 3300049582 Ga0501048_0191415 Ga0501048_0191415_210_1298 351
86 3300049587 Ga0501071_0174977 Ga0501071_0174977_338_1426 351
87 3300049588 Ga0501072_0108894 Ga0501072_0108894_635_1723 351
88 3300049590 Ga0501074_0099528 Ga0501074_0099528_414_1502 351
89 3300049591 Ga0501075_0218899 Ga0501075_0218899_179_1267 351
90 3300049593 Ga0501077_0119823 Ga0501077_0119823_139_1227 351
91 3300049741 Ga0501079_0119111 Ga0501079_0119111_158_1246 351
92 3300049743 Ga0501081_0029345 Ga0501081_0029345_2475_3563 351
93 3300049824 Ga0501045_0089611 Ga0501045_0089611_395_1483 351
94 3300054114 Ga0501084_0120149 Ga0501084_0120149_525_1613 351
95 3300060353 Ga0501082_0276595 Ga0501082_0276595_148_1236 351
96 3300003659 JGI25404J52841_10017148 JGI25404J52841_100171481 353
97 3300005347 Ga0070668_100132943 Ga0070668_1001329431 353
98 3300005983 Ga0081540_1020402 Ga0081540_10204022 353
99 3300014968 Ga0157379_10199057 Ga0157379_101990571 353
100 3300003316 rootH1_10177097 rootH1_101770971 355
101 3300005330 Ga0070690_100193583 Ga0070690_1001935832 355
102 3300005985 Ga0081539_10023650 Ga0081539_100236502 355
103 3300006946 Ga0079104_1021380 Ga0079104_10213801 355
104 3300027111 Ga0209281_1013518 Ga0209281_10135181 355
105 3300031548 Ga0307408_100140304 Ga0307408_1001403041 355
106 3300031731 Ga0307405_10171721 Ga0307405_101717211 355
107 3300031911 Ga0307412_10250273 Ga0307412_102502731 355
108 3300032002 Ga0307416_100185620 Ga0307416_1001856201 355
109 3300048928 Ga0496125_0124762 Ga0496125_0124762_181_1344 355
110 iso_pu_bacteria 2838686498 2838694245 356
111 iso_pu_bacteria 2842271015 2842278756 356
112 3300003373 JGI25407J50210_10016431 JGI25407J50210_100164311 357
113 3300003373 JGI25407J50210_10020924 JGI25407J50210_100209241 357
114 3300007265 Ga0099794_10066185 Ga0099794_100661851 357
115 3300025922 Ga0207646_10383622 Ga0207646_103836221 357
116 3300027512 Ga0209179_1005573 Ga0209179_10055732 357
117 3300031456 Ga0307513_10328949 Ga0307513_103289491 357
118 3300037418 Ga0395900_0464087 Ga0395900_0464087_111_1199 357
119 3300049574 Ga0501038_0176871 Ga0501038_0176871_468_1556 357
120 3300049577 Ga0501041_0069904 Ga0501041_0069904_901_1989 357
121 3300049588 Ga0501072_0086879 Ga0501072_0086879_1142_2230 357
122 3300049592 Ga0501076_0101102 Ga0501076_0101102_231_1319 357
123 3300049742 Ga0501080_0320106 Ga0501080_0320106_157_1245 357
124 3300050507 nmdc:mga05p37_64130_c1 nmdc:mga05p37_64130_c1_3274_4362 357
125 3300060353 Ga0501082_0030298 Ga0501082_0030298_2865_3953 357
126 3300061734 Ga0530510_0030186 Ga0530510_0030186_165_1253 357
127 iso_pu_bacteria 2937036028 2937036503 357
128 3300003316 rootH1_10173562 rootH1_101735621 358
129 3300006178 Ga0075367_10058594 Ga0075367_100585943 358
130 3300006353 Ga0075370_10033927 Ga0075370_100339273 358
131 3300006914 Ga0075436_100083840 Ga0075436_1000838402 358
132 3300021384 Ga0213876_10061021 Ga0213876_100610212 358
133 3300035691 Ga0373931_0099126 Ga0373931_0099126_147_1304 358
134 3300037853 Ga0436364_1405813 Ga0436364_1405813_292_1446 358
135 3300039437 Ga0436365_0006810 Ga0436365_0006810_74_1228 358
136 3300050494 nmdc:mga06z11_65656_c1 nmdc:mga06z11_65656_c1_523_1677 358
137 3300005455 Ga0070663_100173340 Ga0070663_1001733402 359
138 3300005548 Ga0070665_100170538 Ga0070665_1001705383 359
139 3300005844 Ga0068862_100301795 Ga0068862_1003017951 359
140 3300011119 Ga0105246_10112013 Ga0105246_101120132 359
141 3300014325 Ga0163163_10268039 Ga0163163_102680392 359
142 3300017792 Ga0163161_10095234 Ga0163161_100952342 359
143 3300025900 Ga0207710_10098478 Ga0207710_100984781 359
144 3300025942 Ga0207689_10075318 Ga0207689_100753182 359
145 3300026067 Ga0207678_10174566 Ga0207678_101745662 359
146 3300026075 Ga0207708_10117180 Ga0207708_101171803 359
147 3300028379 Ga0268266_10098147 Ga0268266_100981472 359
148 3300046492 Ga0495585_0020518 Ga0495585_0020518_1233_2327 359
149 3300046501 Ga0495607_0050153 Ga0495607_0050153_182_1276 359
150 3300046523 Ga0495644_0019090 Ga0495644_0019090_280_1374 359
151 3300046537 Ga0495598_0008347 Ga0495598_0008347_1160_2254 359
152 3300046615 Ga0495656_0021157 Ga0495656_0021157_1241_2335 359
153 3300046648 Ga0495611_0035303 Ga0495611_0035303_943_2037 359
154 3300046665 Ga0495661_0087712 Ga0495661_0087712_294_1388 359
155 3300046665 Ga0495661_0097422 Ga0495661_0097422_533_1627 359
156 3300046691 Ga0495670_0028503 Ga0495670_0028503_1419_2513 359
157 3300047318 Ga0495636_0071531 Ga0495636_0071531_217_1311 359
158 3300049741 Ga0501079_0095478 Ga0501079_0095478_992_2086 359
159 3300049823 Ga0501044_0378058 Ga0501044_0378058_203_1297 359
160 3300046615 Ga0495656_0059704 Ga0495656_0059704_151_1329 360
161 3300046648 Ga0495611_0085431 Ga0495611_0085431_184_1362 360
162 3300053077 Ga0495601_0178508 Ga0495601_0178508_35_1192 360
163 3300046517 Ga0495630_0349929 Ga0495630_0349929_11_1096 361
164 iso_pu_bacteria 2773857925 2774874564 361
165 3300003322 rootL2_10312573 rootL2_103125732 362
166 3300005435 Ga0070714_100199214 Ga0070714_1001992142 362
167 3300005436 Ga0070713_100182758 Ga0070713_1001827582 362
168 3300025928 Ga0207700_10124518 Ga0207700_101245182 362
169 3300048924 Ga0496121_0118303 Ga0496121_0118303_632_1720 362
170 3300005456 Ga0070678_100200651 Ga0070678_1002006511 363
171 3300035170 Ga0373943_0097138 Ga0373943_0097138_303_1457 363
172 3300035171 Ga0373946_0054075 Ga0373946_0054075_150_1295 363
173 3300035695 Ga0373927_0066862 Ga0373927_0066862_795_1949 363
174 3300035725 Ga0373947_0073976 Ga0373947_0073976_591_1745 363
175 3300037068 Ga0373925_0116618 Ga0373925_0116618_676_1830 363
176 3300046460 Ga0495638_0126188 Ga0495638_0126188_337_1485 363
177 3300046533 Ga0495640_0062634 Ga0495640_0062634_615_1760 363
178 3300046660 Ga0495625_0009490 Ga0495625_0009490_406_1554 363
179 3300047321 Ga0495676_0235006 Ga0495676_0235006_58_1203 363
180 3300059424 Ga0590075_016673 Ga0590075_016673_84_1238 363
181 3300005445 Ga0070708_100122022 Ga0070708_1001220221 364
182 3300005467 Ga0070706_100212671 Ga0070706_1002126712 364
183 3300005468 Ga0070707_100276087 Ga0070707_1002760872 364
184 3300005471 Ga0070698_100224479 Ga0070698_1002244791 364
185 3300005563 Ga0068855_100347677 Ga0068855_1003476771 364
186 3300005616 Ga0068852_100180404 Ga0068852_1001804042 364
187 3300009093 Ga0105240_10362693 Ga0105240_103626931 364
188 3300009545 Ga0105237_10254204 Ga0105237_102542041 364
189 3300009551 Ga0105238_10464613 Ga0105238_104646131 364
190 3300014326 Ga0157380_10108833 Ga0157380_101088331 364
191 3300021358 Ga0213873_10005426 Ga0213873_100054261 364
192 3300021361 Ga0213872_10023647 Ga0213872_100236473 364
193 3300021377 Ga0213874_10022298 Ga0213874_100222981 364
194 3300021384 Ga0213876_10013980 Ga0213876_100139805 364
195 3300021441 Ga0213871_10015465 Ga0213871_100154651 364
196 3300025910 Ga0207684_10123089 Ga0207684_101230892 364
197 3300025911 Ga0207654_10128375 Ga0207654_101283751 364
198 3300025914 Ga0207671_10183097 Ga0207671_101830971 364
199 3300025922 Ga0207646_10201734 Ga0207646_102017341 364
200 3300025924 Ga0207694_10158975 Ga0207694_101589752 364
201 3300025949 Ga0207667_10313889 Ga0207667_103138891 364
202 3300026142 Ga0207698_10034493 Ga0207698_100344934 364
203 3300039437 Ga0436365_0064527 Ga0436365_0064527_42_1205 364
204 3300039447 Ga0436361_0570546 Ga0436361_0570546_78_1235 364
205 3300039450 Ga0436363_0188199 Ga0436363_0188199_646_1809 364
206 3300039453 Ga0436362_0228811 Ga0436362_0228811_2176_3339 364
207 3300042436 Ga0439435_0010845 Ga0439435_0010845_300_1397 364
208 3300046500 Ga0495596_0051735 Ga0495596_0051735_415_1572 364
209 3300046507 Ga0495606_0102116 Ga0495606_0102116_374_1480 364
210 3300046535 Ga0495586_0029501 Ga0495586_0029501_710_1816 364
211 3300048090 Ga0495615_0012105 Ga0495615_0012105_608_1705 364
212 3300048920 Ga0496117_0067819 Ga0496117_0067819_826_1983 364
213 3300048921 Ga0496118_0085174 Ga0496118_0085174_846_2003 364
214 3300048922 Ga0496119_0032189 Ga0496119_0032189_1451_2608 364
215 3300048923 Ga0496120_0083952 Ga0496120_0083952_324_1481 364
216 3300050509 nmdc:mga0qj67_148234_c1 nmdc:mga0qj67_148234_c1_155_1264 364
217 3300050514 nmdc:mga08x19_82878_c1 nmdc:mga08x19_82878_c1_44_1138 364
218 3300061734 Ga0530510_0080159 Ga0530510_0080159_1157_2314 364
219 3300039447 Ga0436361_0770865 Ga0436361_0770865_443_1567 365
220 3300005578 Ga0068854_100077788 Ga0068854_1000777882 366
221 3300025981 Ga0207640_10056761 Ga0207640_100567612 366
222 3300031456 Ga0307513_10061832 Ga0307513_100618322 366
223 3300031691 Ga0316579_10063545 Ga0316579_100635451 366
224 3300031728 Ga0316578_10033379 Ga0316578_100333792 366
225 3300039447 Ga0436361_0448929 Ga0436361_0448929_567_1730 366
226 3300049588 Ga0501072_0247744 Ga0501072_0247744_183_1283 366
227 3300005295 Ga0065707_10026835 Ga0065707_100268352 367
228 3300009148 Ga0105243_10075494 Ga0105243_100754941 367
229 3300025933 Ga0207706_10207441 Ga0207706_102074411 367
230 3300025961 Ga0207712_10163269 Ga0207712_101632691 367
231 3300053121 Ga0500607_064980 Ga0500607_064980_564_1727 367
232 3300053122 Ga0500608_047531 Ga0500608_047531_555_1718 367
233 3300053136 Ga0500559_0017669 Ga0500559_0017669_663_1811 367
234 3300053136 Ga0500559_0088102 Ga0500559_0088102_101_1264 367
235 3300053138 Ga0500564_063131 Ga0500564_063131_123_1286 367
236 3300053144 Ga0500585_021297 Ga0500585_021297_337_1500 367
237 3300053148 Ga0500590_037703 Ga0500590_037703_1179_2342 367
238 3300053154 Ga0500619_002763 Ga0500619_002763_255_1418 367
239 3300053154 Ga0500619_043774 Ga0500619_043774_215_1363 367
240 3300053162 Ga0500638_098532 Ga0500638_098532_101_1264 367
241 3300005457 Ga0070662_100117232 Ga0070662_1001172321 368
242 3300025933 Ga0207706_10143115 Ga0207706_101431151 368
243 3300035398 Ga0316574_0008917 Ga0316574_0008917_1260_2399 368
244 iso_pu_bacteria 2871444079 2871448002 368
245 3300014497 Ga0182008_10063362 Ga0182008_100633622 369
246 3300021377 Ga0213874_10012407 Ga0213874_100124071 369
247 3300039450 Ga0436363_0953581 Ga0436363_0953581_492_1673 369
248 3300047317 Ga0495604_0137112 Ga0495604_0137112_385_1554 369
249 3300049515 Ga0501292_000003 Ga0501292_000003_94145_95311 369
250 3300049775 Ga0501279_000009 Ga0501279_000009_65017_66183 369
251 iso_pu_bacteria 2977565890 2977566734 369
252 3300003203 JGI25406J46586_10020029 JGI25406J46586_100200291 370
253 3300003373 JGI25407J50210_10023927 JGI25407J50210_100239271 370
254 3300005467 Ga0070706_100116852 Ga0070706_1001168524 370
255 3300005468 Ga0070707_100197891 Ga0070707_1001978911 370
256 3300005518 Ga0070699_100141087 Ga0070699_1001410872 370
257 3300005616 Ga0068852_100148474 Ga0068852_1001484742 370
258 3300005981 Ga0081538_10042022 Ga0081538_100420223 370
259 3300005985 Ga0081539_10029182 Ga0081539_100291824 370
260 3300009147 Ga0114129_10318742 Ga0114129_103187422 370
261 3300025910 Ga0207684_10052991 Ga0207684_100529914 370
262 3300025922 Ga0207646_10321393 Ga0207646_103213931 370
263 3300025942 Ga0207689_10242957 Ga0207689_102429571 370
264 3300026142 Ga0207698_10142501 Ga0207698_101425011 370
265 3300031733 Ga0316577_10092970 Ga0316577_100929702 370
266 3300031824 Ga0307413_10072369 Ga0307413_100723692 370
267 3300036712 Ga0316584_0048002 Ga0316584_0048002_90_1232 370
268 3300037853 Ga0436364_0256259 Ga0436364_0256259_50_1237 370
269 3300049587 Ga0501071_0039102 Ga0501071_0039102_2197_3339 370
270 3300001989 JGI24739J22299_10000445 JGI24739J22299_100004453 371
271 3300005289 Ga0065704_10013137 Ga0065704_100131371 371
272 3300005289 Ga0065704_10022000 Ga0065704_100220002 371
273 3300005295 Ga0065707_10005105 Ga0065707_100051052 371
274 3300005295 Ga0065707_10013210 Ga0065707_100132102 371
275 3300005295 Ga0065707_10133766 Ga0065707_101337662 371
276 3300005295 Ga0065707_10153706 Ga0065707_101537061 371
277 3300005329 Ga0070683_100158682 Ga0070683_1001586823 371
278 3300005329 Ga0070683_100230827 Ga0070683_1002308271 371
279 3300005338 Ga0068868_100056503 Ga0068868_1000565032 371
280 3300005340 Ga0070689_100054700 Ga0070689_1000547002 371
281 3300005340 Ga0070689_100114354 Ga0070689_1001143542 371
282 3300005343 Ga0070687_100027481 Ga0070687_1000274813 371
283 3300005344 Ga0070661_100019619 Ga0070661_1000196192 371
284 3300005344 Ga0070661_100030428 Ga0070661_1000304284 371
285 3300005347 Ga0070668_100090504 Ga0070668_1000905043 371
286 3300005347 Ga0070668_100091334 Ga0070668_1000913343 371
287 3300005347 Ga0070668_100133316 Ga0070668_1001333162 371
288 3300005356 Ga0070674_100068515 Ga0070674_1000685153 371
289 3300005365 Ga0070688_100142056 Ga0070688_1001420561 371
290 3300005406 Ga0070703_10020473 Ga0070703_100204731 371
291 3300005438 Ga0070701_10065497 Ga0070701_100654972 371
292 3300005440 Ga0070705_100029518 Ga0070705_1000295184 371
293 3300005441 Ga0070700_100060121 Ga0070700_1000601211 371
294 3300005441 Ga0070700_100098785 Ga0070700_1000987852 371
295 3300005441 Ga0070700_100167191 Ga0070700_1001671911 371
296 3300005445 Ga0070708_100043267 Ga0070708_1000432672 371
297 3300005445 Ga0070708_100065075 Ga0070708_1000650753 371
298 3300005445 Ga0070708_100248458 Ga0070708_1002484581 371
299 3300005455 Ga0070663_100152263 Ga0070663_1001522631 371
300 3300005457 Ga0070662_100132161 Ga0070662_1001321612 371
301 3300005467 Ga0070706_100022952 Ga0070706_1000229522 371
302 3300005467 Ga0070706_100082644 Ga0070706_1000826442 371
303 3300005467 Ga0070706_100282702 Ga0070706_1002827021 371
304 3300005468 Ga0070707_100093518 Ga0070707_1000935183 371
305 3300005471 Ga0070698_100039155 Ga0070698_1000391553 371
306 3300005471 Ga0070698_100041662 Ga0070698_1000416622 371
307 3300005471 Ga0070698_100238024 Ga0070698_1002380242 371
308 3300005471 Ga0070698_100250645 Ga0070698_1002506452 371
309 3300005518 Ga0070699_100188767 Ga0070699_1001887672 371
310 3300005535 Ga0070684_100036812 Ga0070684_1000368123 371
311 3300005535 Ga0070684_100042691 Ga0070684_1000426914 371
312 3300005536 Ga0070697_100064431 Ga0070697_1000644312 371
313 3300005544 Ga0070686_100005670 Ga0070686_1000056705 371
314 3300005544 Ga0070686_100021748 Ga0070686_1000217481 371
315 3300005544 Ga0070686_100029194 Ga0070686_1000291944 371
316 3300005549 Ga0070704_100063790 Ga0070704_1000637903 371
317 3300005564 Ga0070664_100056268 Ga0070664_1000562684 371
318 3300005564 Ga0070664_100170704 Ga0070664_1001707043 371
319 3300005577 Ga0068857_100000670 Ga0068857_10000067013 371
320 3300005577 Ga0068857_100121975 Ga0068857_1001219751 371
321 3300005577 Ga0068857_100179001 Ga0068857_1001790013 371
322 3300005615 Ga0070702_100048757 Ga0070702_1000487572 371
323 3300005617 Ga0068859_100049640 Ga0068859_1000496405 371
324 3300005617 Ga0068859_100147472 Ga0068859_1001474722 371
325 3300005618 Ga0068864_100046780 Ga0068864_1000467802 371
326 3300005718 Ga0068866_10017550 Ga0068866_100175504 371
327 3300005719 Ga0068861_100050731 Ga0068861_1000507313 371
328 3300005719 Ga0068861_100074288 Ga0068861_1000742883 371
329 3300005719 Ga0068861_100147153 Ga0068861_1001471532 371
330 3300005841 Ga0068863_100371986 Ga0068863_1003719861 371
331 3300005842 Ga0068858_100043420 Ga0068858_1000434204 371
332 3300005842 Ga0068858_100250383 Ga0068858_1002503831 371
333 3300005842 Ga0068858_100278195 Ga0068858_1002781952 371
334 3300005843 Ga0068860_100313241 Ga0068860_1003132412 371
335 3300005844 Ga0068862_100051072 Ga0068862_1000510722 371
336 3300005937 Ga0081455_10034693 Ga0081455_100346932 371
337 3300005937 Ga0081455_10060963 Ga0081455_100609633 371
338 3300005937 Ga0081455_10077244 Ga0081455_100772442 371
339 3300005937 Ga0081455_10148560 Ga0081455_101485601 371
340 3300005981 Ga0081538_10022883 Ga0081538_100228834 371
341 3300005981 Ga0081538_10037462 Ga0081538_100374622 371
342 3300005981 Ga0081538_10076313 Ga0081538_100763131 371
343 3300005983 Ga0081540_1012755 Ga0081540_10127553 371
344 3300005983 Ga0081540_1019794 Ga0081540_10197944 371
345 3300005985 Ga0081539_10033365 Ga0081539_100333653 371
346 3300005985 Ga0081539_10071648 Ga0081539_100716482 371
347 3300006194 Ga0075427_10009009 Ga0075427_100090092 371
348 3300006844 Ga0075428_100028486 Ga0075428_1000284864 371
349 3300006844 Ga0075428_100037503 Ga0075428_1000375031 371
350 3300006844 Ga0075428_100044076 Ga0075428_1000440769 371
351 3300006844 Ga0075428_100056233 Ga0075428_1000562336 371
352 3300006844 Ga0075428_100113539 Ga0075428_1001135393 371
353 3300006844 Ga0075428_100153628 Ga0075428_1001536282 371
354 3300006844 Ga0075428_100178206 Ga0075428_1001782062 371
355 3300006844 Ga0075428_100238891 Ga0075428_1002388912 371
356 3300006844 Ga0075428_100240881 Ga0075428_1002408812 371
357 3300006846 Ga0075430_100104083 Ga0075430_1001040833 371
358 3300006846 Ga0075430_100128178 Ga0075430_1001281782 371
359 3300006846 Ga0075430_100136375 Ga0075430_1001363752 371
360 3300006846 Ga0075430_100143877 Ga0075430_1001438771 371
361 3300006846 Ga0075430_100155888 Ga0075430_1001558882 371
362 3300006847 Ga0075431_100016082 Ga0075431_10001608211 371
363 3300006847 Ga0075431_100068694 Ga0075431_1000686945 371
364 3300006847 Ga0075431_100090552 Ga0075431_1000905525 371
365 3300006847 Ga0075431_100134752 Ga0075431_1001347524 371
366 3300006847 Ga0075431_100170922 Ga0075431_1001709223 371
367 3300006847 Ga0075431_100172878 Ga0075431_1001728782 371
368 3300006847 Ga0075431_100176238 Ga0075431_1001762382 371
369 3300006847 Ga0075431_100262655 Ga0075431_1002626552 371
370 3300006847 Ga0075431_100321829 Ga0075431_1003218292 371
371 3300006847 Ga0075431_100323032 Ga0075431_1003230321 371
372 3300006847 Ga0075431_100354974 Ga0075431_1003549742 371
373 3300006852 Ga0075433_10105382 Ga0075433_101053823 371
374 3300006852 Ga0075433_10113421 Ga0075433_101134212 371
375 3300006852 Ga0075433_10218347 Ga0075433_102183472 371
376 3300006871 Ga0075434_100111690 Ga0075434_1001116903 371
377 3300006871 Ga0075434_100117323 Ga0075434_1001173233 371
378 3300006871 Ga0075434_100144371 Ga0075434_1001443713 371
379 3300006871 Ga0075434_100172584 Ga0075434_1001725841 371
380 3300006871 Ga0075434_100186892 Ga0075434_1001868922 371
381 3300006880 Ga0075429_100030455 Ga0075429_1000304558 371
382 3300006880 Ga0075429_100089551 Ga0075429_1000895513 371
383 3300006880 Ga0075429_100139350 Ga0075429_1001393502 371
384 3300006880 Ga0075429_100195909 Ga0075429_1001959091 371
385 3300006931 Ga0097620_100049638 Ga0097620_1000496385 371
386 3300006931 Ga0097620_100147457 Ga0097620_1001474573 371
387 3300007265 Ga0099794_10013814 Ga0099794_100138142 371
388 3300007265 Ga0099794_10021704 Ga0099794_100217042 371
389 3300009094 Ga0111539_10092223 Ga0111539_100922233 371
390 3300009094 Ga0111539_10198932 Ga0111539_101989322 371
391 3300009094 Ga0111539_10256727 Ga0111539_102567271 371
392 3300009094 Ga0111539_10259598 Ga0111539_102595982 371
393 3300009098 Ga0105245_10119969 Ga0105245_101199692 371
394 3300009098 Ga0105245_10209572 Ga0105245_102095721 371
395 3300009098 Ga0105245_10328610 Ga0105245_103286101 371
396 3300009101 Ga0105247_10066308 Ga0105247_100663082 371
397 3300009147 Ga0114129_10059733 Ga0114129_100597335 371
398 3300009147 Ga0114129_10103518 Ga0114129_101035184 371
399 3300009147 Ga0114129_10180619 Ga0114129_101806192 371
400 3300009147 Ga0114129_10238572 Ga0114129_102385722 371
401 3300009147 Ga0114129_10392504 Ga0114129_103925041 371
402 3300009147 Ga0114129_10407221 Ga0114129_104072212 371
403 3300009551 Ga0105238_10001089 Ga0105238_100010899 371
404 3300009553 Ga0105249_10065134 Ga0105249_100651341 371
405 3300009553 Ga0105249_10065964 Ga0105249_100659641 371
406 3300009553 Ga0105249_10073156 Ga0105249_100731561 371
407 3300009553 Ga0105249_10106865 Ga0105249_101068651 371
408 3300009553 Ga0105249_10131083 Ga0105249_101310833 371
409 3300009553 Ga0105249_10161943 Ga0105249_101619432 371
410 3300010375 Ga0105239_10114091 Ga0105239_101140912 371
411 3300011119 Ga0105246_10072021 Ga0105246_100720211 371
412 3300011119 Ga0105246_10113782 Ga0105246_101137821 371
413 3300011119 Ga0105246_10335028 Ga0105246_103350281 371
414 3300012494 Ga0157341_1000641 Ga0157341_10006411 371
415 3300012498 Ga0157345_1000645 Ga0157345_10006451 371
416 3300012500 Ga0157314_1001201 Ga0157314_10012012 371
417 3300013104 Ga0157370_10000266 Ga0157370_1000026644 371
418 3300013105 Ga0157369_10001890 Ga0157369_1000189016 371
419 3300013306 Ga0163162_10048215 Ga0163162_100482155 371
420 3300013306 Ga0163162_10226462 Ga0163162_102264622 371
421 3300013306 Ga0163162_10350063 Ga0163162_103500632 371
422 3300013308 Ga0157375_10059926 Ga0157375_100599262 371
423 3300013308 Ga0157375_10229889 Ga0157375_102298891 371
424 3300013308 Ga0157375_10301794 Ga0157375_103017941 371
425 3300014968 Ga0157379_10049084 Ga0157379_100490843 371
426 3300014968 Ga0157379_10112357 Ga0157379_101123571 371
427 3300014968 Ga0157379_10121942 Ga0157379_101219421 371
428 3300014968 Ga0157379_10127797 Ga0157379_101277972 371
429 3300017792 Ga0163161_10028056 Ga0163161_100280566 371
430 3300017792 Ga0163161_10091201 Ga0163161_100912012 371
431 3300025885 Ga0207653_10007395 Ga0207653_100073953 371
432 3300025885 Ga0207653_10013116 Ga0207653_100131163 371
433 3300025899 Ga0207642_10054676 Ga0207642_100546761 371
434 3300025900 Ga0207710_10068229 Ga0207710_100682291 371
435 3300025910 Ga0207684_10065341 Ga0207684_100653413 371
436 3300025910 Ga0207684_10070992 Ga0207684_100709922 371
437 3300025910 Ga0207684_10330982 Ga0207684_103309821 371
438 3300025918 Ga0207662_10105905 Ga0207662_101059052 371
439 3300025920 Ga0207649_10020385 Ga0207649_100203853 371
440 3300025920 Ga0207649_10108756 Ga0207649_101087561 371
441 3300025922 Ga0207646_10025672 Ga0207646_100256727 371
442 3300025922 Ga0207646_10137491 Ga0207646_101374912 371
443 3300025922 Ga0207646_10164594 Ga0207646_101645941 371
444 3300025927 Ga0207687_10062213 Ga0207687_100622132 371
445 3300025927 Ga0207687_10180630 Ga0207687_101806301 371
446 3300025933 Ga0207706_10124875 Ga0207706_101248751 371
447 3300025936 Ga0207670_10013313 Ga0207670_100133132 371
448 3300025938 Ga0207704_10025221 Ga0207704_100252214 371
449 3300025939 Ga0207665_10151335 Ga0207665_101513352 371
450 3300025942 Ga0207689_10124354 Ga0207689_101243542 371
451 3300025944 Ga0207661_10043519 Ga0207661_100435192 371
452 3300025945 Ga0207679_10020622 Ga0207679_100206222 371
453 3300025945 Ga0207679_10055004 Ga0207679_100550043 371
454 3300025961 Ga0207712_10030225 Ga0207712_100302254 371
455 3300025961 Ga0207712_10057203 Ga0207712_100572032 371
456 3300025961 Ga0207712_10116998 Ga0207712_101169981 371
457 3300025961 Ga0207712_10167792 Ga0207712_101677922 371
458 3300025972 Ga0207668_10081840 Ga0207668_100818402 371
459 3300025972 Ga0207668_10158970 Ga0207668_101589701 371
460 3300026023 Ga0207677_10017107 Ga0207677_100171072 371
461 3300026035 Ga0207703_10030010 Ga0207703_100300104 371
462 3300026067 Ga0207678_10042293 Ga0207678_100422933 371
463 3300026075 Ga0207708_10034821 Ga0207708_100348214 371
464 3300026075 Ga0207708_10141581 Ga0207708_101415812 371
465 3300026075 Ga0207708_10209608 Ga0207708_102096081 371
466 3300026088 Ga0207641_10249901 Ga0207641_102499011 371
467 3300026095 Ga0207676_10173823 Ga0207676_101738231 371
468 3300026116 Ga0207674_10211658 Ga0207674_102116581 371
469 3300026116 Ga0207674_10256811 Ga0207674_102568111 371
470 3300026118 Ga0207675_100174143 Ga0207675_1001741432 371
471 3300026118 Ga0207675_100184116 Ga0207675_1001841162 371
472 3300027907 Ga0207428_10017929 Ga0207428_100179294 371
473 3300027907 Ga0207428_10143633 Ga0207428_101436331 371
474 3300027907 Ga0207428_10158012 Ga0207428_101580122 371
475 3300027907 Ga0207428_10194478 Ga0207428_101944781 371
476 3300028381 Ga0268264_10124048 Ga0268264_101240482 371
477 3300028381 Ga0268264_10258266 Ga0268264_102582661 371
478 3300031548 Ga0307408_100301131 Ga0307408_1003011311 371
479 3300031727 Ga0316576_10115783 Ga0316576_101157832 371
480 3300031901 Ga0307406_10210014 Ga0307406_102100141 371
481 3300033179 Ga0307507_10154252 Ga0307507_101542521 371
482 3300037418 Ga0395900_0344792 Ga0395900_0344792_83_1198 371
483 3300038443 Ga0395901_0014899 Ga0395901_0014899_718_1833 371
484 3300039438 Ga0436360_1069144 Ga0436360_1069144_144_1310 371
485 3300042005 Ga0439448_0010142 Ga0439448_0010142_433_1578 371
486 3300042005 Ga0439448_0012955 Ga0439448_0012955_1154_2299 371
487 3300042436 Ga0439435_0011464 Ga0439435_0011464_152_1297 371
488 3300042437 Ga0439444_0014561 Ga0439444_0014561_79_1224 371
489 3300042461 Ga0439460_0010137 Ga0439460_0010137_800_1945 371
490 3300044673 Ga0453683_0022403 Ga0453683_0022403_2787_3932 371
491 3300044673 Ga0453683_0063524 Ga0453683_0063524_1018_2163 371
492 3300044694 Ga0466963_0101529 Ga0466963_0101529_311_1498 371
493 3300045051 Ga0451576_0080230 Ga0451576_0080230_131_1276 371
494 3300045051 Ga0451576_0155383 Ga0451576_0155383_1063_2208 371
495 3300046492 Ga0495585_0052634 Ga0495585_0052634_937_2082 371
496 3300046506 Ga0495583_0057461 Ga0495583_0057461_188_1303 371
497 3300046523 Ga0495644_0025041 Ga0495644_0025041_112_1257 371
498 3300046523 Ga0495644_0055438 Ga0495644_0055438_231_1376 371
499 3300046525 Ga0495663_0037518 Ga0495663_0037518_218_1363 371
500 3300046537 Ga0495598_0017098 Ga0495598_0017098_558_1703 371
501 3300046558 Ga0495633_0095227 Ga0495633_0095227_146_1291 371
502 3300046615 Ga0495656_0025244 Ga0495656_0025244_1094_2239 371
503 3300046615 Ga0495656_0035075 Ga0495656_0035075_214_1359 371
504 3300046615 Ga0495656_0044978 Ga0495656_0044978_608_1753 371
505 3300046648 Ga0495611_0069690 Ga0495611_0069690_356_1501 371
506 3300046660 Ga0495625_0138938 Ga0495625_0138938_142_1257 371
507 3300046664 Ga0495659_0034517 Ga0495659_0034517_469_1614 371
508 3300046691 Ga0495670_0034258 Ga0495670_0034258_319_1464 371
509 3300046691 Ga0495670_0058140 Ga0495670_0058140_643_1788 371
510 3300047317 Ga0495604_0139782 Ga0495604_0139782_399_1565 371
511 3300048919 Ga0496116_0077563 Ga0496116_0077563_297_1496 371
512 3300048920 Ga0496117_0030138 Ga0496117_0030138_1847_3046 371
513 3300048921 Ga0496118_0060761 Ga0496118_0060761_575_1774 371
514 3300048923 Ga0496120_0062457 Ga0496120_0062457_523_1722 371
515 3300048924 Ga0496121_0122451 Ga0496121_0122451_736_1935 371
516 3300048928 Ga0496125_0142484 Ga0496125_0142484_433_1632 371
517 3300049568 Ga0501031_0095830 Ga0501031_0095830_316_1461 371
518 3300049568 Ga0501031_0128345 Ga0501031_0128345_381_1526 371
519 3300049570 Ga0501033_0068482 Ga0501033_0068482_1300_2445 371
520 3300049570 Ga0501033_0134394 Ga0501033_0134394_519_1664 371
521 3300049572 Ga0501036_0244249 Ga0501036_0244249_323_1468 371
522 3300049573 Ga0501037_0112937 Ga0501037_0112937_459_1604 371
523 3300049574 Ga0501038_0167446 Ga0501038_0167446_341_1486 371
524 3300049574 Ga0501038_0204837 Ga0501038_0204837_141_1286 371
525 3300049575 Ga0501039_0148447 Ga0501039_0148447_307_1452 371
526 3300049575 Ga0501039_0183910 Ga0501039_0183910_379_1524 371
527 3300049576 Ga0501040_0080703 Ga0501040_0080703_479_1624 371
528 3300049577 Ga0501041_0053540 Ga0501041_0053540_859_2004 371
529 3300049578 Ga0501042_0063897 Ga0501042_0063897_1190_2335 371
530 3300049578 Ga0501042_0096725 Ga0501042_0096725_558_1703 371
531 3300049579 Ga0501043_0226910 Ga0501043_0226910_195_1340 371
532 3300049580 Ga0501046_0048596 Ga0501046_0048596_1752_2897 371
533 3300049580 Ga0501046_0156915 Ga0501046_0156915_396_1541 371
534 3300049582 Ga0501048_0074358 Ga0501048_0074358_1140_2285 371
535 3300049582 Ga0501048_0116060 Ga0501048_0116060_451_1596 371
536 3300049584 Ga0501068_0103069 Ga0501068_0103069_503_1648 371
537 3300049587 Ga0501071_0086328 Ga0501071_0086328_343_1488 371
538 3300049588 Ga0501072_0066312 Ga0501072_0066312_516_1661 371
539 3300049588 Ga0501072_0073479 Ga0501072_0073479_1449_2594 371
540 3300049590 Ga0501074_0095876 Ga0501074_0095876_560_1705 371
541 3300049591 Ga0501075_0033123 Ga0501075_0033123_1175_2320 371
542 3300049591 Ga0501075_0126924 Ga0501075_0126924_582_1727 371
543 3300049592 Ga0501076_0019153 Ga0501076_0019153_1751_2896 371
544 3300049592 Ga0501076_0033955 Ga0501076_0033955_1299_2444 371
545 3300049592 Ga0501076_0296611 Ga0501076_0296611_25_1182 371
546 3300049593 Ga0501077_0068213 Ga0501077_0068213_402_1547 371
547 3300049593 Ga0501077_0113968 Ga0501077_0113968_190_1335 371
548 3300049741 Ga0501079_0085673 Ga0501079_0085673_1155_2300 371
549 3300049742 Ga0501080_0152215 Ga0501080_0152215_387_1532 371
550 3300049742 Ga0501080_0166416 Ga0501080_0166416_687_1832 371
551 3300049743 Ga0501081_0021507 Ga0501081_0021507_2031_3176 371
552 3300049743 Ga0501081_0037195 Ga0501081_0037195_727_1872 371
553 3300049744 Ga0501083_0109286 Ga0501083_0109286_460_1605 371
554 3300049822 Ga0501035_0138353 Ga0501035_0138353_431_1576 371
555 3300049824 Ga0501045_0131801 Ga0501045_0131801_514_1659 371
556 3300050507 nmdc:mga05p37_140359_c2 nmdc:mga05p37_140359_c2_918_2096 371
557 3300050507 nmdc:mga05p37_147962_c1 nmdc:mga05p37_147962_c1_1552_2697 371
558 3300050507 nmdc:mga05p37_18846_c1 nmdc:mga05p37_18846_c1_4096_5241 371
559 3300050507 nmdc:mga05p37_214241_c1 nmdc:mga05p37_214241_c1_1036_2181 371
560 3300050507 nmdc:mga05p37_294342_c1 nmdc:mga05p37_294342_c1_610_1839 371
561 3300050507 nmdc:mga05p37_296795_c1 nmdc:mga05p37_296795_c1_568_1713 371
562 3300050507 nmdc:mga05p37_315224_c1 nmdc:mga05p37_315224_c1_322_1467 371
563 3300050507 nmdc:mga05p37_325489_c1 nmdc:mga05p37_325489_c1_477_1622 371
564 3300050507 nmdc:mga05p37_330387_c1 nmdc:mga05p37_330387_c1_552_1697 371
565 3300050507 nmdc:mga05p37_388158_c1 nmdc:mga05p37_388158_c1_151_1296 371
566 3300050507 nmdc:mga05p37_71184_c1 nmdc:mga05p37_71184_c1_1929_3074 371
567 3300050508 nmdc:mga09592_113749_c1 nmdc:mga09592_113749_c1_905_2050 371
568 3300050508 nmdc:mga09592_121521_c1 nmdc:mga09592_121521_c1_127_1272 371
569 3300050508 nmdc:mga09592_14305_c1 nmdc:mga09592_14305_c1_868_2046 371
570 3300050508 nmdc:mga09592_176248_c1 nmdc:mga09592_176248_c1_98_1327 371
571 3300050508 nmdc:mga09592_198399_c1 nmdc:mga09592_198399_c1_120_1265 371
572 3300050508 nmdc:mga09592_23318_c1 nmdc:mga09592_23318_c1_3102_4247 371
573 3300050508 nmdc:mga09592_250822_c1 nmdc:mga09592_250822_c1_11_1156 371
574 3300050508 nmdc:mga09592_287484_c1 nmdc:mga09592_287484_c1_95_1240 371
575 3300050508 nmdc:mga09592_294541_c1 nmdc:mga09592_294541_c1_237_1382 371
576 3300050508 nmdc:mga09592_91846_c1 nmdc:mga09592_91846_c1_1019_2164 371
577 3300050509 nmdc:mga0qj67_171515_c1 nmdc:mga0qj67_171515_c1_99_1244 371
578 3300050509 nmdc:mga0qj67_173935_c1 nmdc:mga0qj67_173935_c1_124_1269 371
579 3300050509 nmdc:mga0qj67_174118_c1 nmdc:mga0qj67_174118_c1_332_1477 371
580 3300050509 nmdc:mga0qj67_85493_c1 nmdc:mga0qj67_85493_c1_217_1362 371
581 3300050510 nmdc:mga06r32_131178_c1 nmdc:mga06r32_131178_c1_171_1316 371
582 3300050510 nmdc:mga06r32_148132_c1 nmdc:mga06r32_148132_c1_111_1256 371
583 3300050510 nmdc:mga06r32_20735_c1 nmdc:mga06r32_20735_c1_861_2006 371
584 3300050510 nmdc:mga06r32_241794_c1 nmdc:mga06r32_241794_c1_119_1264 371
585 3300050510 nmdc:mga06r32_255754_c1 nmdc:mga06r32_255754_c1_197_1342 371
586 3300050510 nmdc:mga06r32_285044_c1 nmdc:mga06r32_285044_c1_473_1618 371
587 3300050510 nmdc:mga06r32_339117_c1 nmdc:mga06r32_339117_c1_147_1292 371
588 3300050510 nmdc:mga06r32_89715_c1 nmdc:mga06r32_89715_c1_785_1963 371
589 3300050510 nmdc:mga06r32_90360_c1 nmdc:mga06r32_90360_c1_1752_2897 371
590 3300050510 nmdc:mga06r32_92706_c1 nmdc:mga06r32_92706_c1_1752_2897 371
591 3300050511 nmdc:mga08y16_134872_c1 nmdc:mga08y16_134872_c1_194_1339 371
592 3300050511 nmdc:mga08y16_185560_c1 nmdc:mga08y16_185560_c1_35_1213 371
593 3300050511 nmdc:mga08y16_225389_c1 nmdc:mga08y16_225389_c1_220_1365 371
594 3300050511 nmdc:mga08y16_58655_c1 nmdc:mga08y16_58655_c1_723_1868 371
595 3300050511 nmdc:mga08y16_79815_c1 nmdc:mga08y16_79815_c1_2120_3265 371
596 3300050512 nmdc:mga0n895_142923_c1 nmdc:mga0n895_142923_c1_1032_2210 371
597 3300050512 nmdc:mga0n895_274843_c1 nmdc:mga0n895_274843_c1_103_1248 371
598 3300050512 nmdc:mga0n895_338057_c1 nmdc:mga0n895_338057_c1_301_1446 371
599 3300050512 nmdc:mga0n895_408776_c1 nmdc:mga0n895_408776_c1_125_1270 371
600 3300050512 nmdc:mga0n895_43653_c1 nmdc:mga0n895_43653_c1_571_1716 371
601 3300050512 nmdc:mga0n895_93056_c1 nmdc:mga0n895_93056_c1_1551_2696 371
602 3300050515 nmdc:mga0a205_238460_c1 nmdc:mga0a205_238460_c1_446_1591 371
603 3300050515 nmdc:mga0a205_294144_c1 nmdc:mga0a205_294144_c1_242_1387 371
604 3300050515 nmdc:mga0a205_68006_c1 nmdc:mga0a205_68006_c1_411_1589 371
605 3300053080 Ga0500635_0001844 Ga0500635_0001844_1964_3127 371
606 3300053091 Ga0500647_0055479 Ga0500647_0055479_664_1827 371
607 3300053162 Ga0500638_039815 Ga0500638_039815_812_1975 371
608 3300053177 Ga0500636_0070043 Ga0500636_0070043_725_1888 371
609 3300053737 Ga0500601_001109 Ga0500601_001109_1318_2481 371
610 3300054114 Ga0501084_0138029 Ga0501084_0138029_403_1548 371
611 3300054114 Ga0501084_0186111 Ga0501084_0186111_498_1643 371
612 3300060353 Ga0501082_0090664 Ga0501082_0090664_123_1268 371
613 3300060353 Ga0501082_0214945 Ga0501082_0214945_213_1358 371
614 3300061734 Ga0530510_0015761 Ga0530510_0015761_116_1261 371
615 3300061734 Ga0530510_0146364 Ga0530510_0146364_117_1262 371
616 iso_pu_bacteria 8016583857 8016586139 371
617 iso_pu_bacteria 8016583857 8016586216 371
618 iso_pu_bacteria 2513237092 2513628061 372
619 iso_pu_bacteria 2904690495 2904691835 372
620 iso_pu_bacteria 2906626472 2906629480 372
621 iso_pu_bacteria 2908756301 2908757862 372
622 3300031010 Ga0265771_1000388 Ga0265771_10003881 373
623 iso_pu_bacteria 2916041962 2916043385 373
624 iso_pu_bacteria 2937113482 2937119833 373
625 iso_pu_bacteria 2957415311 2957417195 373
626 iso_pu_bacteria 2960610863 2960611930 373
627 iso_pu_bacteria 2960687367 2960689294 373
628 iso_pu_bacteria 2970177841 2970179763 373
629 iso_pu_bacteria 2977523885 2977525213 373
630 3300006237 Ga0097621_100175799 Ga0097621_1001757992 374
631 3300025893 Ga0207682_10044128 Ga0207682_100441282 374
632 3300025931 Ga0207644_10095484 Ga0207644_100954842 374
633 3300046525 Ga0495663_0023777 Ga0495663_0023777_512_1684 374
634 3300046542 Ga0495597_0038306 Ga0495597_0038306_349_1473 374
635 3300003911 JGI25405J52794_10012956 JGI25405J52794_100129563 375
636 3300005439 Ga0070711_100186894 Ga0070711_1001868941 375
637 3300005468 Ga0070707_100149799 Ga0070707_1001497992 375
638 3300006175 Ga0070712_100104009 Ga0070712_1001040091 375
639 3300006844 Ga0075428_100269056 Ga0075428_1002690562 375
640 3300009147 Ga0114129_10153380 Ga0114129_101533802 375
641 3300031251 Ga0265327_10051715 Ga0265327_100517151 375
642 3300046524 Ga0495648_0015268 Ga0495648_0015268_1879_3081 375
643 3300053085 Ga0495619_0121574 Ga0495619_0121574_534_1697 375
644 3300059424 Ga0590075_024090 Ga0590075_024090_43_1200 375
645 3300001977 JGI24746J21847_1008261 JGI24746J21847_10082611 376
646 3300001978 JGI24747J21853_1003876 JGI24747J21853_10038761 376
647 3300001989 JGI24739J22299_10041017 JGI24739J22299_100410171 376
648 3300001991 JGI24743J22301_10001747 JGI24743J22301_100017472 376
649 3300002073 JGI24745J21846_1002341 JGI24745J21846_10023411 376
650 3300002074 JGI24748J21848_1004181 JGI24748J21848_10041811 376
651 3300002077 JGI24744J21845_10003722 JGI24744J21845_100037221 376
652 3300002155 JGI24033J26618_1003691 JGI24033J26618_10036911 376
653 3300003203 JGI25406J46586_10036361 JGI25406J46586_100363611 376
654 3300005327 Ga0070658_10160378 Ga0070658_101603781 376
655 3300005328 Ga0070676_10051561 Ga0070676_100515612 376
656 3300005331 Ga0070670_100046887 Ga0070670_1000468871 376
657 3300005335 Ga0070666_10104035 Ga0070666_101040351 376
658 3300005337 Ga0070682_100097005 Ga0070682_1000970052 376
659 3300005338 Ga0068868_100061274 Ga0068868_1000612742 376
660 3300005339 Ga0070660_100095957 Ga0070660_1000959573 376
661 3300005340 Ga0070689_100178328 Ga0070689_1001783281 376
662 3300005343 Ga0070687_100070198 Ga0070687_1000701981 376
663 3300005353 Ga0070669_100113286 Ga0070669_1001132861 376
664 3300005354 Ga0070675_100093991 Ga0070675_1000939913 376
665 3300005355 Ga0070671_100211370 Ga0070671_1002113701 376
666 3300005364 Ga0070673_100039577 Ga0070673_1000395772 376
667 3300005365 Ga0070688_100213407 Ga0070688_1002134071 376
668 3300005440 Ga0070705_100089861 Ga0070705_1000898611 376
669 3300005440 Ga0070705_100121711 Ga0070705_1001217111 376
670 3300005441 Ga0070700_100105665 Ga0070700_1001056652 376
671 3300005456 Ga0070678_100140384 Ga0070678_1001403842 376
672 3300005457 Ga0070662_100117374 Ga0070662_1001173742 376
673 3300005467 Ga0070706_100183782 Ga0070706_1001837821 376
674 3300005518 Ga0070699_100144774 Ga0070699_1001447743 376
675 3300005535 Ga0070684_100093032 Ga0070684_1000930323 376
676 3300005539 Ga0068853_100146627 Ga0068853_1001466272 376
677 3300005544 Ga0070686_100059901 Ga0070686_1000599012 376
678 3300005547 Ga0070693_100072847 Ga0070693_1000728472 376
679 3300005548 Ga0070665_100256282 Ga0070665_1002562821 376
680 3300005549 Ga0070704_100161089 Ga0070704_1001610891 376
681 3300005564 Ga0070664_100238007 Ga0070664_1002380071 376
682 3300005578 Ga0068854_100171959 Ga0068854_1001719591 376
683 3300005617 Ga0068859_100201378 Ga0068859_1002013782 376
684 3300005618 Ga0068864_100084529 Ga0068864_1000845293 376
685 3300005718 Ga0068866_10037987 Ga0068866_100379872 376
686 3300005841 Ga0068863_100233521 Ga0068863_1002335212 376
687 3300005842 Ga0068858_100444856 Ga0068858_1004448561 376
688 3300005843 Ga0068860_100097671 Ga0068860_1000976712 376
689 3300005937 Ga0081455_10037468 Ga0081455_100374682 376
690 3300006881 Ga0068865_100105700 Ga0068865_1001057003 376
691 3300006931 Ga0097620_100201376 Ga0097620_1002013762 376
692 3300007788 Ga0099795_10047541 Ga0099795_100475411 376
693 3300009098 Ga0105245_10259206 Ga0105245_102592061 376
694 3300009148 Ga0105243_10160804 Ga0105243_101608041 376
695 3300009176 Ga0105242_10136604 Ga0105242_101366042 376
696 3300009177 Ga0105248_10191085 Ga0105248_101910852 376
697 3300009545 Ga0105237_10186964 Ga0105237_101869642 376
698 3300010375 Ga0105239_10353954 Ga0105239_103539542 376
699 3300013102 Ga0157371_10138482 Ga0157371_101384821 376
700 3300013296 Ga0157374_10209188 Ga0157374_102091882 376
701 3300013306 Ga0163162_10164747 Ga0163162_101647471 376
702 3300013308 Ga0157375_10199452 Ga0157375_101994522 376
703 3300013308 Ga0157375_10226460 Ga0157375_102264603 376
704 3300014968 Ga0157379_10166146 Ga0157379_101661461 376
705 3300017792 Ga0163161_10190241 Ga0163161_101902411 376
706 3300025315 Ga0207697_10072691 Ga0207697_100726911 376
707 3300025899 Ga0207642_10037397 Ga0207642_100373972 376
708 3300025901 Ga0207688_10058297 Ga0207688_100582971 376
709 3300025901 Ga0207688_10141090 Ga0207688_101410902 376
710 3300025906 Ga0207699_10178134 Ga0207699_101781341 376
711 3300025907 Ga0207645_10082311 Ga0207645_100823112 376
712 3300025908 Ga0207643_10085144 Ga0207643_100851441 376
713 3300025910 Ga0207684_10152673 Ga0207684_101526732 376
714 3300025918 Ga0207662_10037067 Ga0207662_100370672 376
715 3300025919 Ga0207657_10202938 Ga0207657_102029381 376
716 3300025920 Ga0207649_10102736 Ga0207649_101027361 376
717 3300025927 Ga0207687_10117642 Ga0207687_101176421 376
718 3300025928 Ga0207700_10159642 Ga0207700_101596421 376
719 3300025929 Ga0207664_10153783 Ga0207664_101537831 376
720 3300025933 Ga0207706_10152090 Ga0207706_101520902 376
721 3300025935 Ga0207709_10123769 Ga0207709_101237691 376
722 3300025938 Ga0207704_10152334 Ga0207704_101523341 376
723 3300025940 Ga0207691_10158591 Ga0207691_101585911 376
724 3300025941 Ga0207711_10193058 Ga0207711_101930582 376
725 3300025942 Ga0207689_10058015 Ga0207689_100580152 376
726 3300025945 Ga0207679_10274016 Ga0207679_102740161 376
727 3300025960 Ga0207651_10165221 Ga0207651_101652211 376
728 3300025961 Ga0207712_10219023 Ga0207712_102190231 376
729 3300025972 Ga0207668_10131079 Ga0207668_101310792 376
730 3300025981 Ga0207640_10037158 Ga0207640_100371582 376
731 3300026067 Ga0207678_10105080 Ga0207678_101050802 376
732 3300026075 Ga0207708_10031070 Ga0207708_100310702 376
733 3300026075 Ga0207708_10124288 Ga0207708_101242882 376
734 3300026095 Ga0207676_10208348 Ga0207676_102083481 376
735 3300026116 Ga0207674_10074163 Ga0207674_100741632 376
736 3300026121 Ga0207683_10044883 Ga0207683_100448833 376
737 3300028379 Ga0268266_10162001 Ga0268266_101620011 376
738 3300028380 Ga0268265_10296635 Ga0268265_102966351 376
739 3300028381 Ga0268264_10181015 Ga0268264_101810151 376
740 3300031824 Ga0307413_10130659 Ga0307413_101306591 376
741 3300031852 Ga0307410_10105031 Ga0307410_101050312 376
742 3300031901 Ga0307406_10116285 Ga0307406_101162852 376
743 3300031903 Ga0307407_10126480 Ga0307407_101264801 376
744 3300031911 Ga0307412_10167039 Ga0307412_101670391 376
745 3300031995 Ga0307409_100189203 Ga0307409_1001892032 376
746 3300032002 Ga0307416_100208014 Ga0307416_1002080142 376
747 3300032004 Ga0307414_10110067 Ga0307414_101100672 376
748 3300032005 Ga0307411_10142978 Ga0307411_101429781 376
749 3300032126 Ga0307415_100150739 Ga0307415_1001507391 376
750 3300039437 Ga0436365_0700849 Ga0436365_0700849_274_1434 376
751 3300039450 Ga0436363_1156995 Ga0436363_1156995_506_1666 376
752 3300048905 Ga0496102_0162272 Ga0496102_0162272_184_1344 376
753 3300048906 Ga0496103_0079111 Ga0496103_0079111_727_1887 376
754 3300048918 Ga0496115_0100162 Ga0496115_0100162_645_1805 376
755 3300049675 Ga0501243_008819 Ga0501243_008819_384_1544 376
756 3300050510 nmdc:mga06r32_436412_c1 nmdc:mga06r32_436412_c1_12_1172 376
757 3300048903 Ga0496100_0215467 Ga0496100_0215467_178_1347 377
758 3300005435 Ga0070714_100170228 Ga0070714_1001702283 378
759 3300006173 Ga0070716_100055988 Ga0070716_1000559882 378
760 3300025939 Ga0207665_10085023 Ga0207665_100850232 378
761 3300035117 Ga0373953_0055691 Ga0373953_0055691_103_1275 378
762 3300035170 Ga0373943_0103169 Ga0373943_0103169_219_1391 378
763 3300046463 Ga0495653_0120556 Ga0495653_0120556_464_1636 378
764 3300046477 Ga0495664_0107819 Ga0495664_0107819_177_1349 378
765 3300046516 Ga0495628_0150437 Ga0495628_0150437_145_1317 378
766 3300048906 Ga0496103_0105904 Ga0496103_0105904_199_1365 378
767 3300048924 Ga0496121_0051976 Ga0496121_0051976_877_2025 378
768 3300053085 Ga0495619_0125732 Ga0495619_0125732_348_1520 378
769 iso_pu_bacteria 2509276022 2509398767 378
770 iso_pu_bacteria 2894232714 2894241453 378
771 3300005985 Ga0081539_10074538 Ga0081539_100745382 379
772 3300007788 Ga0099795_10014397 Ga0099795_100143972 379
773 3300027512 Ga0209179_1007027 Ga0209179_10070271 379
774 3300035083 Ga0373926_0022972 Ga0373926_0022972_297_1460 379
775 3300035086 Ga0373934_0029429 Ga0373934_0029429_881_2044 379
776 3300035111 Ga0373923_0024422 Ga0373923_0024422_566_1729 379
777 3300035117 Ga0373953_0037220 Ga0373953_0037220_252_1415 379
778 3300035118 Ga0373954_0041247 Ga0373954_0041247_116_1279 379
779 3300035119 Ga0373956_0039464 Ga0373956_0039464_739_1902 379
780 3300035120 Ga0373957_0014082 Ga0373957_0014082_588_1751 379
781 3300035170 Ga0373943_0054037 Ga0373943_0054037_199_1362 379
782 3300035172 Ga0373955_0056092 Ga0373955_0056092_874_2037 379
783 3300035410 Ga0373924_0041626 Ga0373924_0041626_123_1286 379
784 3300035692 Ga0373935_0084765 Ga0373935_0084765_113_1276 379
785 3300035724 Ga0373933_0062719 Ga0373933_0062719_326_1489 379
786 3300035725 Ga0373947_0079596 Ga0373947_0079596_235_1398 379
787 3300036401 Ga0373937_0220458 Ga0373937_0220458_529_1692 379
788 3300037068 Ga0373925_0197552 Ga0373925_0197552_201_1364 379
789 3300046454 Ga0495592_0071135 Ga0495592_0071135_1255_2418 379
790 3300046459 Ga0495629_0109758 Ga0495629_0109758_234_1397 379
791 3300046462 Ga0495651_0204679 Ga0495651_0204679_100_1263 379
792 3300046463 Ga0495653_0026804 Ga0495653_0026804_704_1867 379
793 3300046472 Ga0495580_0152375 Ga0495580_0152375_188_1351 379
794 3300046473 Ga0495582_0127731 Ga0495582_0127731_67_1230 379
795 3300046476 Ga0495662_0059784 Ga0495662_0059784_209_1372 379
796 3300046477 Ga0495664_0069996 Ga0495664_0069996_743_1906 379
797 3300046499 Ga0495594_0088844 Ga0495594_0088844_304_1467 379
798 3300046511 Ga0495608_0095145 Ga0495608_0095145_605_1768 379
799 3300046514 Ga0495618_0097831 Ga0495618_0097831_589_1752 379
800 3300046516 Ga0495628_0116639 Ga0495628_0116639_659_1822 379
801 3300046517 Ga0495630_0135063 Ga0495630_0135063_196_1359 379
802 3300046529 Ga0495652_0122944 Ga0495652_0122944_114_1277 379
803 3300046533 Ga0495640_0095116 Ga0495640_0095116_277_1440 379
804 3300046536 Ga0495587_0077923 Ga0495587_0077923_640_1803 379
805 3300046543 Ga0495645_0125842 Ga0495645_0125842_115_1278 379
806 3300046559 Ga0495667_0070204 Ga0495667_0070204_505_1668 379
807 3300046642 Ga0495634_0082615 Ga0495634_0082615_832_1995 379
808 3300046663 Ga0495635_0069964 Ga0495635_0069964_570_1733 379
809 3300046675 Ga0495657_0097023 Ga0495657_0097023_184_1347 379
810 3300046678 Ga0495599_0087520 Ga0495599_0087520_518_1681 379
811 3300046679 Ga0495623_0130625 Ga0495623_0130625_112_1275 379
812 3300046680 Ga0495646_0065162 Ga0495646_0065162_482_1645 379
813 3300046689 Ga0495613_0104524 Ga0495613_0104524_339_1502 379
814 3300046690 Ga0495624_0103569 Ga0495624_0103569_462_1625 379
815 3300046809 Ga0495600_0086625 Ga0495600_0086625_584_1747 379
816 3300047317 Ga0495604_0125798 Ga0495604_0125798_153_1316 379
817 3300047319 Ga0495674_0112845 Ga0495674_0112845_133_1296 379
818 3300047321 Ga0495676_0087846 Ga0495676_0087846_219_1382 379
819 3300047322 Ga0495680_0116214 Ga0495680_0116214_111_1274 379
820 3300047444 Ga0495675_0070438 Ga0495675_0070438_452_1615 379
821 3300047471 Ga0495684_0117712 Ga0495684_0117712_741_1904 379
822 3300047673 Ga0495593_0056823 Ga0495593_0056823_167_1330 379
823 3300048088 Ga0495602_0147045 Ga0495602_0147045_153_1316 379
824 3300048089 Ga0495614_0046798 Ga0495614_0046798_222_1385 379
825 3300053077 Ga0495601_0108958 Ga0495601_0108958_94_1257 379
826 3300053084 Ga0495595_0054233 Ga0495595_0054233_560_1723 379
827 3300053085 Ga0495619_0053191 Ga0495619_0053191_972_2135 379
828 iso_pu_bacteria 2508501114 2509074005 379
829 iso_pu_bacteria 2517572143 2517896288 379
830 iso_pu_bacteria 2528768022 2528855657 379
831 iso_pu_bacteria 2582581315 2585329032 379
832 iso_pu_bacteria 2977864932 2977866094 379
833 3300005434 Ga0070709_10095920 Ga0070709_100959202 380
834 3300005435 Ga0070714_100181083 Ga0070714_1001810832 380
835 3300005436 Ga0070713_100170128 Ga0070713_1001701281 380
836 3300005437 Ga0070710_10053386 Ga0070710_100533862 380
837 3300005439 Ga0070711_100036660 Ga0070711_1000366602 380
838 3300005564 Ga0070664_100113082 Ga0070664_1001130824 380
839 3300006028 Ga0070717_10173475 Ga0070717_101734752 380
840 3300006173 Ga0070716_100086094 Ga0070716_1000860942 380
841 3300006175 Ga0070712_100273002 Ga0070712_1002730021 380
842 3300006178 Ga0075367_10082312 Ga0075367_100823121 380
843 3300006871 Ga0075434_100239939 Ga0075434_1002399392 380
844 3300021361 Ga0213872_10046034 Ga0213872_100460342 380
845 3300025898 Ga0207692_10023051 Ga0207692_100230511 380
846 3300025915 Ga0207693_10219567 Ga0207693_102195671 380
847 3300025916 Ga0207663_10106052 Ga0207663_101060521 380
848 3300025929 Ga0207664_10012633 Ga0207664_100126331 380
849 3300025939 Ga0207665_10046964 Ga0207665_100469641 380
850 3300025945 Ga0207679_10154138 Ga0207679_101541381 380
851 3300039438 Ga0436360_0136438 Ga0436360_0136438_66_1232 380
852 3300039447 Ga0436361_0242002 Ga0436361_0242002_427_1593 380
853 3300039453 Ga0436362_1240782 Ga0436362_1240782_1163_2329 380
854 3300041459 Ga0451800_1108730 Ga0451800_1108730_212_1384 380
855 3300048907 Ga0496104_0188026 Ga0496104_0188026_593_1765 380
856 3300048912 Ga0496109_0217097 Ga0496109_0217097_147_1319 380
857 3300048913 Ga0496110_0061683 Ga0496110_0061683_568_1740 380
858 3300048915 Ga0496112_0218055 Ga0496112_0218055_503_1675 380
859 3300048916 Ga0496113_0186533 Ga0496113_0186533_375_1547 380
860 iso_pu_bacteria 2508501050 2508728110 380
861 iso_pu_bacteria 2582581305 2585261060 380
862 iso_pu_bacteria 2585427528 2585543877 380
863 iso_pu_bacteria 2718217882 2719179016 380
864 iso_pu_bacteria 2718217882 2719184509 380
865 iso_pu_bacteria 2718218009 2719728529 380
866 iso_pu_bacteria 2718218009 2719729381 380
867 iso_pu_bacteria 2718218233 2720618054 380
868 iso_pu_bacteria 2718218235 2720634248 380
869 iso_pu_bacteria 2718218363 2721143628 380
870 iso_pu_bacteria 2718218363 2721144220 380
871 iso_pu_bacteria 2718218365 2721155131 380
872 iso_pu_bacteria 2718218365 2721155380 380
873 iso_pu_bacteria 2718218365 2721158614 380
874 iso_pu_bacteria 2718218366 2721166724 380
875 iso_pu_bacteria 2721755514 2722837702 380
876 iso_pu_bacteria 2721755556 2723030542 380
877 iso_pu_bacteria 2721755684 2723558603 380
878 iso_pu_bacteria 2721755684 2723563554 380
879 iso_pu_bacteria 2721755684 2723563800 380
880 iso_pu_bacteria 2721755684 2723564904 380
881 iso_pu_bacteria 2721755810 2724041274 380
882 iso_pu_bacteria 2721755810 2724041554 380
883 iso_pu_bacteria 2728369352 2730111075 380
884 iso_pu_bacteria 2728369365 2730161477 380
885 iso_pu_bacteria 2728369397 2730296013 380
886 iso_pu_bacteria 2728369397 2730296260 380
887 iso_pu_bacteria 2728369397 2730298246 380
888 iso_pu_bacteria 2751185800 2753361038 380
889 iso_pu_bacteria 2818991448 2819613895 380
890 iso_pu_bacteria 2921250672 2921256104 380
891 iso_pu_bacteria 8005282627 8005284202 380
892 iso_pu_bacteria 8005497431 8005500065 380
893 iso_pu_bacteria 8005497431 8005502321 380
894 iso_pu_bacteria 8005668836 8005671482 380
895 iso_pu_bacteria 8005668836 8005673748 380
896 iso_pu_bacteria 8005668836 8005674360 380
897 3300021377 Ga0213874_10003712 Ga0213874_100037124 381
898 3300039450 Ga0436363_0019643 Ga0436363_0019643_2224_3375 381
899 iso_pu_bacteria 2510917028 2511183881 381
900 iso_pu_bacteria 2582581867 2585402136 381
901 iso_pu_bacteria 2582581867 2585403822 381
902 iso_pu_bacteria 2582581867 2585404382 381
903 iso_pu_bacteria 2582581867 2585404457 381
904 iso_pu_bacteria 2835312727 2835315997 381
905 iso_pu_bacteria 2835312727 2835318508 381
906 iso_pu_bacteria 2835312727 2835319039 381
907 iso_pu_bacteria 2835312727 2835319621 381
908 iso_pu_bacteria 2882632389 2882632406 381
909 3300011119 Ga0105246_10152185 Ga0105246_101521852 382
910 3300025908 Ga0207643_10102932 Ga0207643_101029322 382
911 3300031548 Ga0307408_100165794 Ga0307408_1001657942 382
912 3300031852 Ga0307410_10170955 Ga0307410_101709551 382
913 3300031911 Ga0307412_10216449 Ga0307412_102164491 382
914 3300032002 Ga0307416_100440712 Ga0307416_1004407121 382
915 3300032004 Ga0307414_10295592 Ga0307414_102955921 382
916 3300035170 Ga0373943_0069740 Ga0373943_0069740_139_1290 382
917 3300035692 Ga0373935_0160901 Ga0373935_0160901_359_1510 382
918 3300035725 Ga0373947_0054945 Ga0373947_0054945_991_2142 382
919 3300037471 Ga0395905_0218948 Ga0395905_0218948_499_1665 382
920 iso_pu_bacteria 2510065059 2510319618 382
921 iso_pu_bacteria 2881161766 2881163860 382
922 iso_pu_bacteria 2881161766 2881165828 382
923 iso_pu_bacteria 2888350351 2888351580 382
924 iso_pu_bacteria 2889010040 2889016638 382
925 iso_pu_bacteria 2906328253 2906329274 382
926 iso_pu_bacteria 2977864932 2977870922 382
927 iso_pu_bacteria 2977864932 2977871717 382
928 iso_pu_bacteria 2979742915 2979746122 382
929 3300005288 Ga0065714_10099650 Ga0065714_100996501 383
930 3300005331 Ga0070670_100307627 Ga0070670_1003076272 383
931 3300005335 Ga0070666_10141490 Ga0070666_101414902 383
932 3300005339 Ga0070660_100121771 Ga0070660_1001217712 383
933 3300005355 Ga0070671_100216550 Ga0070671_1002165502 383
934 3300005364 Ga0070673_100170657 Ga0070673_1001706573 383
935 3300005456 Ga0070678_100289976 Ga0070678_1002899761 383
936 3300005459 Ga0068867_100027947 Ga0068867_1000279471 383
937 3300005544 Ga0070686_100126765 Ga0070686_1001267652 383
938 3300005841 Ga0068863_100302161 Ga0068863_1003021611 383
939 3300005843 Ga0068860_100199421 Ga0068860_1001994212 383
940 3300009098 Ga0105245_10133327 Ga0105245_101333273 383
941 3300009101 Ga0105247_10153492 Ga0105247_101534922 383
942 3300009553 Ga0105249_10261650 Ga0105249_102616503 383
943 3300013308 Ga0157375_10212999 Ga0157375_102129992 383
944 3300014968 Ga0157379_10234219 Ga0157379_102342191 383
945 3300017792 Ga0163161_10182136 Ga0163161_101821361 383
946 3300025903 Ga0207680_10124285 Ga0207680_101242852 383
947 3300025919 Ga0207657_10027420 Ga0207657_100274203 383
948 3300025927 Ga0207687_10085062 Ga0207687_100850623 383
949 3300025927 Ga0207687_10188744 Ga0207687_101887441 383
950 3300025931 Ga0207644_10147929 Ga0207644_101479292 383
951 3300025941 Ga0207711_10146464 Ga0207711_101464641 383
952 3300026088 Ga0207641_10300848 Ga0207641_103008482 383
953 3300026118 Ga0207675_100304327 Ga0207675_1003043271 383
954 3300026121 Ga0207683_10243911 Ga0207683_102439112 383
955 3300028800 Ga0265338_10114313 Ga0265338_101143132 383
956 3300031249 Ga0265339_10119329 Ga0265339_101193291 383
957 3300031852 Ga0307410_10032892 Ga0307410_100328921 383
958 3300044684 Ga0466966_0056572 Ga0466966_0056572_1024_2190 383
959 3300048903 Ga0496100_0212350 Ga0496100_0212350_157_1311 383
960 3300048905 Ga0496102_0238395 Ga0496102_0238395_302_1456 383
961 3300048907 Ga0496104_0310640 Ga0496104_0310640_176_1330 383
962 3300048908 Ga0496105_0257579 Ga0496105_0257579_207_1361 383
963 3300048910 Ga0496107_0177593 Ga0496107_0177593_278_1432 383
964 3300048911 Ga0496108_0308227 Ga0496108_0308227_82_1236 383
965 3300048913 Ga0496110_0138916 Ga0496110_0138916_133_1287 383
966 3300053102 Ga0500554_021448 Ga0500554_021448_501_1670 383
967 3300053136 Ga0500559_0037907 Ga0500559_0037907_496_1674 383
968 iso_pu_bacteria 2503198000 2503204429 383
969 iso_pu_bacteria 2510917028 2511183372 383
970 iso_pu_bacteria 2513237103 2513713642 383
971 iso_pu_bacteria 2516143018 2516207572 383
972 iso_pu_bacteria 2643221618 2644104678 383
973 iso_pu_bacteria 2643221655 2644313098 383
974 iso_pu_bacteria 2643221712 2644612721 383
975 iso_pu_bacteria 2882632389 2882640561 383
976 iso_pu_bacteria 2924754689 2924762770 383
977 iso_pu_bacteria 2941499720 2941502269 383
978 iso_pu_bacteria 2958064165 2958069110 383
979 iso_pu_bacteria 2977828996 2977832907 383
980 iso_pu_bacteria 2977864932 2977866360 383
981 iso_pu_bacteria 2996341866 2996343817 383
982 iso_pu_bacteria 643692032 643692287 383
983 3300002739 JGI25158J39367_1000017 JGI25158J39367_100001729 384
984 3300002987 JGI25159J45721_1000239 JGI25159J45721_100023922 384
985 3300003354 JGI25160J50197_1000513 JGI25160J50197_100051319 384
986 3300003374 JGI25161J50226_1000102 JGI25161J50226_100010243 384
987 3300003775 Ga0055524_1005861 Ga0055524_10058611 384
988 3300003792 Ga0055540_1021203 Ga0055540_10212031 384
989 3300003792 Ga0055540_1026271 Ga0055540_10262711 384
990 3300004625 Ga0055543_1000016 Ga0055543_10000164 384
991 3300005262 Ga0065165_1001457 Ga0065165_10014577 384
992 3300006186 Ga0075369_10044288 Ga0075369_100442883 384
993 3300014326 Ga0157380_10066469 Ga0157380_100664691 384
994 3300025208 Ga0209436_100003 Ga0209436_100003172 384
995 3300025273 Ga0209673_1000638 Ga0209673_100063829 384
996 3300025284 Ga0209130_1000051 Ga0209130_100005140 384
997 3300025295 Ga0209564_1001097 Ga0209564_100109712 384
998 3300025299 Ga0209256_1000578 Ga0209256_100057829 384
999 3300025299 Ga0209256_1017981 Ga0209256_10179813 384
1000 3300025302 Ga0207426_1000043 Ga0207426_1000043258 384
1001 3300025303 Ga0209051_1004206 Ga0209051_10042069 384
1002 3300025303 Ga0209051_1013113 Ga0209051_10131133 384
1003 3300041413 Ga0439465_0031299 Ga0439465_0031299_49_1215 384
1004 3300050489 nmdc:mga03683_87601_c1 nmdc:mga03683_87601_c1_70_1236 384
1005 3300050496 nmdc:mga07m45_24001_c1 nmdc:mga07m45_24001_c1_333_1499 384
1006 3300053093 Ga0500651_0039906 Ga0500651_0039906_354_1523 384
1007 3300053153 Ga0500616_0056185 Ga0500616_0056185_556_1722 384
1008 iso_pu_bacteria 2643221618 2644108266 384
1009 iso_pu_bacteria 2643221655 2644307285 384
1010 iso_pu_bacteria 2643221659 2644331301 384
1011 iso_pu_bacteria 2643221712 2644613374 384
1012 iso_pu_bacteria 2855839649 2855846186 384
1013 iso_pu_bacteria 2855839649 2855846192 384
1014 iso_pu_bacteria 2855839649 2855846369 384
1015 iso_pu_bacteria 2874123672 2874128924 384
1016 iso_pu_bacteria 2876808645 2876815429 384
1017 iso_pu_bacteria 2879110137 2879110441 384
1018 iso_pu_bacteria 2882632389 2882637974 384
1019 iso_pu_bacteria 2916028427 2916030709 384
1020 iso_pu_bacteria 2916055098 2916058652 384
1021 iso_pu_bacteria 2921201388 2921208424 384
1022 iso_pu_bacteria 2921263974 2921268934 384
1023 iso_pu_bacteria 2924158325 2924164426 384
1024 iso_pu_bacteria 2924172951 2924175208 384
1025 iso_pu_bacteria 2937042894 2937048201 384
1026 iso_pu_bacteria 2937106411 2937106645 384
1027 iso_pu_bacteria 2957478035 2957481281 384
1028 iso_pu_bacteria 2957498199 2957501192 384
1029 iso_pu_bacteria 2964628898 2964635841 384
1030 iso_pu_bacteria 2964670856 2964676747 384
1031 iso_pu_bacteria 2967664464 2967664884 384
1032 iso_pu_bacteria 2967678726 2967686020 384
1033 iso_pu_bacteria 2967714385 2967720304 384
1034 iso_pu_bacteria 2967775926 2967779262 384
1035 iso_pu_bacteria 2970054988 2970055543 384
1036 iso_pu_bacteria 2970156795 2970157264 384
1037 iso_pu_bacteria 637000159 637078005 384
1038 iso_pu_bacteria 8006984368 8006992112 384
1039 3300001990 JGI24737J22298_10013530 JGI24737J22298_100135301 385
1040 3300001991 JGI24743J22301_10003049 JGI24743J22301_100030491 385
1041 3300002070 JGI24750J21931_1001808 JGI24750J21931_10018083 385
1042 3300002073 JGI24745J21846_1002996 JGI24745J21846_10029961 385
1043 3300002075 JGI24738J21930_10007082 JGI24738J21930_100070821 385
1044 3300002076 JGI24749J21850_1002463 JGI24749J21850_10024633 385
1045 3300002239 JGI24034J26672_10002224 JGI24034J26672_100022241 385
1046 3300002239 JGI24034J26672_10002409 JGI24034J26672_100024093 385
1047 3300005330 Ga0070690_100039305 Ga0070690_1000393052 385
1048 3300005336 Ga0070680_100076817 Ga0070680_1000768171 385
1049 3300005338 Ga0068868_100126253 Ga0068868_1001262533 385
1050 3300005339 Ga0070660_100065696 Ga0070660_1000656962 385
1051 3300005341 Ga0070691_10024936 Ga0070691_100249364 385
1052 3300005345 Ga0070692_10081101 Ga0070692_100811012 385
1053 3300005347 Ga0070668_100069633 Ga0070668_1000696333 385
1054 3300005353 Ga0070669_100060312 Ga0070669_1000603123 385
1055 3300005356 Ga0070674_100052849 Ga0070674_1000528491 385
1056 3300005356 Ga0070674_100157563 Ga0070674_1001575631 385
1057 3300005365 Ga0070688_100049876 Ga0070688_1000498763 385
1058 3300005366 Ga0070659_100090289 Ga0070659_1000902892 385
1059 3300005436 Ga0070713_100235794 Ga0070713_1002357941 385
1060 3300005441 Ga0070700_100052392 Ga0070700_1000523921 385
1061 3300005457 Ga0070662_100085487 Ga0070662_1000854873 385
1062 3300005459 Ga0068867_100064341 Ga0068867_1000643411 385
1063 3300005459 Ga0068867_100322214 Ga0068867_1003222141 385
1064 3300005471 Ga0070698_100224098 Ga0070698_1002240981 385
1065 3300005535 Ga0070684_100147199 Ga0070684_1001471993 385
1066 3300005539 Ga0068853_100072271 Ga0068853_1000722711 385
1067 3300005543 Ga0070672_100063166 Ga0070672_1000631663 385
1068 3300005544 Ga0070686_100052466 Ga0070686_1000524662 385
1069 3300005545 Ga0070695_100027876 Ga0070695_1000278762 385
1070 3300005546 Ga0070696_100057457 Ga0070696_1000574571 385
1071 3300005547 Ga0070693_100032304 Ga0070693_1000323042 385
1072 3300005547 Ga0070693_100035389 Ga0070693_1000353892 385
1073 3300005548 Ga0070665_100173567 Ga0070665_1001735673 385
1074 3300005549 Ga0070704_100062100 Ga0070704_1000621003 385
1075 3300005563 Ga0068855_100125369 Ga0068855_1001253694 385
1076 3300005577 Ga0068857_100337153 Ga0068857_1003371531 385
1077 3300005616 Ga0068852_100079887 Ga0068852_1000798872 385
1078 3300005617 Ga0068859_100214114 Ga0068859_1002141142 385
1079 3300005718 Ga0068866_10023944 Ga0068866_100239443 385
1080 3300005719 Ga0068861_100059763 Ga0068861_1000597632 385
1081 3300005834 Ga0068851_10029329 Ga0068851_100293293 385
1082 3300005842 Ga0068858_100194365 Ga0068858_1001943653 385
1083 3300005843 Ga0068860_100259413 Ga0068860_1002594132 385
1084 3300005844 Ga0068862_100094868 Ga0068862_1000948683 385
1085 3300005983 Ga0081540_1032803 Ga0081540_10328032 385
1086 3300006028 Ga0070717_10028590 Ga0070717_100285906 385
1087 3300006038 Ga0075365_10000237 Ga0075365_1000023714 385
1088 3300006237 Ga0097621_100369276 Ga0097621_1003692761 385
1089 3300006358 Ga0068871_100188192 Ga0068871_1001881922 385
1090 3300006931 Ga0097620_100214115 Ga0097620_1002141152 385
1091 3300007265 Ga0099794_10037080 Ga0099794_100370802 385
1092 3300009176 Ga0105242_10042694 Ga0105242_100426941 385
1093 3300009177 Ga0105248_10265291 Ga0105248_102652911 385
1094 3300009551 Ga0105238_10155951 Ga0105238_101559512 385
1095 3300009553 Ga0105249_10087969 Ga0105249_100879692 385
1096 3300010159 Ga0099796_10031997 Ga0099796_100319971 385
1097 3300010375 Ga0105239_10350117 Ga0105239_103501172 385
1098 3300013100 Ga0157373_10147401 Ga0157373_101474012 385
1099 3300013105 Ga0157369_10034157 Ga0157369_100341571 385
1100 3300013306 Ga0163162_10123215 Ga0163162_101232152 385
1101 3300014745 Ga0157377_10056938 Ga0157377_100569382 385
1102 3300014968 Ga0157379_10089881 Ga0157379_100898812 385
1103 3300014969 Ga0157376_10168647 Ga0157376_101686471 385
1104 3300014969 Ga0157376_10192738 Ga0157376_101927382 385
1105 3300017792 Ga0163161_10047094 Ga0163161_100470942 385
1106 3300025315 Ga0207697_10067500 Ga0207697_100675001 385
1107 3300025321 Ga0207656_10020468 Ga0207656_100204681 385
1108 3300025901 Ga0207688_10006342 Ga0207688_100063424 385
1109 3300025903 Ga0207680_10141499 Ga0207680_101414991 385
1110 3300025904 Ga0207647_10024961 Ga0207647_100249614 385
1111 3300025907 Ga0207645_10111662 Ga0207645_101116622 385
1112 3300025913 Ga0207695_10181228 Ga0207695_101812282 385
1113 3300025914 Ga0207671_10069987 Ga0207671_100699871 385
1114 3300025918 Ga0207662_10047126 Ga0207662_100471262 385
1115 3300025919 Ga0207657_10160948 Ga0207657_101609482 385
1116 3300025923 Ga0207681_10296772 Ga0207681_102967721 385
1117 3300025924 Ga0207694_10067966 Ga0207694_100679661 385
1118 3300025932 Ga0207690_10179921 Ga0207690_101799211 385
1119 3300025933 Ga0207706_10084757 Ga0207706_100847571 385
1120 3300025936 Ga0207670_10057092 Ga0207670_100570922 385
1121 3300025937 Ga0207669_10139873 Ga0207669_101398731 385
1122 3300025940 Ga0207691_10175945 Ga0207691_101759451 385
1123 3300025941 Ga0207711_10216361 Ga0207711_102163611 385
1124 3300025942 Ga0207689_10149536 Ga0207689_101495361 385
1125 3300025949 Ga0207667_10116556 Ga0207667_101165562 385
1126 3300025961 Ga0207712_10070453 Ga0207712_100704531 385
1127 3300025972 Ga0207668_10254341 Ga0207668_102543411 385
1128 3300025981 Ga0207640_10047237 Ga0207640_100472372 385
1129 3300025986 Ga0207658_10124148 Ga0207658_101241482 385
1130 3300026035 Ga0207703_10256407 Ga0207703_102564071 385
1131 3300026075 Ga0207708_10041968 Ga0207708_100419681 385
1132 3300026078 Ga0207702_10240583 Ga0207702_102405832 385
1133 3300026089 Ga0207648_10098061 Ga0207648_100980612 385
1134 3300026116 Ga0207674_10155203 Ga0207674_101552032 385
1135 3300026118 Ga0207675_100211147 Ga0207675_1002111471 385
1136 3300026121 Ga0207683_10155014 Ga0207683_101550142 385
1137 3300026121 Ga0207683_10232163 Ga0207683_102321631 385
1138 3300026142 Ga0207698_10172916 Ga0207698_101729162 385
1139 3300027111 Ga0209281_1012592 Ga0209281_10125921 385
1140 3300027512 Ga0209179_1013132 Ga0209179_10131321 385
1141 3300027671 Ga0209588_1037461 Ga0209588_10374611 385
1142 3300028379 Ga0268266_10256057 Ga0268266_102560571 385
1143 3300028794 Ga0307515_10272353 Ga0307515_102723531 385
1144 3300035119 Ga0373956_0097093 Ga0373956_0097093_73_1239 385
1145 3300037312 Ga0395899_0151556 Ga0395899_0151556_102_1259 385
1146 3300037418 Ga0395900_0117244 Ga0395900_0117244_1028_2185 385
1147 3300037466 Ga0395898_0077001 Ga0395898_0077001_600_1757 385
1148 3300039447 Ga0436361_0092328 Ga0436361_0092328_598_1758 385
1149 3300046457 Ga0495590_0003911 Ga0495590_0003911_4151_5311 385
1150 3300046491 Ga0495584_0012657 Ga0495584_0012657_2078_3238 385
1151 3300046492 Ga0495585_0078038 Ga0495585_0078038_417_1577 385
1152 3300046506 Ga0495583_0029184 Ga0495583_0029184_811_1968 385
1153 3300046506 Ga0495583_0063724 Ga0495583_0063724_313_1515 385
1154 3300046512 Ga0495610_0043752 Ga0495610_0043752_767_1927 385
1155 3300046513 Ga0495616_0000239 Ga0495616_0000239_43113_44273 385
1156 3300046515 Ga0495620_0022767 Ga0495620_0022767_346_1506 385
1157 3300046516 Ga0495628_0112734 Ga0495628_0112734_328_1488 385
1158 3300046519 Ga0495632_0009988 Ga0495632_0009988_196_1356 385
1159 3300046520 Ga0495637_0047770 Ga0495637_0047770_209_1369 385
1160 3300046522 Ga0495643_0003559 Ga0495643_0003559_7236_8396 385
1161 3300046533 Ga0495640_0058489 Ga0495640_0058489_950_2110 385
1162 3300046536 Ga0495587_0024811 Ga0495587_0024811_1278_2438 385
1163 3300046542 Ga0495597_0016421 Ga0495597_0016421_1114_2274 385
1164 3300046558 Ga0495633_0012801 Ga0495633_0012801_2380_3537 385
1165 3300046648 Ga0495611_0038485 Ga0495611_0038485_513_1673 385
1166 3300046660 Ga0495625_0011433 Ga0495625_0011433_1089_2249 385
1167 3300046694 Ga0495649_0003870 Ga0495649_0003870_6195_7355 385
1168 3300046810 Ga0495660_0037115 Ga0495660_0037115_699_1859 385
1169 3300047317 Ga0495604_0167957 Ga0495604_0167957_305_1465 385
1170 3300047323 Ga0495683_0017636 Ga0495683_0017636_195_1355 385
1171 3300047443 Ga0495687_005675 Ga0495687_005675_1863_3023 385
1172 3300048091 Ga0495626_0035838 Ga0495626_0035838_679_1839 385
1173 3300048903 Ga0496100_0049336 Ga0496100_0049336_183_1349 385
1174 3300048904 Ga0496101_0062655 Ga0496101_0062655_86_1252 385
1175 3300048905 Ga0496102_0198578 Ga0496102_0198578_97_1263 385
1176 3300048906 Ga0496103_0022814 Ga0496103_0022814_2480_3646 385
1177 3300048909 Ga0496106_0035659 Ga0496106_0035659_1184_2350 385
1178 3300048910 Ga0496107_0064211 Ga0496107_0064211_93_1259 385
1179 3300048911 Ga0496108_0082218 Ga0496108_0082218_1417_2583 385
1180 3300048912 Ga0496109_0093101 Ga0496109_0093101_216_1382 385
1181 3300048913 Ga0496110_0089496 Ga0496110_0089496_1438_2604 385
1182 3300048920 Ga0496117_0037958 Ga0496117_0037958_1246_2403 385
1183 3300048924 Ga0496121_0000190 Ga0496121_0000190_115335_116492 385
1184 3300048929 Ga0496126_0003079 Ga0496126_0003079_16215_17372 385
1185 3300049460 Ga0495682_0027510 Ga0495682_0027510_144_1304 385
1186 3300050492 nmdc:mga0yw44_51736_c1 nmdc:mga0yw44_51736_c1_114_1274 385
1187 3300053094 Ga0500566_0096029 Ga0500566_0096029_359_1516 385
1188 3300053136 Ga0500559_0049240 Ga0500559_0049240_416_1576 385
1189 3300053138 Ga0500564_108019 Ga0500564_108019_19_1176 385
1190 3300053730 Ga0500645_014651 Ga0500645_014651_1029_2186 385
1191 3300005356 Ga0070674_100140269 Ga0070674_1001402692 386
1192 3300005467 Ga0070706_100087796 Ga0070706_1000877961 386
1193 3300025928 Ga0207700_10233032 Ga0207700_102330321 386
1194 3300031711 Ga0265314_10058171 Ga0265314_100581713 386
1195 3300033180 Ga0307510_10156464 Ga0307510_101564641 386
1196 3300035083 Ga0373926_0010123 Ga0373926_0010123_1554_2726 386
1197 3300035086 Ga0373934_0066146 Ga0373934_0066146_30_1202 386
1198 3300035111 Ga0373923_0013618 Ga0373923_0013618_1400_2572 386
1199 3300035116 Ga0373945_0020878 Ga0373945_0020878_709_1881 386
1200 3300035118 Ga0373954_0052933 Ga0373954_0052933_546_1718 386
1201 3300035120 Ga0373957_0035934 Ga0373957_0035934_520_1692 386
1202 3300035171 Ga0373946_0044419 Ga0373946_0044419_540_1712 386
1203 3300035172 Ga0373955_0049563 Ga0373955_0049563_770_1942 386
1204 3300035410 Ga0373924_0026767 Ga0373924_0026767_887_2059 386
1205 3300035724 Ga0373933_0182282 Ga0373933_0182282_28_1200 386
1206 3300036401 Ga0373937_0294051 Ga0373937_0294051_237_1409 386
1207 3300046454 Ga0495592_0131939 Ga0495592_0131939_382_1554 386
1208 3300046459 Ga0495629_0097991 Ga0495629_0097991_607_1779 386
1209 3300046462 Ga0495651_0120157 Ga0495651_0120157_210_1382 386
1210 3300046463 Ga0495653_0101691 Ga0495653_0101691_516_1688 386
1211 3300046472 Ga0495580_0099626 Ga0495580_0099626_463_1635 386
1212 3300046477 Ga0495664_0091647 Ga0495664_0091647_416_1588 386
1213 3300046499 Ga0495594_0131058 Ga0495594_0131058_90_1262 386
1214 3300046511 Ga0495608_0062185 Ga0495608_0062185_413_1585 386
1215 3300046514 Ga0495618_0106589 Ga0495618_0106589_412_1584 386
1216 3300046516 Ga0495628_0136738 Ga0495628_0136738_490_1662 386
1217 3300046517 Ga0495630_0140897 Ga0495630_0140897_206_1378 386
1218 3300046526 Ga0495666_0036384 Ga0495666_0036384_405_1577 386
1219 3300046529 Ga0495652_0160158 Ga0495652_0160158_185_1357 386
1220 3300046533 Ga0495640_0102247 Ga0495640_0102247_491_1663 386
1221 3300046535 Ga0495586_0052048 Ga0495586_0052048_406_1578 386
1222 3300046535 Ga0495586_0111999 Ga0495586_0111999_197_1369 386
1223 3300046536 Ga0495587_0047790 Ga0495587_0047790_965_2137 386
1224 3300046559 Ga0495667_0122914 Ga0495667_0122914_91_1263 386
1225 3300046642 Ga0495634_0118667 Ga0495634_0118667_432_1604 386
1226 3300046663 Ga0495635_0117420 Ga0495635_0117420_241_1413 386
1227 3300046675 Ga0495657_0097182 Ga0495657_0097182_548_1720 386
1228 3300046678 Ga0495599_0119386 Ga0495599_0119386_411_1583 386
1229 3300046679 Ga0495623_0058022 Ga0495623_0058022_394_1566 386
1230 3300046680 Ga0495646_0090238 Ga0495646_0090238_341_1513 386
1231 3300046681 Ga0495647_0038784 Ga0495647_0038784_17_1189 386
1232 3300046689 Ga0495613_0225731 Ga0495613_0225731_20_1192 386
1233 3300046690 Ga0495624_0051568 Ga0495624_0051568_933_2105 386
1234 3300047315 Ga0495581_0110903 Ga0495581_0110903_123_1295 386
1235 3300047317 Ga0495604_0153214 Ga0495604_0153214_436_1608 386
1236 3300047319 Ga0495674_0128953 Ga0495674_0128953_70_1242 386
1237 3300047322 Ga0495680_0126830 Ga0495680_0126830_126_1298 386
1238 3300047444 Ga0495675_0133742 Ga0495675_0133742_211_1383 386
1239 3300047469 Ga0495673_0000025 Ga0495673_0000025_134280_135440 386
1240 3300047471 Ga0495684_0107933 Ga0495684_0107933_415_1587 386
1241 3300048088 Ga0495602_0111996 Ga0495602_0111996_401_1573 386
1242 3300048089 Ga0495614_0075101 Ga0495614_0075101_188_1360 386
1243 3300049579 Ga0501043_0039063 Ga0501043_0039063_746_1906 386
1244 3300049823 Ga0501044_0347322 Ga0501044_0347322_221_1381 386
1245 3300053085 Ga0495619_0212567 Ga0495619_0212567_28_1200 386
1246 3300001991 JGI24743J22301_10009186 JGI24743J22301_100091862 387
1247 3300005329 Ga0070683_100196421 Ga0070683_1001964212 387
1248 3300005331 Ga0070670_100132265 Ga0070670_1001322652 387
1249 3300005337 Ga0070682_100085558 Ga0070682_1000855582 387
1250 3300005338 Ga0068868_100098812 Ga0068868_1000988122 387
1251 3300005339 Ga0070660_100199812 Ga0070660_1001998121 387
1252 3300005341 Ga0070691_10094421 Ga0070691_100944212 387
1253 3300005344 Ga0070661_100168746 Ga0070661_1001687461 387
1254 3300005355 Ga0070671_100182528 Ga0070671_1001825281 387
1255 3300005434 Ga0070709_10079394 Ga0070709_100793941 387
1256 3300005434 Ga0070709_10126851 Ga0070709_101268512 387
1257 3300005435 Ga0070714_100134109 Ga0070714_1001341092 387
1258 3300005436 Ga0070713_100187871 Ga0070713_1001878712 387
1259 3300005437 Ga0070710_10087246 Ga0070710_100872461 387
1260 3300005441 Ga0070700_100152800 Ga0070700_1001528001 387
1261 3300005456 Ga0070678_100233602 Ga0070678_1002336022 387
1262 3300005459 Ga0068867_100177894 Ga0068867_1001778941 387
1263 3300005518 Ga0070699_100196855 Ga0070699_1001968552 387
1264 3300005530 Ga0070679_100298246 Ga0070679_1002982462 387
1265 3300005535 Ga0070684_100295794 Ga0070684_1002957941 387
1266 3300005536 Ga0070697_100207462 Ga0070697_1002074622 387
1267 3300005545 Ga0070695_100126396 Ga0070695_1001263961 387
1268 3300005546 Ga0070696_100088711 Ga0070696_1000887112 387
1269 3300005547 Ga0070693_100132237 Ga0070693_1001322371 387
1270 3300005548 Ga0070665_100282284 Ga0070665_1002822841 387
1271 3300005563 Ga0068855_100200293 Ga0068855_1002002931 387
1272 3300005564 Ga0070664_100158082 Ga0070664_1001580821 387
1273 3300005578 Ga0068854_100154959 Ga0068854_1001549591 387
1274 3300005614 Ga0068856_100127785 Ga0068856_1001277853 387
1275 3300005614 Ga0068856_100204652 Ga0068856_1002046522 387
1276 3300005614 Ga0068856_100362757 Ga0068856_1003627571 387
1277 3300005615 Ga0070702_100074057 Ga0070702_1000740571 387
1278 3300005618 Ga0068864_100219732 Ga0068864_1002197322 387
1279 3300005618 Ga0068864_100293770 Ga0068864_1002937701 387
1280 3300005719 Ga0068861_100158170 Ga0068861_1001581701 387
1281 3300005834 Ga0068851_10080757 Ga0068851_100807571 387
1282 3300005840 Ga0068870_10089223 Ga0068870_100892232 387
1283 3300005841 Ga0068863_100200631 Ga0068863_1002006311 387
1284 3300005843 Ga0068860_100272084 Ga0068860_1002720841 387
1285 3300005937 Ga0081455_10046581 Ga0081455_100465812 387
1286 3300006163 Ga0070715_10092648 Ga0070715_100926482 387
1287 3300006175 Ga0070712_100023822 Ga0070712_1000238223 387
1288 3300006175 Ga0070712_100118513 Ga0070712_1001185132 387
1289 3300006237 Ga0097621_100155150 Ga0097621_1001551502 387
1290 3300006358 Ga0068871_100239595 Ga0068871_1002395951 387
1291 3300006871 Ga0075434_100139403 Ga0075434_1001394032 387
1292 3300009101 Ga0105247_10112449 Ga0105247_101124491 387
1293 3300009148 Ga0105243_10154633 Ga0105243_101546331 387
1294 3300009174 Ga0105241_10116136 Ga0105241_101161362 387
1295 3300010375 Ga0105239_10296049 Ga0105239_102960491 387
1296 3300010375 Ga0105239_10315092 Ga0105239_103150921 387
1297 3300011119 Ga0105246_10179428 Ga0105246_101794281 387
1298 3300013100 Ga0157373_10139260 Ga0157373_101392601 387
1299 3300013105 Ga0157369_10194162 Ga0157369_101941622 387
1300 3300013296 Ga0157374_10226799 Ga0157374_102267991 387
1301 3300013306 Ga0163162_10259820 Ga0163162_102598201 387
1302 3300014326 Ga0157380_10346207 Ga0157380_103462071 387
1303 3300015261 Ga0182006_1037985 Ga0182006_10379851 387
1304 3300024227 Ga0228598_1016767 Ga0228598_10167671 387
1305 3300025315 Ga0207697_10057659 Ga0207697_100576591 387
1306 3300025321 Ga0207656_10018708 Ga0207656_100187082 387
1307 3300025885 Ga0207653_10010653 Ga0207653_100106532 387
1308 3300025898 Ga0207692_10087156 Ga0207692_100871561 387
1309 3300025905 Ga0207685_10090782 Ga0207685_100907821 387
1310 3300025906 Ga0207699_10038640 Ga0207699_100386402 387
1311 3300025911 Ga0207654_10134631 Ga0207654_101346311 387
1312 3300025915 Ga0207693_10050815 Ga0207693_100508152 387
1313 3300025915 Ga0207693_10054163 Ga0207693_100541632 387
1314 3300025916 Ga0207663_10162719 Ga0207663_101627191 387
1315 3300025921 Ga0207652_10191568 Ga0207652_101915682 387
1316 3300025922 Ga0207646_10085312 Ga0207646_100853123 387
1317 3300025924 Ga0207694_10167132 Ga0207694_101671321 387
1318 3300025928 Ga0207700_10061188 Ga0207700_100611882 387
1319 3300025928 Ga0207700_10084330 Ga0207700_100843301 387
1320 3300025929 Ga0207664_10184830 Ga0207664_101848301 387
1321 3300025931 Ga0207644_10155737 Ga0207644_101557371 387
1322 3300025931 Ga0207644_10199542 Ga0207644_101995421 387
1323 3300025936 Ga0207670_10176473 Ga0207670_101764731 387
1324 3300025939 Ga0207665_10105827 Ga0207665_101058272 387
1325 3300025941 Ga0207711_10265947 Ga0207711_102659471 387
1326 3300025942 Ga0207689_10280483 Ga0207689_102804831 387
1327 3300025944 Ga0207661_10144957 Ga0207661_101449572 387
1328 3300025945 Ga0207679_10224435 Ga0207679_102244351 387
1329 3300025949 Ga0207667_10293975 Ga0207667_102939751 387
1330 3300025960 Ga0207651_10236558 Ga0207651_102365581 387
1331 3300025981 Ga0207640_10126586 Ga0207640_101265862 387
1332 3300026023 Ga0207677_10180695 Ga0207677_101806951 387
1333 3300026023 Ga0207677_10217403 Ga0207677_102174031 387
1334 3300026075 Ga0207708_10151776 Ga0207708_101517762 387
1335 3300026078 Ga0207702_10257253 Ga0207702_102572531 387
1336 3300026095 Ga0207676_10158789 Ga0207676_101587892 387
1337 3300027312 Ga0209371_1014098 Ga0209371_10140982 387
1338 3300027907 Ga0207428_10172822 Ga0207428_101728221 387
1339 3300028794 Ga0307515_10159094 Ga0307515_101590941 387
1340 3300030500 Ga0268256_1015307 Ga0268256_10153071 387
1341 3300035112 Ga0373932_0022780 Ga0373932_0022780_423_1598 387
1342 3300035207 Ga0373942_0015044 Ga0373942_0015044_351_1526 387
1343 3300035691 Ga0373931_0029914 Ga0373931_0029914_1141_2316 387
1344 3300037471 Ga0395905_0245497 Ga0395905_0245497_377_1540 387
1345 3300039438 Ga0436360_1035749 Ga0436360_1035749_311_1477 387
1346 3300039447 Ga0436361_0020797 Ga0436361_0020797_154_1317 387
1347 3300039447 Ga0436361_0311593 Ga0436361_0311593_249_1415 387
1348 3300039447 Ga0436361_0544795 Ga0436361_0544795_230_1396 387
1349 3300041491 Ga0451833_1253448 Ga0451833_1253448_813_1976 387
1350 3300046506 Ga0495583_0026640 Ga0495583_0026640_1343_2575 387
1351 3300046506 Ga0495583_0083780 Ga0495583_0083780_28_1191 387
1352 3300046515 Ga0495620_0054010 Ga0495620_0054010_183_1346 387
1353 3300046518 Ga0495631_0047803 Ga0495631_0047803_110_1273 387
1354 3300046520 Ga0495637_0019012 Ga0495637_0019012_1740_2903 387
1355 3300046522 Ga0495643_0074231 Ga0495643_0074231_467_1699 387
1356 3300046533 Ga0495640_0162460 Ga0495640_0162460_237_1400 387
1357 3300046538 Ga0495609_0050774 Ga0495609_0050774_148_1311 387
1358 3300046542 Ga0495597_0055793 Ga0495597_0055793_113_1276 387
1359 3300046660 Ga0495625_0076778 Ga0495625_0076778_484_1647 387
1360 3300046674 Ga0495588_0012534 Ga0495588_0012534_2361_3524 387
1361 3300046809 Ga0495600_0062515 Ga0495600_0062515_387_1550 387
1362 3300046810 Ga0495660_0078778 Ga0495660_0078778_234_1397 387
1363 3300047472 Ga0495686_0098249 Ga0495686_0098249_519_1682 387
1364 3300048903 Ga0496100_0165211 Ga0496100_0165211_183_1358 387
1365 3300048905 Ga0496102_0297064 Ga0496102_0297064_331_1506 387
1366 3300048908 Ga0496105_0086155 Ga0496105_0086155_772_1950 387
1367 3300048908 Ga0496105_0183730 Ga0496105_0183730_295_1470 387
1368 3300048909 Ga0496106_0184404 Ga0496106_0184404_155_1330 387
1369 3300048910 Ga0496107_0140945 Ga0496107_0140945_351_1526 387
1370 3300048910 Ga0496107_0154013 Ga0496107_0154013_344_1519 387
1371 3300048911 Ga0496108_0193680 Ga0496108_0193680_261_1436 387
1372 3300048911 Ga0496108_0227953 Ga0496108_0227953_125_1300 387
1373 3300048912 Ga0496109_0176547 Ga0496109_0176547_206_1381 387
1374 3300048912 Ga0496109_0359981 Ga0496109_0359981_175_1350 387
1375 3300048913 Ga0496110_0216288 Ga0496110_0216288_433_1608 387
1376 3300048915 Ga0496112_0185062 Ga0496112_0185062_538_1713 387
1377 3300048915 Ga0496112_0228308 Ga0496112_0228308_121_1296 387
1378 3300048916 Ga0496113_0153181 Ga0496113_0153181_313_1488 387
1379 3300048917 Ga0496114_0211286 Ga0496114_0211286_173_1348 387
1380 3300048929 Ga0496126_0133142 Ga0496126_0133142_751_1914 387
1381 3300050511 nmdc:mga08y16_133291_c1 nmdc:mga08y16_133291_c1_490_1668 387
1382 3300050512 nmdc:mga0n895_285705_c1 nmdc:mga0n895_285705_c1_297_1472 387
1383 3300050512 nmdc:mga0n895_362978_c1 nmdc:mga0n895_362978_c1_25_1203 387
1384 3300050513 nmdc:mga0rr50_47412_c1 nmdc:mga0rr50_47412_c1_1827_3002 387
1385 3300050514 nmdc:mga08x19_89542_c1 nmdc:mga08x19_89542_c1_246_1421 387
1386 3300053077 Ga0495601_0192801 Ga0495601_0192801_14_1180 387
1387 3300053078 Ga0495612_0051706 Ga0495612_0051706_382_1557 387
1388 3300053079 Ga0500610_0072123 Ga0500610_0072123_339_1502 387
1389 3300053083 Ga0495655_0028530 Ga0495655_0028530_139_1317 387
1390 3300053088 Ga0500644_0054719 Ga0500644_0054719_87_1250 387
1391 3300053103 Ga0500555_002499 Ga0500555_002499_427_1590 387
1392 3300053104 Ga0500556_0004459 Ga0500556_0004459_2470_3633 387
1393 3300053117 Ga0500593_055703 Ga0500593_055703_261_1424 387
1394 3300053130 Ga0500642_0016575 Ga0500642_0016575_986_2149 387
1395 3300053131 Ga0500652_027022 Ga0500652_027022_706_1869 387
1396 3300053133 Ga0500655_007591 Ga0500655_007591_462_1625 387
1397 3300053134 Ga0500658_0059787 Ga0500658_0059787_94_1257 387
1398 3300053136 Ga0500559_0068892 Ga0500559_0068892_90_1259 387
1399 3300053139 Ga0500568_0000561 Ga0500568_0000561_22342_23508 387
1400 2162886006 SwRhRL3b_contig_901166 SwRhRL3b_0776.00001330 388
1401 2162886007 SwRhRL2b_contig_3722764 SwRhRL2b_0630.00007200 388
1402 3300001978 JGI24747J21853_1001542 JGI24747J21853_10015422 388
1403 3300001979 JGI24740J21852_10027188 JGI24740J21852_100271882 388
1404 3300001979 JGI24740J21852_10044782 JGI24740J21852_100447821 388
1405 3300001989 JGI24739J22299_10036364 JGI24739J22299_100363641 388
1406 3300002067 JGI24735J21928_10029427 JGI24735J21928_100294271 388
1407 3300002074 JGI24748J21848_1003907 JGI24748J21848_10039072 388
1408 3300002075 JGI24738J21930_10012844 JGI24738J21930_100128442 388
1409 3300002076 JGI24749J21850_1007154 JGI24749J21850_10071542 388
1410 3300002077 JGI24744J21845_10011910 JGI24744J21845_100119102 388
1411 3300002704 JGI25155J39150_1001521 JGI25155J39150_10015211 388
1412 3300002705 JGI25156J39149_1014887 JGI25156J39149_10148871 388
1413 3300002738 JGI25154J39366_1007017 JGI25154J39366_10070171 388
1414 3300002741 JGI25157J39369_1007435 JGI25157J39369_10074351 388
1415 3300003187 JGI25151J46595_10009973 JGI25151J46595_100099732 388
1416 3300003187 JGI25151J46595_10039500 JGI25151J46595_100395001 388
1417 3300003775 Ga0055524_1005219 Ga0055524_10052195 388
1418 3300005290 Ga0065712_10125824 Ga0065712_101258241 388
1419 3300005293 Ga0065715_10013205 Ga0065715_100132051 388
1420 3300005295 Ga0065707_10142377 Ga0065707_101423772 388
1421 3300005295 Ga0065707_10143099 Ga0065707_101430992 388
1422 3300005331 Ga0070670_100093751 Ga0070670_1000937513 388
1423 3300005333 Ga0070677_10041932 Ga0070677_100419323 388
1424 3300005336 Ga0070680_100161604 Ga0070680_1001616042 388
1425 3300005339 Ga0070660_100228539 Ga0070660_1002285392 388
1426 3300005340 Ga0070689_100167805 Ga0070689_1001678052 388
1427 3300005343 Ga0070687_100037081 Ga0070687_1000370813 388
1428 3300005343 Ga0070687_100118645 Ga0070687_1001186451 388
1429 3300005345 Ga0070692_10081430 Ga0070692_100814302 388
1430 3300005353 Ga0070669_100139391 Ga0070669_1001393913 388
1431 3300005406 Ga0070703_10026842 Ga0070703_100268421 388
1432 3300005406 Ga0070703_10030498 Ga0070703_100304981 388
1433 3300005434 Ga0070709_10113157 Ga0070709_101131571 388
1434 3300005435 Ga0070714_100124646 Ga0070714_1001246462 388
1435 3300005437 Ga0070710_10152923 Ga0070710_101529231 388
1436 3300005438 Ga0070701_10068120 Ga0070701_100681202 388
1437 3300005439 Ga0070711_100183368 Ga0070711_1001833681 388
1438 3300005444 Ga0070694_100070545 Ga0070694_1000705452 388
1439 3300005444 Ga0070694_100198382 Ga0070694_1001983821 388
1440 3300005455 Ga0070663_100150145 Ga0070663_1001501452 388
1441 3300005456 Ga0070678_100041137 Ga0070678_1000411374 388
1442 3300005457 Ga0070662_100167397 Ga0070662_1001673972 388
1443 3300005458 Ga0070681_10244983 Ga0070681_102449832 388
1444 3300005518 Ga0070699_100198739 Ga0070699_1001987392 388
1445 3300005518 Ga0070699_100250383 Ga0070699_1002503832 388
1446 3300005530 Ga0070679_100097033 Ga0070679_1000970334 388
1447 3300005535 Ga0070684_100140765 Ga0070684_1001407651 388
1448 3300005536 Ga0070697_100270405 Ga0070697_1002704052 388
1449 3300005539 Ga0068853_100244220 Ga0068853_1002442202 388
1450 3300005543 Ga0070672_100134215 Ga0070672_1001342153 388
1451 3300005544 Ga0070686_100109627 Ga0070686_1001096272 388
1452 3300005547 Ga0070693_100096992 Ga0070693_1000969922 388
1453 3300005549 Ga0070704_100188625 Ga0070704_1001886252 388
1454 3300005563 Ga0068855_100208482 Ga0068855_1002084823 388
1455 3300005564 Ga0070664_100063426 Ga0070664_1000634262 388
1456 3300005578 Ga0068854_100213748 Ga0068854_1002137482 388
1457 3300005615 Ga0070702_100119008 Ga0070702_1001190082 388
1458 3300005616 Ga0068852_100294680 Ga0068852_1002946801 388
1459 3300005617 Ga0068859_100458018 Ga0068859_1004580182 388
1460 3300005618 Ga0068864_100223167 Ga0068864_1002231672 388
1461 3300005719 Ga0068861_100069458 Ga0068861_1000694584 388
1462 3300005719 Ga0068861_100069897 Ga0068861_1000698972 388
1463 3300005840 Ga0068870_10123059 Ga0068870_101230591 388
1464 3300005842 Ga0068858_100246762 Ga0068858_1002467622 388
1465 3300005843 Ga0068860_100443086 Ga0068860_1004430861 388
1466 3300005844 Ga0068862_100155612 Ga0068862_1001556123 388
1467 3300006163 Ga0070715_10065874 Ga0070715_100658741 388
1468 3300006163 Ga0070715_10110393 Ga0070715_101103931 388
1469 3300006175 Ga0070712_100139273 Ga0070712_1001392732 388
1470 3300006177 Ga0075362_10027549 Ga0075362_100275492 388
1471 3300006195 Ga0075366_10098877 Ga0075366_100988772 388
1472 3300006237 Ga0097621_100236899 Ga0097621_1002368992 388
1473 3300006358 Ga0068871_100064536 Ga0068871_1000645364 388
1474 3300006852 Ga0075433_10168083 Ga0075433_101680831 388
1475 3300006871 Ga0075434_100247405 Ga0075434_1002474052 388
1476 3300006871 Ga0075434_100256741 Ga0075434_1002567412 388
1477 3300006881 Ga0068865_100234443 Ga0068865_1002344432 388
1478 3300006914 Ga0075436_100057442 Ga0075436_1000574422 388
1479 3300006931 Ga0097620_100458013 Ga0097620_1004580131 388
1480 3300007076 Ga0075435_100113724 Ga0075435_1001137243 388
1481 3300007265 Ga0099794_10055581 Ga0099794_100555812 388
1482 3300009036 Ga0105244_10067882 Ga0105244_100678822 388
1483 3300009092 Ga0105250_10036507 Ga0105250_100365072 388
1484 3300009093 Ga0105240_10318397 Ga0105240_103183972 388
1485 3300009098 Ga0105245_10224149 Ga0105245_102241492 388
1486 3300009101 Ga0105247_10124936 Ga0105247_101249362 388
1487 3300009147 Ga0114129_10256015 Ga0114129_102560152 388
1488 3300009174 Ga0105241_10177138 Ga0105241_101771382 388
1489 3300009174 Ga0105241_10200440 Ga0105241_102004402 388
1490 3300009174 Ga0105241_10259302 Ga0105241_102593022 388
1491 3300009553 Ga0105249_10362762 Ga0105249_103627622 388
1492 3300010159 Ga0099796_10043800 Ga0099796_100438001 388
1493 3300010375 Ga0105239_10447305 Ga0105239_104473051 388
1494 3300012477 Ga0157336_1000317 Ga0157336_10003172 388
1495 3300012507 Ga0157342_1001050 Ga0157342_10010502 388
1496 3300013102 Ga0157371_10135552 Ga0157371_101355522 388
1497 3300013297 Ga0157378_10226928 Ga0157378_102269282 388
1498 3300013306 Ga0163162_10287604 Ga0163162_102876042 388
1499 3300013307 Ga0157372_10439058 Ga0157372_104390581 388
1500 3300013308 Ga0157375_10287252 Ga0157375_102872521 388
1501 3300014325 Ga0163163_10346828 Ga0163163_103468282 388
1502 3300014969 Ga0157376_10125198 Ga0157376_101251981 388
1503 3300014969 Ga0157376_10269995 Ga0157376_102699951 388
1504 3300017792 Ga0163161_10134010 Ga0163161_101340101 388
1505 3300021384 Ga0213876_10074413 Ga0213876_100744132 388
1506 3300021441 Ga0213871_10016699 Ga0213871_100166991 388
1507 3300024227 Ga0228598_1011746 Ga0228598_10117462 388
1508 3300025206 Ga0209435_104472 Ga0209435_1044721 388
1509 3300025223 Ga0207672_1001655 Ga0207672_10016552 388
1510 3300025246 Ga0209646_1009087 Ga0209646_10090871 388
1511 3300025250 Ga0209026_1011565 Ga0209026_10115651 388
1512 3300025256 Ga0209759_1019831 Ga0209759_10198311 388
1513 3300025273 Ga0209673_1002243 Ga0209673_10022434 388
1514 3300025294 Ga0209025_1000392 Ga0209025_100039265 388
1515 3300025295 Ga0209564_1000881 Ga0209564_100088134 388
1516 3300025299 Ga0209256_1000915 Ga0209256_100091513 388
1517 3300025315 Ga0207697_10050798 Ga0207697_100507981 388
1518 3300025711 Ga0207696_1030230 Ga0207696_10302301 388
1519 3300025885 Ga0207653_10026461 Ga0207653_100264612 388
1520 3300025885 Ga0207653_10040725 Ga0207653_100407252 388
1521 3300025893 Ga0207682_10012714 Ga0207682_100127143 388
1522 3300025898 Ga0207692_10017649 Ga0207692_100176492 388
1523 3300025899 Ga0207642_10036628 Ga0207642_100366283 388
1524 3300025900 Ga0207710_10078683 Ga0207710_100786831 388
1525 3300025901 Ga0207688_10063796 Ga0207688_100637962 388
1526 3300025904 Ga0207647_10042567 Ga0207647_100425672 388
1527 3300025905 Ga0207685_10025557 Ga0207685_100255572 388
1528 3300025906 Ga0207699_10026756 Ga0207699_100267562 388
1529 3300025907 Ga0207645_10121052 Ga0207645_101210522 388
1530 3300025908 Ga0207643_10115584 Ga0207643_101155841 388
1531 3300025911 Ga0207654_10076110 Ga0207654_100761101 388
1532 3300025911 Ga0207654_10127439 Ga0207654_101274391 388
1533 3300025913 Ga0207695_10238628 Ga0207695_102386281 388
1534 3300025914 Ga0207671_10183867 Ga0207671_101838671 388
1535 3300025915 Ga0207693_10224793 Ga0207693_102247931 388
1536 3300025916 Ga0207663_10089821 Ga0207663_100898212 388
1537 3300025916 Ga0207663_10169279 Ga0207663_101692791 388
1538 3300025916 Ga0207663_10171566 Ga0207663_101715661 388
1539 3300025918 Ga0207662_10098498 Ga0207662_100984982 388
1540 3300025918 Ga0207662_10106555 Ga0207662_101065552 388
1541 3300025919 Ga0207657_10065538 Ga0207657_100655382 388
1542 3300025921 Ga0207652_10103318 Ga0207652_101033182 388
1543 3300025923 Ga0207681_10160383 Ga0207681_101603831 388
1544 3300025925 Ga0207650_10197782 Ga0207650_101977822 388
1545 3300025927 Ga0207687_10195667 Ga0207687_101956671 388
1546 3300025929 Ga0207664_10210675 Ga0207664_102106752 388
1547 3300025931 Ga0207644_10103020 Ga0207644_101030202 388
1548 3300025932 Ga0207690_10194779 Ga0207690_101947792 388
1549 3300025933 Ga0207706_10119918 Ga0207706_101199181 388
1550 3300025933 Ga0207706_10167282 Ga0207706_101672822 388
1551 3300025933 Ga0207706_10243283 Ga0207706_102432831 388
1552 3300025934 Ga0207686_10030719 Ga0207686_100307192 388
1553 3300025935 Ga0207709_10121758 Ga0207709_101217582 388
1554 3300025936 Ga0207670_10165799 Ga0207670_101657992 388
1555 3300025936 Ga0207670_10242793 Ga0207670_102427931 388
1556 3300025937 Ga0207669_10077941 Ga0207669_100779412 388
1557 3300025938 Ga0207704_10119108 Ga0207704_101191082 388
1558 3300025939 Ga0207665_10140341 Ga0207665_101403412 388
1559 3300025939 Ga0207665_10174844 Ga0207665_101748441 388
1560 3300025940 Ga0207691_10196892 Ga0207691_101968922 388
1561 3300025942 Ga0207689_10176177 Ga0207689_101761772 388
1562 3300025945 Ga0207679_10099648 Ga0207679_100996482 388
1563 3300025960 Ga0207651_10183438 Ga0207651_101834382 388
1564 3300025961 Ga0207712_10136315 Ga0207712_101363152 388
1565 3300025972 Ga0207668_10156768 Ga0207668_101567682 388
1566 3300025981 Ga0207640_10143039 Ga0207640_101430392 388
1567 3300025986 Ga0207658_10040031 Ga0207658_100400313 388
1568 3300025986 Ga0207658_10172172 Ga0207658_101721722 388
1569 3300026035 Ga0207703_10251480 Ga0207703_102514801 388
1570 3300026041 Ga0207639_10174531 Ga0207639_101745312 388
1571 3300026067 Ga0207678_10191923 Ga0207678_101919232 388
1572 3300026067 Ga0207678_10241467 Ga0207678_102414672 388
1573 3300026075 Ga0207708_10138892 Ga0207708_101388923 388
1574 3300026075 Ga0207708_10139209 Ga0207708_101392092 388
1575 3300026078 Ga0207702_10253620 Ga0207702_102536201 388
1576 3300026088 Ga0207641_10244140 Ga0207641_102441402 388
1577 3300026089 Ga0207648_10201139 Ga0207648_102011392 388
1578 3300026089 Ga0207648_10205872 Ga0207648_102058722 388
1579 3300026095 Ga0207676_10274742 Ga0207676_102747421 388
1580 3300026118 Ga0207675_100034176 Ga0207675_1000341762 388
1581 3300026118 Ga0207675_100278435 Ga0207675_1002784352 388
1582 3300026121 Ga0207683_10070908 Ga0207683_100709081 388
1583 3300026121 Ga0207683_10206422 Ga0207683_102064222 388
1584 3300026142 Ga0207698_10203129 Ga0207698_102031292 388
1585 3300027671 Ga0209588_1017446 Ga0209588_10174462 388
1586 3300027671 Ga0209588_1020444 Ga0209588_10204441 388
1587 3300027671 Ga0209588_1032644 Ga0209588_10326442 388
1588 3300027671 Ga0209588_1038131 Ga0209588_10381311 388
1589 3300027907 Ga0207428_10026452 Ga0207428_100264523 388
1590 3300028380 Ga0268265_10192999 Ga0268265_101929992 388
1591 3300028380 Ga0268265_10344072 Ga0268265_103440721 388
1592 3300028381 Ga0268264_10190924 Ga0268264_101909243 388
1593 3300030878 Ga0265770_1004061 Ga0265770_10040612 388
1594 3300031090 Ga0265760_10018460 Ga0265760_100184601 388
1595 3300031995 Ga0307409_100217594 Ga0307409_1002175942 388
1596 3300034817 Ga0373948_0009227 Ga0373948_0009227_230_1396 388
1597 3300034820 Ga0373959_0004703 Ga0373959_0004703_700_1866 388
1598 3300035083 Ga0373926_0016744 Ga0373926_0016744_554_1720 388
1599 3300035083 Ga0373926_0020734 Ga0373926_0020734_721_1887 388
1600 3300035083 Ga0373926_0077649 Ga0373926_0077649_19_1197 388
1601 3300035084 Ga0373928_0008027 Ga0373928_0008027_498_1664 388
1602 3300035086 Ga0373934_0030330 Ga0373934_0030330_849_2015 388
1603 3300035089 Ga0373944_0005365 Ga0373944_0005365_1083_2249 388
1604 3300035092 Ga0373952_0010966 Ga0373952_0010966_254_1420 388
1605 3300035113 Ga0373936_0027383 Ga0373936_0027383_142_1308 388
1606 3300035118 Ga0373954_0028298 Ga0373954_0028298_1010_2176 388
1607 3300035118 Ga0373954_0045218 Ga0373954_0045218_59_1225 388
1608 3300035118 Ga0373954_0065893 Ga0373954_0065893_377_1555 388
1609 3300035120 Ga0373957_0017278 Ga0373957_0017278_1141_2307 388
1610 3300035121 Ga0373960_0017632 Ga0373960_0017632_124_1290 388
1611 3300035170 Ga0373943_0072817 Ga0373943_0072817_268_1434 388
1612 3300035170 Ga0373943_0081537 Ga0373943_0081537_186_1352 388
1613 3300035171 Ga0373946_0043629 Ga0373946_0043629_211_1377 388
1614 3300035172 Ga0373955_0021663 Ga0373955_0021663_709_1875 388
1615 3300035172 Ga0373955_0032469 Ga0373955_0032469_1549_2715 388
1616 3300035172 Ga0373955_0079850 Ga0373955_0079850_138_1316 388
1617 3300035172 Ga0373955_0139938 Ga0373955_0139938_147_1313 388
1618 3300035207 Ga0373942_0011164 Ga0373942_0011164_568_1734 388
1619 3300035410 Ga0373924_0029361 Ga0373924_0029361_832_1998 388
1620 3300035410 Ga0373924_0037828 Ga0373924_0037828_692_1858 388
1621 3300035691 Ga0373931_0072573 Ga0373931_0072573_560_1726 388
1622 3300035691 Ga0373931_0159674 Ga0373931_0159674_61_1227 388
1623 3300035692 Ga0373935_0067765 Ga0373935_0067765_96_1262 388
1624 3300035692 Ga0373935_0086944 Ga0373935_0086944_541_1707 388
1625 3300035692 Ga0373935_0101033 Ga0373935_0101033_310_1476 388
1626 3300035692 Ga0373935_0138088 Ga0373935_0138088_86_1252 388
1627 3300035692 Ga0373935_0157701 Ga0373935_0157701_126_1304 388
1628 3300035695 Ga0373927_0040745 Ga0373927_0040745_68_1234 388
1629 3300035695 Ga0373927_0054162 Ga0373927_0054162_482_1648 388
1630 3300035695 Ga0373927_0082080 Ga0373927_0082080_533_1711 388
1631 3300035695 Ga0373927_0119960 Ga0373927_0119960_310_1476 388
1632 3300035695 Ga0373927_0127744 Ga0373927_0127744_400_1566 388
1633 3300035724 Ga0373933_0042382 Ga0373933_0042382_59_1225 388
1634 3300035724 Ga0373933_0121273 Ga0373933_0121273_350_1528 388
1635 3300035724 Ga0373933_0123095 Ga0373933_0123095_204_1370 388
1636 3300035725 Ga0373947_0152412 Ga0373947_0152412_89_1255 388
1637 3300035725 Ga0373947_0205775 Ga0373947_0205775_77_1243 388
1638 3300036401 Ga0373937_0165521 Ga0373937_0165521_59_1225 388
1639 3300036401 Ga0373937_0208670 Ga0373937_0208670_410_1576 388
1640 3300036401 Ga0373937_0214034 Ga0373937_0214034_167_1345 388
1641 3300037068 Ga0373925_0113162 Ga0373925_0113162_193_1359 388
1642 3300037853 Ga0436364_0173979 Ga0436364_0173979_676_1842 388
1643 3300039437 Ga0436365_0053528 Ga0436365_0053528_1159_2325 388
1644 3300039437 Ga0436365_1132570 Ga0436365_1132570_969_2135 388
1645 3300039447 Ga0436361_0287361 Ga0436361_0287361_685_1860 388
1646 3300039453 Ga0436362_0495641 Ga0436362_0495641_502_1668 388
1647 3300041459 Ga0451800_1597933 Ga0451800_1597933_367_1533 388
1648 3300046452 Ga0495617_020661 Ga0495617_020661_388_1554 388
1649 3300046454 Ga0495592_0032949 Ga0495592_0032949_200_1366 388
1650 3300046454 Ga0495592_0124571 Ga0495592_0124571_466_1632 388
1651 3300046454 Ga0495592_0138165 Ga0495592_0138165_133_1311 388
1652 3300046455 Ga0495603_0070881 Ga0495603_0070881_511_1677 388
1653 3300046457 Ga0495590_0043222 Ga0495590_0043222_185_1351 388
1654 3300046458 Ga0495591_021310 Ga0495591_021310_238_1404 388
1655 3300046459 Ga0495629_0094978 Ga0495629_0094978_712_1878 388
1656 3300046459 Ga0495629_0137539 Ga0495629_0137539_160_1326 388
1657 3300046460 Ga0495638_0053533 Ga0495638_0053533_112_1278 388
1658 3300046461 Ga0495641_0026586 Ga0495641_0026586_283_1449 388
1659 3300046461 Ga0495641_0081876 Ga0495641_0081876_201_1367 388
1660 3300046462 Ga0495651_0064325 Ga0495651_0064325_1052_2218 388
1661 3300046463 Ga0495653_0078075 Ga0495653_0078075_1042_2208 388
1662 3300046463 Ga0495653_0122689 Ga0495653_0122689_429_1595 388
1663 3300046472 Ga0495580_0098794 Ga0495580_0098794_493_1659 388
1664 3300046472 Ga0495580_0141829 Ga0495580_0141829_326_1492 388
1665 3300046473 Ga0495582_0120740 Ga0495582_0120740_104_1270 388
1666 3300046474 Ga0495605_0050174 Ga0495605_0050174_187_1353 388
1667 3300046475 Ga0495639_0021368 Ga0495639_0021368_355_1521 388
1668 3300046475 Ga0495639_0045183 Ga0495639_0045183_316_1482 388
1669 3300046475 Ga0495639_0099888 Ga0495639_0099888_95_1261 388
1670 3300046477 Ga0495664_0042689 Ga0495664_0042689_98_1264 388
1671 3300046477 Ga0495664_0115512 Ga0495664_0115512_313_1491 388
1672 3300046492 Ga0495585_0047739 Ga0495585_0047739_291_1457 388
1673 3300046500 Ga0495596_0027703 Ga0495596_0027703_438_1604 388
1674 3300046501 Ga0495607_0071366 Ga0495607_0071366_109_1275 388
1675 3300046506 Ga0495583_0046408 Ga0495583_0046408_247_1413 388
1676 3300046511 Ga0495608_0075441 Ga0495608_0075441_200_1366 388
1677 3300046514 Ga0495618_0038568 Ga0495618_0038568_817_1983 388
1678 3300046514 Ga0495618_0120760 Ga0495618_0120760_264_1430 388
1679 3300046515 Ga0495620_0041819 Ga0495620_0041819_432_1598 388
1680 3300046516 Ga0495628_0172132 Ga0495628_0172132_261_1427 388
1681 3300046516 Ga0495628_0204555 Ga0495628_0204555_209_1387 388
1682 3300046516 Ga0495628_0240164 Ga0495628_0240164_33_1199 388
1683 3300046517 Ga0495630_0037826 Ga0495630_0037826_2007_3173 388
1684 3300046517 Ga0495630_0125223 Ga0495630_0125223_640_1806 388
1685 3300046517 Ga0495630_0167475 Ga0495630_0167475_72_1250 388
1686 3300046517 Ga0495630_0184487 Ga0495630_0184487_334_1500 388
1687 3300046517 Ga0495630_0255975 Ga0495630_0255975_77_1243 388
1688 3300046518 Ga0495631_0025174 Ga0495631_0025174_897_2063 388
1689 3300046520 Ga0495637_0021558 Ga0495637_0021558_365_1534 388
1690 3300046520 Ga0495637_0061368 Ga0495637_0061368_101_1267 388
1691 3300046523 Ga0495644_0024142 Ga0495644_0024142_903_2069 388
1692 3300046523 Ga0495644_0057439 Ga0495644_0057439_116_1282 388
1693 3300046525 Ga0495663_0007708 Ga0495663_0007708_696_1862 388
1694 3300046525 Ga0495663_0049692 Ga0495663_0049692_69_1235 388
1695 3300046526 Ga0495666_0024174 Ga0495666_0024174_1137_2303 388
1696 3300046526 Ga0495666_0077035 Ga0495666_0077035_174_1340 388
1697 3300046526 Ga0495666_0091229 Ga0495666_0091229_222_1388 388
1698 3300046528 Ga0495642_0016786 Ga0495642_0016786_793_1959 388
1699 3300046529 Ga0495652_0113376 Ga0495652_0113376_640_1806 388
1700 3300046531 Ga0495665_0066720 Ga0495665_0066720_483_1649 388
1701 3300046531 Ga0495665_0096044 Ga0495665_0096044_99_1265 388
1702 3300046533 Ga0495640_0112676 Ga0495640_0112676_421_1599 388
1703 3300046535 Ga0495586_0055908 Ga0495586_0055908_255_1421 388
1704 3300046535 Ga0495586_0163804 Ga0495586_0163804_69_1235 388
1705 3300046536 Ga0495587_0028844 Ga0495587_0028844_1304_2470 388
1706 3300046537 Ga0495598_0006567 Ga0495598_0006567_687_1853 388
1707 3300046537 Ga0495598_0010983 Ga0495598_0010983_345_1517 388
1708 3300046537 Ga0495598_0021165 Ga0495598_0021165_326_1492 388
1709 3300046538 Ga0495609_0034776 Ga0495609_0034776_873_2039 388
1710 3300046539 Ga0495621_0014913 Ga0495621_0014913_381_1547 388
1711 3300046542 Ga0495597_0056454 Ga0495597_0056454_352_1521 388
1712 3300046543 Ga0495645_0082066 Ga0495645_0082066_99_1265 388
1713 3300046543 Ga0495645_0139957 Ga0495645_0139957_342_1508 388
1714 3300046543 Ga0495645_0142999 Ga0495645_0142999_302_1480 388
1715 3300046558 Ga0495633_0047004 Ga0495633_0047004_343_1509 388
1716 3300046558 Ga0495633_0059276 Ga0495633_0059276_562_1728 388
1717 3300046559 Ga0495667_0023192 Ga0495667_0023192_1052_2218 388
1718 3300046559 Ga0495667_0066165 Ga0495667_0066165_1082_2260 388
1719 3300046559 Ga0495667_0147364 Ga0495667_0147364_180_1346 388
1720 3300046615 Ga0495656_0010174 Ga0495656_0010174_1290_2456 388
1721 3300046615 Ga0495656_0084358 Ga0495656_0084358_28_1200 388
1722 3300046616 Ga0495668_0030783 Ga0495668_0030783_974_2140 388
1723 3300046642 Ga0495634_0070562 Ga0495634_0070562_344_1510 388
1724 3300046642 Ga0495634_0070983 Ga0495634_0070983_195_1361 388
1725 3300046648 Ga0495611_0025038 Ga0495611_0025038_762_1928 388
1726 3300046660 Ga0495625_0112239 Ga0495625_0112239_343_1509 388
1727 3300046663 Ga0495635_0124412 Ga0495635_0124412_391_1557 388
1728 3300046664 Ga0495659_0022665 Ga0495659_0022665_400_1566 388
1729 3300046664 Ga0495659_0044293 Ga0495659_0044293_110_1276 388
1730 3300046665 Ga0495661_0065872 Ga0495661_0065872_205_1371 388
1731 3300046674 Ga0495588_0035234 Ga0495588_0035234_998_2164 388
1732 3300046674 Ga0495588_0065820 Ga0495588_0065820_672_1838 388
1733 3300046675 Ga0495657_0047518 Ga0495657_0047518_1401_2567 388
1734 3300046675 Ga0495657_0131603 Ga0495657_0131603_60_1226 388
1735 3300046679 Ga0495623_0055331 Ga0495623_0055331_284_1450 388
1736 3300046679 Ga0495623_0107867 Ga0495623_0107867_434_1600 388
1737 3300046680 Ga0495646_0018299 Ga0495646_0018299_1767_2933 388
1738 3300046680 Ga0495646_0086273 Ga0495646_0086273_308_1474 388
1739 3300046681 Ga0495647_0022723 Ga0495647_0022723_174_1340 388
1740 3300046681 Ga0495647_0042393 Ga0495647_0042393_201_1367 388
1741 3300046683 Ga0495658_0069053 Ga0495658_0069053_730_1896 388
1742 3300046684 Ga0495669_0026871 Ga0495669_0026871_69_1235 388
1743 3300046684 Ga0495669_0033308 Ga0495669_0033308_954_2120 388
1744 3300046689 Ga0495613_0055351 Ga0495613_0055351_390_1556 388
1745 3300046689 Ga0495613_0134243 Ga0495613_0134243_407_1573 388
1746 3300046690 Ga0495624_0106133 Ga0495624_0106133_484_1650 388
1747 3300046690 Ga0495624_0106223 Ga0495624_0106223_174_1340 388
1748 3300046691 Ga0495670_0075631 Ga0495670_0075631_475_1641 388
1749 3300046692 Ga0495671_0096186 Ga0495671_0096186_38_1207 388
1750 3300046694 Ga0495649_0052787 Ga0495649_0052787_81_1250 388
1751 3300046694 Ga0495649_0070073 Ga0495649_0070073_287_1453 388
1752 3300046809 Ga0495600_0043926 Ga0495600_0043926_1399_2565 388
1753 3300046810 Ga0495660_0034715 Ga0495660_0034715_1508_2674 388
1754 3300047315 Ga0495581_0115315 Ga0495581_0115315_189_1355 388
1755 3300047317 Ga0495604_0108434 Ga0495604_0108434_215_1381 388
1756 3300047317 Ga0495604_0110504 Ga0495604_0110504_636_1802 388
1757 3300047319 Ga0495674_0166826 Ga0495674_0166826_202_1368 388
1758 3300047319 Ga0495674_0176094 Ga0495674_0176094_461_1627 388
1759 3300047319 Ga0495674_0181556 Ga0495674_0181556_191_1357 388
1760 3300047319 Ga0495674_0222809 Ga0495674_0222809_72_1250 388
1761 3300047320 Ga0495672_0107676 Ga0495672_0107676_231_1397 388
1762 3300047321 Ga0495676_0079335 Ga0495676_0079335_104_1270 388
1763 3300047321 Ga0495676_0094852 Ga0495676_0094852_201_1367 388
1764 3300047321 Ga0495676_0109212 Ga0495676_0109212_49_1215 388
1765 3300047321 Ga0495676_0120372 Ga0495676_0120372_297_1463 388
1766 3300047322 Ga0495680_0142090 Ga0495680_0142090_196_1362 388
1767 3300047322 Ga0495680_0180807 Ga0495680_0180807_219_1397 388
1768 3300047444 Ga0495675_0024019 Ga0495675_0024019_1048_2214 388
1769 3300047445 Ga0495677_0043066 Ga0495677_0043066_366_1532 388
1770 3300047446 Ga0495679_040661 Ga0495679_040661_25_1191 388
1771 3300047447 Ga0495685_012989 Ga0495685_012989_763_1929 388
1772 3300047447 Ga0495685_034146 Ga0495685_034146_173_1339 388
1773 3300047469 Ga0495673_0037896 Ga0495673_0037896_820_1986 388
1774 3300047471 Ga0495684_0044248 Ga0495684_0044248_1371_2537 388
1775 3300047471 Ga0495684_0147549 Ga0495684_0147549_180_1346 388
1776 3300047673 Ga0495593_0080124 Ga0495593_0080124_429_1595 388
1777 3300048088 Ga0495602_0099892 Ga0495602_0099892_1028_2194 388
1778 3300048088 Ga0495602_0145383 Ga0495602_0145383_413_1579 388
1779 3300048090 Ga0495615_0005598 Ga0495615_0005598_691_1857 388
1780 3300048903 Ga0496100_0139096 Ga0496100_0139096_201_1367 388
1781 3300048905 Ga0496102_0231910 Ga0496102_0231910_390_1556 388
1782 3300048907 Ga0496104_0000056 Ga0496104_0000056_11870_13036 388
1783 3300048907 Ga0496104_0036995 Ga0496104_0036995_170_1336 388
1784 3300048907 Ga0496104_0247250 Ga0496104_0247250_399_1565 388
1785 3300048908 Ga0496105_0000036 Ga0496105_0000036_42_1208 388
1786 3300048910 Ga0496107_0100574 Ga0496107_0100574_512_1678 388
1787 3300048911 Ga0496108_0200568 Ga0496108_0200568_185_1351 388
1788 3300048911 Ga0496108_0228256 Ga0496108_0228256_261_1427 388
1789 3300048912 Ga0496109_0039786 Ga0496109_0039786_1214_2380 388
1790 3300048912 Ga0496109_0331669 Ga0496109_0331669_177_1343 388
1791 3300048913 Ga0496110_0192969 Ga0496110_0192969_279_1445 388
1792 3300048913 Ga0496110_0219092 Ga0496110_0219092_163_1329 388
1793 3300048914 Ga0496111_0144157 Ga0496111_0144157_176_1342 388
1794 3300048914 Ga0496111_0171762 Ga0496111_0171762_97_1263 388
1795 3300048914 Ga0496111_0207864 Ga0496111_0207864_99_1265 388
1796 3300048915 Ga0496112_0001860 Ga0496112_0001860_1630_2796 388
1797 3300048915 Ga0496112_0015616 Ga0496112_0015616_5486_6652 388
1798 3300048915 Ga0496112_0240417 Ga0496112_0240417_424_1590 388
1799 3300048916 Ga0496113_0170895 Ga0496113_0170895_396_1562 388
1800 3300048917 Ga0496114_0223390 Ga0496114_0223390_287_1453 388
1801 3300048918 Ga0496115_0220924 Ga0496115_0220924_239_1405 388
1802 3300049571 Ga0501034_0063775 Ga0501034_0063775_500_1666 388
1803 3300049572 Ga0501036_0160018 Ga0501036_0160018_233_1399 388
1804 3300049575 Ga0501039_0155644 Ga0501039_0155644_176_1342 388
1805 3300049586 Ga0501070_0200717 Ga0501070_0200717_46_1212 388
1806 3300049822 Ga0501035_0160049 Ga0501035_0160049_500_1666 388
1807 3300050489 nmdc:mga03683_55366_c1 nmdc:mga03683_55366_c1_402_1568 388
1808 3300050494 nmdc:mga06z11_247_c1 nmdc:mga06z11_247_c1_192_1370 388
1809 3300050507 nmdc:mga05p37_343559_c1 nmdc:mga05p37_343559_c1_421_1587 388
1810 3300050512 nmdc:mga0n895_189659_c1 nmdc:mga0n895_189659_c1_354_1520 388
1811 3300050512 nmdc:mga0n895_250694_c1 nmdc:mga0n895_250694_c1_501_1667 388
1812 3300050513 nmdc:mga0rr50_279023_c1 nmdc:mga0rr50_279023_c1_16_1182 388
1813 3300050513 nmdc:mga0rr50_57695_c1 nmdc:mga0rr50_57695_c1_750_1916 388
1814 3300050514 nmdc:mga08x19_122370_c1 nmdc:mga08x19_122370_c1_511_1677 388
1815 3300050515 nmdc:mga0a205_236004_c1 nmdc:mga0a205_236004_c1_123_1289 388
1816 3300050515 nmdc:mga0a205_260119_c1 nmdc:mga0a205_260119_c1_294_1460 388
1817 3300053077 Ga0495601_0077303 Ga0495601_0077303_585_1763 388
1818 3300053078 Ga0495612_0027175 Ga0495612_0027175_253_1419 388
1819 3300053078 Ga0495612_0042479 Ga0495612_0042479_178_1344 388
1820 3300053078 Ga0495612_0063520 Ga0495612_0063520_189_1355 388
1821 3300053079 Ga0500610_0081606 Ga0500610_0081606_338_1507 388
1822 3300053083 Ga0495655_0002509 Ga0495655_0002509_676_1842 388
1823 3300053085 Ga0495619_0091761 Ga0495619_0091761_59_1225 388
1824 3300053085 Ga0495619_0163763 Ga0495619_0163763_174_1340 388
1825 3300053123 Ga0500614_006583 Ga0500614_006583_1076_2254 388
1826 3300053130 Ga0500642_0014056 Ga0500642_0014056_1057_2226 388

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02371

Transposase_20

Transposase IS116/IS110/IS902 family

311

393

0.93

PF01548

DEDD_Tnp_IS110

Transposase

89

239

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gvc-assembly1.cif.gz_B crystal structure of flavin-containing monooxygenase (fmo)from s.pombe and substrate (methimazole) complex 0.7197 21 49
4n2z-assembly1.cif.gz_A crystal structure of the alpha-l-arabinofuranosidase paabf62a from podospora anserina in complex with cellotriose 0.7027 23 51
6uj5-assembly1.cif.gz_B crystal structure of cab1 pantothenate kinase from saccharomyces cerevisiae 0.6795 21 111
7t1h-assembly1.cif.gz_B crystal structure of cab1 pantothenate kinase from saccharomyces cerevisiae in complex with compound yu281445 0.673 20 111
2csu-assembly1.cif.gz_B crystal structure of ph0766 from pyrococcus horikoshii ot3 0.6611 68 103
ID Description Score Start End Superfamily
3ebgA01 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.7661 19 37 2.60.40.1730
af_Q9CX34_135_247_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7399 23 51 2.60.40.790
af_Q5SPH3_283_512_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7266 24 50 3.50.50.60
af_Q9VCC0_206_319_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7105 23 51 2.60.40.790
af_P71924_1_167_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6922 113 248 1.10.287.1490
ID Description Score Start End GO Terms
AF-A0A2V4YDB0-F1-model_v4 deleted 0.9754 260 388
AF-A0A2V4YDB0-F1-model_v4 deleted 0.9607 260 388
AF-A0A1I3WLR7-F1-model_v4 Transposase 0.9584 15 83
AF-A0A450Z0S6-F1-model_v4 Transposase IS116/IS110/IS902 family protein 0.9466 258 388 GO:0003677
GO:0004803
GO:0006313
AF-A0A450Y443-F1-model_v4 Transposase IS116/IS110/IS902 family protein 0.9417 256 388 GO:0003677
GO:0004803
GO:0006313

Feature Viewer

pLDDT pTM Quality
86.03 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map