F495813
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1826 | 665 | 1691 | 383 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10296049|Ga0105239_102960491 |
| Length | 445 |
| Sequence | MASNPRIVRRAVWKDWKPPIRGIGRLTRKILWAFGWRPALQKSEVADAPTLEPTMLNDAPLPAQAAIRTDLGAIFVSMELSRRTWLITSLSPGAGEKMSKHSVPASDVPGLLHRFAELKRKAAARSGRDFPIIVIQEAGLDGFWIHRVLQSEGIESHVVDPASILTSRRARRAKTDRIDGETLVRTLMAFKRGEPRVCSMARAPTPQEEDRRRVCRERRILVGERVRHVNRIKGLLFAQGIFGYEPLRKCRRERLEDLRTGDGRPLPVHLKAQIIRELDRLELVLAQLKAVAAERDTLLKTASDEMPAPPAMLVQLKGIGPEIAAVLWSEGLFRRFDNRRQVAAYAGLAPTPWQSGSIDHEQGVSKAGNPRLRTTMVELAWLWLRNQPTSALSLWFHERVQSLSGRMRKTIIVALARKLLVALWRYMTAGVVIEGAVMKPASATI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 4 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 5 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 6 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 7 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 8 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 9 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 10 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 11 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 12 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 13 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 14 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 15 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 16 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 17 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 18 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 19 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 20 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 21 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 22 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 23 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 24 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 25 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 26 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 27 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 28 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 29 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 30 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 31 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 32 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 33 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 34 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 35 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 36 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 37 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 38 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 39 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 40 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 41 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 42 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 43 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 44 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 45 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 46 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 47 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 48 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 49 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 50 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 51 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 52 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 53 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 54 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 55 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 56 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 57 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 58 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 59 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 60 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 61 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 62 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 63 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 64 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 65 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 66 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 67 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 68 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 69 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 70 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 71 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 72 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 73 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 74 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 75 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 76 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 77 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 78 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 79 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 80 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 81 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 82 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 83 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 84 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 85 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 86 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 87 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 88 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 89 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 90 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 91 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 92 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 93 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 94 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 95 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 96 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 97 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 98 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 99 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 100 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 101 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 102 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 103 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 104 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 105 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 106 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 107 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 108 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 109 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 110 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 111 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 112 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 113 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 114 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 115 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 116 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 117 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 118 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 119 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 120 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 121 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 122 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 123 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 124 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 125 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 126 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 127 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 128 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 129 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 130 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 131 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 132 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 133 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 134 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 135 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 136 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 137 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 140 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 141 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 144 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 146 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 147 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 148 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 150 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 151 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 152 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 154 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 161 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 164 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 165 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 167 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 168 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 169 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 172 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 173 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 178 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 179 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 180 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 181 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 182 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 183 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 185 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 186 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 187 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 188 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 190 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 191 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 195 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 196 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 198 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 199 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 200 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 202 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 203 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 204 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 205 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 206 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 207 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 208 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 209 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 210 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 211 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 212 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 213 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 214 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 215 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 216 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 218 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 219 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 220 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 221 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 222 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 223 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 224 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 225 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 226 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 228 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 229 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 230 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 231 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 232 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 233 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 234 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 235 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 236 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 237 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 239 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 240 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 241 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 242 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 244 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 245 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 247 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 248 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 251 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 252 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 253 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 254 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 255 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 256 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 257 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 258 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 259 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 260 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 261 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 262 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 263 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 264 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 265 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 266 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 267 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 268 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 269 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 270 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 271 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 272 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 273 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 274 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 275 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 276 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 277 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 278 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 279 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 280 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 281 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 282 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 283 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 284 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 285 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 286 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 287 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 288 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 289 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 291 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 292 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 293 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 294 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 295 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 296 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 297 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 298 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 299 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 300 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 366 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 370 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 374 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 375 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 376 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 380 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 381 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 382 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 383 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 384 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 385 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 386 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 387 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 388 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 389 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 390 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 391 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 392 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 393 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 394 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 395 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 396 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 397 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 398 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 399 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 400 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 401 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 402 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 403 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 404 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 405 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 406 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 407 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 408 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 409 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 410 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 411 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 412 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 413 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 414 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 415 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 416 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 417 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 418 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 419 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 420 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 421 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 422 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 423 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 424 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 425 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 426 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 427 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 428 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 429 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 430 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 431 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 432 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 433 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 434 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 435 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 436 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 437 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 438 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 439 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 440 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 441 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 442 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 443 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 444 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 445 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 446 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 447 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 448 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 449 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 450 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 451 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 452 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 453 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 454 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 550 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 551 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 552 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 553 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 554 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 555 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 556 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 557 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 558 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 559 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 560 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 561 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 562 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 563 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 564 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 565 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 566 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 567 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 568 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 569 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 570 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 571 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 572 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 573 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 574 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 576 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 577 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 578 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 579 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 580 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 581 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 582 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 583 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 584 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 585 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 586 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 587 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 588 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 589 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 590 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 591 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 592 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 593 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 594 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 595 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 596 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 597 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 598 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 599 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 600 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 601 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 602 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 603 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 604 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 605 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 606 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 607 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 608 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 609 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 610 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 611 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 612 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 613 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 614 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 615 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 616 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 617 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 618 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 619 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 620 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 621 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 624 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 625 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 629 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 630 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 631 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 632 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 633 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 634 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 635 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 636 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 637 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 638 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 639 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 640 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 641 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 642 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 643 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 644 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 645 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 646 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 647 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 648 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 649 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 650 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 651 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 652 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 653 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 654 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 655 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 656 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 657 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 658 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 659 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 660 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 661 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 662 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 663 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 664 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 665 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.44 |
| Metatranscriptomes | 0.16 |
| Isolates | 7.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.16 |
| Nodule | 5.42 |
| Rhizoplane | 3.89 |
| Rhizosphere | 81.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_901166 | 2162886006 | Bacteria | 1580 |
| 2 | SwRhRL2b_contig_3722764 | 2162886007 | Bacteria | 1637 |
| 3 | JGI24746J21847_1008261 | 3300001977 | Bacteria | 1574 |
| 4 | JGI24746J21847_1012047 | 3300001977 | Bacteria | 1267 |
| 5 | JGI24747J21853_1001542 | 3300001978 | Bacteria | 1746 |
| 6 | JGI24747J21853_1003876 | 3300001978 | Bacteria | 1311 |
| 7 | JGI24740J21852_10027188 | 3300001979 | Bacteria | 1906 |
| 8 | JGI24740J21852_10041322 | 3300001979 | Bacteria | 1390 |
| 9 | JGI24740J21852_10044782 | 3300001979 | Bacteria | 1310 |
| 10 | JGI24739J22299_10000445 | 3300001989 | Bacteria | 14396 |
| 11 | JGI24739J22299_10036364 | 3300001989 | Bacteria | 1664 |
| 12 | JGI24739J22299_10041017 | 3300001989 | Bacteria | 1542 |
| 13 | JGI24737J22298_10013530 | 3300001990 | Bacteria | 2655 |
| 14 | JGI24743J22301_10001747 | 3300001991 | Bacteria | 3111 |
| 15 | JGI24743J22301_10003049 | 3300001991 | Bacteria | 2605 |
| 16 | JGI24743J22301_10009186 | 3300001991 | Bacteria | 1748 |
| 17 | JGI24735J21928_10029427 | 3300002067 | Bacteria | 1635 |
| 18 | JGI24735J21928_10040336 | 3300002067 | Bacteria | 1363 |
| 19 | JGI24750J21931_1001808 | 3300002070 | Bacteria | 2608 |
| 20 | JGI24750J21931_1005003 | 3300002070 | Bacteria | 1621 |
| 21 | JGI24745J21846_1002341 | 3300002073 | Bacteria | 1928 |
| 22 | JGI24745J21846_1002996 | 3300002073 | Bacteria | 1751 |
| 23 | JGI24748J21848_1003907 | 3300002074 | Bacteria | 1707 |
| 24 | JGI24748J21848_1004181 | 3300002074 | Bacteria | 1653 |
| 25 | JGI24738J21930_10007082 | 3300002075 | Bacteria | 2604 |
| 26 | JGI24738J21930_10012844 | 3300002075 | Bacteria | 1823 |
| 27 | JGI24749J21850_1002463 | 3300002076 | Bacteria | 2604 |
| 28 | JGI24749J21850_1007154 | 3300002076 | Bacteria | 1552 |
| 29 | JGI24744J21845_10003722 | 3300002077 | Bacteria | 3147 |
| 30 | JGI24744J21845_10011910 | 3300002077 | Bacteria | 1771 |
| 31 | JGI24744J21845_10017976 | 3300002077 | Bacteria | 1403 |
| 32 | JGI24033J26618_1003691 | 3300002155 | Bacteria | 1624 |
| 33 | JGI24034J26672_10002224 | 3300002239 | Bacteria | 2644 |
| 34 | JGI24034J26672_10002409 | 3300002239 | Bacteria | 2572 |
| 35 | JGI24742J22300_10009063 | 3300002244 | Bacteria | 1641 |
| 36 | JGI25155J39150_1001521 | 3300002704 | Bacteria | 1581 |
| 37 | JGI25156J39149_1014887 | 3300002705 | Bacteria | 1581 |
| 38 | JGI25154J39366_1007017 | 3300002738 | Bacteria | 1581 |
| 39 | JGI25158J39367_1000017 | 3300002739 | Bacteria | 42066 |
| 40 | JGI25157J39369_1007435 | 3300002741 | Bacteria | 1581 |
| 41 | JGI25159J45721_1000239 | 3300002987 | Bacteria | 25945 |
| 42 | JGI25151J46595_10009973 | 3300003187 | Bacteria | 4453 |
| 43 | JGI25151J46595_10039500 | 3300003187 | Bacteria | 1741 |
| 44 | JGI25406J46586_10020029 | 3300003203 | Bacteria | 2715 |
| 45 | JGI25406J46586_10036361 | 3300003203 | Bacteria | 1787 |
| 46 | rootH1_10173562 | 3300003316 | Bacteria | 1389 |
| 47 | rootH1_10177097 | 3300003316 | Unclassified | 1394 |
| 48 | rootL2_10312573 | 3300003322 | Bacteria | 2133 |
| 49 | JGI25160J50197_1000513 | 3300003354 | Bacteria | 22892 |
| 50 | JGI25407J50210_10016431 | 3300003373 | Bacteria | 1917 |
| 51 | JGI25407J50210_10020924 | 3300003373 | Bacteria | 1701 |
| 52 | JGI25407J50210_10023927 | 3300003373 | Bacteria | 1586 |
| 53 | JGI25161J50226_1000102 | 3300003374 | Bacteria | 67971 |
| 54 | JGI25404J52841_10017148 | 3300003659 | Bacteria | 1570 |
| 55 | Ga0055524_1005219 | 3300003775 | Bacteria | 5843 |
| 56 | Ga0055524_1005861 | 3300003775 | Bacteria | 5421 |
| 57 | Ga0055540_1021203 | 3300003792 | Bacteria | 1695 |
| 58 | Ga0055540_1026271 | 3300003792 | Bacteria | 1411 |
| 59 | JGI25405J52794_10012956 | 3300003911 | Bacteria | 1611 |
| 60 | Ga0055543_1000016 | 3300004625 | Bacteria | 176117 |
| 61 | Ga0065165_1001457 | 3300005262 | Bacteria | 25562 |
| 62 | Ga0065714_10099650 | 3300005288 | Bacteria | 1682 |
| 63 | Ga0065704_10013137 | 3300005289 | Unclassified | 2378 |
| 64 | Ga0065704_10022000 | 3300005289 | Unclassified | 2134 |
| 65 | Ga0065712_10125824 | 3300005290 | Bacteria | 1609 |
| 66 | Ga0065715_10013205 | 3300005293 | Bacteria | 1911 |
| 67 | Ga0065715_10024588 | 3300005293 | Bacteria | 1449 |
| 68 | Ga0065707_10005105 | 3300005295 | Bacteria | 2954 |
| 69 | Ga0065707_10013210 | 3300005295 | Unclassified | 1636 |
| 70 | Ga0065707_10026835 | 3300005295 | Bacteria | 2425 |
| 71 | Ga0065707_10133766 | 3300005295 | Bacteria | 1871 |
| 72 | Ga0065707_10142377 | 3300005295 | Bacteria | 1756 |
| 73 | Ga0065707_10143099 | 3300005295 | Bacteria | 1747 |
| 74 | Ga0065707_10153706 | 3300005295 | Bacteria | 1631 |
| 75 | Ga0070658_10160378 | 3300005327 | Bacteria | 1886 |
| 76 | Ga0070676_10051561 | 3300005328 | Bacteria | 2416 |
| 77 | Ga0070676_10111479 | 3300005328 | Bacteria | 1704 |
| 78 | Ga0070683_100158682 | 3300005329 | Bacteria | 2145 |
| 79 | Ga0070683_100196421 | 3300005329 | Bacteria | 1916 |
| 80 | Ga0070683_100230827 | 3300005329 | Unclassified | 1759 |
| 81 | Ga0070690_100039305 | 3300005330 | Bacteria | 2989 |
| 82 | Ga0070690_100193583 | 3300005330 | Bacteria | 1411 |
| 83 | Ga0070670_100046887 | 3300005331 | Bacteria | 3717 |
| 84 | Ga0070670_100093751 | 3300005331 | Bacteria | 2582 |
| 85 | Ga0070670_100132265 | 3300005331 | Bacteria | 2155 |
| 86 | Ga0070670_100307627 | 3300005331 | Bacteria | 1387 |
| 87 | Ga0070677_10041932 | 3300005333 | Bacteria | 1809 |
| 88 | Ga0068869_100092415 | 3300005334 | Bacteria | 2277 |
| 89 | Ga0070666_10104035 | 3300005335 | Bacteria | 1959 |
| 90 | Ga0070666_10137316 | 3300005335 | Bacteria | 1702 |
| 91 | Ga0070666_10141490 | 3300005335 | Bacteria | 1676 |
| 92 | Ga0070680_100076817 | 3300005336 | Bacteria | 2750 |
| 93 | Ga0070680_100161604 | 3300005336 | Bacteria | 1882 |
| 94 | Ga0070682_100052096 | 3300005337 | Bacteria | 2560 |
| 95 | Ga0070682_100085558 | 3300005337 | Bacteria | 2051 |
| 96 | Ga0070682_100097005 | 3300005337 | Bacteria | 1939 |
| 97 | Ga0068868_100056503 | 3300005338 | Bacteria | 3099 |
| 98 | Ga0068868_100061274 | 3300005338 | Bacteria | 2980 |
| 99 | Ga0068868_100098812 | 3300005338 | Bacteria | 2360 |
| 100 | Ga0068868_100126253 | 3300005338 | Bacteria | 2090 |
| 101 | Ga0070660_100065696 | 3300005339 | Bacteria | 2823 |
| 102 | Ga0070660_100095957 | 3300005339 | Bacteria | 2344 |
| 103 | Ga0070660_100121771 | 3300005339 | Bacteria | 2082 |
| 104 | Ga0070660_100199812 | 3300005339 | Bacteria | 1621 |
| 105 | Ga0070660_100228539 | 3300005339 | Bacteria | 1513 |
| 106 | Ga0070689_100054700 | 3300005340 | Plasmid | 3090 |
| 107 | Ga0070689_100114354 | 3300005340 | Bacteria | 2150 |
| 108 | Ga0070689_100162589 | 3300005340 | Bacteria | 1805 |
| 109 | Ga0070689_100167805 | 3300005340 | Bacteria | 1777 |
| 110 | Ga0070689_100178328 | 3300005340 | Bacteria | 1724 |
| 111 | Ga0070691_10024936 | 3300005341 | Bacteria | 2782 |
| 112 | Ga0070691_10094421 | 3300005341 | Bacteria | 1478 |
| 113 | Ga0070687_100027481 | 3300005343 | Plasmid | 2750 |
| 114 | Ga0070687_100037081 | 3300005343 | Bacteria | 2434 |
| 115 | Ga0070687_100070198 | 3300005343 | Bacteria | 1878 |
| 116 | Ga0070687_100118645 | 3300005343 | Bacteria | 1509 |
| 117 | Ga0070661_100019619 | 3300005344 | Unclassified | 4818 |
| 118 | Ga0070661_100030428 | 3300005344 | Bacteria | 3900 |
| 119 | Ga0070661_100168746 | 3300005344 | Bacteria | 1661 |
| 120 | Ga0070692_10081101 | 3300005345 | Bacteria | 1747 |
| 121 | Ga0070692_10081430 | 3300005345 | Bacteria | 1744 |
| 122 | Ga0070668_100069633 | 3300005347 | Bacteria | 2737 |
| 123 | Ga0070668_100090504 | 3300005347 | Bacteria | 2411 |
| 124 | Ga0070668_100091334 | 3300005347 | Bacteria | 2400 |
| 125 | Ga0070668_100132943 | 3300005347 | Bacteria | 1998 |
| 126 | Ga0070668_100133316 | 3300005347 | Unclassified | 1995 |
| 127 | Ga0070669_100060312 | 3300005353 | Bacteria | 2787 |
| 128 | Ga0070669_100113286 | 3300005353 | Bacteria | 2060 |
| 129 | Ga0070669_100139391 | 3300005353 | Bacteria | 1868 |
| 130 | Ga0070675_100093991 | 3300005354 | Bacteria | 2515 |
| 131 | Ga0070671_100182528 | 3300005355 | Bacteria | 1777 |
| 132 | Ga0070671_100211370 | 3300005355 | Bacteria | 1645 |
| 133 | Ga0070671_100216550 | 3300005355 | Bacteria | 1625 |
| 134 | Ga0070674_100052849 | 3300005356 | Bacteria | 2803 |
| 135 | Ga0070674_100068515 | 3300005356 | Bacteria | 2500 |
| 136 | Ga0070674_100140269 | 3300005356 | Bacteria | 1813 |
| 137 | Ga0070674_100157563 | 3300005356 | Bacteria | 1719 |
| 138 | Ga0070673_100039577 | 3300005364 | Bacteria | 3609 |
| 139 | Ga0070673_100170657 | 3300005364 | Bacteria | 1856 |
| 140 | Ga0070688_100049876 | 3300005365 | Bacteria | 2606 |
| 141 | Ga0070688_100142056 | 3300005365 | Bacteria | 1632 |
| 142 | Ga0070688_100213407 | 3300005365 | Bacteria | 1356 |
| 143 | Ga0070659_100090289 | 3300005366 | Bacteria | 2455 |
| 144 | Ga0070667_100106704 | 3300005367 | Bacteria | 2424 |
| 145 | Ga0070703_10020473 | 3300005406 | Unclassified | 1925 |
| 146 | Ga0070703_10026842 | 3300005406 | Bacteria | 1713 |
| 147 | Ga0070703_10030498 | 3300005406 | Bacteria | 1624 |
| 148 | Ga0070709_10079394 | 3300005434 | Bacteria | 2137 |
| 149 | Ga0070709_10095920 | 3300005434 | Unclassified | 1965 |
| 150 | Ga0070709_10113157 | 3300005434 | Bacteria | 1827 |
| 151 | Ga0070709_10126851 | 3300005434 | Bacteria | 1737 |
| 152 | Ga0070714_100124646 | 3300005435 | Bacteria | 2295 |
| 153 | Ga0070714_100134109 | 3300005435 | Bacteria | 2215 |
| 154 | Ga0070714_100170228 | 3300005435 | Bacteria | 1976 |
| 155 | Ga0070714_100181083 | 3300005435 | Unclassified | 1917 |
| 156 | Ga0070714_100199214 | 3300005435 | Bacteria | 1831 |
| 157 | Ga0070713_100170128 | 3300005436 | Bacteria | 1951 |
| 158 | Ga0070713_100182758 | 3300005436 | Bacteria | 1885 |
| 159 | Ga0070713_100187871 | 3300005436 | Bacteria | 1860 |
| 160 | Ga0070713_100235794 | 3300005436 | Bacteria | 1665 |
| 161 | Ga0070710_10053386 | 3300005437 | Bacteria | 2276 |
| 162 | Ga0070710_10087246 | 3300005437 | Bacteria | 1833 |
| 163 | Ga0070710_10152923 | 3300005437 | Bacteria | 1424 |
| 164 | Ga0070701_10065497 | 3300005438 | Bacteria | 1928 |
| 165 | Ga0070701_10068120 | 3300005438 | Bacteria | 1895 |
| 166 | Ga0070701_10107151 | 3300005438 | Bacteria | 1556 |
| 167 | Ga0070711_100036660 | 3300005439 | Bacteria | 3286 |
| 168 | Ga0070711_100150655 | 3300005439 | Bacteria | 1753 |
| 169 | Ga0070711_100183368 | 3300005439 | Bacteria | 1603 |
| 170 | Ga0070711_100186894 | 3300005439 | Bacteria | 1589 |
| 171 | Ga0070705_100029518 | 3300005440 | Bacteria | 3018 |
| 172 | Ga0070705_100089861 | 3300005440 | Bacteria | 1910 |
| 173 | Ga0070705_100121711 | 3300005440 | Bacteria | 1686 |
| 174 | Ga0070700_100052392 | 3300005441 | Bacteria | 2544 |
| 175 | Ga0070700_100060121 | 3300005441 | Bacteria | 2394 |
| 176 | Ga0070700_100098785 | 3300005441 | Unclassified | 1919 |
| 177 | Ga0070700_100105665 | 3300005441 | Bacteria | 1862 |
| 178 | Ga0070700_100132409 | 3300005441 | Bacteria | 1684 |
| 179 | Ga0070700_100152800 | 3300005441 | Bacteria | 1580 |
| 180 | Ga0070700_100167191 | 3300005441 | Bacteria | 1520 |
| 181 | Ga0070694_100070545 | 3300005444 | Bacteria | 2406 |
| 182 | Ga0070694_100198382 | 3300005444 | Bacteria | 1494 |
| 183 | Ga0070708_100043267 | 3300005445 | Plasmid | 3956 |
| 184 | Ga0070708_100065075 | 3300005445 | Bacteria | 3268 |
| 185 | Ga0070708_100114882 | 3300005445 | Bacteria | 2477 |
| 186 | Ga0070708_100122022 | 3300005445 | Bacteria | 2405 |
| 187 | Ga0070708_100248458 | 3300005445 | Unclassified | 1671 |
| 188 | Ga0070663_100090232 | 3300005455 | Bacteria | 2269 |
| 189 | Ga0070663_100150145 | 3300005455 | Bacteria | 1786 |
| 190 | Ga0070663_100152263 | 3300005455 | Unclassified | 1774 |
| 191 | Ga0070663_100173340 | 3300005455 | Bacteria | 1669 |
| 192 | Ga0070678_100041137 | 3300005456 | Bacteria | 3274 |
| 193 | Ga0070678_100140384 | 3300005456 | Bacteria | 1932 |
| 194 | Ga0070678_100200651 | 3300005456 | Bacteria | 1646 |
| 195 | Ga0070678_100233602 | 3300005456 | Bacteria | 1534 |
| 196 | Ga0070678_100289976 | 3300005456 | Bacteria | 1387 |
| 197 | Ga0070662_100085487 | 3300005457 | Bacteria | 2357 |
| 198 | Ga0070662_100117232 | 3300005457 | Bacteria | 2036 |
| 199 | Ga0070662_100117374 | 3300005457 | Bacteria | 2035 |
| 200 | Ga0070662_100132161 | 3300005457 | Bacteria | 1925 |
| 201 | Ga0070662_100167397 | 3300005457 | Bacteria | 1723 |
| 202 | Ga0070681_10244983 | 3300005458 | Bacteria | 1705 |
| 203 | Ga0068867_100027947 | 3300005459 | Bacteria | 4058 |
| 204 | Ga0068867_100064341 | 3300005459 | Bacteria | 2726 |
| 205 | Ga0068867_100177894 | 3300005459 | Bacteria | 1689 |
| 206 | Ga0068867_100322214 | 3300005459 | Bacteria | 1281 |
| 207 | Ga0070685_10044018 | 3300005466 | Bacteria | 2554 |
| 208 | Ga0070706_100022952 | 3300005467 | Bacteria | 5746 |
| 209 | Ga0070706_100082644 | 3300005467 | Bacteria | 2975 |
| 210 | Ga0070706_100087796 | 3300005467 | Bacteria | 2883 |
| 211 | Ga0070706_100116852 | 3300005467 | Unclassified | 2484 |
| 212 | Ga0070706_100183782 | 3300005467 | Bacteria | 1953 |
| 213 | Ga0070706_100212671 | 3300005467 | Bacteria | 1805 |
| 214 | Ga0070706_100282702 | 3300005467 | Bacteria | 1548 |
| 215 | Ga0070707_100093518 | 3300005468 | Bacteria | 2911 |
| 216 | Ga0070707_100149799 | 3300005468 | Bacteria | 2271 |
| 217 | Ga0070707_100197891 | 3300005468 | Bacteria | 1959 |
| 218 | Ga0070707_100276087 | 3300005468 | Bacteria | 1634 |
| 219 | Ga0070698_100039155 | 3300005471 | Bacteria | 4881 |
| 220 | Ga0070698_100041662 | 3300005471 | Plasmid | 4714 |
| 221 | Ga0070698_100089376 | 3300005471 | Bacteria | 3064 |
| 222 | Ga0070698_100224098 | 3300005471 | Bacteria | 1813 |
| 223 | Ga0070698_100224479 | 3300005471 | Bacteria | 1812 |
| 224 | Ga0070698_100238024 | 3300005471 | Bacteria | 1754 |
| 225 | Ga0070698_100250645 | 3300005471 | Bacteria | 1703 |
| 226 | Ga0070699_100141087 | 3300005518 | Bacteria | 2128 |
| 227 | Ga0070699_100144774 | 3300005518 | Bacteria | 2099 |
| 228 | Ga0070699_100188767 | 3300005518 | Bacteria | 1830 |
| 229 | Ga0070699_100196855 | 3300005518 | Bacteria | 1791 |
| 230 | Ga0070699_100198739 | 3300005518 | Bacteria | 1782 |
| 231 | Ga0070699_100250383 | 3300005518 | Bacteria | 1582 |
| 232 | Ga0070679_100097033 | 3300005530 | Bacteria | 2935 |
| 233 | Ga0070679_100298246 | 3300005530 | Bacteria | 1562 |
| 234 | Ga0070684_100036812 | 3300005535 | Bacteria | 4194 |
| 235 | Ga0070684_100042691 | 3300005535 | Unclassified | 3916 |
| 236 | Ga0070684_100093032 | 3300005535 | Bacteria | 2683 |
| 237 | Ga0070684_100140765 | 3300005535 | Bacteria | 2182 |
| 238 | Ga0070684_100147199 | 3300005535 | Bacteria | 2132 |
| 239 | Ga0070684_100295794 | 3300005535 | Bacteria | 1485 |
| 240 | Ga0070697_100064431 | 3300005536 | Plasmid | 2993 |
| 241 | Ga0070697_100207462 | 3300005536 | Bacteria | 1667 |
| 242 | Ga0070697_100270405 | 3300005536 | Bacteria | 1457 |
| 243 | Ga0068853_100072271 | 3300005539 | Bacteria | 3006 |
| 244 | Ga0068853_100146627 | 3300005539 | Bacteria | 2121 |
| 245 | Ga0068853_100244220 | 3300005539 | Bacteria | 1646 |
| 246 | Ga0070672_100063166 | 3300005543 | Bacteria | 2924 |
| 247 | Ga0070672_100134215 | 3300005543 | Bacteria | 2037 |
| 248 | Ga0070672_100153541 | 3300005543 | Bacteria | 1906 |
| 249 | Ga0070686_100005670 | 3300005544 | Bacteria | 6916 |
| 250 | Ga0070686_100021748 | 3300005544 | Plasmid | 3818 |
| 251 | Ga0070686_100029194 | 3300005544 | Plasmid | 3352 |
| 252 | Ga0070686_100052466 | 3300005544 | Bacteria | 2600 |
| 253 | Ga0070686_100059901 | 3300005544 | Bacteria | 2454 |
| 254 | Ga0070686_100109627 | 3300005544 | Bacteria | 1878 |
| 255 | Ga0070686_100126765 | 3300005544 | Bacteria | 1760 |
| 256 | Ga0070695_100027876 | 3300005545 | Bacteria | 3502 |
| 257 | Ga0070695_100126396 | 3300005545 | Bacteria | 1756 |
| 258 | Ga0070696_100057457 | 3300005546 | Bacteria | 2716 |
| 259 | Ga0070696_100088711 | 3300005546 | Bacteria | 2199 |
| 260 | Ga0070693_100032304 | 3300005547 | Bacteria | 2877 |
| 261 | Ga0070693_100035389 | 3300005547 | Bacteria | 2769 |
| 262 | Ga0070693_100072847 | 3300005547 | Bacteria | 2027 |
| 263 | Ga0070693_100096992 | 3300005547 | Bacteria | 1788 |
| 264 | Ga0070693_100132237 | 3300005547 | Bacteria | 1561 |
| 265 | Ga0070665_100170538 | 3300005548 | Bacteria | 2177 |
| 266 | Ga0070665_100173567 | 3300005548 | Bacteria | 2156 |
| 267 | Ga0070665_100256282 | 3300005548 | Bacteria | 1750 |
| 268 | Ga0070665_100282284 | 3300005548 | Bacteria | 1662 |
| 269 | Ga0070704_100062100 | 3300005549 | Bacteria | 2677 |
| 270 | Ga0070704_100063790 | 3300005549 | Plasmid | 2645 |
| 271 | Ga0070704_100161089 | 3300005549 | Bacteria | 1774 |
| 272 | Ga0070704_100188625 | 3300005549 | Bacteria | 1655 |
| 273 | Ga0068855_100125369 | 3300005563 | Bacteria | 2937 |
| 274 | Ga0068855_100200293 | 3300005563 | Bacteria | 2248 |
| 275 | Ga0068855_100208482 | 3300005563 | Bacteria | 2197 |
| 276 | Ga0068855_100347677 | 3300005563 | Bacteria | 1634 |
| 277 | Ga0070664_100056268 | 3300005564 | Unclassified | 3342 |
| 278 | Ga0070664_100063426 | 3300005564 | Bacteria | 3151 |
| 279 | Ga0070664_100113082 | 3300005564 | Bacteria | 2371 |
| 280 | Ga0070664_100158082 | 3300005564 | Bacteria | 2004 |
| 281 | Ga0070664_100170704 | 3300005564 | Unclassified | 1929 |
| 282 | Ga0070664_100238007 | 3300005564 | Bacteria | 1633 |
| 283 | Ga0068857_100000670 | 3300005577 | Bacteria | 25389 |
| 284 | Ga0068857_100121975 | 3300005577 | Bacteria | 2347 |
| 285 | Ga0068857_100179001 | 3300005577 | Unclassified | 1929 |
| 286 | Ga0068857_100337153 | 3300005577 | Bacteria | 1395 |
| 287 | Ga0068854_100077788 | 3300005578 | Bacteria | 2442 |
| 288 | Ga0068854_100154959 | 3300005578 | Bacteria | 1769 |
| 289 | Ga0068854_100171959 | 3300005578 | Bacteria | 1686 |
| 290 | Ga0068854_100213748 | 3300005578 | Bacteria | 1522 |
| 291 | Ga0068856_100127785 | 3300005614 | Bacteria | 2545 |
| 292 | Ga0068856_100204652 | 3300005614 | Bacteria | 1988 |
| 293 | Ga0068856_100362757 | 3300005614 | Bacteria | 1467 |
| 294 | Ga0070702_100048757 | 3300005615 | Unclassified | 2412 |
| 295 | Ga0070702_100074057 | 3300005615 | Bacteria | 2019 |
| 296 | Ga0070702_100119008 | 3300005615 | Bacteria | 1650 |
| 297 | Ga0068852_100079887 | 3300005616 | Bacteria | 2898 |
| 298 | Ga0068852_100148474 | 3300005616 | Unclassified | 2177 |
| 299 | Ga0068852_100180404 | 3300005616 | Bacteria | 1985 |
| 300 | Ga0068852_100294680 | 3300005616 | Bacteria | 1568 |
| 301 | Ga0068859_100049640 | 3300005617 | Bacteria | 4214 |
| 302 | Ga0068859_100147472 | 3300005617 | Unclassified | 2428 |
| 303 | Ga0068859_100201378 | 3300005617 | Bacteria | 2075 |
| 304 | Ga0068859_100214114 | 3300005617 | Bacteria | 2014 |
| 305 | Ga0068859_100458018 | 3300005617 | Bacteria | 1371 |
| 306 | Ga0068864_100046780 | 3300005618 | Bacteria | 3714 |
| 307 | Ga0068864_100084529 | 3300005618 | Bacteria | 2788 |
| 308 | Ga0068864_100219732 | 3300005618 | Bacteria | 1753 |
| 309 | Ga0068864_100223167 | 3300005618 | Bacteria | 1739 |
| 310 | Ga0068864_100293770 | 3300005618 | Bacteria | 1519 |
| 311 | Ga0068866_10017550 | 3300005718 | Bacteria | 3220 |
| 312 | Ga0068866_10023944 | 3300005718 | Bacteria | 2846 |
| 313 | Ga0068866_10037987 | 3300005718 | Bacteria | 2368 |
| 314 | Ga0068861_100050731 | 3300005719 | Bacteria | 3147 |
| 315 | Ga0068861_100059763 | 3300005719 | Bacteria | 2919 |
| 316 | Ga0068861_100069458 | 3300005719 | Bacteria | 2725 |
| 317 | Ga0068861_100069897 | 3300005719 | Bacteria | 2717 |
| 318 | Ga0068861_100074288 | 3300005719 | Bacteria | 2643 |
| 319 | Ga0068861_100147153 | 3300005719 | Bacteria | 1929 |
| 320 | Ga0068861_100158170 | 3300005719 | Bacteria | 1866 |
| 321 | Ga0068851_10029329 | 3300005834 | Bacteria | 2723 |
| 322 | Ga0068851_10080757 | 3300005834 | Bacteria | 1698 |
| 323 | Ga0068870_10089223 | 3300005840 | Bacteria | 1720 |
| 324 | Ga0068870_10123059 | 3300005840 | Bacteria | 1497 |
| 325 | Ga0068863_100200631 | 3300005841 | Bacteria | 1919 |
| 326 | Ga0068863_100233521 | 3300005841 | Bacteria | 1774 |
| 327 | Ga0068863_100302161 | 3300005841 | Bacteria | 1553 |
| 328 | Ga0068863_100371986 | 3300005841 | Bacteria | 1395 |
| 329 | Ga0068858_100043420 | 3300005842 | Bacteria | 4168 |
| 330 | Ga0068858_100194365 | 3300005842 | Bacteria | 1917 |
| 331 | Ga0068858_100220666 | 3300005842 | Bacteria | 1795 |
| 332 | Ga0068858_100246762 | 3300005842 | Bacteria | 1695 |
| 333 | Ga0068858_100250383 | 3300005842 | Bacteria | 1683 |
| 334 | Ga0068858_100278195 | 3300005842 | Unclassified | 1593 |
| 335 | Ga0068858_100444856 | 3300005842 | Bacteria | 1248 |
| 336 | Ga0068860_100097671 | 3300005843 | Bacteria | 2800 |
| 337 | Ga0068860_100199421 | 3300005843 | Bacteria | 1939 |
| 338 | Ga0068860_100259413 | 3300005843 | Bacteria | 1694 |
| 339 | Ga0068860_100272084 | 3300005843 | Bacteria | 1653 |
| 340 | Ga0068860_100313241 | 3300005843 | Unclassified | 1539 |
| 341 | Ga0068860_100443086 | 3300005843 | Bacteria | 1290 |
| 342 | Ga0068862_100051072 | 3300005844 | Bacteria | 3536 |
| 343 | Ga0068862_100094868 | 3300005844 | Bacteria | 2602 |
| 344 | Ga0068862_100155612 | 3300005844 | Bacteria | 2037 |
| 345 | Ga0068862_100240574 | 3300005844 | Bacteria | 1646 |
| 346 | Ga0068862_100301795 | 3300005844 | Bacteria | 1473 |
| 347 | Ga0081455_10034693 | 3300005937 | Bacteria | 4517 |
| 348 | Ga0081455_10037468 | 3300005937 | Bacteria | 4306 |
| 349 | Ga0081455_10046581 | 3300005937 | Bacteria | 3760 |
| 350 | Ga0081455_10060963 | 3300005937 | Bacteria | 3177 |
| 351 | Ga0081455_10077244 | 3300005937 | Bacteria | 2740 |
| 352 | Ga0081455_10148560 | 3300005937 | Unclassified | 1809 |
| 353 | Ga0081538_10022883 | 3300005981 | Plasmid | 4510 |
| 354 | Ga0081538_10037462 | 3300005981 | Plasmid | 3145 |
| 355 | Ga0081538_10042022 | 3300005981 | Bacteria | 2891 |
| 356 | Ga0081538_10076313 | 3300005981 | Bacteria | 1812 |
| 357 | Ga0081540_1012755 | 3300005983 | Bacteria | 5504 |
| 358 | Ga0081540_1019794 | 3300005983 | Plasmid | 4075 |
| 359 | Ga0081540_1020402 | 3300005983 | Bacteria | 3987 |
| 360 | Ga0081540_1032803 | 3300005983 | Bacteria | 2829 |
| 361 | Ga0081539_10023650 | 3300005985 | Plasmid | 4017 |
| 362 | Ga0081539_10029182 | 3300005985 | Bacteria | 3453 |
| 363 | Ga0081539_10033365 | 3300005985 | Plasmid | 3136 |
| 364 | Ga0081539_10071648 | 3300005985 | Unclassified | 1855 |
| 365 | Ga0081539_10074538 | 3300005985 | Unclassified | 1807 |
| 366 | Ga0070717_10028590 | 3300006028 | Bacteria | 4464 |
| 367 | Ga0070717_10173475 | 3300006028 | Bacteria | 1876 |
| 368 | Ga0075365_10000237 | 3300006038 | Bacteria | 18850 |
| 369 | Ga0070715_10065874 | 3300006163 | Bacteria | 1604 |
| 370 | Ga0070715_10092648 | 3300006163 | Bacteria | 1393 |
| 371 | Ga0070715_10110393 | 3300006163 | Bacteria | 1296 |
| 372 | Ga0070716_100055988 | 3300006173 | Bacteria | 2259 |
| 373 | Ga0070716_100086094 | 3300006173 | Bacteria | 1889 |
| 374 | Ga0070712_100023822 | 3300006175 | Bacteria | 4048 |
| 375 | Ga0070712_100104009 | 3300006175 | Bacteria | 2106 |
| 376 | Ga0070712_100118513 | 3300006175 | Bacteria | 1988 |
| 377 | Ga0070712_100139273 | 3300006175 | Bacteria | 1849 |
| 378 | Ga0070712_100273002 | 3300006175 | Unclassified | 1359 |
| 379 | Ga0075362_10027549 | 3300006177 | Bacteria | 2434 |
| 380 | Ga0075367_10058594 | 3300006178 | Bacteria | 2292 |
| 381 | Ga0075367_10082312 | 3300006178 | Bacteria | 1949 |
| 382 | Ga0075369_10044288 | 3300006186 | Bacteria | 1911 |
| 383 | Ga0075427_10009009 | 3300006194 | Bacteria | 1483 |
| 384 | Ga0075366_10098877 | 3300006195 | Unclassified | 1750 |
| 385 | Ga0097621_100155150 | 3300006237 | Bacteria | 1965 |
| 386 | Ga0097621_100175799 | 3300006237 | Bacteria | 1848 |
| 387 | Ga0097621_100236899 | 3300006237 | Bacteria | 1594 |
| 388 | Ga0097621_100369276 | 3300006237 | Bacteria | 1280 |
| 389 | Ga0075370_10033927 | 3300006353 | Bacteria | 2860 |
| 390 | Ga0068871_100064536 | 3300006358 | Bacteria | 2998 |
| 391 | Ga0068871_100188192 | 3300006358 | Bacteria | 1777 |
| 392 | Ga0068871_100239595 | 3300006358 | Bacteria | 1577 |
| 393 | Ga0075428_100028486 | 3300006844 | Bacteria | 6180 |
| 394 | Ga0075428_100037503 | 3300006844 | Bacteria | 5336 |
| 395 | Ga0075428_100044076 | 3300006844 | Plasmid | 4903 |
| 396 | Ga0075428_100056233 | 3300006844 | Unclassified | 4310 |
| 397 | Ga0075428_100113539 | 3300006844 | Bacteria | 2951 |
| 398 | Ga0075428_100153628 | 3300006844 | Bacteria | 2500 |
| 399 | Ga0075428_100178206 | 3300006844 | Unclassified | 2301 |
| 400 | Ga0075428_100238891 | 3300006844 | Unclassified | 1960 |
| 401 | Ga0075428_100240881 | 3300006844 | Bacteria | 1951 |
| 402 | Ga0075428_100269056 | 3300006844 | Bacteria | 1834 |
| 403 | Ga0075430_100104083 | 3300006846 | Bacteria | 2369 |
| 404 | Ga0075430_100128178 | 3300006846 | Unclassified | 2115 |
| 405 | Ga0075430_100136375 | 3300006846 | Bacteria | 2044 |
| 406 | Ga0075430_100143877 | 3300006846 | Unclassified | 1986 |
| 407 | Ga0075430_100155888 | 3300006846 | Bacteria | 1901 |
| 408 | Ga0075430_100189928 | 3300006846 | Unclassified | 1707 |
| 409 | Ga0075431_100016082 | 3300006847 | Bacteria | 7592 |
| 410 | Ga0075431_100068694 | 3300006847 | Plasmid | 3656 |
| 411 | Ga0075431_100090552 | 3300006847 | Bacteria | 3157 |
| 412 | Ga0075431_100134752 | 3300006847 | Bacteria | 2546 |
| 413 | Ga0075431_100170922 | 3300006847 | Unclassified | 2233 |
| 414 | Ga0075431_100172878 | 3300006847 | Bacteria | 2220 |
| 415 | Ga0075431_100176238 | 3300006847 | Bacteria | 2196 |
| 416 | Ga0075431_100262655 | 3300006847 | Unclassified | 1752 |
| 417 | Ga0075431_100321829 | 3300006847 | Bacteria | 1559 |
| 418 | Ga0075431_100323032 | 3300006847 | Bacteria | 1556 |
| 419 | Ga0075431_100354974 | 3300006847 | Bacteria | 1473 |
| 420 | Ga0075433_10105382 | 3300006852 | Bacteria | 2498 |
| 421 | Ga0075433_10113421 | 3300006852 | Unclassified | 2404 |
| 422 | Ga0075433_10168083 | 3300006852 | Bacteria | 1952 |
| 423 | Ga0075433_10218347 | 3300006852 | Bacteria | 1694 |
| 424 | Ga0075434_100111690 | 3300006871 | Bacteria | 2744 |
| 425 | Ga0075434_100117323 | 3300006871 | Bacteria | 2674 |
| 426 | Ga0075434_100139403 | 3300006871 | Bacteria | 2444 |
| 427 | Ga0075434_100144371 | 3300006871 | Unclassified | 2400 |
| 428 | Ga0075434_100172584 | 3300006871 | Bacteria | 2182 |
| 429 | Ga0075434_100186892 | 3300006871 | Unclassified | 2092 |
| 430 | Ga0075434_100239939 | 3300006871 | Bacteria | 1833 |
| 431 | Ga0075434_100247405 | 3300006871 | Bacteria | 1802 |
| 432 | Ga0075434_100256741 | 3300006871 | Bacteria | 1766 |
| 433 | Ga0075429_100030455 | 3300006880 | Plasmid | 4688 |
| 434 | Ga0075429_100089551 | 3300006880 | Bacteria | 2682 |
| 435 | Ga0075429_100139350 | 3300006880 | Bacteria | 2123 |
| 436 | Ga0075429_100195909 | 3300006880 | Bacteria | 1770 |
| 437 | Ga0068865_100105700 | 3300006881 | Bacteria | 2068 |
| 438 | Ga0068865_100234443 | 3300006881 | Bacteria | 1441 |
| 439 | Ga0075436_100057442 | 3300006914 | Bacteria | 2688 |
| 440 | Ga0075436_100083840 | 3300006914 | Bacteria | 2212 |
| 441 | Ga0097620_100049638 | 3300006931 | Bacteria | 4214 |
| 442 | Ga0097620_100147457 | 3300006931 | Unclassified | 2428 |
| 443 | Ga0097620_100201376 | 3300006931 | Bacteria | 2075 |
| 444 | Ga0097620_100214115 | 3300006931 | Bacteria | 2014 |
| 445 | Ga0097620_100458013 | 3300006931 | Bacteria | 1371 |
| 446 | Ga0079104_1021380 | 3300006946 | Bacteria | 1762 |
| 447 | Ga0075435_100113724 | 3300007076 | Bacteria | 2253 |
| 448 | Ga0099794_10013814 | 3300007265 | Bacteria | 3523 |
| 449 | Ga0099794_10021704 | 3300007265 | Bacteria | 2920 |
| 450 | Ga0099794_10037080 | 3300007265 | Bacteria | 2307 |
| 451 | Ga0099794_10055581 | 3300007265 | Bacteria | 1913 |
| 452 | Ga0099794_10066185 | 3300007265 | Bacteria | 1763 |
| 453 | Ga0099795_10014397 | 3300007788 | Bacteria | 2452 |
| 454 | Ga0099795_10047541 | 3300007788 | Bacteria | 1551 |
| 455 | Ga0105244_10067882 | 3300009036 | Bacteria | 1783 |
| 456 | Ga0105250_10036507 | 3300009092 | Bacteria | 1972 |
| 457 | Ga0105240_10318397 | 3300009093 | Bacteria | 1774 |
| 458 | Ga0105240_10362693 | 3300009093 | Bacteria | 1641 |
| 459 | Ga0111539_10092223 | 3300009094 | Bacteria | 3559 |
| 460 | Ga0111539_10198932 | 3300009094 | Bacteria | 2337 |
| 461 | Ga0111539_10256727 | 3300009094 | Bacteria | 2035 |
| 462 | Ga0111539_10259598 | 3300009094 | Bacteria | 2023 |
| 463 | Ga0105245_10119969 | 3300009098 | Unclassified | 2455 |
| 464 | Ga0105245_10133327 | 3300009098 | Bacteria | 2332 |
| 465 | Ga0105245_10209572 | 3300009098 | Bacteria | 1875 |
| 466 | Ga0105245_10224149 | 3300009098 | Bacteria | 1815 |
| 467 | Ga0105245_10259206 | 3300009098 | Bacteria | 1692 |
| 468 | Ga0105245_10328610 | 3300009098 | Unclassified | 1508 |
| 469 | Ga0105245_10439836 | 3300009098 | Unclassified | 1310 |
| 470 | Ga0105247_10066308 | 3300009101 | Unclassified | 2248 |
| 471 | Ga0105247_10112449 | 3300009101 | Bacteria | 1754 |
| 472 | Ga0105247_10124936 | 3300009101 | Bacteria | 1671 |
| 473 | Ga0105247_10153492 | 3300009101 | Bacteria | 1519 |
| 474 | Ga0114129_10059733 | 3300009147 | Bacteria | 5330 |
| 475 | Ga0114129_10103518 | 3300009147 | Bacteria | 3936 |
| 476 | Ga0114129_10153380 | 3300009147 | Bacteria | 3152 |
| 477 | Ga0114129_10180619 | 3300009147 | Plasmid | 2871 |
| 478 | Ga0114129_10238572 | 3300009147 | Bacteria | 2445 |
| 479 | Ga0114129_10250180 | 3300009147 | Bacteria | 2379 |
| 480 | Ga0114129_10256015 | 3300009147 | Bacteria | 2348 |
| 481 | Ga0114129_10318742 | 3300009147 | Unclassified | 2067 |
| 482 | Ga0114129_10392504 | 3300009147 | Unclassified | 1830 |
| 483 | Ga0114129_10407221 | 3300009147 | Bacteria | 1792 |
| 484 | Ga0105243_10075494 | 3300009148 | Bacteria | 2736 |
| 485 | Ga0105243_10154633 | 3300009148 | Bacteria | 1971 |
| 486 | Ga0105243_10160804 | 3300009148 | Bacteria | 1936 |
| 487 | Ga0105241_10116136 | 3300009174 | Bacteria | 2149 |
| 488 | Ga0105241_10177138 | 3300009174 | Bacteria | 1766 |
| 489 | Ga0105241_10200440 | 3300009174 | Bacteria | 1667 |
| 490 | Ga0105241_10259302 | 3300009174 | Bacteria | 1477 |
| 491 | Ga0105242_10042694 | 3300009176 | Bacteria | 3664 |
| 492 | Ga0105242_10136604 | 3300009176 | Bacteria | 2123 |
| 493 | Ga0105248_10191085 | 3300009177 | Bacteria | 2307 |
| 494 | Ga0105248_10265291 | 3300009177 | Bacteria | 1933 |
| 495 | Ga0105237_10186964 | 3300009545 | Bacteria | 2072 |
| 496 | Ga0105237_10254204 | 3300009545 | Bacteria | 1759 |
| 497 | Ga0105237_10276888 | 3300009545 | Unclassified | 1680 |
| 498 | Ga0105238_10001089 | 3300009551 | Bacteria | 27423 |
| 499 | Ga0105238_10155951 | 3300009551 | Bacteria | 2258 |
| 500 | Ga0105238_10464613 | 3300009551 | Bacteria | 1263 |
| 501 | Ga0105249_10065134 | 3300009553 | Bacteria | 3352 |
| 502 | Ga0105249_10065964 | 3300009553 | Bacteria | 3332 |
| 503 | Ga0105249_10073156 | 3300009553 | Plasmid | 3170 |
| 504 | Ga0105249_10087969 | 3300009553 | Bacteria | 2900 |
| 505 | Ga0105249_10106865 | 3300009553 | Bacteria | 2641 |
| 506 | Ga0105249_10131083 | 3300009553 | Bacteria | 2393 |
| 507 | Ga0105249_10161943 | 3300009553 | Bacteria | 2163 |
| 508 | Ga0105249_10261650 | 3300009553 | Bacteria | 1719 |
| 509 | Ga0105249_10362762 | 3300009553 | Bacteria | 1471 |
| 510 | Ga0099796_10031997 | 3300010159 | Bacteria | 1720 |
| 511 | Ga0099796_10043800 | 3300010159 | Bacteria | 1526 |
| 512 | Ga0105239_10114091 | 3300010375 | Plasmid | 2997 |
| 513 | Ga0105239_10296049 | 3300010375 | Bacteria | 1822 |
| 514 | Ga0105239_10315092 | 3300010375 | Bacteria | 1763 |
| 515 | Ga0105239_10350117 | 3300010375 | Bacteria | 1668 |
| 516 | Ga0105239_10353954 | 3300010375 | Bacteria | 1658 |
| 517 | Ga0105239_10447305 | 3300010375 | Bacteria | 1465 |
| 518 | Ga0105246_10072021 | 3300011119 | Unclassified | 2435 |
| 519 | Ga0105246_10112013 | 3300011119 | Bacteria | 2006 |
| 520 | Ga0105246_10113782 | 3300011119 | Bacteria | 1993 |
| 521 | Ga0105246_10152185 | 3300011119 | Bacteria | 1752 |
| 522 | Ga0105246_10179428 | 3300011119 | Bacteria | 1629 |
| 523 | Ga0105246_10335028 | 3300011119 | Unclassified | 1234 |
| 524 | Ga0157336_1000317 | 3300012477 | Bacteria | 2141 |
| 525 | Ga0157341_1000641 | 3300012494 | Unclassified | 1842 |
| 526 | Ga0157345_1000645 | 3300012498 | Bacteria | 2912 |
| 527 | Ga0157314_1001201 | 3300012500 | Unclassified | 1913 |
| 528 | Ga0157342_1001050 | 3300012507 | Bacteria | 1926 |
| 529 | Ga0157373_10139260 | 3300013100 | Bacteria | 1706 |
| 530 | Ga0157373_10147401 | 3300013100 | Bacteria | 1656 |
| 531 | Ga0157371_10135552 | 3300013102 | Bacteria | 1753 |
| 532 | Ga0157371_10138482 | 3300013102 | Bacteria | 1734 |
| 533 | Ga0157370_10000266 | 3300013104 | Bacteria | 66475 |
| 534 | Ga0157369_10001890 | 3300013105 | Bacteria | 25252 |
| 535 | Ga0157369_10034157 | 3300013105 | Bacteria | 5583 |
| 536 | Ga0157369_10194162 | 3300013105 | Bacteria | 2132 |
| 537 | Ga0157374_10209188 | 3300013296 | Bacteria | 1912 |
| 538 | Ga0157374_10226799 | 3300013296 | Bacteria | 1835 |
| 539 | Ga0157378_10226928 | 3300013297 | Bacteria | 1778 |
| 540 | Ga0163162_10048215 | 3300013306 | Bacteria | 4268 |
| 541 | Ga0163162_10123215 | 3300013306 | Bacteria | 2697 |
| 542 | Ga0163162_10164747 | 3300013306 | Bacteria | 2340 |
| 543 | Ga0163162_10216164 | 3300013306 | Unclassified | 2047 |
| 544 | Ga0163162_10226462 | 3300013306 | Bacteria | 1999 |
| 545 | Ga0163162_10259820 | 3300013306 | Bacteria | 1868 |
| 546 | Ga0163162_10287604 | 3300013306 | Bacteria | 1776 |
| 547 | Ga0163162_10350063 | 3300013306 | Archaea | 1610 |
| 548 | Ga0157372_10439058 | 3300013307 | Bacteria | 1521 |
| 549 | Ga0157375_10059926 | 3300013308 | Bacteria | 3773 |
| 550 | Ga0157375_10199452 | 3300013308 | Bacteria | 2156 |
| 551 | Ga0157375_10212999 | 3300013308 | Bacteria | 2090 |
| 552 | Ga0157375_10226460 | 3300013308 | Bacteria | 2028 |
| 553 | Ga0157375_10229889 | 3300013308 | Bacteria | 2014 |
| 554 | Ga0157375_10287252 | 3300013308 | Bacteria | 1808 |
| 555 | Ga0157375_10301794 | 3300013308 | Bacteria | 1765 |
| 556 | Ga0163163_10268039 | 3300014325 | Bacteria | 1759 |
| 557 | Ga0163163_10346828 | 3300014325 | Bacteria | 1540 |
| 558 | Ga0157380_10066469 | 3300014326 | Bacteria | 2900 |
| 559 | Ga0157380_10108833 | 3300014326 | Bacteria | 2324 |
| 560 | Ga0157380_10346207 | 3300014326 | Bacteria | 1389 |
| 561 | Ga0182008_10063362 | 3300014497 | Bacteria | 1821 |
| 562 | Ga0157377_10056938 | 3300014745 | Bacteria | 2221 |
| 563 | Ga0157379_10049084 | 3300014968 | Bacteria | 3768 |
| 564 | Ga0157379_10089881 | 3300014968 | Bacteria | 2755 |
| 565 | Ga0157379_10112357 | 3300014968 | Bacteria | 2448 |
| 566 | Ga0157379_10121942 | 3300014968 | Bacteria | 2345 |
| 567 | Ga0157379_10127797 | 3300014968 | Bacteria | 2287 |
| 568 | Ga0157379_10166146 | 3300014968 | Bacteria | 1992 |
| 569 | Ga0157379_10199057 | 3300014968 | Bacteria | 1811 |
| 570 | Ga0157379_10234219 | 3300014968 | Bacteria | 1665 |
| 571 | Ga0157376_10125198 | 3300014969 | Bacteria | 2284 |
| 572 | Ga0157376_10168647 | 3300014969 | Bacteria | 1991 |
| 573 | Ga0157376_10192738 | 3300014969 | Bacteria | 1870 |
| 574 | Ga0157376_10269995 | 3300014969 | Bacteria | 1597 |
| 575 | Ga0157376_10493120 | 3300014969 | Bacteria | 1202 |
| 576 | Ga0182006_1037985 | 3300015261 | Bacteria | 1906 |
| 577 | Ga0163161_10028056 | 3300017792 | Plasmid | 3996 |
| 578 | Ga0163161_10047094 | 3300017792 | Bacteria | 3113 |
| 579 | Ga0163161_10091201 | 3300017792 | Unclassified | 2255 |
| 580 | Ga0163161_10095234 | 3300017792 | Bacteria | 2208 |
| 581 | Ga0163161_10134010 | 3300017792 | Bacteria | 1871 |
| 582 | Ga0163161_10182136 | 3300017792 | Bacteria | 1611 |
| 583 | Ga0163161_10190241 | 3300017792 | Bacteria | 1577 |
| 584 | Ga0213873_10005426 | 3300021358 | Bacteria | 2446 |
| 585 | Ga0213872_10023647 | 3300021361 | Bacteria | 2827 |
| 586 | Ga0213872_10046034 | 3300021361 | Bacteria | 1985 |
| 587 | Ga0213874_10003712 | 3300021377 | Bacteria | 3416 |
| 588 | Ga0213874_10012407 | 3300021377 | Bacteria | 2185 |
| 589 | Ga0213874_10022298 | 3300021377 | Bacteria | 1755 |
| 590 | Ga0213876_10013980 | 3300021384 | Bacteria | 4253 |
| 591 | Ga0213876_10061021 | 3300021384 | Bacteria | 1989 |
| 592 | Ga0213876_10074413 | 3300021384 | Bacteria | 1794 |
| 593 | Ga0213871_10015465 | 3300021441 | Bacteria | 1825 |
| 594 | Ga0213871_10016699 | 3300021441 | Bacteria | 1773 |
| 595 | Ga0228598_1011746 | 3300024227 | Bacteria | 1741 |
| 596 | Ga0228598_1016767 | 3300024227 | Bacteria | 1446 |
| 597 | Ga0209435_104472 | 3300025206 | Bacteria | 1581 |
| 598 | Ga0209436_100003 | 3300025208 | Bacteria | 220530 |
| 599 | Ga0207672_1001655 | 3300025223 | Bacteria | 1583 |
| 600 | Ga0209646_1009087 | 3300025246 | Bacteria | 1581 |
| 601 | Ga0209026_1011565 | 3300025250 | Bacteria | 1581 |
| 602 | Ga0209759_1019831 | 3300025256 | Bacteria | 1581 |
| 603 | Ga0209673_1000638 | 3300025273 | Bacteria | 52958 |
| 604 | Ga0209673_1002243 | 3300025273 | Bacteria | 13955 |
| 605 | Ga0209130_1000051 | 3300025284 | Bacteria | 220482 |
| 606 | Ga0209025_1000392 | 3300025294 | Bacteria | 90826 |
| 607 | Ga0209564_1000881 | 3300025295 | Bacteria | 39731 |
| 608 | Ga0209564_1001097 | 3300025295 | Bacteria | 32207 |
| 609 | Ga0209256_1000578 | 3300025299 | Bacteria | 52169 |
| 610 | Ga0209256_1000915 | 3300025299 | Bacteria | 36110 |
| 611 | Ga0209256_1017981 | 3300025299 | Bacteria | 2320 |
| 612 | Ga0207426_1000043 | 3300025302 | Bacteria | 432827 |
| 613 | Ga0209051_1004206 | 3300025303 | Bacteria | 8980 |
| 614 | Ga0209051_1013113 | 3300025303 | Bacteria | 3963 |
| 615 | Ga0207697_10050798 | 3300025315 | Bacteria | 1713 |
| 616 | Ga0207697_10057659 | 3300025315 | Bacteria | 1612 |
| 617 | Ga0207697_10067500 | 3300025315 | Bacteria | 1495 |
| 618 | Ga0207697_10072691 | 3300025315 | Bacteria | 1442 |
| 619 | Ga0207656_10018708 | 3300025321 | Bacteria | 2730 |
| 620 | Ga0207656_10020468 | 3300025321 | Bacteria | 2630 |
| 621 | Ga0207696_1030230 | 3300025711 | Bacteria | 1648 |
| 622 | Ga0207653_10007395 | 3300025885 | Unclassified | 3423 |
| 623 | Ga0207653_10010653 | 3300025885 | Bacteria | 2870 |
| 624 | Ga0207653_10013116 | 3300025885 | Plasmid | 2593 |
| 625 | Ga0207653_10026461 | 3300025885 | Bacteria | 1860 |
| 626 | Ga0207653_10040725 | 3300025885 | Bacteria | 1524 |
| 627 | Ga0207682_10012714 | 3300025893 | Bacteria | 3283 |
| 628 | Ga0207682_10044128 | 3300025893 | Bacteria | 1827 |
| 629 | Ga0207692_10017649 | 3300025898 | Bacteria | 3186 |
| 630 | Ga0207692_10023051 | 3300025898 | Bacteria | 2874 |
| 631 | Ga0207692_10087156 | 3300025898 | Bacteria | 1684 |
| 632 | Ga0207642_10036628 | 3300025899 | Bacteria | 2107 |
| 633 | Ga0207642_10037397 | 3300025899 | Bacteria | 2091 |
| 634 | Ga0207642_10054676 | 3300025899 | Bacteria | 1822 |
| 635 | Ga0207710_10068229 | 3300025900 | Bacteria | 1626 |
| 636 | Ga0207710_10078683 | 3300025900 | Bacteria | 1526 |
| 637 | Ga0207710_10098478 | 3300025900 | Bacteria | 1377 |
| 638 | Ga0207688_10006342 | 3300025901 | Bacteria | 6437 |
| 639 | Ga0207688_10058297 | 3300025901 | Bacteria | 2173 |
| 640 | Ga0207688_10063796 | 3300025901 | Bacteria | 2078 |
| 641 | Ga0207688_10141090 | 3300025901 | Bacteria | 1418 |
| 642 | Ga0207680_10124285 | 3300025903 | Bacteria | 1692 |
| 643 | Ga0207680_10141499 | 3300025903 | Bacteria | 1595 |
| 644 | Ga0207647_10024961 | 3300025904 | Bacteria | 3935 |
| 645 | Ga0207647_10042567 | 3300025904 | Bacteria | 2848 |
| 646 | Ga0207685_10025557 | 3300025905 | Bacteria | 2041 |
| 647 | Ga0207685_10090782 | 3300025905 | Bacteria | 1286 |
| 648 | Ga0207699_10026756 | 3300025906 | Bacteria | 3184 |
| 649 | Ga0207699_10038640 | 3300025906 | Bacteria | 2737 |
| 650 | Ga0207699_10178134 | 3300025906 | Bacteria | 1427 |
| 651 | Ga0207645_10082311 | 3300025907 | Bacteria | 2063 |
| 652 | Ga0207645_10111662 | 3300025907 | Bacteria | 1770 |
| 653 | Ga0207645_10121052 | 3300025907 | Bacteria | 1699 |
| 654 | Ga0207643_10085144 | 3300025908 | Bacteria | 1836 |
| 655 | Ga0207643_10102932 | 3300025908 | Bacteria | 1676 |
| 656 | Ga0207643_10115584 | 3300025908 | Bacteria | 1584 |
| 657 | Ga0207684_10052991 | 3300025910 | Plasmid | 3444 |
| 658 | Ga0207684_10065341 | 3300025910 | Bacteria | 3089 |
| 659 | Ga0207684_10070992 | 3300025910 | Bacteria | 2959 |
| 660 | Ga0207684_10123089 | 3300025910 | Bacteria | 2224 |
| 661 | Ga0207684_10152673 | 3300025910 | Bacteria | 1987 |
| 662 | Ga0207684_10330982 | 3300025910 | Unclassified | 1312 |
| 663 | Ga0207654_10076110 | 3300025911 | Bacteria | 2008 |
| 664 | Ga0207654_10127439 | 3300025911 | Bacteria | 1607 |
| 665 | Ga0207654_10128375 | 3300025911 | Bacteria | 1602 |
| 666 | Ga0207654_10134631 | 3300025911 | Bacteria | 1568 |
| 667 | Ga0207695_10181228 | 3300025913 | Bacteria | 2027 |
| 668 | Ga0207695_10238628 | 3300025913 | Bacteria | 1720 |
| 669 | Ga0207671_10069987 | 3300025914 | Bacteria | 2615 |
| 670 | Ga0207671_10183097 | 3300025914 | Bacteria | 1631 |
| 671 | Ga0207671_10183867 | 3300025914 | Bacteria | 1628 |
| 672 | Ga0207693_10050815 | 3300025915 | Bacteria | 3254 |
| 673 | Ga0207693_10054163 | 3300025915 | Bacteria | 3147 |
| 674 | Ga0207693_10219567 | 3300025915 | Unclassified | 1493 |
| 675 | Ga0207693_10224793 | 3300025915 | Bacteria | 1474 |
| 676 | Ga0207663_10089821 | 3300025916 | Bacteria | 2035 |
| 677 | Ga0207663_10106052 | 3300025916 | Unclassified | 1898 |
| 678 | Ga0207663_10162719 | 3300025916 | Bacteria | 1577 |
| 679 | Ga0207663_10169279 | 3300025916 | Bacteria | 1550 |
| 680 | Ga0207663_10171566 | 3300025916 | Bacteria | 1541 |
| 681 | Ga0207662_10037067 | 3300025918 | Bacteria | 2853 |
| 682 | Ga0207662_10047126 | 3300025918 | Bacteria | 2552 |
| 683 | Ga0207662_10098498 | 3300025918 | Bacteria | 1809 |
| 684 | Ga0207662_10105905 | 3300025918 | Bacteria | 1748 |
| 685 | Ga0207662_10106555 | 3300025918 | Bacteria | 1743 |
| 686 | Ga0207657_10027420 | 3300025919 | Bacteria | 5217 |
| 687 | Ga0207657_10065538 | 3300025919 | Bacteria | 3096 |
| 688 | Ga0207657_10160948 | 3300025919 | Bacteria | 1823 |
| 689 | Ga0207657_10202938 | 3300025919 | Bacteria | 1594 |
| 690 | Ga0207649_10020385 | 3300025920 | Bacteria | 3802 |
| 691 | Ga0207649_10102736 | 3300025920 | Bacteria | 1895 |
| 692 | Ga0207649_10108756 | 3300025920 | Bacteria | 1848 |
| 693 | Ga0207652_10103318 | 3300025921 | Bacteria | 2519 |
| 694 | Ga0207652_10191568 | 3300025921 | Bacteria | 1839 |
| 695 | Ga0207646_10025672 | 3300025922 | Bacteria | 5387 |
| 696 | Ga0207646_10085312 | 3300025922 | Bacteria | 2825 |
| 697 | Ga0207646_10137491 | 3300025922 | Bacteria | 2200 |
| 698 | Ga0207646_10164594 | 3300025922 | Bacteria | 2002 |
| 699 | Ga0207646_10201734 | 3300025922 | Bacteria | 1797 |
| 700 | Ga0207646_10321393 | 3300025922 | Bacteria | 1398 |
| 701 | Ga0207646_10383622 | 3300025922 | Bacteria | 1269 |
| 702 | Ga0207681_10160383 | 3300025923 | Bacteria | 1694 |
| 703 | Ga0207681_10296772 | 3300025923 | Bacteria | 1277 |
| 704 | Ga0207694_10067966 | 3300025924 | Bacteria | 2782 |
| 705 | Ga0207694_10158975 | 3300025924 | Bacteria | 1824 |
| 706 | Ga0207694_10167132 | 3300025924 | Bacteria | 1779 |
| 707 | Ga0207650_10197782 | 3300025925 | Bacteria | 1609 |
| 708 | Ga0207687_10062213 | 3300025927 | Plasmid | 2639 |
| 709 | Ga0207687_10085062 | 3300025927 | Bacteria | 2294 |
| 710 | Ga0207687_10117642 | 3300025927 | Bacteria | 1983 |
| 711 | Ga0207687_10180630 | 3300025927 | Unclassified | 1634 |
| 712 | Ga0207687_10188744 | 3300025927 | Unclassified | 1602 |
| 713 | Ga0207687_10195667 | 3300025927 | Bacteria | 1577 |
| 714 | Ga0207700_10061188 | 3300025928 | Bacteria | 2855 |
| 715 | Ga0207700_10084330 | 3300025928 | Bacteria | 2490 |
| 716 | Ga0207700_10124518 | 3300025928 | Bacteria | 2095 |
| 717 | Ga0207700_10159642 | 3300025928 | Bacteria | 1871 |
| 718 | Ga0207700_10233032 | 3300025928 | Bacteria | 1566 |
| 719 | Ga0207664_10012633 | 3300025929 | Bacteria | 6041 |
| 720 | Ga0207664_10153783 | 3300025929 | Bacteria | 1956 |
| 721 | Ga0207664_10184830 | 3300025929 | Bacteria | 1791 |
| 722 | Ga0207664_10210675 | 3300025929 | Bacteria | 1681 |
| 723 | Ga0207644_10095484 | 3300025931 | Bacteria | 2223 |
| 724 | Ga0207644_10103020 | 3300025931 | Bacteria | 2147 |
| 725 | Ga0207644_10147929 | 3300025931 | Bacteria | 1815 |
| 726 | Ga0207644_10155737 | 3300025931 | Bacteria | 1771 |
| 727 | Ga0207644_10199542 | 3300025931 | Bacteria | 1577 |
| 728 | Ga0207690_10179921 | 3300025932 | Bacteria | 1591 |
| 729 | Ga0207690_10194779 | 3300025932 | Bacteria | 1535 |
| 730 | Ga0207706_10084757 | 3300025933 | Bacteria | 2786 |
| 731 | Ga0207706_10119918 | 3300025933 | Bacteria | 2313 |
| 732 | Ga0207706_10124875 | 3300025933 | Unclassified | 2264 |
| 733 | Ga0207706_10143115 | 3300025933 | Bacteria | 2103 |
| 734 | Ga0207706_10152090 | 3300025933 | Bacteria | 2035 |
| 735 | Ga0207706_10167282 | 3300025933 | Bacteria | 1932 |
| 736 | Ga0207706_10207441 | 3300025933 | Bacteria | 1718 |
| 737 | Ga0207706_10243283 | 3300025933 | Bacteria | 1573 |
| 738 | Ga0207686_10030719 | 3300025934 | Bacteria | 3184 |
| 739 | Ga0207709_10121758 | 3300025935 | Bacteria | 1763 |
| 740 | Ga0207709_10123769 | 3300025935 | Bacteria | 1751 |
| 741 | Ga0207670_10013313 | 3300025936 | Bacteria | 4845 |
| 742 | Ga0207670_10057092 | 3300025936 | Bacteria | 2646 |
| 743 | Ga0207670_10165799 | 3300025936 | Bacteria | 1653 |
| 744 | Ga0207670_10176473 | 3300025936 | Bacteria | 1606 |
| 745 | Ga0207670_10242793 | 3300025936 | Bacteria | 1388 |
| 746 | Ga0207669_10077941 | 3300025937 | Bacteria | 2109 |
| 747 | Ga0207669_10139873 | 3300025937 | Bacteria | 1678 |
| 748 | Ga0207704_10025221 | 3300025938 | Bacteria | 3241 |
| 749 | Ga0207704_10119108 | 3300025938 | Bacteria | 1802 |
| 750 | Ga0207704_10152334 | 3300025938 | Bacteria | 1633 |
| 751 | Ga0207665_10046964 | 3300025939 | Bacteria | 2894 |
| 752 | Ga0207665_10085023 | 3300025939 | Bacteria | 2184 |
| 753 | Ga0207665_10105827 | 3300025939 | Bacteria | 1971 |
| 754 | Ga0207665_10140341 | 3300025939 | Bacteria | 1722 |
| 755 | Ga0207665_10151335 | 3300025939 | Bacteria | 1662 |
| 756 | Ga0207665_10174844 | 3300025939 | Bacteria | 1552 |
| 757 | Ga0207691_10084125 | 3300025940 | Bacteria | 2856 |
| 758 | Ga0207691_10158591 | 3300025940 | Bacteria | 1986 |
| 759 | Ga0207691_10175945 | 3300025940 | Bacteria | 1872 |
| 760 | Ga0207691_10196892 | 3300025940 | Bacteria | 1755 |
| 761 | Ga0207711_10146464 | 3300025941 | Bacteria | 2128 |
| 762 | Ga0207711_10193058 | 3300025941 | Bacteria | 1856 |
| 763 | Ga0207711_10216361 | 3300025941 | Bacteria | 1751 |
| 764 | Ga0207711_10265947 | 3300025941 | Bacteria | 1577 |
| 765 | Ga0207689_10058015 | 3300025942 | Bacteria | 3184 |
| 766 | Ga0207689_10075318 | 3300025942 | Bacteria | 2774 |
| 767 | Ga0207689_10124354 | 3300025942 | Bacteria | 2122 |
| 768 | Ga0207689_10149536 | 3300025942 | Bacteria | 1925 |
| 769 | Ga0207689_10176177 | 3300025942 | Bacteria | 1763 |
| 770 | Ga0207689_10242957 | 3300025942 | Unclassified | 1488 |
| 771 | Ga0207689_10280483 | 3300025942 | Bacteria | 1380 |
| 772 | Ga0207661_10043519 | 3300025944 | Bacteria | 3543 |
| 773 | Ga0207661_10144957 | 3300025944 | Bacteria | 2047 |
| 774 | Ga0207679_10020622 | 3300025945 | Bacteria | 4450 |
| 775 | Ga0207679_10055004 | 3300025945 | Plasmid | 2932 |
| 776 | Ga0207679_10099648 | 3300025945 | Bacteria | 2269 |
| 777 | Ga0207679_10154138 | 3300025945 | Bacteria | 1874 |
| 778 | Ga0207679_10224435 | 3300025945 | Bacteria | 1582 |
| 779 | Ga0207679_10274016 | 3300025945 | Bacteria | 1444 |
| 780 | Ga0207667_10116556 | 3300025949 | Bacteria | 2752 |
| 781 | Ga0207667_10293975 | 3300025949 | Bacteria | 1659 |
| 782 | Ga0207667_10313889 | 3300025949 | Bacteria | 1601 |
| 783 | Ga0207651_10165221 | 3300025960 | Bacteria | 1739 |
| 784 | Ga0207651_10183438 | 3300025960 | Bacteria | 1662 |
| 785 | Ga0207651_10236558 | 3300025960 | Bacteria | 1486 |
| 786 | Ga0207712_10030225 | 3300025961 | Bacteria | 3640 |
| 787 | Ga0207712_10057203 | 3300025961 | Plasmid | 2751 |
| 788 | Ga0207712_10070453 | 3300025961 | Bacteria | 2512 |
| 789 | Ga0207712_10116998 | 3300025961 | Unclassified | 2010 |
| 790 | Ga0207712_10136315 | 3300025961 | Bacteria | 1878 |
| 791 | Ga0207712_10163269 | 3300025961 | Bacteria | 1734 |
| 792 | Ga0207712_10167792 | 3300025961 | Unclassified | 1713 |
| 793 | Ga0207712_10219023 | 3300025961 | Bacteria | 1521 |
| 794 | Ga0207668_10081840 | 3300025972 | Bacteria | 2343 |
| 795 | Ga0207668_10131079 | 3300025972 | Bacteria | 1914 |
| 796 | Ga0207668_10156768 | 3300025972 | Bacteria | 1769 |
| 797 | Ga0207668_10158970 | 3300025972 | Unclassified | 1758 |
| 798 | Ga0207668_10254341 | 3300025972 | Bacteria | 1428 |
| 799 | Ga0207640_10037158 | 3300025981 | Bacteria | 3062 |
| 800 | Ga0207640_10047237 | 3300025981 | Bacteria | 2775 |
| 801 | Ga0207640_10056761 | 3300025981 | Bacteria | 2572 |
| 802 | Ga0207640_10126586 | 3300025981 | Bacteria | 1840 |
| 803 | Ga0207640_10143039 | 3300025981 | Bacteria | 1746 |
| 804 | Ga0207658_10040031 | 3300025986 | Bacteria | 3385 |
| 805 | Ga0207658_10124148 | 3300025986 | Bacteria | 2063 |
| 806 | Ga0207658_10172172 | 3300025986 | Bacteria | 1784 |
| 807 | Ga0207677_10017107 | 3300026023 | Bacteria | 4314 |
| 808 | Ga0207677_10180695 | 3300026023 | Bacteria | 1659 |
| 809 | Ga0207677_10217403 | 3300026023 | Bacteria | 1530 |
| 810 | Ga0207703_10030010 | 3300026035 | Bacteria | 4294 |
| 811 | Ga0207703_10175227 | 3300026035 | Bacteria | 1889 |
| 812 | Ga0207703_10251480 | 3300026035 | Bacteria | 1593 |
| 813 | Ga0207703_10256407 | 3300026035 | Bacteria | 1579 |
| 814 | Ga0207639_10174531 | 3300026041 | Bacteria | 1823 |
| 815 | Ga0207678_10042293 | 3300026067 | Bacteria | 3948 |
| 816 | Ga0207678_10105080 | 3300026067 | Bacteria | 2410 |
| 817 | Ga0207678_10174566 | 3300026067 | Bacteria | 1835 |
| 818 | Ga0207678_10191923 | 3300026067 | Bacteria | 1746 |
| 819 | Ga0207678_10241467 | 3300026067 | Bacteria | 1547 |
| 820 | Ga0207708_10031070 | 3300026075 | Bacteria | 4052 |
| 821 | Ga0207708_10034821 | 3300026075 | Bacteria | 3831 |
| 822 | Ga0207708_10041968 | 3300026075 | Bacteria | 3488 |
| 823 | Ga0207708_10117180 | 3300026075 | Bacteria | 2072 |
| 824 | Ga0207708_10124288 | 3300026075 | Bacteria | 2013 |
| 825 | Ga0207708_10138892 | 3300026075 | Bacteria | 1905 |
| 826 | Ga0207708_10139209 | 3300026075 | Bacteria | 1902 |
| 827 | Ga0207708_10141581 | 3300026075 | Unclassified | 1887 |
| 828 | Ga0207708_10151776 | 3300026075 | Bacteria | 1824 |
| 829 | Ga0207708_10209608 | 3300026075 | Bacteria | 1557 |
| 830 | Ga0207702_10240583 | 3300026078 | Bacteria | 1695 |
| 831 | Ga0207702_10253620 | 3300026078 | Bacteria | 1653 |
| 832 | Ga0207702_10257253 | 3300026078 | Bacteria | 1642 |
| 833 | Ga0207641_10244140 | 3300026088 | Bacteria | 1674 |
| 834 | Ga0207641_10249901 | 3300026088 | Unclassified | 1656 |
| 835 | Ga0207641_10300848 | 3300026088 | Bacteria | 1515 |
| 836 | Ga0207648_10098061 | 3300026089 | Bacteria | 2565 |
| 837 | Ga0207648_10201139 | 3300026089 | Bacteria | 1767 |
| 838 | Ga0207648_10205872 | 3300026089 | Bacteria | 1746 |
| 839 | Ga0207676_10158789 | 3300026095 | Bacteria | 1956 |
| 840 | Ga0207676_10173823 | 3300026095 | Unclassified | 1879 |
| 841 | Ga0207676_10208348 | 3300026095 | Bacteria | 1732 |
| 842 | Ga0207676_10274742 | 3300026095 | Bacteria | 1527 |
| 843 | Ga0207674_10074163 | 3300026116 | Bacteria | 3415 |
| 844 | Ga0207674_10155203 | 3300026116 | Bacteria | 2244 |
| 845 | Ga0207674_10211658 | 3300026116 | Unclassified | 1887 |
| 846 | Ga0207674_10256811 | 3300026116 | Bacteria | 1694 |
| 847 | Ga0207675_100034176 | 3300026118 | Bacteria | 4740 |
| 848 | Ga0207675_100151016 | 3300026118 | Bacteria | 2211 |
| 849 | Ga0207675_100174143 | 3300026118 | Unclassified | 2058 |
| 850 | Ga0207675_100184116 | 3300026118 | Unclassified | 2001 |
| 851 | Ga0207675_100211147 | 3300026118 | Bacteria | 1867 |
| 852 | Ga0207675_100278435 | 3300026118 | Bacteria | 1625 |
| 853 | Ga0207675_100304327 | 3300026118 | Unclassified | 1553 |
| 854 | Ga0207683_10044883 | 3300026121 | Bacteria | 3864 |
| 855 | Ga0207683_10046123 | 3300026121 | Bacteria | 3812 |
| 856 | Ga0207683_10070908 | 3300026121 | Bacteria | 3079 |
| 857 | Ga0207683_10155014 | 3300026121 | Bacteria | 2069 |
| 858 | Ga0207683_10206422 | 3300026121 | Bacteria | 1787 |
| 859 | Ga0207683_10232163 | 3300026121 | Bacteria | 1683 |
| 860 | Ga0207683_10243911 | 3300026121 | Bacteria | 1639 |
| 861 | Ga0207698_10034493 | 3300026142 | Bacteria | 3689 |
| 862 | Ga0207698_10142501 | 3300026142 | Unclassified | 2067 |
| 863 | Ga0207698_10172916 | 3300026142 | Bacteria | 1904 |
| 864 | Ga0207698_10203129 | 3300026142 | Bacteria | 1776 |
| 865 | Ga0209281_1012592 | 3300027111 | Bacteria | 1851 |
| 866 | Ga0209281_1013518 | 3300027111 | Bacteria | 1761 |
| 867 | Ga0209371_1014098 | 3300027312 | Bacteria | 2207 |
| 868 | Ga0209179_1005573 | 3300027512 | Bacteria | 1980 |
| 869 | Ga0209179_1007027 | 3300027512 | Bacteria | 1843 |
| 870 | Ga0209179_1013132 | 3300027512 | Bacteria | 1500 |
| 871 | Ga0209588_1017446 | 3300027671 | Bacteria | 2226 |
| 872 | Ga0209588_1020444 | 3300027671 | Bacteria | 2073 |
| 873 | Ga0209588_1032644 | 3300027671 | Bacteria | 1668 |
| 874 | Ga0209588_1037461 | 3300027671 | Bacteria | 1561 |
| 875 | Ga0209588_1038131 | 3300027671 | Bacteria | 1548 |
| 876 | Ga0207428_10017929 | 3300027907 | Bacteria | 6066 |
| 877 | Ga0207428_10026452 | 3300027907 | Bacteria | 4844 |
| 878 | Ga0207428_10061512 | 3300027907 | Unclassified | 2972 |
| 879 | Ga0207428_10143633 | 3300027907 | Bacteria | 1820 |
| 880 | Ga0207428_10158012 | 3300027907 | Bacteria | 1723 |
| 881 | Ga0207428_10172822 | 3300027907 | Unclassified | 1636 |
| 882 | Ga0207428_10194478 | 3300027907 | Bacteria | 1528 |
| 883 | Ga0207428_10242345 | 3300027907 | Unclassified | 1347 |
| 884 | Ga0268266_10098147 | 3300028379 | Bacteria | 2577 |
| 885 | Ga0268266_10162001 | 3300028379 | Bacteria | 2024 |
| 886 | Ga0268266_10256057 | 3300028379 | Bacteria | 1620 |
| 887 | Ga0268265_10192999 | 3300028380 | Bacteria | 1760 |
| 888 | Ga0268265_10296635 | 3300028380 | Bacteria | 1453 |
| 889 | Ga0268265_10344072 | 3300028380 | Bacteria | 1359 |
| 890 | Ga0268264_10124048 | 3300028381 | Bacteria | 2280 |
| 891 | Ga0268264_10181015 | 3300028381 | Bacteria | 1914 |
| 892 | Ga0268264_10190924 | 3300028381 | Bacteria | 1867 |
| 893 | Ga0268264_10258266 | 3300028381 | Unclassified | 1622 |
| 894 | Ga0307515_10159094 | 3300028794 | Bacteria | 2314 |
| 895 | Ga0307515_10272353 | 3300028794 | Bacteria | 1412 |
| 896 | Ga0265338_10114313 | 3300028800 | Bacteria | 2166 |
| 897 | Ga0268256_1015307 | 3300030500 | Bacteria | 2244 |
| 898 | Ga0265770_1004061 | 3300030878 | Bacteria | 1992 |
| 899 | Ga0265771_1000388 | 3300031010 | Bacteria | 1551 |
| 900 | Ga0265760_10018460 | 3300031090 | Bacteria | 2009 |
| 901 | Ga0265339_10119329 | 3300031249 | Bacteria | 1357 |
| 902 | Ga0265327_10051715 | 3300031251 | Bacteria | 2143 |
| 903 | Ga0307513_10061832 | 3300031456 | Bacteria | 3961 |
| 904 | Ga0307513_10328949 | 3300031456 | Bacteria | 1283 |
| 905 | Ga0307408_100140304 | 3300031548 | Bacteria | 1896 |
| 906 | Ga0307408_100165794 | 3300031548 | Bacteria | 1759 |
| 907 | Ga0307408_100301131 | 3300031548 | Bacteria | 1343 |
| 908 | Ga0316579_10063545 | 3300031691 | Unclassified | 1740 |
| 909 | Ga0265314_10058171 | 3300031711 | Bacteria | 2650 |
| 910 | Ga0316576_10115783 | 3300031727 | Unclassified | 2011 |
| 911 | Ga0316578_10033379 | 3300031728 | Plasmid | 2948 |
| 912 | Ga0307405_10171721 | 3300031731 | Bacteria | 1547 |
| 913 | Ga0316577_10092970 | 3300031733 | Bacteria | 1688 |
| 914 | Ga0307413_10072369 | 3300031824 | Bacteria | 2176 |
| 915 | Ga0307413_10130659 | 3300031824 | Bacteria | 1718 |
| 916 | Ga0307410_10032892 | 3300031852 | Bacteria | 3343 |
| 917 | Ga0307410_10105031 | 3300031852 | Bacteria | 2032 |
| 918 | Ga0307410_10170955 | 3300031852 | Bacteria | 1637 |
| 919 | Ga0307406_10116285 | 3300031901 | Bacteria | 1850 |
| 920 | Ga0307406_10210014 | 3300031901 | Bacteria | 1439 |
| 921 | Ga0307407_10126480 | 3300031903 | Bacteria | 1628 |
| 922 | Ga0307412_10167039 | 3300031911 | Bacteria | 1641 |
| 923 | Ga0307412_10216449 | 3300031911 | Bacteria | 1465 |
| 924 | Ga0307412_10250273 | 3300031911 | Bacteria | 1375 |
| 925 | Ga0307409_100189203 | 3300031995 | Bacteria | 1830 |
| 926 | Ga0307409_100217594 | 3300031995 | Bacteria | 1722 |
| 927 | Ga0307416_100185620 | 3300032002 | Bacteria | 1954 |
| 928 | Ga0307416_100208014 | 3300032002 | Bacteria | 1863 |
| 929 | Ga0307416_100440712 | 3300032002 | Bacteria | 1352 |
| 930 | Ga0307414_10110067 | 3300032004 | Bacteria | 2094 |
| 931 | Ga0307414_10295592 | 3300032004 | Bacteria | 1367 |
| 932 | Ga0307411_10142978 | 3300032005 | Bacteria | 1766 |
| 933 | Ga0307415_100150739 | 3300032126 | Bacteria | 1789 |
| 934 | Ga0307507_10154252 | 3300033179 | Bacteria | 1717 |
| 935 | Ga0307510_10156464 | 3300033180 | Bacteria | 1885 |
| 936 | Ga0373948_0009227 | 3300034817 | Bacteria | 1698 |
| 937 | Ga0373959_0004703 | 3300034820 | Bacteria | 2213 |
| 938 | Ga0373926_0010123 | 3300035083 | Bacteria | 3156 |
| 939 | Ga0373926_0016744 | 3300035083 | Bacteria | 2511 |
| 940 | Ga0373926_0020734 | 3300035083 | Bacteria | 2271 |
| 941 | Ga0373926_0022972 | 3300035083 | Bacteria | 2164 |
| 942 | Ga0373926_0077649 | 3300035083 | Bacteria | 1225 |
| 943 | Ga0373928_0008027 | 3300035084 | Bacteria | 2043 |
| 944 | Ga0373934_0029429 | 3300035086 | Bacteria | 2144 |
| 945 | Ga0373934_0030330 | 3300035086 | Bacteria | 2114 |
| 946 | Ga0373934_0066146 | 3300035086 | Bacteria | 1443 |
| 947 | Ga0373944_0005365 | 3300035089 | Bacteria | 3373 |
| 948 | Ga0373944_0035202 | 3300035089 | Unclassified | 1525 |
| 949 | Ga0373952_0010966 | 3300035092 | Bacteria | 1760 |
| 950 | Ga0373923_0013618 | 3300035111 | Bacteria | 3035 |
| 951 | Ga0373923_0024422 | 3300035111 | Bacteria | 2385 |
| 952 | Ga0373932_0022780 | 3300035112 | Bacteria | 1668 |
| 953 | Ga0373936_0027383 | 3300035113 | Bacteria | 2235 |
| 954 | Ga0373945_0020878 | 3300035116 | Bacteria | 2245 |
| 955 | Ga0373953_0037220 | 3300035117 | Bacteria | 1919 |
| 956 | Ga0373953_0055691 | 3300035117 | Bacteria | 1606 |
| 957 | Ga0373954_0028298 | 3300035118 | Bacteria | 2576 |
| 958 | Ga0373954_0041247 | 3300035118 | Bacteria | 2151 |
| 959 | Ga0373954_0045218 | 3300035118 | Bacteria | 2056 |
| 960 | Ga0373954_0052933 | 3300035118 | Bacteria | 1907 |
| 961 | Ga0373954_0065893 | 3300035118 | Bacteria | 1714 |
| 962 | Ga0373954_0088274 | 3300035118 | Bacteria | 1487 |
| 963 | Ga0373956_0039464 | 3300035119 | Bacteria | 2092 |
| 964 | Ga0373956_0097093 | 3300035119 | Bacteria | 1363 |
| 965 | Ga0373957_0014082 | 3300035120 | Bacteria | 2727 |
| 966 | Ga0373957_0017278 | 3300035120 | Bacteria | 2509 |
| 967 | Ga0373957_0035934 | 3300035120 | Bacteria | 1843 |
| 968 | Ga0373960_0017632 | 3300035121 | Bacteria | 1852 |
| 969 | Ga0373943_0054037 | 3300035170 | Bacteria | 1985 |
| 970 | Ga0373943_0069740 | 3300035170 | Bacteria | 1777 |
| 971 | Ga0373943_0072817 | 3300035170 | Bacteria | 1743 |
| 972 | Ga0373943_0081537 | 3300035170 | Bacteria | 1659 |
| 973 | Ga0373943_0097138 | 3300035170 | Unclassified | 1534 |
| 974 | Ga0373943_0103169 | 3300035170 | Bacteria | 1494 |
| 975 | Ga0373946_0043629 | 3300035171 | Bacteria | 1848 |
| 976 | Ga0373946_0044419 | 3300035171 | Bacteria | 1834 |
| 977 | Ga0373946_0054075 | 3300035171 | Bacteria | 1688 |
| 978 | Ga0373955_0021663 | 3300035172 | Bacteria | 3248 |
| 979 | Ga0373955_0032469 | 3300035172 | Bacteria | 2740 |
| 980 | Ga0373955_0049563 | 3300035172 | Bacteria | 2280 |
| 981 | Ga0373955_0056092 | 3300035172 | Bacteria | 2160 |
| 982 | Ga0373955_0079850 | 3300035172 | Bacteria | 1846 |
| 983 | Ga0373955_0139938 | 3300035172 | Bacteria | 1418 |
| 984 | Ga0373942_0011164 | 3300035207 | Bacteria | 2125 |
| 985 | Ga0373942_0015044 | 3300035207 | Bacteria | 1880 |
| 986 | Ga0316574_0008917 | 3300035398 | Bacteria | 5597 |
| 987 | Ga0373924_0026767 | 3300035410 | Bacteria | 2289 |
| 988 | Ga0373924_0029361 | 3300035410 | Bacteria | 2197 |
| 989 | Ga0373924_0037828 | 3300035410 | Bacteria | 1966 |
| 990 | Ga0373924_0041626 | 3300035410 | Unclassified | 1882 |
| 991 | Ga0373931_0029914 | 3300035691 | Bacteria | 2800 |
| 992 | Ga0373931_0072573 | 3300035691 | Bacteria | 1882 |
| 993 | Ga0373931_0099126 | 3300035691 | Unclassified | 1636 |
| 994 | Ga0373931_0159674 | 3300035691 | Bacteria | 1320 |
| 995 | Ga0373935_0067765 | 3300035692 | Bacteria | 2295 |
| 996 | Ga0373935_0084765 | 3300035692 | Unclassified | 2064 |
| 997 | Ga0373935_0086944 | 3300035692 | Bacteria | 2040 |
| 998 | Ga0373935_0101033 | 3300035692 | Bacteria | 1901 |
| 999 | Ga0373935_0138088 | 3300035692 | Bacteria | 1644 |
| 1000 | Ga0373935_0157701 | 3300035692 | Bacteria | 1544 |
| 1001 | Ga0373935_0160901 | 3300035692 | Bacteria | 1530 |
| 1002 | Ga0373935_0258042 | 3300035692 | Bacteria | 1222 |
| 1003 | Ga0373927_0040745 | 3300035695 | Bacteria | 3013 |
| 1004 | Ga0373927_0054162 | 3300035695 | Bacteria | 2594 |
| 1005 | Ga0373927_0066862 | 3300035695 | Unclassified | 2325 |
| 1006 | Ga0373927_0082080 | 3300035695 | Bacteria | 2089 |
| 1007 | Ga0373927_0119960 | 3300035695 | Bacteria | 1716 |
| 1008 | Ga0373927_0127744 | 3300035695 | Bacteria | 1660 |
| 1009 | Ga0373933_0042382 | 3300035724 | Bacteria | 2690 |
| 1010 | Ga0373933_0062719 | 3300035724 | Bacteria | 2245 |
| 1011 | Ga0373933_0121273 | 3300035724 | Bacteria | 1637 |
| 1012 | Ga0373933_0123095 | 3300035724 | Bacteria | 1625 |
| 1013 | Ga0373933_0182282 | 3300035724 | Bacteria | 1339 |
| 1014 | Ga0373947_0054945 | 3300035725 | Bacteria | 2404 |
| 1015 | Ga0373947_0073976 | 3300035725 | Unclassified | 2095 |
| 1016 | Ga0373947_0079596 | 3300035725 | Bacteria | 2025 |
| 1017 | Ga0373947_0152412 | 3300035725 | Bacteria | 1489 |
| 1018 | Ga0373947_0205775 | 3300035725 | Bacteria | 1289 |
| 1019 | Ga0373937_0165521 | 3300036401 | Bacteria | 2073 |
| 1020 | Ga0373937_0208670 | 3300036401 | Bacteria | 1837 |
| 1021 | Ga0373937_0214034 | 3300036401 | Bacteria | 1813 |
| 1022 | Ga0373937_0220458 | 3300036401 | Unclassified | 1785 |
| 1023 | Ga0373937_0294051 | 3300036401 | Bacteria | 1534 |
| 1024 | Ga0316584_0048002 | 3300036712 | Plasmid | 3190 |
| 1025 | Ga0373925_0113162 | 3300037068 | Bacteria | 2098 |
| 1026 | Ga0373925_0116618 | 3300037068 | Unclassified | 2068 |
| 1027 | Ga0373925_0197552 | 3300037068 | Bacteria | 1598 |
| 1028 | Ga0395899_0151556 | 3300037312 | Bacteria | 1643 |
| 1029 | Ga0395900_0117244 | 3300037418 | Bacteria | 2732 |
| 1030 | Ga0395900_0344792 | 3300037418 | Bacteria | 1464 |
| 1031 | Ga0395900_0464087 | 3300037418 | Unclassified | 1221 |
| 1032 | Ga0395898_0077001 | 3300037466 | Bacteria | 3220 |
| 1033 | Ga0395905_0218948 | 3300037471 | Bacteria | 1782 |
| 1034 | Ga0395905_0245497 | 3300037471 | Bacteria | 1673 |
| 1035 | Ga0436364_0173979 | 3300037853 | Bacteria | 2924 |
| 1036 | Ga0436364_0256259 | 3300037853 | Unclassified | 1314 |
| 1037 | Ga0436364_1405813 | 3300037853 | Bacteria | 2096 |
| 1038 | Ga0395901_0014899 | 3300038443 | Bacteria | 7900 |
| 1039 | Ga0436365_0006810 | 3300039437 | Bacteria | 1954 |
| 1040 | Ga0436365_0053528 | 3300039437 | Bacteria | 3434 |
| 1041 | Ga0436365_0064527 | 3300039437 | Bacteria | 32229 |
| 1042 | Ga0436365_0700849 | 3300039437 | Bacteria | 2847 |
| 1043 | Ga0436365_1132570 | 3300039437 | Bacteria | 2507 |
| 1044 | Ga0436360_0136438 | 3300039438 | Bacteria | 1816 |
| 1045 | Ga0436360_1035749 | 3300039438 | Bacteria | 1858 |
| 1046 | Ga0436360_1069144 | 3300039438 | Bacteria | 1330 |
| 1047 | Ga0436361_0020797 | 3300039447 | Bacteria | 1740 |
| 1048 | Ga0436361_0092328 | 3300039447 | Bacteria | 1863 |
| 1049 | Ga0436361_0242002 | 3300039447 | Bacteria | 2893 |
| 1050 | Ga0436361_0287361 | 3300039447 | Bacteria | 2503 |
| 1051 | Ga0436361_0311593 | 3300039447 | Bacteria | 1999 |
| 1052 | Ga0436361_0448929 | 3300039447 | Bacteria | 1971 |
| 1053 | Ga0436361_0544795 | 3300039447 | Bacteria | 1705 |
| 1054 | Ga0436361_0570546 | 3300039447 | Bacteria | 1603 |
| 1055 | Ga0436361_0770865 | 3300039447 | Bacteria | 1686 |
| 1056 | Ga0436363_0019643 | 3300039450 | Bacteria | 4175 |
| 1057 | Ga0436363_0188199 | 3300039450 | Bacteria | 3169 |
| 1058 | Ga0436363_0953581 | 3300039450 | Bacteria | 2508 |
| 1059 | Ga0436363_1116784 | 3300039450 | Bacteria | 1193 |
| 1060 | Ga0436363_1156995 | 3300039450 | Unclassified | 1837 |
| 1061 | Ga0436362_0228811 | 3300039453 | Bacteria | 3756 |
| 1062 | Ga0436362_0495641 | 3300039453 | Bacteria | 1746 |
| 1063 | Ga0436362_1240782 | 3300039453 | Bacteria | 2488 |
| 1064 | Ga0439465_0031299 | 3300041413 | Bacteria | 1694 |
| 1065 | Ga0451798_0178063 | 3300041458 | Unclassified | 1009 |
| 1066 | Ga0451800_1108730 | 3300041459 | Bacteria | 1877 |
| 1067 | Ga0451800_1597933 | 3300041459 | Bacteria | 1892 |
| 1068 | Ga0451833_1253448 | 3300041491 | Bacteria | 2208 |
| 1069 | Ga0439448_0010142 | 3300042005 | Plasmid | 2787 |
| 1070 | Ga0439448_0012955 | 3300042005 | Bacteria | 2502 |
| 1071 | Ga0439435_0010845 | 3300042436 | Bacteria | 2173 |
| 1072 | Ga0439435_0011464 | 3300042436 | Bacteria | 2128 |
| 1073 | Ga0439444_0014561 | 3300042437 | Unclassified | 1317 |
| 1074 | Ga0439460_0010137 | 3300042461 | Bacteria | 2404 |
| 1075 | Ga0453683_0022403 | 3300044673 | Bacteria | 4029 |
| 1076 | Ga0453683_0063524 | 3300044673 | Unclassified | 2308 |
| 1077 | Ga0466966_0056572 | 3300044684 | Bacteria | 2481 |
| 1078 | Ga0466966_0097323 | 3300044684 | Bacteria | 1822 |
| 1079 | Ga0466963_0101529 | 3300044694 | Bacteria | 1969 |
| 1080 | Ga0451576_0080230 | 3300045051 | Bacteria | 3395 |
| 1081 | Ga0451576_0155383 | 3300045051 | Bacteria | 2386 |
| 1082 | Ga0495617_020661 | 3300046452 | Bacteria | 2226 |
| 1083 | Ga0495592_0032949 | 3300046454 | Bacteria | 3908 |
| 1084 | Ga0495592_0071135 | 3300046454 | Bacteria | 2532 |
| 1085 | Ga0495592_0124571 | 3300046454 | Bacteria | 1809 |
| 1086 | Ga0495592_0131939 | 3300046454 | Bacteria | 1746 |
| 1087 | Ga0495592_0138165 | 3300046454 | Bacteria | 1697 |
| 1088 | Ga0495592_0170690 | 3300046454 | Bacteria | 1490 |
| 1089 | Ga0495603_0070881 | 3300046455 | Bacteria | 2048 |
| 1090 | Ga0495603_0098779 | 3300046455 | Unclassified | 1705 |
| 1091 | Ga0495590_0003911 | 3300046457 | Bacteria | 6055 |
| 1092 | Ga0495590_0043222 | 3300046457 | Bacteria | 1571 |
| 1093 | Ga0495590_0058533 | 3300046457 | Bacteria | 1347 |
| 1094 | Ga0495591_021310 | 3300046458 | Bacteria | 2118 |
| 1095 | Ga0495629_0094978 | 3300046459 | Bacteria | 2080 |
| 1096 | Ga0495629_0097991 | 3300046459 | Bacteria | 2045 |
| 1097 | Ga0495629_0109758 | 3300046459 | Unclassified | 1923 |
| 1098 | Ga0495629_0137539 | 3300046459 | Bacteria | 1700 |
| 1099 | Ga0495638_0053533 | 3300046460 | Bacteria | 2511 |
| 1100 | Ga0495638_0126188 | 3300046460 | Bacteria | 1508 |
| 1101 | Ga0495641_0026586 | 3300046461 | Bacteria | 2822 |
| 1102 | Ga0495641_0081876 | 3300046461 | Bacteria | 1445 |
| 1103 | Ga0495651_0064325 | 3300046462 | Bacteria | 2803 |
| 1104 | Ga0495651_0120157 | 3300046462 | Bacteria | 1931 |
| 1105 | Ga0495651_0204679 | 3300046462 | Unclassified | 1378 |
| 1106 | Ga0495653_0026804 | 3300046463 | Bacteria | 4617 |
| 1107 | Ga0495653_0078075 | 3300046463 | Bacteria | 2456 |
| 1108 | Ga0495653_0101691 | 3300046463 | Bacteria | 2081 |
| 1109 | Ga0495653_0120556 | 3300046463 | Bacteria | 1870 |
| 1110 | Ga0495653_0122689 | 3300046463 | Bacteria | 1849 |
| 1111 | Ga0495580_0098794 | 3300046472 | Bacteria | 2030 |
| 1112 | Ga0495580_0099626 | 3300046472 | Bacteria | 2021 |
| 1113 | Ga0495580_0141829 | 3300046472 | Bacteria | 1665 |
| 1114 | Ga0495580_0152375 | 3300046472 | Bacteria | 1601 |
| 1115 | Ga0495582_0120740 | 3300046473 | Bacteria | 1476 |
| 1116 | Ga0495582_0127731 | 3300046473 | Unclassified | 1435 |
| 1117 | Ga0495605_0050174 | 3300046474 | Bacteria | 2036 |
| 1118 | Ga0495605_0079356 | 3300046474 | Bacteria | 1537 |
| 1119 | Ga0495639_0021368 | 3300046475 | Bacteria | 2832 |
| 1120 | Ga0495639_0045183 | 3300046475 | Bacteria | 1992 |
| 1121 | Ga0495639_0060468 | 3300046475 | Unclassified | 1736 |
| 1122 | Ga0495639_0099888 | 3300046475 | Bacteria | 1369 |
| 1123 | Ga0495662_0059784 | 3300046476 | Bacteria | 1840 |
| 1124 | Ga0495664_0042689 | 3300046477 | Bacteria | 2686 |
| 1125 | Ga0495664_0069996 | 3300046477 | Bacteria | 2094 |
| 1126 | Ga0495664_0091647 | 3300046477 | Bacteria | 1827 |
| 1127 | Ga0495664_0107819 | 3300046477 | Bacteria | 1680 |
| 1128 | Ga0495664_0115512 | 3300046477 | Bacteria | 1622 |
| 1129 | Ga0495584_0012657 | 3300046491 | Bacteria | 4306 |
| 1130 | Ga0495584_0163008 | 3300046491 | Bacteria | 1133 |
| 1131 | Ga0495585_0020518 | 3300046492 | Bacteria | 3800 |
| 1132 | Ga0495585_0047739 | 3300046492 | Bacteria | 2383 |
| 1133 | Ga0495585_0052634 | 3300046492 | Unclassified | 2254 |
| 1134 | Ga0495585_0078038 | 3300046492 | Bacteria | 1797 |
| 1135 | Ga0495594_0088844 | 3300046499 | Unclassified | 1730 |
| 1136 | Ga0495594_0131058 | 3300046499 | Bacteria | 1420 |
| 1137 | Ga0495596_0027703 | 3300046500 | Bacteria | 2276 |
| 1138 | Ga0495596_0051735 | 3300046500 | Bacteria | 1609 |
| 1139 | Ga0495607_0027298 | 3300046501 | Bacteria | 3532 |
| 1140 | Ga0495607_0050153 | 3300046501 | Bacteria | 2431 |
| 1141 | Ga0495607_0071366 | 3300046501 | Bacteria | 1936 |
| 1142 | Ga0495583_0026640 | 3300046506 | Bacteria | 2861 |
| 1143 | Ga0495583_0029184 | 3300046506 | Bacteria | 2702 |
| 1144 | Ga0495583_0046408 | 3300046506 | Bacteria | 2003 |
| 1145 | Ga0495583_0057461 | 3300046506 | Bacteria | 1749 |
| 1146 | Ga0495583_0063724 | 3300046506 | Bacteria | 1637 |
| 1147 | Ga0495583_0083780 | 3300046506 | Bacteria | 1382 |
| 1148 | Ga0495606_0102116 | 3300046507 | Bacteria | 1744 |
| 1149 | Ga0495608_0062185 | 3300046511 | Bacteria | 2453 |
| 1150 | Ga0495608_0075441 | 3300046511 | Bacteria | 2197 |
| 1151 | Ga0495608_0095145 | 3300046511 | Unclassified | 1924 |
| 1152 | Ga0495610_0043752 | 3300046512 | Bacteria | 2228 |
| 1153 | Ga0495616_0000239 | 3300046513 | Bacteria | 44698 |
| 1154 | Ga0495618_0038568 | 3300046514 | Bacteria | 3003 |
| 1155 | Ga0495618_0097831 | 3300046514 | Bacteria | 1877 |
| 1156 | Ga0495618_0106589 | 3300046514 | Bacteria | 1794 |
| 1157 | Ga0495618_0120760 | 3300046514 | Bacteria | 1678 |
| 1158 | Ga0495620_0022767 | 3300046515 | Bacteria | 3010 |
| 1159 | Ga0495620_0041819 | 3300046515 | Bacteria | 2007 |
| 1160 | Ga0495620_0054010 | 3300046515 | Bacteria | 1699 |
| 1161 | Ga0495628_0112734 | 3300046516 | Bacteria | 2090 |
| 1162 | Ga0495628_0116639 | 3300046516 | Bacteria | 2050 |
| 1163 | Ga0495628_0136738 | 3300046516 | Bacteria | 1872 |
| 1164 | Ga0495628_0150437 | 3300046516 | Bacteria | 1773 |
| 1165 | Ga0495628_0172132 | 3300046516 | Bacteria | 1641 |
| 1166 | Ga0495628_0204555 | 3300046516 | Bacteria | 1486 |
| 1167 | Ga0495628_0240164 | 3300046516 | Bacteria | 1355 |
| 1168 | Ga0495630_0037826 | 3300046517 | Bacteria | 3608 |
| 1169 | Ga0495630_0125223 | 3300046517 | Bacteria | 1950 |
| 1170 | Ga0495630_0135063 | 3300046517 | Bacteria | 1874 |
| 1171 | Ga0495630_0140897 | 3300046517 | Bacteria | 1833 |
| 1172 | Ga0495630_0167475 | 3300046517 | Bacteria | 1673 |
| 1173 | Ga0495630_0184487 | 3300046517 | Bacteria | 1591 |
| 1174 | Ga0495630_0255975 | 3300046517 | Bacteria | 1337 |
| 1175 | Ga0495630_0349929 | 3300046517 | Bacteria | 1131 |
| 1176 | Ga0495631_0025174 | 3300046518 | Bacteria | 2742 |
| 1177 | Ga0495631_0047803 | 3300046518 | Bacteria | 1877 |
| 1178 | Ga0495632_0009988 | 3300046519 | Bacteria | 5662 |
| 1179 | Ga0495637_0019012 | 3300046520 | Bacteria | 3181 |
| 1180 | Ga0495637_0021558 | 3300046520 | Bacteria | 2953 |
| 1181 | Ga0495637_0047770 | 3300046520 | Bacteria | 1805 |
| 1182 | Ga0495637_0061368 | 3300046520 | Bacteria | 1541 |
| 1183 | Ga0495643_0003559 | 3300046522 | Bacteria | 11328 |
| 1184 | Ga0495643_0074231 | 3300046522 | Bacteria | 1781 |
| 1185 | Ga0495643_0140647 | 3300046522 | Bacteria | 1204 |
| 1186 | Ga0495644_0019090 | 3300046523 | Bacteria | 2617 |
| 1187 | Ga0495644_0024142 | 3300046523 | Bacteria | 2312 |
| 1188 | Ga0495644_0025041 | 3300046523 | Bacteria | 2267 |
| 1189 | Ga0495644_0055438 | 3300046523 | Bacteria | 1489 |
| 1190 | Ga0495644_0057439 | 3300046523 | Bacteria | 1462 |
| 1191 | Ga0495648_0015268 | 3300046524 | Bacteria | 5585 |
| 1192 | Ga0495663_0007708 | 3300046525 | Bacteria | 2977 |
| 1193 | Ga0495663_0023777 | 3300046525 | Bacteria | 1777 |
| 1194 | Ga0495663_0037518 | 3300046525 | Bacteria | 1462 |
| 1195 | Ga0495663_0049692 | 3300046525 | Bacteria | 1295 |
| 1196 | Ga0495666_0024174 | 3300046526 | Bacteria | 3002 |
| 1197 | Ga0495666_0036384 | 3300046526 | Bacteria | 2397 |
| 1198 | Ga0495666_0077035 | 3300046526 | Bacteria | 1580 |
| 1199 | Ga0495666_0091229 | 3300046526 | Bacteria | 1437 |
| 1200 | Ga0495642_0016786 | 3300046528 | Bacteria | 2855 |
| 1201 | Ga0495652_0113376 | 3300046529 | Bacteria | 2176 |
| 1202 | Ga0495652_0122944 | 3300046529 | Unclassified | 2066 |
| 1203 | Ga0495652_0160158 | 3300046529 | Bacteria | 1748 |
| 1204 | Ga0495665_0066720 | 3300046531 | Bacteria | 1898 |
| 1205 | Ga0495665_0096044 | 3300046531 | Bacteria | 1556 |
| 1206 | Ga0495640_0058489 | 3300046533 | Bacteria | 2628 |
| 1207 | Ga0495640_0062634 | 3300046533 | Bacteria | 2522 |
| 1208 | Ga0495640_0095116 | 3300046533 | Bacteria | 1961 |
| 1209 | Ga0495640_0102247 | 3300046533 | Bacteria | 1880 |
| 1210 | Ga0495640_0112676 | 3300046533 | Bacteria | 1776 |
| 1211 | Ga0495640_0162460 | 3300046533 | Bacteria | 1430 |
| 1212 | Ga0495586_0029501 | 3300046535 | Bacteria | 2935 |
| 1213 | Ga0495586_0052048 | 3300046535 | Unclassified | 2216 |
| 1214 | Ga0495586_0055908 | 3300046535 | Bacteria | 2139 |
| 1215 | Ga0495586_0111999 | 3300046535 | Bacteria | 1519 |
| 1216 | Ga0495586_0163804 | 3300046535 | Bacteria | 1254 |
| 1217 | Ga0495587_0024811 | 3300046536 | Bacteria | 3670 |
| 1218 | Ga0495587_0028844 | 3300046536 | Bacteria | 3372 |
| 1219 | Ga0495587_0047790 | 3300046536 | Bacteria | 2536 |
| 1220 | Ga0495587_0077923 | 3300046536 | Unclassified | 1923 |
| 1221 | Ga0495598_0006567 | 3300046537 | Bacteria | 2632 |
| 1222 | Ga0495598_0008347 | 3300046537 | Bacteria | 2409 |
| 1223 | Ga0495598_0010983 | 3300046537 | Bacteria | 2183 |
| 1224 | Ga0495598_0017098 | 3300046537 | Unclassified | 1864 |
| 1225 | Ga0495598_0021165 | 3300046537 | Bacteria | 1726 |
| 1226 | Ga0495609_0034776 | 3300046538 | Bacteria | 2282 |
| 1227 | Ga0495609_0050774 | 3300046538 | Bacteria | 1848 |
| 1228 | Ga0495621_0014913 | 3300046539 | Bacteria | 2469 |
| 1229 | Ga0495597_0016421 | 3300046542 | Bacteria | 3494 |
| 1230 | Ga0495597_0038306 | 3300046542 | Bacteria | 2149 |
| 1231 | Ga0495597_0055793 | 3300046542 | Bacteria | 1731 |
| 1232 | Ga0495597_0056454 | 3300046542 | Bacteria | 1719 |
| 1233 | Ga0495645_0082066 | 3300046543 | Bacteria | 2312 |
| 1234 | Ga0495645_0125842 | 3300046543 | Unclassified | 1800 |
| 1235 | Ga0495645_0139957 | 3300046543 | Bacteria | 1689 |
| 1236 | Ga0495645_0142999 | 3300046543 | Bacteria | 1667 |
| 1237 | Ga0495645_0335614 | 3300046543 | Unclassified | 977 |
| 1238 | Ga0495633_0012801 | 3300046558 | Bacteria | 4445 |
| 1239 | Ga0495633_0047004 | 3300046558 | Bacteria | 2040 |
| 1240 | Ga0495633_0059276 | 3300046558 | Bacteria | 1795 |
| 1241 | Ga0495633_0095227 | 3300046558 | Unclassified | 1383 |
| 1242 | Ga0495667_0023192 | 3300046559 | Bacteria | 4181 |
| 1243 | Ga0495667_0066165 | 3300046559 | Bacteria | 2363 |
| 1244 | Ga0495667_0070204 | 3300046559 | Bacteria | 2285 |
| 1245 | Ga0495667_0122914 | 3300046559 | Bacteria | 1675 |
| 1246 | Ga0495667_0147364 | 3300046559 | Bacteria | 1516 |
| 1247 | Ga0495656_0010174 | 3300046615 | Bacteria | 3410 |
| 1248 | Ga0495656_0021157 | 3300046615 | Bacteria | 2530 |
| 1249 | Ga0495656_0025244 | 3300046615 | Bacteria | 2354 |
| 1250 | Ga0495656_0035075 | 3300046615 | Bacteria | 2059 |
| 1251 | Ga0495656_0044978 | 3300046615 | Unclassified | 1861 |
| 1252 | Ga0495656_0059704 | 3300046615 | Bacteria | 1660 |
| 1253 | Ga0495656_0074496 | 3300046615 | Unclassified | 1516 |
| 1254 | Ga0495656_0084358 | 3300046615 | Bacteria | 1440 |
| 1255 | Ga0495668_0030783 | 3300046616 | Bacteria | 3026 |
| 1256 | Ga0495634_0070562 | 3300046642 | Bacteria | 2302 |
| 1257 | Ga0495634_0070983 | 3300046642 | Bacteria | 2294 |
| 1258 | Ga0495634_0082615 | 3300046642 | Bacteria | 2099 |
| 1259 | Ga0495634_0118667 | 3300046642 | Bacteria | 1695 |
| 1260 | Ga0495611_0025038 | 3300046648 | Bacteria | 2598 |
| 1261 | Ga0495611_0035303 | 3300046648 | Bacteria | 2214 |
| 1262 | Ga0495611_0038485 | 3300046648 | Bacteria | 2127 |
| 1263 | Ga0495611_0069690 | 3300046648 | Unclassified | 1607 |
| 1264 | Ga0495611_0085431 | 3300046648 | Bacteria | 1455 |
| 1265 | Ga0495625_0009490 | 3300046660 | Bacteria | 8136 |
| 1266 | Ga0495625_0011433 | 3300046660 | Bacteria | 7238 |
| 1267 | Ga0495625_0076778 | 3300046660 | Bacteria | 2335 |
| 1268 | Ga0495625_0112239 | 3300046660 | Bacteria | 1862 |
| 1269 | Ga0495625_0138938 | 3300046660 | Bacteria | 1640 |
| 1270 | Ga0495635_0069964 | 3300046663 | Bacteria | 2405 |
| 1271 | Ga0495635_0117420 | 3300046663 | Bacteria | 1815 |
| 1272 | Ga0495635_0124412 | 3300046663 | Bacteria | 1758 |
| 1273 | Ga0495659_0022665 | 3300046664 | Bacteria | 2127 |
| 1274 | Ga0495659_0034517 | 3300046664 | Unclassified | 1779 |
| 1275 | Ga0495659_0044293 | 3300046664 | Bacteria | 1599 |
| 1276 | Ga0495661_0065872 | 3300046665 | Bacteria | 2133 |
| 1277 | Ga0495661_0087712 | 3300046665 | Bacteria | 1778 |
| 1278 | Ga0495661_0097422 | 3300046665 | Unclassified | 1661 |
| 1279 | Ga0495588_0012534 | 3300046674 | Bacteria | 4011 |
| 1280 | Ga0495588_0035234 | 3300046674 | Bacteria | 2535 |
| 1281 | Ga0495588_0065820 | 3300046674 | Bacteria | 1880 |
| 1282 | Ga0495657_0047518 | 3300046675 | Bacteria | 2900 |
| 1283 | Ga0495657_0097023 | 3300046675 | Bacteria | 1882 |
| 1284 | Ga0495657_0097182 | 3300046675 | Bacteria | 1880 |
| 1285 | Ga0495657_0131603 | 3300046675 | Bacteria | 1566 |
| 1286 | Ga0495599_0087520 | 3300046678 | Bacteria | 1944 |
| 1287 | Ga0495599_0119386 | 3300046678 | Bacteria | 1639 |
| 1288 | Ga0495623_0055331 | 3300046679 | Bacteria | 2501 |
| 1289 | Ga0495623_0058022 | 3300046679 | Bacteria | 2434 |
| 1290 | Ga0495623_0107867 | 3300046679 | Bacteria | 1690 |
| 1291 | Ga0495623_0130625 | 3300046679 | Unclassified | 1504 |
| 1292 | Ga0495646_0018299 | 3300046680 | Bacteria | 4438 |
| 1293 | Ga0495646_0065162 | 3300046680 | Bacteria | 2157 |
| 1294 | Ga0495646_0086273 | 3300046680 | Bacteria | 1821 |
| 1295 | Ga0495646_0090238 | 3300046680 | Bacteria | 1771 |
| 1296 | Ga0495647_0022723 | 3300046681 | Bacteria | 2268 |
| 1297 | Ga0495647_0038784 | 3300046681 | Bacteria | 1802 |
| 1298 | Ga0495647_0042393 | 3300046681 | Bacteria | 1737 |
| 1299 | Ga0495658_0069053 | 3300046683 | Bacteria | 2047 |
| 1300 | Ga0495658_0101588 | 3300046683 | Unclassified | 1717 |
| 1301 | Ga0495669_0026871 | 3300046684 | Bacteria | 2515 |
| 1302 | Ga0495669_0033308 | 3300046684 | Bacteria | 2267 |
| 1303 | Ga0495613_0055351 | 3300046689 | Bacteria | 2914 |
| 1304 | Ga0495613_0104524 | 3300046689 | Bacteria | 2044 |
| 1305 | Ga0495613_0134243 | 3300046689 | Bacteria | 1771 |
| 1306 | Ga0495613_0225731 | 3300046689 | Bacteria | 1313 |
| 1307 | Ga0495624_0051568 | 3300046690 | Bacteria | 2602 |
| 1308 | Ga0495624_0103569 | 3300046690 | Unclassified | 1751 |
| 1309 | Ga0495624_0106133 | 3300046690 | Bacteria | 1728 |
| 1310 | Ga0495624_0106223 | 3300046690 | Bacteria | 1727 |
| 1311 | Ga0495670_0028503 | 3300046691 | Bacteria | 2768 |
| 1312 | Ga0495670_0034258 | 3300046691 | Bacteria | 2528 |
| 1313 | Ga0495670_0058140 | 3300046691 | Unclassified | 1941 |
| 1314 | Ga0495670_0075631 | 3300046691 | Bacteria | 1709 |
| 1315 | Ga0495671_0096186 | 3300046692 | Bacteria | 1449 |
| 1316 | Ga0495649_0003870 | 3300046694 | Bacteria | 9910 |
| 1317 | Ga0495649_0052787 | 3300046694 | Bacteria | 2202 |
| 1318 | Ga0495649_0070073 | 3300046694 | Bacteria | 1880 |
| 1319 | Ga0495600_0043926 | 3300046809 | Bacteria | 2915 |
| 1320 | Ga0495600_0062515 | 3300046809 | Bacteria | 2432 |
| 1321 | Ga0495600_0086625 | 3300046809 | Bacteria | 2043 |
| 1322 | Ga0495660_0034715 | 3300046810 | Bacteria | 2820 |
| 1323 | Ga0495660_0037115 | 3300046810 | Bacteria | 2715 |
| 1324 | Ga0495660_0078778 | 3300046810 | Bacteria | 1731 |
| 1325 | Ga0495581_0110903 | 3300047315 | Bacteria | 1595 |
| 1326 | Ga0495581_0115315 | 3300047315 | Bacteria | 1562 |
| 1327 | Ga0495604_0108434 | 3300047317 | Bacteria | 2028 |
| 1328 | Ga0495604_0110504 | 3300047317 | Bacteria | 2005 |
| 1329 | Ga0495604_0125798 | 3300047317 | Bacteria | 1848 |
| 1330 | Ga0495604_0137112 | 3300047317 | Bacteria | 1752 |
| 1331 | Ga0495604_0139782 | 3300047317 | Bacteria | 1731 |
| 1332 | Ga0495604_0153214 | 3300047317 | Bacteria | 1635 |
| 1333 | Ga0495604_0167957 | 3300047317 | Bacteria | 1545 |
| 1334 | Ga0495636_0071531 | 3300047318 | Bacteria | 1481 |
| 1335 | Ga0495674_0112845 | 3300047319 | Bacteria | 2302 |
| 1336 | Ga0495674_0128953 | 3300047319 | Bacteria | 2132 |
| 1337 | Ga0495674_0166826 | 3300047319 | Bacteria | 1839 |
| 1338 | Ga0495674_0176094 | 3300047319 | Bacteria | 1782 |
| 1339 | Ga0495674_0181556 | 3300047319 | Bacteria | 1752 |
| 1340 | Ga0495674_0222809 | 3300047319 | Bacteria | 1558 |
| 1341 | Ga0495672_0107676 | 3300047320 | Bacteria | 1501 |
| 1342 | Ga0495672_0119634 | 3300047320 | Bacteria | 1402 |
| 1343 | Ga0495676_0079335 | 3300047321 | Bacteria | 2496 |
| 1344 | Ga0495676_0087846 | 3300047321 | Bacteria | 2334 |
| 1345 | Ga0495676_0094852 | 3300047321 | Bacteria | 2221 |
| 1346 | Ga0495676_0109212 | 3300047321 | Bacteria | 2033 |
| 1347 | Ga0495676_0120372 | 3300047321 | Bacteria | 1910 |
| 1348 | Ga0495676_0235006 | 3300047321 | Bacteria | 1257 |
| 1349 | Ga0495680_0116214 | 3300047322 | Unclassified | 1978 |
| 1350 | Ga0495680_0126830 | 3300047322 | Bacteria | 1878 |
| 1351 | Ga0495680_0142090 | 3300047322 | Bacteria | 1755 |
| 1352 | Ga0495680_0180807 | 3300047322 | Bacteria | 1522 |
| 1353 | Ga0495683_0017636 | 3300047323 | Bacteria | 3698 |
| 1354 | Ga0495687_005675 | 3300047443 | Bacteria | 7884 |
| 1355 | Ga0495675_0024019 | 3300047444 | Bacteria | 3884 |
| 1356 | Ga0495675_0070438 | 3300047444 | Bacteria | 2207 |
| 1357 | Ga0495675_0133742 | 3300047444 | Bacteria | 1540 |
| 1358 | Ga0495677_0043066 | 3300047445 | Bacteria | 1654 |
| 1359 | Ga0495679_040661 | 3300047446 | Bacteria | 1444 |
| 1360 | Ga0495685_012989 | 3300047447 | Bacteria | 2824 |
| 1361 | Ga0495685_034146 | 3300047447 | Bacteria | 1747 |
| 1362 | Ga0495673_0000025 | 3300047469 | Bacteria | 512352 |
| 1363 | Ga0495673_0037896 | 3300047469 | Bacteria | 2198 |
| 1364 | Ga0495684_0044248 | 3300047471 | Bacteria | 3408 |
| 1365 | Ga0495684_0107933 | 3300047471 | Bacteria | 2102 |
| 1366 | Ga0495684_0117712 | 3300047471 | Unclassified | 2002 |
| 1367 | Ga0495684_0147549 | 3300047471 | Bacteria | 1760 |
| 1368 | Ga0495686_0032089 | 3300047472 | Bacteria | 3401 |
| 1369 | Ga0495686_0098249 | 3300047472 | Bacteria | 1769 |
| 1370 | Ga0495593_0056823 | 3300047673 | Bacteria | 2056 |
| 1371 | Ga0495593_0080124 | 3300047673 | Bacteria | 1689 |
| 1372 | Ga0495602_0099892 | 3300048088 | Bacteria | 2384 |
| 1373 | Ga0495602_0111996 | 3300048088 | Bacteria | 2215 |
| 1374 | Ga0495602_0145383 | 3300048088 | Bacteria | 1871 |
| 1375 | Ga0495602_0147045 | 3300048088 | Bacteria | 1857 |
| 1376 | Ga0495614_0046798 | 3300048089 | Unclassified | 1855 |
| 1377 | Ga0495614_0075101 | 3300048089 | Bacteria | 1460 |
| 1378 | Ga0495615_0005598 | 3300048090 | Bacteria | 2269 |
| 1379 | Ga0495615_0012105 | 3300048090 | Bacteria | 1771 |
| 1380 | Ga0495626_0035838 | 3300048091 | Bacteria | 2367 |
| 1381 | Ga0496100_0049336 | 3300048903 | Bacteria | 2721 |
| 1382 | Ga0496100_0139096 | 3300048903 | Bacteria | 1718 |
| 1383 | Ga0496100_0165211 | 3300048903 | Bacteria | 1589 |
| 1384 | Ga0496100_0212350 | 3300048903 | Bacteria | 1416 |
| 1385 | Ga0496100_0215467 | 3300048903 | Bacteria | 1407 |
| 1386 | Ga0496101_0062655 | 3300048904 | Bacteria | 2704 |
| 1387 | Ga0496102_0000345 | 3300048905 | Bacteria | 56618 |
| 1388 | Ga0496102_0162272 | 3300048905 | Bacteria | 2102 |
| 1389 | Ga0496102_0198578 | 3300048905 | Bacteria | 1890 |
| 1390 | Ga0496102_0231910 | 3300048905 | Bacteria | 1740 |
| 1391 | Ga0496102_0238395 | 3300048905 | Unclassified | 1715 |
| 1392 | Ga0496102_0297064 | 3300048905 | Bacteria | 1522 |
| 1393 | Ga0496103_0000276 | 3300048906 | Bacteria | 48842 |
| 1394 | Ga0496103_0022814 | 3300048906 | Bacteria | 3770 |
| 1395 | Ga0496103_0079111 | 3300048906 | Bacteria | 2065 |
| 1396 | Ga0496103_0105904 | 3300048906 | Bacteria | 1783 |
| 1397 | Ga0496104_0000056 | 3300048907 | Bacteria | 122670 |
| 1398 | Ga0496104_0036995 | 3300048907 | Bacteria | 4564 |
| 1399 | Ga0496104_0188026 | 3300048907 | Bacteria | 1976 |
| 1400 | Ga0496104_0247250 | 3300048907 | Bacteria | 1696 |
| 1401 | Ga0496104_0310640 | 3300048907 | Unclassified | 1489 |
| 1402 | Ga0496105_0000036 | 3300048908 | Bacteria | 122670 |
| 1403 | Ga0496105_0086155 | 3300048908 | Bacteria | 2596 |
| 1404 | Ga0496105_0183730 | 3300048908 | Bacteria | 1711 |
| 1405 | Ga0496105_0257579 | 3300048908 | Bacteria | 1412 |
| 1406 | Ga0496106_0035659 | 3300048909 | Bacteria | 3719 |
| 1407 | Ga0496106_0184404 | 3300048909 | Bacteria | 1657 |
| 1408 | Ga0496107_0064211 | 3300048910 | Bacteria | 2661 |
| 1409 | Ga0496107_0100574 | 3300048910 | Bacteria | 2119 |
| 1410 | Ga0496107_0140945 | 3300048910 | Bacteria | 1782 |
| 1411 | Ga0496107_0154013 | 3300048910 | Bacteria | 1701 |
| 1412 | Ga0496107_0177593 | 3300048910 | Unclassified | 1581 |
| 1413 | Ga0496108_0082218 | 3300048911 | Bacteria | 2730 |
| 1414 | Ga0496108_0193680 | 3300048911 | Bacteria | 1762 |
| 1415 | Ga0496108_0200568 | 3300048911 | Bacteria | 1731 |
| 1416 | Ga0496108_0227953 | 3300048911 | Bacteria | 1619 |
| 1417 | Ga0496108_0228256 | 3300048911 | Bacteria | 1618 |
| 1418 | Ga0496108_0282702 | 3300048911 | Bacteria | 1444 |
| 1419 | Ga0496108_0308227 | 3300048911 | Bacteria | 1379 |
| 1420 | Ga0496109_0039786 | 3300048912 | Bacteria | 4257 |
| 1421 | Ga0496109_0093101 | 3300048912 | Bacteria | 2788 |
| 1422 | Ga0496109_0176547 | 3300048912 | Bacteria | 2005 |
| 1423 | Ga0496109_0217097 | 3300048912 | Bacteria | 1798 |
| 1424 | Ga0496109_0331669 | 3300048912 | Bacteria | 1436 |
| 1425 | Ga0496109_0339188 | 3300048912 | Bacteria | 1419 |
| 1426 | Ga0496109_0359981 | 3300048912 | Bacteria | 1374 |
| 1427 | Ga0496110_0061683 | 3300048913 | Bacteria | 3310 |
| 1428 | Ga0496110_0089496 | 3300048913 | Bacteria | 2751 |
| 1429 | Ga0496110_0138916 | 3300048913 | Bacteria | 2196 |
| 1430 | Ga0496110_0192969 | 3300048913 | Bacteria | 1849 |
| 1431 | Ga0496110_0216288 | 3300048913 | Bacteria | 1742 |
| 1432 | Ga0496110_0219092 | 3300048913 | Bacteria | 1730 |
| 1433 | Ga0496111_0144157 | 3300048914 | Bacteria | 1765 |
| 1434 | Ga0496111_0171762 | 3300048914 | Bacteria | 1610 |
| 1435 | Ga0496111_0207864 | 3300048914 | Bacteria | 1454 |
| 1436 | Ga0496112_0001860 | 3300048915 | Bacteria | 16617 |
| 1437 | Ga0496112_0015616 | 3300048915 | Bacteria | 7091 |
| 1438 | Ga0496112_0185062 | 3300048915 | Bacteria | 2046 |
| 1439 | Ga0496112_0218055 | 3300048915 | Bacteria | 1864 |
| 1440 | Ga0496112_0228308 | 3300048915 | Bacteria | 1816 |
| 1441 | Ga0496112_0240417 | 3300048915 | Bacteria | 1763 |
| 1442 | Ga0496113_0153181 | 3300048916 | Bacteria | 1819 |
| 1443 | Ga0496113_0170895 | 3300048916 | Bacteria | 1721 |
| 1444 | Ga0496113_0186533 | 3300048916 | Bacteria | 1645 |
| 1445 | Ga0496114_0211286 | 3300048917 | Bacteria | 1702 |
| 1446 | Ga0496114_0223390 | 3300048917 | Bacteria | 1653 |
| 1447 | Ga0496115_0100162 | 3300048918 | Bacteria | 2375 |
| 1448 | Ga0496115_0220924 | 3300048918 | Bacteria | 1563 |
| 1449 | Ga0496116_0038523 | 3300048919 | Bacteria | 3317 |
| 1450 | Ga0496116_0077563 | 3300048919 | Bacteria | 2075 |
| 1451 | Ga0496117_0000633 | 3300048920 | Bacteria | 56618 |
| 1452 | Ga0496117_0030138 | 3300048920 | Bacteria | 4169 |
| 1453 | Ga0496117_0037958 | 3300048920 | Bacteria | 3581 |
| 1454 | Ga0496117_0067819 | 3300048920 | Bacteria | 2412 |
| 1455 | Ga0496118_0000654 | 3300048921 | Bacteria | 56618 |
| 1456 | Ga0496118_0060761 | 3300048921 | Bacteria | 2804 |
| 1457 | Ga0496118_0085174 | 3300048921 | Bacteria | 2202 |
| 1458 | Ga0496119_0032189 | 3300048922 | Bacteria | 3499 |
| 1459 | Ga0496120_0031779 | 3300048923 | Bacteria | 3192 |
| 1460 | Ga0496120_0062457 | 3300048923 | Bacteria | 2075 |
| 1461 | Ga0496120_0083952 | 3300048923 | Bacteria | 1718 |
| 1462 | Ga0496121_0000190 | 3300048924 | Bacteria | 136607 |
| 1463 | Ga0496121_0051976 | 3300048924 | Bacteria | 3446 |
| 1464 | Ga0496121_0118303 | 3300048924 | Bacteria | 2006 |
| 1465 | Ga0496121_0122451 | 3300048924 | Bacteria | 1961 |
| 1466 | Ga0496124_0000664 | 3300048927 | Bacteria | 56618 |
| 1467 | Ga0496125_0124762 | 3300048928 | Bacteria | 1827 |
| 1468 | Ga0496125_0142484 | 3300048928 | Bacteria | 1664 |
| 1469 | Ga0496126_0003079 | 3300048929 | Bacteria | 21570 |
| 1470 | Ga0496126_0133142 | 3300048929 | Bacteria | 2146 |
| 1471 | Ga0495682_0027510 | 3300049460 | Bacteria | 2109 |
| 1472 | Ga0501292_000003 | 3300049515 | Bacteria | 161908 |
| 1473 | Ga0501031_0095830 | 3300049568 | Bacteria | 1936 |
| 1474 | Ga0501031_0128345 | 3300049568 | Bacteria | 1656 |
| 1475 | Ga0501033_0068482 | 3300049570 | Bacteria | 2609 |
| 1476 | Ga0501033_0134394 | 3300049570 | Bacteria | 1790 |
| 1477 | Ga0501034_0063775 | 3300049571 | Bacteria | 3698 |
| 1478 | Ga0501036_0160018 | 3300049572 | Bacteria | 1898 |
| 1479 | Ga0501036_0244249 | 3300049572 | Bacteria | 1505 |
| 1480 | Ga0501036_0288481 | 3300049572 | Bacteria | 1373 |
| 1481 | Ga0501037_0112937 | 3300049573 | Bacteria | 1956 |
| 1482 | Ga0501038_0167446 | 3300049574 | Bacteria | 1781 |
| 1483 | Ga0501038_0176871 | 3300049574 | Bacteria | 1724 |
| 1484 | Ga0501038_0204837 | 3300049574 | Bacteria | 1581 |
| 1485 | Ga0501039_0090528 | 3300049575 | Bacteria | 2384 |
| 1486 | Ga0501039_0148447 | 3300049575 | Bacteria | 1842 |
| 1487 | Ga0501039_0155644 | 3300049575 | Bacteria | 1795 |
| 1488 | Ga0501039_0183910 | 3300049575 | Bacteria | 1643 |
| 1489 | Ga0501040_0080703 | 3300049576 | Bacteria | 2253 |
| 1490 | Ga0501040_0132326 | 3300049576 | Bacteria | 1754 |
| 1491 | Ga0501041_0053540 | 3300049577 | Bacteria | 2461 |
| 1492 | Ga0501041_0069904 | 3300049577 | Bacteria | 2154 |
| 1493 | Ga0501041_0088254 | 3300049577 | Bacteria | 1914 |
| 1494 | Ga0501042_0063897 | 3300049578 | Bacteria | 2630 |
| 1495 | Ga0501042_0096725 | 3300049578 | Bacteria | 2121 |
| 1496 | Ga0501043_0039063 | 3300049579 | Bacteria | 3731 |
| 1497 | Ga0501043_0226910 | 3300049579 | Bacteria | 1443 |
| 1498 | Ga0501046_0048596 | 3300049580 | Unclassified | 3359 |
| 1499 | Ga0501046_0156915 | 3300049580 | Bacteria | 1713 |
| 1500 | Ga0501048_0074358 | 3300049582 | Bacteria | 2397 |
| 1501 | Ga0501048_0116060 | 3300049582 | Bacteria | 1891 |
| 1502 | Ga0501048_0191415 | 3300049582 | Bacteria | 1449 |
| 1503 | Ga0501068_0103069 | 3300049584 | Bacteria | 1769 |
| 1504 | Ga0501070_0200717 | 3300049586 | Bacteria | 1638 |
| 1505 | Ga0501071_0039102 | 3300049587 | Bacteria | 3392 |
| 1506 | Ga0501071_0086328 | 3300049587 | Bacteria | 2301 |
| 1507 | Ga0501071_0153222 | 3300049587 | Bacteria | 1720 |
| 1508 | Ga0501071_0174977 | 3300049587 | Bacteria | 1607 |
| 1509 | Ga0501072_0066312 | 3300049588 | Bacteria | 2847 |
| 1510 | Ga0501072_0073479 | 3300049588 | Bacteria | 2703 |
| 1511 | Ga0501072_0086879 | 3300049588 | Unclassified | 2481 |
| 1512 | Ga0501072_0108894 | 3300049588 | Bacteria | 2204 |
| 1513 | Ga0501072_0247744 | 3300049588 | Bacteria | 1419 |
| 1514 | Ga0501074_0095876 | 3300049590 | Bacteria | 2124 |
| 1515 | Ga0501074_0099528 | 3300049590 | Bacteria | 2081 |
| 1516 | Ga0501075_0033123 | 3300049591 | Bacteria | 3842 |
| 1517 | Ga0501075_0126924 | 3300049591 | Bacteria | 1942 |
| 1518 | Ga0501075_0218899 | 3300049591 | Bacteria | 1452 |
| 1519 | Ga0501076_0019153 | 3300049592 | Bacteria | 5225 |
| 1520 | Ga0501076_0033955 | 3300049592 | Bacteria | 3984 |
| 1521 | Ga0501076_0101102 | 3300049592 | Bacteria | 2323 |
| 1522 | Ga0501076_0296611 | 3300049592 | Bacteria | 1325 |
| 1523 | Ga0501077_0068213 | 3300049593 | Bacteria | 2254 |
| 1524 | Ga0501077_0113968 | 3300049593 | Bacteria | 1714 |
| 1525 | Ga0501077_0119823 | 3300049593 | Bacteria | 1667 |
| 1526 | Ga0501243_008819 | 3300049675 | Bacteria | 1560 |
| 1527 | Ga0501079_0085673 | 3300049741 | Bacteria | 2438 |
| 1528 | Ga0501079_0095478 | 3300049741 | Unclassified | 2304 |
| 1529 | Ga0501079_0119111 | 3300049741 | Bacteria | 2052 |
| 1530 | Ga0501080_0152215 | 3300049742 | Bacteria | 2137 |
| 1531 | Ga0501080_0166416 | 3300049742 | Bacteria | 2034 |
| 1532 | Ga0501080_0320106 | 3300049742 | Bacteria | 1404 |
| 1533 | Ga0501081_0021507 | 3300049743 | Bacteria | 4306 |
| 1534 | Ga0501081_0029345 | 3300049743 | Bacteria | 3717 |
| 1535 | Ga0501081_0037195 | 3300049743 | Bacteria | 3320 |
| 1536 | Ga0501083_0109286 | 3300049744 | Bacteria | 1818 |
| 1537 | Ga0501267_003081 | 3300049764 | Bacteria | 1503 |
| 1538 | Ga0501279_000009 | 3300049775 | Bacteria | 117146 |
| 1539 | Ga0501035_0138353 | 3300049822 | Bacteria | 2118 |
| 1540 | Ga0501035_0160049 | 3300049822 | Bacteria | 1949 |
| 1541 | Ga0501044_0347322 | 3300049823 | Bacteria | 1404 |
| 1542 | Ga0501044_0378058 | 3300049823 | Bacteria | 1332 |
| 1543 | Ga0501045_0089611 | 3300049824 | Bacteria | 2272 |
| 1544 | Ga0501045_0131801 | 3300049824 | Bacteria | 1858 |
| 1545 | Ga0501204_005175 | 3300049850 | Bacteria | 1422 |
| 1546 | nmdc:mga03683_55366_c1 | 3300050489 | Unclassified | 1666 |
| 1547 | nmdc:mga03683_87601_c1 | 3300050489 | Bacteria | 1353 |
| 1548 | nmdc:mga0yw44_51736_c1 | 3300050492 | Bacteria | 2488 |
| 1549 | nmdc:mga06z11_247_c1 | 3300050494 | Bacteria | 21101 |
| 1550 | nmdc:mga06z11_65656_c1 | 3300050494 | Bacteria | 1905 |
| 1551 | nmdc:mga07m45_24001_c1 | 3300050496 | Bacteria | 3336 |
| 1552 | nmdc:mga05p37_109753_c1 | 3300050507 | Unclassified | 3394 |
| 1553 | nmdc:mga05p37_140359_c2 | 3300050507 | Bacteria | 2495 |
| 1554 | nmdc:mga05p37_147962_c1 | 3300050507 | Plasmid | 2875 |
| 1555 | nmdc:mga05p37_18846_c1 | 3300050507 | Bacteria | 8342 |
| 1556 | nmdc:mga05p37_214241_c1 | 3300050507 | Archaea | 2327 |
| 1557 | nmdc:mga05p37_294342_c1 | 3300050507 | Unclassified | 1931 |
| 1558 | nmdc:mga05p37_296795_c1 | 3300050507 | Bacteria | 1921 |
| 1559 | nmdc:mga05p37_315224_c1 | 3300050507 | Bacteria | 1853 |
| 1560 | nmdc:mga05p37_325489_c1 | 3300050507 | Bacteria | 1818 |
| 1561 | nmdc:mga05p37_330387_c1 | 3300050507 | Unclassified | 1801 |
| 1562 | nmdc:mga05p37_343559_c1 | 3300050507 | Bacteria | 1759 |
| 1563 | nmdc:mga05p37_388158_c1 | 3300050507 | Bacteria | 1634 |
| 1564 | nmdc:mga05p37_64130_c1 | 3300050507 | Plasmid | 4521 |
| 1565 | nmdc:mga05p37_71184_c1 | 3300050507 | Bacteria | 4278 |
| 1566 | nmdc:mga05p37_7735_c1 | 3300050507 | Bacteria | 12685 |
| 1567 | nmdc:mga09592_113749_c1 | 3300050508 | Unclassified | 2323 |
| 1568 | nmdc:mga09592_121521_c1 | 3300050508 | Archaea | 2244 |
| 1569 | nmdc:mga09592_14305_c1 | 3300050508 | Bacteria | 6478 |
| 1570 | nmdc:mga09592_176248_c1 | 3300050508 | Bacteria | 1849 |
| 1571 | nmdc:mga09592_198399_c1 | 3300050508 | Bacteria | 1738 |
| 1572 | nmdc:mga09592_232064_c1 | 3300050508 | Unclassified | 1599 |
| 1573 | nmdc:mga09592_23318_c1 | 3300050508 | Bacteria | 5112 |
| 1574 | nmdc:mga09592_250822_c1 | 3300050508 | Unclassified | 1534 |
| 1575 | nmdc:mga09592_287484_c1 | 3300050508 | Bacteria | 1426 |
| 1576 | nmdc:mga09592_294541_c1 | 3300050508 | Bacteria | 1407 |
| 1577 | nmdc:mga09592_91846_c1 | 3300050508 | Bacteria | 2595 |
| 1578 | nmdc:mga0qj67_148234_c1 | 3300050509 | Unclassified | 1903 |
| 1579 | nmdc:mga0qj67_162358_c1 | 3300050509 | Bacteria | 1814 |
| 1580 | nmdc:mga0qj67_171515_c1 | 3300050509 | Unclassified | 1762 |
| 1581 | nmdc:mga0qj67_173935_c1 | 3300050509 | Bacteria | 1749 |
| 1582 | nmdc:mga0qj67_174118_c1 | 3300050509 | Bacteria | 1748 |
| 1583 | nmdc:mga0qj67_85493_c1 | 3300050509 | Bacteria | 2530 |
| 1584 | nmdc:mga06r32_131178_c1 | 3300050510 | Archaea | 2478 |
| 1585 | nmdc:mga06r32_148132_c1 | 3300050510 | Bacteria | 2325 |
| 1586 | nmdc:mga06r32_20735_c1 | 3300050510 | Bacteria | 6054 |
| 1587 | nmdc:mga06r32_241794_c1 | 3300050510 | Unclassified | 1793 |
| 1588 | nmdc:mga06r32_255754_c1 | 3300050510 | Bacteria | 1739 |
| 1589 | nmdc:mga06r32_285044_c1 | 3300050510 | Bacteria | 1639 |
| 1590 | nmdc:mga06r32_339117_c1 | 3300050510 | Bacteria | 1488 |
| 1591 | nmdc:mga06r32_436412_c1 | 3300050510 | Bacteria | 1290 |
| 1592 | nmdc:mga06r32_89715_c1 | 3300050510 | Bacteria | 3002 |
| 1593 | nmdc:mga06r32_90360_c1 | 3300050510 | Plasmid | 2992 |
| 1594 | nmdc:mga06r32_92706_c1 | 3300050510 | Bacteria | 2954 |
| 1595 | nmdc:mga08y16_133291_c1 | 3300050511 | Bacteria | 2583 |
| 1596 | nmdc:mga08y16_134872_c1 | 3300050511 | Unclassified | 2566 |
| 1597 | nmdc:mga08y16_185560_c1 | 3300050511 | Unclassified | 2159 |
| 1598 | nmdc:mga08y16_225389_c1 | 3300050511 | Unclassified | 1940 |
| 1599 | nmdc:mga08y16_268731_c1 | 3300050511 | Bacteria | 1761 |
| 1600 | nmdc:mga08y16_58655_c1 | 3300050511 | Bacteria | 4022 |
| 1601 | nmdc:mga08y16_79815_c1 | 3300050511 | Bacteria | 3411 |
| 1602 | nmdc:mga0n895_142923_c1 | 3300050512 | Bacteria | 2422 |
| 1603 | nmdc:mga0n895_189659_c1 | 3300050512 | Bacteria | 2087 |
| 1604 | nmdc:mga0n895_250694_c1 | 3300050512 | Bacteria | 1797 |
| 1605 | nmdc:mga0n895_274843_c1 | 3300050512 | Bacteria | 1709 |
| 1606 | nmdc:mga0n895_285705_c1 | 3300050512 | Bacteria | 1673 |
| 1607 | nmdc:mga0n895_338057_c1 | 3300050512 | Bacteria | 1525 |
| 1608 | nmdc:mga0n895_362978_c1 | 3300050512 | Bacteria | 1466 |
| 1609 | nmdc:mga0n895_408776_c1 | 3300050512 | Bacteria | 1373 |
| 1610 | nmdc:mga0n895_43653_c1 | 3300050512 | Plasmid | 4369 |
| 1611 | nmdc:mga0n895_93056_c1 | 3300050512 | Plasmid | 3018 |
| 1612 | nmdc:mga0rr50_279023_c1 | 3300050513 | Bacteria | 1394 |
| 1613 | nmdc:mga0rr50_47412_c1 | 3300050513 | Bacteria | 3170 |
| 1614 | nmdc:mga0rr50_57695_c1 | 3300050513 | Bacteria | 2905 |
| 1615 | nmdc:mga08x19_122370_c1 | 3300050514 | Bacteria | 1745 |
| 1616 | nmdc:mga08x19_82878_c1 | 3300050514 | Unclassified | 2108 |
| 1617 | nmdc:mga08x19_89542_c1 | 3300050514 | Bacteria | 2030 |
| 1618 | nmdc:mga0a205_236004_c1 | 3300050515 | Bacteria | 1711 |
| 1619 | nmdc:mga0a205_238460_c1 | 3300050515 | Bacteria | 1700 |
| 1620 | nmdc:mga0a205_260119_c1 | 3300050515 | Bacteria | 1613 |
| 1621 | nmdc:mga0a205_294144_c1 | 3300050515 | Bacteria | 1498 |
| 1622 | nmdc:mga0a205_68006_c1 | 3300050515 | Plasmid | 3441 |
| 1623 | Ga0495601_0077303 | 3300053077 | Bacteria | 2131 |
| 1624 | Ga0495601_0108958 | 3300053077 | Unclassified | 1792 |
| 1625 | Ga0495601_0178508 | 3300053077 | Bacteria | 1388 |
| 1626 | Ga0495601_0192801 | 3300053077 | Bacteria | 1332 |
| 1627 | Ga0495612_0027175 | 3300053078 | Bacteria | 2300 |
| 1628 | Ga0495612_0042479 | 3300053078 | Bacteria | 1855 |
| 1629 | Ga0495612_0051706 | 3300053078 | Bacteria | 1689 |
| 1630 | Ga0495612_0063520 | 3300053078 | Bacteria | 1531 |
| 1631 | Ga0500610_0072123 | 3300053079 | Bacteria | 1800 |
| 1632 | Ga0500610_0081606 | 3300053079 | Bacteria | 1685 |
| 1633 | Ga0500635_0001844 | 3300053080 | Bacteria | 5177 |
| 1634 | Ga0495655_0002509 | 3300053083 | Bacteria | 2924 |
| 1635 | Ga0495655_0009993 | 3300053083 | Bacteria | 1859 |
| 1636 | Ga0495655_0028530 | 3300053083 | Bacteria | 1334 |
| 1637 | Ga0495595_0054233 | 3300053084 | Unclassified | 1863 |
| 1638 | Ga0495619_0053191 | 3300053085 | Bacteria | 2677 |
| 1639 | Ga0495619_0091761 | 3300053085 | Bacteria | 2056 |
| 1640 | Ga0495619_0121574 | 3300053085 | Bacteria | 1790 |
| 1641 | Ga0495619_0125732 | 3300053085 | Bacteria | 1759 |
| 1642 | Ga0495619_0163763 | 3300053085 | Bacteria | 1536 |
| 1643 | Ga0495619_0212567 | 3300053085 | Bacteria | 1339 |
| 1644 | Ga0500644_0054719 | 3300053088 | Bacteria | 1382 |
| 1645 | Ga0500647_0055479 | 3300053091 | Bacteria | 1906 |
| 1646 | Ga0500651_0039906 | 3300053093 | Bacteria | 2957 |
| 1647 | Ga0500566_0096029 | 3300053094 | Bacteria | 1632 |
| 1648 | Ga0500554_021448 | 3300053102 | Bacteria | 1791 |
| 1649 | Ga0500555_002499 | 3300053103 | Bacteria | 5314 |
| 1650 | Ga0500556_0004459 | 3300053104 | Bacteria | 3984 |
| 1651 | Ga0500593_055703 | 3300053117 | Bacteria | 1746 |
| 1652 | Ga0500607_064980 | 3300053121 | Bacteria | 1897 |
| 1653 | Ga0500608_047531 | 3300053122 | Bacteria | 2061 |
| 1654 | Ga0500614_006583 | 3300053123 | Bacteria | 2441 |
| 1655 | Ga0500618_000101 | 3300053125 | Bacteria | 69860 |
| 1656 | Ga0500642_0014056 | 3300053130 | Bacteria | 2966 |
| 1657 | Ga0500642_0016575 | 3300053130 | Bacteria | 2803 |
| 1658 | Ga0500652_027022 | 3300053131 | Bacteria | 2215 |
| 1659 | Ga0500655_007591 | 3300053133 | Bacteria | 1952 |
| 1660 | Ga0500658_0059787 | 3300053134 | Bacteria | 1581 |
| 1661 | Ga0500559_0017669 | 3300053136 | Bacteria | 3013 |
| 1662 | Ga0500559_0037907 | 3300053136 | Bacteria | 2091 |
| 1663 | Ga0500559_0049240 | 3300053136 | Bacteria | 1855 |
| 1664 | Ga0500559_0068892 | 3300053136 | Bacteria | 1590 |
| 1665 | Ga0500559_0088102 | 3300053136 | Bacteria | 1418 |
| 1666 | Ga0500564_063131 | 3300053138 | Bacteria | 1677 |
| 1667 | Ga0500564_108019 | 3300053138 | Bacteria | 1224 |
| 1668 | Ga0500568_0000561 | 3300053139 | Bacteria | 27307 |
| 1669 | Ga0500585_021297 | 3300053144 | Bacteria | 2125 |
| 1670 | Ga0500590_037703 | 3300053148 | Bacteria | 2496 |
| 1671 | Ga0500616_0056185 | 3300053153 | Bacteria | 2055 |
| 1672 | Ga0500619_002763 | 3300053154 | Bacteria | 3452 |
| 1673 | Ga0500619_043774 | 3300053154 | Bacteria | 1424 |
| 1674 | Ga0500638_039815 | 3300053162 | Unclassified | 2281 |
| 1675 | Ga0500638_098532 | 3300053162 | Bacteria | 1366 |
| 1676 | Ga0500636_0070043 | 3300053177 | Bacteria | 2035 |
| 1677 | Ga0500645_014651 | 3300053730 | Bacteria | 2495 |
| 1678 | Ga0500601_001109 | 3300053737 | Plasmid | 3048 |
| 1679 | Ga0501084_0120149 | 3300054114 | Bacteria | 2209 |
| 1680 | Ga0501084_0138029 | 3300054114 | Bacteria | 2052 |
| 1681 | Ga0501084_0186111 | 3300054114 | Bacteria | 1752 |
| 1682 | Ga0590075_016673 | 3300059424 | Bacteria | 1807 |
| 1683 | Ga0590075_024090 | 3300059424 | Bacteria | 1527 |
| 1684 | Ga0501082_0030298 | 3300060353 | Plasmid | 4663 |
| 1685 | Ga0501082_0090664 | 3300060353 | Bacteria | 2639 |
| 1686 | Ga0501082_0214945 | 3300060353 | Bacteria | 1672 |
| 1687 | Ga0501082_0276595 | 3300060353 | Bacteria | 1461 |
| 1688 | Ga0530510_0015761 | 3300061734 | Bacteria | 5343 |
| 1689 | Ga0530510_0030186 | 3300061734 | Plasmid | 3892 |
| 1690 | Ga0530510_0080159 | 3300061734 | Bacteria | 2375 |
| 1691 | Ga0530510_0146364 | 3300061734 | Bacteria | 1742 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046491 | Ga0495584_0163008 | Ga0495584_0163008_123_1079 | 294 |
| 2 | 3300035118 | Ga0373954_0088274 | Ga0373954_0088274_17_958 | 309 |
| 3 | 3300046543 | Ga0495645_0335614 | Ga0495645_0335614_26_967 | 309 |
| 4 | 3300039450 | Ga0436363_1116784 | Ga0436363_1116784_17_964 | 310 |
| 5 | 3300014969 | Ga0157376_10493120 | Ga0157376_104931202 | 312 |
| 6 | 3300049850 | Ga0501204_005175 | Ga0501204_005175_455_1405 | 312 |
| 7 | iso_pu_bacteria | 2513237138 | 2513870703 | 314 |
| 8 | 3300041458 | Ga0451798_0178063 | Ga0451798_0178063_17_976 | 316 |
| 9 | 3300005439 | Ga0070711_100150655 | Ga0070711_1001506552 | 318 |
| 10 | iso_pu_bacteria | 3000135777 | 3000137128 | 318 |
| 11 | 3300006846 | Ga0075430_100189928 | Ga0075430_1001899281 | 321 |
| 12 | 3300050508 | nmdc:mga09592_232064_c1 | nmdc:mga09592_232064_c1_554_1540 | 323 |
| 13 | 3300053125 | Ga0500618_000101 | Ga0500618_000101_15104_16087 | 323 |
| 14 | iso_pu_bacteria | 2937822353 | 2937827598 | 324 |
| 15 | 3300009147 | Ga0114129_10250180 | Ga0114129_102501801 | 326 |
| 16 | 3300049764 | Ga0501267_003081 | Ga0501267_003081_434_1429 | 326 |
| 17 | 3300050507 | nmdc:mga05p37_109753_c1 | nmdc:mga05p37_109753_c1_1929_2924 | 326 |
| 18 | iso_pu_bacteria | 2687453392 | 2688601095 | 326 |
| 19 | 3300048911 | Ga0496108_0282702 | Ga0496108_0282702_50_1045 | 327 |
| 20 | 3300048912 | Ga0496109_0339188 | Ga0496109_0339188_412_1407 | 327 |
| 21 | 3300046457 | Ga0495590_0058533 | Ga0495590_0058533_263_1321 | 328 |
| 22 | 3300046522 | Ga0495643_0140647 | Ga0495643_0140647_23_1081 | 328 |
| 23 | 3300047320 | Ga0495672_0119634 | Ga0495672_0119634_332_1390 | 328 |
| 24 | 3300009098 | Ga0105245_10439836 | Ga0105245_104398361 | 329 |
| 25 | 3300013306 | Ga0163162_10216164 | Ga0163162_102161641 | 329 |
| 26 | 3300009545 | Ga0105237_10276888 | Ga0105237_102768881 | 331 |
| 27 | 3300027907 | Ga0207428_10242345 | Ga0207428_102423453 | 331 |
| 28 | 3300046501 | Ga0495607_0027298 | Ga0495607_0027298_26_1024 | 331 |
| 29 | 3300046615 | Ga0495656_0074496 | Ga0495656_0074496_27_1037 | 331 |
| 30 | 3300047472 | Ga0495686_0032089 | Ga0495686_0032089_35_1033 | 331 |
| 31 | 3300050509 | nmdc:mga0qj67_162358_c1 | nmdc:mga0qj67_162358_c1_792_1802 | 331 |
| 32 | 3300050511 | nmdc:mga08y16_268731_c1 | nmdc:mga08y16_268731_c1_486_1496 | 331 |
| 33 | 3300027907 | Ga0207428_10061512 | Ga0207428_100615122 | 336 |
| 34 | 3300035089 | Ga0373944_0035202 | Ga0373944_0035202_490_1512 | 337 |
| 35 | 3300046455 | Ga0495603_0098779 | Ga0495603_0098779_556_1578 | 337 |
| 36 | 3300046475 | Ga0495639_0060468 | Ga0495639_0060468_641_1663 | 337 |
| 37 | 3300046683 | Ga0495658_0101588 | Ga0495658_0101588_591_1613 | 337 |
| 38 | iso_pu_bacteria | 2508501122 | 2509111990 | 337 |
| 39 | 3300005844 | Ga0068862_100240574 | Ga0068862_1002405742 | 340 |
| 40 | 3300026121 | Ga0207683_10046123 | Ga0207683_100461233 | 340 |
| 41 | iso_pu_bacteria | 2855839649 | 2855846219 | 340 |
| 42 | iso_pu_bacteria | 2916076590 | 2916081566 | 340 |
| 43 | 3300035692 | Ga0373935_0258042 | Ga0373935_0258042_36_1064 | 341 |
| 44 | 3300053083 | Ga0495655_0009993 | Ga0495655_0009993_116_1147 | 341 |
| 45 | 3300001977 | JGI24746J21847_1012047 | JGI24746J21847_10120471 | 342 |
| 46 | 3300001979 | JGI24740J21852_10041322 | JGI24740J21852_100413222 | 342 |
| 47 | 3300002067 | JGI24735J21928_10040336 | JGI24735J21928_100403361 | 342 |
| 48 | 3300002077 | JGI24744J21845_10017976 | JGI24744J21845_100179761 | 342 |
| 49 | 3300005293 | Ga0065715_10024588 | Ga0065715_100245881 | 342 |
| 50 | 3300005328 | Ga0070676_10111479 | Ga0070676_101114791 | 342 |
| 51 | 3300005334 | Ga0068869_100092415 | Ga0068869_1000924151 | 342 |
| 52 | 3300005335 | Ga0070666_10137316 | Ga0070666_101373162 | 342 |
| 53 | 3300005337 | Ga0070682_100052096 | Ga0070682_1000520962 | 342 |
| 54 | 3300005340 | Ga0070689_100162589 | Ga0070689_1001625893 | 342 |
| 55 | 3300005367 | Ga0070667_100106704 | Ga0070667_1001067042 | 342 |
| 56 | 3300005438 | Ga0070701_10107151 | Ga0070701_101071512 | 342 |
| 57 | 3300005441 | Ga0070700_100132409 | Ga0070700_1001324091 | 342 |
| 58 | 3300005455 | Ga0070663_100090232 | Ga0070663_1000902321 | 342 |
| 59 | 3300044684 | Ga0466966_0097323 | Ga0466966_0097323_605_1633 | 342 |
| 60 | 3300046454 | Ga0495592_0170690 | Ga0495592_0170690_427_1464 | 344 |
| 61 | 3300046474 | Ga0495605_0079356 | Ga0495605_0079356_435_1472 | 344 |
| 62 | 3300002070 | JGI24750J21931_1005003 | JGI24750J21931_10050032 | 345 |
| 63 | 3300005445 | Ga0070708_100114882 | Ga0070708_1001148821 | 348 |
| 64 | 3300005471 | Ga0070698_100089376 | Ga0070698_1000893763 | 348 |
| 65 | 3300048905 | Ga0496102_0000345 | Ga0496102_0000345_2096_3142 | 348 |
| 66 | 3300048906 | Ga0496103_0000276 | Ga0496103_0000276_45720_46766 | 348 |
| 67 | 3300048919 | Ga0496116_0038523 | Ga0496116_0038523_184_1230 | 348 |
| 68 | 3300048920 | Ga0496117_0000633 | Ga0496117_0000633_53477_54523 | 348 |
| 69 | 3300048921 | Ga0496118_0000654 | Ga0496118_0000654_2096_3142 | 348 |
| 70 | 3300048923 | Ga0496120_0031779 | Ga0496120_0031779_1840_2886 | 348 |
| 71 | 3300048927 | Ga0496124_0000664 | Ga0496124_0000664_2096_3142 | 348 |
| 72 | 3300050507 | nmdc:mga05p37_7735_c1 | nmdc:mga05p37_7735_c1_1274_2350 | 348 |
| 73 | 3300002244 | JGI24742J22300_10009063 | JGI24742J22300_100090632 | 350 |
| 74 | 3300005466 | Ga0070685_10044018 | Ga0070685_100440182 | 350 |
| 75 | 3300005543 | Ga0070672_100153541 | Ga0070672_1001535411 | 350 |
| 76 | 3300005842 | Ga0068858_100220666 | Ga0068858_1002206661 | 350 |
| 77 | 3300025940 | Ga0207691_10084125 | Ga0207691_100841251 | 350 |
| 78 | 3300026035 | Ga0207703_10175227 | Ga0207703_101752271 | 350 |
| 79 | 3300026118 | Ga0207675_100151016 | Ga0207675_1001510162 | 350 |
| 80 | 3300049587 | Ga0501071_0153222 | Ga0501071_0153222_70_1176 | 350 |
| 81 | 3300049572 | Ga0501036_0288481 | Ga0501036_0288481_131_1219 | 351 |
| 82 | 3300049575 | Ga0501039_0090528 | Ga0501039_0090528_686_1774 | 351 |
| 83 | 3300049576 | Ga0501040_0132326 | Ga0501040_0132326_541_1629 | 351 |
| 84 | 3300049577 | Ga0501041_0088254 | Ga0501041_0088254_369_1457 | 351 |
| 85 | 3300049582 | Ga0501048_0191415 | Ga0501048_0191415_210_1298 | 351 |
| 86 | 3300049587 | Ga0501071_0174977 | Ga0501071_0174977_338_1426 | 351 |
| 87 | 3300049588 | Ga0501072_0108894 | Ga0501072_0108894_635_1723 | 351 |
| 88 | 3300049590 | Ga0501074_0099528 | Ga0501074_0099528_414_1502 | 351 |
| 89 | 3300049591 | Ga0501075_0218899 | Ga0501075_0218899_179_1267 | 351 |
| 90 | 3300049593 | Ga0501077_0119823 | Ga0501077_0119823_139_1227 | 351 |
| 91 | 3300049741 | Ga0501079_0119111 | Ga0501079_0119111_158_1246 | 351 |
| 92 | 3300049743 | Ga0501081_0029345 | Ga0501081_0029345_2475_3563 | 351 |
| 93 | 3300049824 | Ga0501045_0089611 | Ga0501045_0089611_395_1483 | 351 |
| 94 | 3300054114 | Ga0501084_0120149 | Ga0501084_0120149_525_1613 | 351 |
| 95 | 3300060353 | Ga0501082_0276595 | Ga0501082_0276595_148_1236 | 351 |
| 96 | 3300003659 | JGI25404J52841_10017148 | JGI25404J52841_100171481 | 353 |
| 97 | 3300005347 | Ga0070668_100132943 | Ga0070668_1001329431 | 353 |
| 98 | 3300005983 | Ga0081540_1020402 | Ga0081540_10204022 | 353 |
| 99 | 3300014968 | Ga0157379_10199057 | Ga0157379_101990571 | 353 |
| 100 | 3300003316 | rootH1_10177097 | rootH1_101770971 | 355 |
| 101 | 3300005330 | Ga0070690_100193583 | Ga0070690_1001935832 | 355 |
| 102 | 3300005985 | Ga0081539_10023650 | Ga0081539_100236502 | 355 |
| 103 | 3300006946 | Ga0079104_1021380 | Ga0079104_10213801 | 355 |
| 104 | 3300027111 | Ga0209281_1013518 | Ga0209281_10135181 | 355 |
| 105 | 3300031548 | Ga0307408_100140304 | Ga0307408_1001403041 | 355 |
| 106 | 3300031731 | Ga0307405_10171721 | Ga0307405_101717211 | 355 |
| 107 | 3300031911 | Ga0307412_10250273 | Ga0307412_102502731 | 355 |
| 108 | 3300032002 | Ga0307416_100185620 | Ga0307416_1001856201 | 355 |
| 109 | 3300048928 | Ga0496125_0124762 | Ga0496125_0124762_181_1344 | 355 |
| 110 | iso_pu_bacteria | 2838686498 | 2838694245 | 356 |
| 111 | iso_pu_bacteria | 2842271015 | 2842278756 | 356 |
| 112 | 3300003373 | JGI25407J50210_10016431 | JGI25407J50210_100164311 | 357 |
| 113 | 3300003373 | JGI25407J50210_10020924 | JGI25407J50210_100209241 | 357 |
| 114 | 3300007265 | Ga0099794_10066185 | Ga0099794_100661851 | 357 |
| 115 | 3300025922 | Ga0207646_10383622 | Ga0207646_103836221 | 357 |
| 116 | 3300027512 | Ga0209179_1005573 | Ga0209179_10055732 | 357 |
| 117 | 3300031456 | Ga0307513_10328949 | Ga0307513_103289491 | 357 |
| 118 | 3300037418 | Ga0395900_0464087 | Ga0395900_0464087_111_1199 | 357 |
| 119 | 3300049574 | Ga0501038_0176871 | Ga0501038_0176871_468_1556 | 357 |
| 120 | 3300049577 | Ga0501041_0069904 | Ga0501041_0069904_901_1989 | 357 |
| 121 | 3300049588 | Ga0501072_0086879 | Ga0501072_0086879_1142_2230 | 357 |
| 122 | 3300049592 | Ga0501076_0101102 | Ga0501076_0101102_231_1319 | 357 |
| 123 | 3300049742 | Ga0501080_0320106 | Ga0501080_0320106_157_1245 | 357 |
| 124 | 3300050507 | nmdc:mga05p37_64130_c1 | nmdc:mga05p37_64130_c1_3274_4362 | 357 |
| 125 | 3300060353 | Ga0501082_0030298 | Ga0501082_0030298_2865_3953 | 357 |
| 126 | 3300061734 | Ga0530510_0030186 | Ga0530510_0030186_165_1253 | 357 |
| 127 | iso_pu_bacteria | 2937036028 | 2937036503 | 357 |
| 128 | 3300003316 | rootH1_10173562 | rootH1_101735621 | 358 |
| 129 | 3300006178 | Ga0075367_10058594 | Ga0075367_100585943 | 358 |
| 130 | 3300006353 | Ga0075370_10033927 | Ga0075370_100339273 | 358 |
| 131 | 3300006914 | Ga0075436_100083840 | Ga0075436_1000838402 | 358 |
| 132 | 3300021384 | Ga0213876_10061021 | Ga0213876_100610212 | 358 |
| 133 | 3300035691 | Ga0373931_0099126 | Ga0373931_0099126_147_1304 | 358 |
| 134 | 3300037853 | Ga0436364_1405813 | Ga0436364_1405813_292_1446 | 358 |
| 135 | 3300039437 | Ga0436365_0006810 | Ga0436365_0006810_74_1228 | 358 |
| 136 | 3300050494 | nmdc:mga06z11_65656_c1 | nmdc:mga06z11_65656_c1_523_1677 | 358 |
| 137 | 3300005455 | Ga0070663_100173340 | Ga0070663_1001733402 | 359 |
| 138 | 3300005548 | Ga0070665_100170538 | Ga0070665_1001705383 | 359 |
| 139 | 3300005844 | Ga0068862_100301795 | Ga0068862_1003017951 | 359 |
| 140 | 3300011119 | Ga0105246_10112013 | Ga0105246_101120132 | 359 |
| 141 | 3300014325 | Ga0163163_10268039 | Ga0163163_102680392 | 359 |
| 142 | 3300017792 | Ga0163161_10095234 | Ga0163161_100952342 | 359 |
| 143 | 3300025900 | Ga0207710_10098478 | Ga0207710_100984781 | 359 |
| 144 | 3300025942 | Ga0207689_10075318 | Ga0207689_100753182 | 359 |
| 145 | 3300026067 | Ga0207678_10174566 | Ga0207678_101745662 | 359 |
| 146 | 3300026075 | Ga0207708_10117180 | Ga0207708_101171803 | 359 |
| 147 | 3300028379 | Ga0268266_10098147 | Ga0268266_100981472 | 359 |
| 148 | 3300046492 | Ga0495585_0020518 | Ga0495585_0020518_1233_2327 | 359 |
| 149 | 3300046501 | Ga0495607_0050153 | Ga0495607_0050153_182_1276 | 359 |
| 150 | 3300046523 | Ga0495644_0019090 | Ga0495644_0019090_280_1374 | 359 |
| 151 | 3300046537 | Ga0495598_0008347 | Ga0495598_0008347_1160_2254 | 359 |
| 152 | 3300046615 | Ga0495656_0021157 | Ga0495656_0021157_1241_2335 | 359 |
| 153 | 3300046648 | Ga0495611_0035303 | Ga0495611_0035303_943_2037 | 359 |
| 154 | 3300046665 | Ga0495661_0087712 | Ga0495661_0087712_294_1388 | 359 |
| 155 | 3300046665 | Ga0495661_0097422 | Ga0495661_0097422_533_1627 | 359 |
| 156 | 3300046691 | Ga0495670_0028503 | Ga0495670_0028503_1419_2513 | 359 |
| 157 | 3300047318 | Ga0495636_0071531 | Ga0495636_0071531_217_1311 | 359 |
| 158 | 3300049741 | Ga0501079_0095478 | Ga0501079_0095478_992_2086 | 359 |
| 159 | 3300049823 | Ga0501044_0378058 | Ga0501044_0378058_203_1297 | 359 |
| 160 | 3300046615 | Ga0495656_0059704 | Ga0495656_0059704_151_1329 | 360 |
| 161 | 3300046648 | Ga0495611_0085431 | Ga0495611_0085431_184_1362 | 360 |
| 162 | 3300053077 | Ga0495601_0178508 | Ga0495601_0178508_35_1192 | 360 |
| 163 | 3300046517 | Ga0495630_0349929 | Ga0495630_0349929_11_1096 | 361 |
| 164 | iso_pu_bacteria | 2773857925 | 2774874564 | 361 |
| 165 | 3300003322 | rootL2_10312573 | rootL2_103125732 | 362 |
| 166 | 3300005435 | Ga0070714_100199214 | Ga0070714_1001992142 | 362 |
| 167 | 3300005436 | Ga0070713_100182758 | Ga0070713_1001827582 | 362 |
| 168 | 3300025928 | Ga0207700_10124518 | Ga0207700_101245182 | 362 |
| 169 | 3300048924 | Ga0496121_0118303 | Ga0496121_0118303_632_1720 | 362 |
| 170 | 3300005456 | Ga0070678_100200651 | Ga0070678_1002006511 | 363 |
| 171 | 3300035170 | Ga0373943_0097138 | Ga0373943_0097138_303_1457 | 363 |
| 172 | 3300035171 | Ga0373946_0054075 | Ga0373946_0054075_150_1295 | 363 |
| 173 | 3300035695 | Ga0373927_0066862 | Ga0373927_0066862_795_1949 | 363 |
| 174 | 3300035725 | Ga0373947_0073976 | Ga0373947_0073976_591_1745 | 363 |
| 175 | 3300037068 | Ga0373925_0116618 | Ga0373925_0116618_676_1830 | 363 |
| 176 | 3300046460 | Ga0495638_0126188 | Ga0495638_0126188_337_1485 | 363 |
| 177 | 3300046533 | Ga0495640_0062634 | Ga0495640_0062634_615_1760 | 363 |
| 178 | 3300046660 | Ga0495625_0009490 | Ga0495625_0009490_406_1554 | 363 |
| 179 | 3300047321 | Ga0495676_0235006 | Ga0495676_0235006_58_1203 | 363 |
| 180 | 3300059424 | Ga0590075_016673 | Ga0590075_016673_84_1238 | 363 |
| 181 | 3300005445 | Ga0070708_100122022 | Ga0070708_1001220221 | 364 |
| 182 | 3300005467 | Ga0070706_100212671 | Ga0070706_1002126712 | 364 |
| 183 | 3300005468 | Ga0070707_100276087 | Ga0070707_1002760872 | 364 |
| 184 | 3300005471 | Ga0070698_100224479 | Ga0070698_1002244791 | 364 |
| 185 | 3300005563 | Ga0068855_100347677 | Ga0068855_1003476771 | 364 |
| 186 | 3300005616 | Ga0068852_100180404 | Ga0068852_1001804042 | 364 |
| 187 | 3300009093 | Ga0105240_10362693 | Ga0105240_103626931 | 364 |
| 188 | 3300009545 | Ga0105237_10254204 | Ga0105237_102542041 | 364 |
| 189 | 3300009551 | Ga0105238_10464613 | Ga0105238_104646131 | 364 |
| 190 | 3300014326 | Ga0157380_10108833 | Ga0157380_101088331 | 364 |
| 191 | 3300021358 | Ga0213873_10005426 | Ga0213873_100054261 | 364 |
| 192 | 3300021361 | Ga0213872_10023647 | Ga0213872_100236473 | 364 |
| 193 | 3300021377 | Ga0213874_10022298 | Ga0213874_100222981 | 364 |
| 194 | 3300021384 | Ga0213876_10013980 | Ga0213876_100139805 | 364 |
| 195 | 3300021441 | Ga0213871_10015465 | Ga0213871_100154651 | 364 |
| 196 | 3300025910 | Ga0207684_10123089 | Ga0207684_101230892 | 364 |
| 197 | 3300025911 | Ga0207654_10128375 | Ga0207654_101283751 | 364 |
| 198 | 3300025914 | Ga0207671_10183097 | Ga0207671_101830971 | 364 |
| 199 | 3300025922 | Ga0207646_10201734 | Ga0207646_102017341 | 364 |
| 200 | 3300025924 | Ga0207694_10158975 | Ga0207694_101589752 | 364 |
| 201 | 3300025949 | Ga0207667_10313889 | Ga0207667_103138891 | 364 |
| 202 | 3300026142 | Ga0207698_10034493 | Ga0207698_100344934 | 364 |
| 203 | 3300039437 | Ga0436365_0064527 | Ga0436365_0064527_42_1205 | 364 |
| 204 | 3300039447 | Ga0436361_0570546 | Ga0436361_0570546_78_1235 | 364 |
| 205 | 3300039450 | Ga0436363_0188199 | Ga0436363_0188199_646_1809 | 364 |
| 206 | 3300039453 | Ga0436362_0228811 | Ga0436362_0228811_2176_3339 | 364 |
| 207 | 3300042436 | Ga0439435_0010845 | Ga0439435_0010845_300_1397 | 364 |
| 208 | 3300046500 | Ga0495596_0051735 | Ga0495596_0051735_415_1572 | 364 |
| 209 | 3300046507 | Ga0495606_0102116 | Ga0495606_0102116_374_1480 | 364 |
| 210 | 3300046535 | Ga0495586_0029501 | Ga0495586_0029501_710_1816 | 364 |
| 211 | 3300048090 | Ga0495615_0012105 | Ga0495615_0012105_608_1705 | 364 |
| 212 | 3300048920 | Ga0496117_0067819 | Ga0496117_0067819_826_1983 | 364 |
| 213 | 3300048921 | Ga0496118_0085174 | Ga0496118_0085174_846_2003 | 364 |
| 214 | 3300048922 | Ga0496119_0032189 | Ga0496119_0032189_1451_2608 | 364 |
| 215 | 3300048923 | Ga0496120_0083952 | Ga0496120_0083952_324_1481 | 364 |
| 216 | 3300050509 | nmdc:mga0qj67_148234_c1 | nmdc:mga0qj67_148234_c1_155_1264 | 364 |
| 217 | 3300050514 | nmdc:mga08x19_82878_c1 | nmdc:mga08x19_82878_c1_44_1138 | 364 |
| 218 | 3300061734 | Ga0530510_0080159 | Ga0530510_0080159_1157_2314 | 364 |
| 219 | 3300039447 | Ga0436361_0770865 | Ga0436361_0770865_443_1567 | 365 |
| 220 | 3300005578 | Ga0068854_100077788 | Ga0068854_1000777882 | 366 |
| 221 | 3300025981 | Ga0207640_10056761 | Ga0207640_100567612 | 366 |
| 222 | 3300031456 | Ga0307513_10061832 | Ga0307513_100618322 | 366 |
| 223 | 3300031691 | Ga0316579_10063545 | Ga0316579_100635451 | 366 |
| 224 | 3300031728 | Ga0316578_10033379 | Ga0316578_100333792 | 366 |
| 225 | 3300039447 | Ga0436361_0448929 | Ga0436361_0448929_567_1730 | 366 |
| 226 | 3300049588 | Ga0501072_0247744 | Ga0501072_0247744_183_1283 | 366 |
| 227 | 3300005295 | Ga0065707_10026835 | Ga0065707_100268352 | 367 |
| 228 | 3300009148 | Ga0105243_10075494 | Ga0105243_100754941 | 367 |
| 229 | 3300025933 | Ga0207706_10207441 | Ga0207706_102074411 | 367 |
| 230 | 3300025961 | Ga0207712_10163269 | Ga0207712_101632691 | 367 |
| 231 | 3300053121 | Ga0500607_064980 | Ga0500607_064980_564_1727 | 367 |
| 232 | 3300053122 | Ga0500608_047531 | Ga0500608_047531_555_1718 | 367 |
| 233 | 3300053136 | Ga0500559_0017669 | Ga0500559_0017669_663_1811 | 367 |
| 234 | 3300053136 | Ga0500559_0088102 | Ga0500559_0088102_101_1264 | 367 |
| 235 | 3300053138 | Ga0500564_063131 | Ga0500564_063131_123_1286 | 367 |
| 236 | 3300053144 | Ga0500585_021297 | Ga0500585_021297_337_1500 | 367 |
| 237 | 3300053148 | Ga0500590_037703 | Ga0500590_037703_1179_2342 | 367 |
| 238 | 3300053154 | Ga0500619_002763 | Ga0500619_002763_255_1418 | 367 |
| 239 | 3300053154 | Ga0500619_043774 | Ga0500619_043774_215_1363 | 367 |
| 240 | 3300053162 | Ga0500638_098532 | Ga0500638_098532_101_1264 | 367 |
| 241 | 3300005457 | Ga0070662_100117232 | Ga0070662_1001172321 | 368 |
| 242 | 3300025933 | Ga0207706_10143115 | Ga0207706_101431151 | 368 |
| 243 | 3300035398 | Ga0316574_0008917 | Ga0316574_0008917_1260_2399 | 368 |
| 244 | iso_pu_bacteria | 2871444079 | 2871448002 | 368 |
| 245 | 3300014497 | Ga0182008_10063362 | Ga0182008_100633622 | 369 |
| 246 | 3300021377 | Ga0213874_10012407 | Ga0213874_100124071 | 369 |
| 247 | 3300039450 | Ga0436363_0953581 | Ga0436363_0953581_492_1673 | 369 |
| 248 | 3300047317 | Ga0495604_0137112 | Ga0495604_0137112_385_1554 | 369 |
| 249 | 3300049515 | Ga0501292_000003 | Ga0501292_000003_94145_95311 | 369 |
| 250 | 3300049775 | Ga0501279_000009 | Ga0501279_000009_65017_66183 | 369 |
| 251 | iso_pu_bacteria | 2977565890 | 2977566734 | 369 |
| 252 | 3300003203 | JGI25406J46586_10020029 | JGI25406J46586_100200291 | 370 |
| 253 | 3300003373 | JGI25407J50210_10023927 | JGI25407J50210_100239271 | 370 |
| 254 | 3300005467 | Ga0070706_100116852 | Ga0070706_1001168524 | 370 |
| 255 | 3300005468 | Ga0070707_100197891 | Ga0070707_1001978911 | 370 |
| 256 | 3300005518 | Ga0070699_100141087 | Ga0070699_1001410872 | 370 |
| 257 | 3300005616 | Ga0068852_100148474 | Ga0068852_1001484742 | 370 |
| 258 | 3300005981 | Ga0081538_10042022 | Ga0081538_100420223 | 370 |
| 259 | 3300005985 | Ga0081539_10029182 | Ga0081539_100291824 | 370 |
| 260 | 3300009147 | Ga0114129_10318742 | Ga0114129_103187422 | 370 |
| 261 | 3300025910 | Ga0207684_10052991 | Ga0207684_100529914 | 370 |
| 262 | 3300025922 | Ga0207646_10321393 | Ga0207646_103213931 | 370 |
| 263 | 3300025942 | Ga0207689_10242957 | Ga0207689_102429571 | 370 |
| 264 | 3300026142 | Ga0207698_10142501 | Ga0207698_101425011 | 370 |
| 265 | 3300031733 | Ga0316577_10092970 | Ga0316577_100929702 | 370 |
| 266 | 3300031824 | Ga0307413_10072369 | Ga0307413_100723692 | 370 |
| 267 | 3300036712 | Ga0316584_0048002 | Ga0316584_0048002_90_1232 | 370 |
| 268 | 3300037853 | Ga0436364_0256259 | Ga0436364_0256259_50_1237 | 370 |
| 269 | 3300049587 | Ga0501071_0039102 | Ga0501071_0039102_2197_3339 | 370 |
| 270 | 3300001989 | JGI24739J22299_10000445 | JGI24739J22299_100004453 | 371 |
| 271 | 3300005289 | Ga0065704_10013137 | Ga0065704_100131371 | 371 |
| 272 | 3300005289 | Ga0065704_10022000 | Ga0065704_100220002 | 371 |
| 273 | 3300005295 | Ga0065707_10005105 | Ga0065707_100051052 | 371 |
| 274 | 3300005295 | Ga0065707_10013210 | Ga0065707_100132102 | 371 |
| 275 | 3300005295 | Ga0065707_10133766 | Ga0065707_101337662 | 371 |
| 276 | 3300005295 | Ga0065707_10153706 | Ga0065707_101537061 | 371 |
| 277 | 3300005329 | Ga0070683_100158682 | Ga0070683_1001586823 | 371 |
| 278 | 3300005329 | Ga0070683_100230827 | Ga0070683_1002308271 | 371 |
| 279 | 3300005338 | Ga0068868_100056503 | Ga0068868_1000565032 | 371 |
| 280 | 3300005340 | Ga0070689_100054700 | Ga0070689_1000547002 | 371 |
| 281 | 3300005340 | Ga0070689_100114354 | Ga0070689_1001143542 | 371 |
| 282 | 3300005343 | Ga0070687_100027481 | Ga0070687_1000274813 | 371 |
| 283 | 3300005344 | Ga0070661_100019619 | Ga0070661_1000196192 | 371 |
| 284 | 3300005344 | Ga0070661_100030428 | Ga0070661_1000304284 | 371 |
| 285 | 3300005347 | Ga0070668_100090504 | Ga0070668_1000905043 | 371 |
| 286 | 3300005347 | Ga0070668_100091334 | Ga0070668_1000913343 | 371 |
| 287 | 3300005347 | Ga0070668_100133316 | Ga0070668_1001333162 | 371 |
| 288 | 3300005356 | Ga0070674_100068515 | Ga0070674_1000685153 | 371 |
| 289 | 3300005365 | Ga0070688_100142056 | Ga0070688_1001420561 | 371 |
| 290 | 3300005406 | Ga0070703_10020473 | Ga0070703_100204731 | 371 |
| 291 | 3300005438 | Ga0070701_10065497 | Ga0070701_100654972 | 371 |
| 292 | 3300005440 | Ga0070705_100029518 | Ga0070705_1000295184 | 371 |
| 293 | 3300005441 | Ga0070700_100060121 | Ga0070700_1000601211 | 371 |
| 294 | 3300005441 | Ga0070700_100098785 | Ga0070700_1000987852 | 371 |
| 295 | 3300005441 | Ga0070700_100167191 | Ga0070700_1001671911 | 371 |
| 296 | 3300005445 | Ga0070708_100043267 | Ga0070708_1000432672 | 371 |
| 297 | 3300005445 | Ga0070708_100065075 | Ga0070708_1000650753 | 371 |
| 298 | 3300005445 | Ga0070708_100248458 | Ga0070708_1002484581 | 371 |
| 299 | 3300005455 | Ga0070663_100152263 | Ga0070663_1001522631 | 371 |
| 300 | 3300005457 | Ga0070662_100132161 | Ga0070662_1001321612 | 371 |
| 301 | 3300005467 | Ga0070706_100022952 | Ga0070706_1000229522 | 371 |
| 302 | 3300005467 | Ga0070706_100082644 | Ga0070706_1000826442 | 371 |
| 303 | 3300005467 | Ga0070706_100282702 | Ga0070706_1002827021 | 371 |
| 304 | 3300005468 | Ga0070707_100093518 | Ga0070707_1000935183 | 371 |
| 305 | 3300005471 | Ga0070698_100039155 | Ga0070698_1000391553 | 371 |
| 306 | 3300005471 | Ga0070698_100041662 | Ga0070698_1000416622 | 371 |
| 307 | 3300005471 | Ga0070698_100238024 | Ga0070698_1002380242 | 371 |
| 308 | 3300005471 | Ga0070698_100250645 | Ga0070698_1002506452 | 371 |
| 309 | 3300005518 | Ga0070699_100188767 | Ga0070699_1001887672 | 371 |
| 310 | 3300005535 | Ga0070684_100036812 | Ga0070684_1000368123 | 371 |
| 311 | 3300005535 | Ga0070684_100042691 | Ga0070684_1000426914 | 371 |
| 312 | 3300005536 | Ga0070697_100064431 | Ga0070697_1000644312 | 371 |
| 313 | 3300005544 | Ga0070686_100005670 | Ga0070686_1000056705 | 371 |
| 314 | 3300005544 | Ga0070686_100021748 | Ga0070686_1000217481 | 371 |
| 315 | 3300005544 | Ga0070686_100029194 | Ga0070686_1000291944 | 371 |
| 316 | 3300005549 | Ga0070704_100063790 | Ga0070704_1000637903 | 371 |
| 317 | 3300005564 | Ga0070664_100056268 | Ga0070664_1000562684 | 371 |
| 318 | 3300005564 | Ga0070664_100170704 | Ga0070664_1001707043 | 371 |
| 319 | 3300005577 | Ga0068857_100000670 | Ga0068857_10000067013 | 371 |
| 320 | 3300005577 | Ga0068857_100121975 | Ga0068857_1001219751 | 371 |
| 321 | 3300005577 | Ga0068857_100179001 | Ga0068857_1001790013 | 371 |
| 322 | 3300005615 | Ga0070702_100048757 | Ga0070702_1000487572 | 371 |
| 323 | 3300005617 | Ga0068859_100049640 | Ga0068859_1000496405 | 371 |
| 324 | 3300005617 | Ga0068859_100147472 | Ga0068859_1001474722 | 371 |
| 325 | 3300005618 | Ga0068864_100046780 | Ga0068864_1000467802 | 371 |
| 326 | 3300005718 | Ga0068866_10017550 | Ga0068866_100175504 | 371 |
| 327 | 3300005719 | Ga0068861_100050731 | Ga0068861_1000507313 | 371 |
| 328 | 3300005719 | Ga0068861_100074288 | Ga0068861_1000742883 | 371 |
| 329 | 3300005719 | Ga0068861_100147153 | Ga0068861_1001471532 | 371 |
| 330 | 3300005841 | Ga0068863_100371986 | Ga0068863_1003719861 | 371 |
| 331 | 3300005842 | Ga0068858_100043420 | Ga0068858_1000434204 | 371 |
| 332 | 3300005842 | Ga0068858_100250383 | Ga0068858_1002503831 | 371 |
| 333 | 3300005842 | Ga0068858_100278195 | Ga0068858_1002781952 | 371 |
| 334 | 3300005843 | Ga0068860_100313241 | Ga0068860_1003132412 | 371 |
| 335 | 3300005844 | Ga0068862_100051072 | Ga0068862_1000510722 | 371 |
| 336 | 3300005937 | Ga0081455_10034693 | Ga0081455_100346932 | 371 |
| 337 | 3300005937 | Ga0081455_10060963 | Ga0081455_100609633 | 371 |
| 338 | 3300005937 | Ga0081455_10077244 | Ga0081455_100772442 | 371 |
| 339 | 3300005937 | Ga0081455_10148560 | Ga0081455_101485601 | 371 |
| 340 | 3300005981 | Ga0081538_10022883 | Ga0081538_100228834 | 371 |
| 341 | 3300005981 | Ga0081538_10037462 | Ga0081538_100374622 | 371 |
| 342 | 3300005981 | Ga0081538_10076313 | Ga0081538_100763131 | 371 |
| 343 | 3300005983 | Ga0081540_1012755 | Ga0081540_10127553 | 371 |
| 344 | 3300005983 | Ga0081540_1019794 | Ga0081540_10197944 | 371 |
| 345 | 3300005985 | Ga0081539_10033365 | Ga0081539_100333653 | 371 |
| 346 | 3300005985 | Ga0081539_10071648 | Ga0081539_100716482 | 371 |
| 347 | 3300006194 | Ga0075427_10009009 | Ga0075427_100090092 | 371 |
| 348 | 3300006844 | Ga0075428_100028486 | Ga0075428_1000284864 | 371 |
| 349 | 3300006844 | Ga0075428_100037503 | Ga0075428_1000375031 | 371 |
| 350 | 3300006844 | Ga0075428_100044076 | Ga0075428_1000440769 | 371 |
| 351 | 3300006844 | Ga0075428_100056233 | Ga0075428_1000562336 | 371 |
| 352 | 3300006844 | Ga0075428_100113539 | Ga0075428_1001135393 | 371 |
| 353 | 3300006844 | Ga0075428_100153628 | Ga0075428_1001536282 | 371 |
| 354 | 3300006844 | Ga0075428_100178206 | Ga0075428_1001782062 | 371 |
| 355 | 3300006844 | Ga0075428_100238891 | Ga0075428_1002388912 | 371 |
| 356 | 3300006844 | Ga0075428_100240881 | Ga0075428_1002408812 | 371 |
| 357 | 3300006846 | Ga0075430_100104083 | Ga0075430_1001040833 | 371 |
| 358 | 3300006846 | Ga0075430_100128178 | Ga0075430_1001281782 | 371 |
| 359 | 3300006846 | Ga0075430_100136375 | Ga0075430_1001363752 | 371 |
| 360 | 3300006846 | Ga0075430_100143877 | Ga0075430_1001438771 | 371 |
| 361 | 3300006846 | Ga0075430_100155888 | Ga0075430_1001558882 | 371 |
| 362 | 3300006847 | Ga0075431_100016082 | Ga0075431_10001608211 | 371 |
| 363 | 3300006847 | Ga0075431_100068694 | Ga0075431_1000686945 | 371 |
| 364 | 3300006847 | Ga0075431_100090552 | Ga0075431_1000905525 | 371 |
| 365 | 3300006847 | Ga0075431_100134752 | Ga0075431_1001347524 | 371 |
| 366 | 3300006847 | Ga0075431_100170922 | Ga0075431_1001709223 | 371 |
| 367 | 3300006847 | Ga0075431_100172878 | Ga0075431_1001728782 | 371 |
| 368 | 3300006847 | Ga0075431_100176238 | Ga0075431_1001762382 | 371 |
| 369 | 3300006847 | Ga0075431_100262655 | Ga0075431_1002626552 | 371 |
| 370 | 3300006847 | Ga0075431_100321829 | Ga0075431_1003218292 | 371 |
| 371 | 3300006847 | Ga0075431_100323032 | Ga0075431_1003230321 | 371 |
| 372 | 3300006847 | Ga0075431_100354974 | Ga0075431_1003549742 | 371 |
| 373 | 3300006852 | Ga0075433_10105382 | Ga0075433_101053823 | 371 |
| 374 | 3300006852 | Ga0075433_10113421 | Ga0075433_101134212 | 371 |
| 375 | 3300006852 | Ga0075433_10218347 | Ga0075433_102183472 | 371 |
| 376 | 3300006871 | Ga0075434_100111690 | Ga0075434_1001116903 | 371 |
| 377 | 3300006871 | Ga0075434_100117323 | Ga0075434_1001173233 | 371 |
| 378 | 3300006871 | Ga0075434_100144371 | Ga0075434_1001443713 | 371 |
| 379 | 3300006871 | Ga0075434_100172584 | Ga0075434_1001725841 | 371 |
| 380 | 3300006871 | Ga0075434_100186892 | Ga0075434_1001868922 | 371 |
| 381 | 3300006880 | Ga0075429_100030455 | Ga0075429_1000304558 | 371 |
| 382 | 3300006880 | Ga0075429_100089551 | Ga0075429_1000895513 | 371 |
| 383 | 3300006880 | Ga0075429_100139350 | Ga0075429_1001393502 | 371 |
| 384 | 3300006880 | Ga0075429_100195909 | Ga0075429_1001959091 | 371 |
| 385 | 3300006931 | Ga0097620_100049638 | Ga0097620_1000496385 | 371 |
| 386 | 3300006931 | Ga0097620_100147457 | Ga0097620_1001474573 | 371 |
| 387 | 3300007265 | Ga0099794_10013814 | Ga0099794_100138142 | 371 |
| 388 | 3300007265 | Ga0099794_10021704 | Ga0099794_100217042 | 371 |
| 389 | 3300009094 | Ga0111539_10092223 | Ga0111539_100922233 | 371 |
| 390 | 3300009094 | Ga0111539_10198932 | Ga0111539_101989322 | 371 |
| 391 | 3300009094 | Ga0111539_10256727 | Ga0111539_102567271 | 371 |
| 392 | 3300009094 | Ga0111539_10259598 | Ga0111539_102595982 | 371 |
| 393 | 3300009098 | Ga0105245_10119969 | Ga0105245_101199692 | 371 |
| 394 | 3300009098 | Ga0105245_10209572 | Ga0105245_102095721 | 371 |
| 395 | 3300009098 | Ga0105245_10328610 | Ga0105245_103286101 | 371 |
| 396 | 3300009101 | Ga0105247_10066308 | Ga0105247_100663082 | 371 |
| 397 | 3300009147 | Ga0114129_10059733 | Ga0114129_100597335 | 371 |
| 398 | 3300009147 | Ga0114129_10103518 | Ga0114129_101035184 | 371 |
| 399 | 3300009147 | Ga0114129_10180619 | Ga0114129_101806192 | 371 |
| 400 | 3300009147 | Ga0114129_10238572 | Ga0114129_102385722 | 371 |
| 401 | 3300009147 | Ga0114129_10392504 | Ga0114129_103925041 | 371 |
| 402 | 3300009147 | Ga0114129_10407221 | Ga0114129_104072212 | 371 |
| 403 | 3300009551 | Ga0105238_10001089 | Ga0105238_100010899 | 371 |
| 404 | 3300009553 | Ga0105249_10065134 | Ga0105249_100651341 | 371 |
| 405 | 3300009553 | Ga0105249_10065964 | Ga0105249_100659641 | 371 |
| 406 | 3300009553 | Ga0105249_10073156 | Ga0105249_100731561 | 371 |
| 407 | 3300009553 | Ga0105249_10106865 | Ga0105249_101068651 | 371 |
| 408 | 3300009553 | Ga0105249_10131083 | Ga0105249_101310833 | 371 |
| 409 | 3300009553 | Ga0105249_10161943 | Ga0105249_101619432 | 371 |
| 410 | 3300010375 | Ga0105239_10114091 | Ga0105239_101140912 | 371 |
| 411 | 3300011119 | Ga0105246_10072021 | Ga0105246_100720211 | 371 |
| 412 | 3300011119 | Ga0105246_10113782 | Ga0105246_101137821 | 371 |
| 413 | 3300011119 | Ga0105246_10335028 | Ga0105246_103350281 | 371 |
| 414 | 3300012494 | Ga0157341_1000641 | Ga0157341_10006411 | 371 |
| 415 | 3300012498 | Ga0157345_1000645 | Ga0157345_10006451 | 371 |
| 416 | 3300012500 | Ga0157314_1001201 | Ga0157314_10012012 | 371 |
| 417 | 3300013104 | Ga0157370_10000266 | Ga0157370_1000026644 | 371 |
| 418 | 3300013105 | Ga0157369_10001890 | Ga0157369_1000189016 | 371 |
| 419 | 3300013306 | Ga0163162_10048215 | Ga0163162_100482155 | 371 |
| 420 | 3300013306 | Ga0163162_10226462 | Ga0163162_102264622 | 371 |
| 421 | 3300013306 | Ga0163162_10350063 | Ga0163162_103500632 | 371 |
| 422 | 3300013308 | Ga0157375_10059926 | Ga0157375_100599262 | 371 |
| 423 | 3300013308 | Ga0157375_10229889 | Ga0157375_102298891 | 371 |
| 424 | 3300013308 | Ga0157375_10301794 | Ga0157375_103017941 | 371 |
| 425 | 3300014968 | Ga0157379_10049084 | Ga0157379_100490843 | 371 |
| 426 | 3300014968 | Ga0157379_10112357 | Ga0157379_101123571 | 371 |
| 427 | 3300014968 | Ga0157379_10121942 | Ga0157379_101219421 | 371 |
| 428 | 3300014968 | Ga0157379_10127797 | Ga0157379_101277972 | 371 |
| 429 | 3300017792 | Ga0163161_10028056 | Ga0163161_100280566 | 371 |
| 430 | 3300017792 | Ga0163161_10091201 | Ga0163161_100912012 | 371 |
| 431 | 3300025885 | Ga0207653_10007395 | Ga0207653_100073953 | 371 |
| 432 | 3300025885 | Ga0207653_10013116 | Ga0207653_100131163 | 371 |
| 433 | 3300025899 | Ga0207642_10054676 | Ga0207642_100546761 | 371 |
| 434 | 3300025900 | Ga0207710_10068229 | Ga0207710_100682291 | 371 |
| 435 | 3300025910 | Ga0207684_10065341 | Ga0207684_100653413 | 371 |
| 436 | 3300025910 | Ga0207684_10070992 | Ga0207684_100709922 | 371 |
| 437 | 3300025910 | Ga0207684_10330982 | Ga0207684_103309821 | 371 |
| 438 | 3300025918 | Ga0207662_10105905 | Ga0207662_101059052 | 371 |
| 439 | 3300025920 | Ga0207649_10020385 | Ga0207649_100203853 | 371 |
| 440 | 3300025920 | Ga0207649_10108756 | Ga0207649_101087561 | 371 |
| 441 | 3300025922 | Ga0207646_10025672 | Ga0207646_100256727 | 371 |
| 442 | 3300025922 | Ga0207646_10137491 | Ga0207646_101374912 | 371 |
| 443 | 3300025922 | Ga0207646_10164594 | Ga0207646_101645941 | 371 |
| 444 | 3300025927 | Ga0207687_10062213 | Ga0207687_100622132 | 371 |
| 445 | 3300025927 | Ga0207687_10180630 | Ga0207687_101806301 | 371 |
| 446 | 3300025933 | Ga0207706_10124875 | Ga0207706_101248751 | 371 |
| 447 | 3300025936 | Ga0207670_10013313 | Ga0207670_100133132 | 371 |
| 448 | 3300025938 | Ga0207704_10025221 | Ga0207704_100252214 | 371 |
| 449 | 3300025939 | Ga0207665_10151335 | Ga0207665_101513352 | 371 |
| 450 | 3300025942 | Ga0207689_10124354 | Ga0207689_101243542 | 371 |
| 451 | 3300025944 | Ga0207661_10043519 | Ga0207661_100435192 | 371 |
| 452 | 3300025945 | Ga0207679_10020622 | Ga0207679_100206222 | 371 |
| 453 | 3300025945 | Ga0207679_10055004 | Ga0207679_100550043 | 371 |
| 454 | 3300025961 | Ga0207712_10030225 | Ga0207712_100302254 | 371 |
| 455 | 3300025961 | Ga0207712_10057203 | Ga0207712_100572032 | 371 |
| 456 | 3300025961 | Ga0207712_10116998 | Ga0207712_101169981 | 371 |
| 457 | 3300025961 | Ga0207712_10167792 | Ga0207712_101677922 | 371 |
| 458 | 3300025972 | Ga0207668_10081840 | Ga0207668_100818402 | 371 |
| 459 | 3300025972 | Ga0207668_10158970 | Ga0207668_101589701 | 371 |
| 460 | 3300026023 | Ga0207677_10017107 | Ga0207677_100171072 | 371 |
| 461 | 3300026035 | Ga0207703_10030010 | Ga0207703_100300104 | 371 |
| 462 | 3300026067 | Ga0207678_10042293 | Ga0207678_100422933 | 371 |
| 463 | 3300026075 | Ga0207708_10034821 | Ga0207708_100348214 | 371 |
| 464 | 3300026075 | Ga0207708_10141581 | Ga0207708_101415812 | 371 |
| 465 | 3300026075 | Ga0207708_10209608 | Ga0207708_102096081 | 371 |
| 466 | 3300026088 | Ga0207641_10249901 | Ga0207641_102499011 | 371 |
| 467 | 3300026095 | Ga0207676_10173823 | Ga0207676_101738231 | 371 |
| 468 | 3300026116 | Ga0207674_10211658 | Ga0207674_102116581 | 371 |
| 469 | 3300026116 | Ga0207674_10256811 | Ga0207674_102568111 | 371 |
| 470 | 3300026118 | Ga0207675_100174143 | Ga0207675_1001741432 | 371 |
| 471 | 3300026118 | Ga0207675_100184116 | Ga0207675_1001841162 | 371 |
| 472 | 3300027907 | Ga0207428_10017929 | Ga0207428_100179294 | 371 |
| 473 | 3300027907 | Ga0207428_10143633 | Ga0207428_101436331 | 371 |
| 474 | 3300027907 | Ga0207428_10158012 | Ga0207428_101580122 | 371 |
| 475 | 3300027907 | Ga0207428_10194478 | Ga0207428_101944781 | 371 |
| 476 | 3300028381 | Ga0268264_10124048 | Ga0268264_101240482 | 371 |
| 477 | 3300028381 | Ga0268264_10258266 | Ga0268264_102582661 | 371 |
| 478 | 3300031548 | Ga0307408_100301131 | Ga0307408_1003011311 | 371 |
| 479 | 3300031727 | Ga0316576_10115783 | Ga0316576_101157832 | 371 |
| 480 | 3300031901 | Ga0307406_10210014 | Ga0307406_102100141 | 371 |
| 481 | 3300033179 | Ga0307507_10154252 | Ga0307507_101542521 | 371 |
| 482 | 3300037418 | Ga0395900_0344792 | Ga0395900_0344792_83_1198 | 371 |
| 483 | 3300038443 | Ga0395901_0014899 | Ga0395901_0014899_718_1833 | 371 |
| 484 | 3300039438 | Ga0436360_1069144 | Ga0436360_1069144_144_1310 | 371 |
| 485 | 3300042005 | Ga0439448_0010142 | Ga0439448_0010142_433_1578 | 371 |
| 486 | 3300042005 | Ga0439448_0012955 | Ga0439448_0012955_1154_2299 | 371 |
| 487 | 3300042436 | Ga0439435_0011464 | Ga0439435_0011464_152_1297 | 371 |
| 488 | 3300042437 | Ga0439444_0014561 | Ga0439444_0014561_79_1224 | 371 |
| 489 | 3300042461 | Ga0439460_0010137 | Ga0439460_0010137_800_1945 | 371 |
| 490 | 3300044673 | Ga0453683_0022403 | Ga0453683_0022403_2787_3932 | 371 |
| 491 | 3300044673 | Ga0453683_0063524 | Ga0453683_0063524_1018_2163 | 371 |
| 492 | 3300044694 | Ga0466963_0101529 | Ga0466963_0101529_311_1498 | 371 |
| 493 | 3300045051 | Ga0451576_0080230 | Ga0451576_0080230_131_1276 | 371 |
| 494 | 3300045051 | Ga0451576_0155383 | Ga0451576_0155383_1063_2208 | 371 |
| 495 | 3300046492 | Ga0495585_0052634 | Ga0495585_0052634_937_2082 | 371 |
| 496 | 3300046506 | Ga0495583_0057461 | Ga0495583_0057461_188_1303 | 371 |
| 497 | 3300046523 | Ga0495644_0025041 | Ga0495644_0025041_112_1257 | 371 |
| 498 | 3300046523 | Ga0495644_0055438 | Ga0495644_0055438_231_1376 | 371 |
| 499 | 3300046525 | Ga0495663_0037518 | Ga0495663_0037518_218_1363 | 371 |
| 500 | 3300046537 | Ga0495598_0017098 | Ga0495598_0017098_558_1703 | 371 |
| 501 | 3300046558 | Ga0495633_0095227 | Ga0495633_0095227_146_1291 | 371 |
| 502 | 3300046615 | Ga0495656_0025244 | Ga0495656_0025244_1094_2239 | 371 |
| 503 | 3300046615 | Ga0495656_0035075 | Ga0495656_0035075_214_1359 | 371 |
| 504 | 3300046615 | Ga0495656_0044978 | Ga0495656_0044978_608_1753 | 371 |
| 505 | 3300046648 | Ga0495611_0069690 | Ga0495611_0069690_356_1501 | 371 |
| 506 | 3300046660 | Ga0495625_0138938 | Ga0495625_0138938_142_1257 | 371 |
| 507 | 3300046664 | Ga0495659_0034517 | Ga0495659_0034517_469_1614 | 371 |
| 508 | 3300046691 | Ga0495670_0034258 | Ga0495670_0034258_319_1464 | 371 |
| 509 | 3300046691 | Ga0495670_0058140 | Ga0495670_0058140_643_1788 | 371 |
| 510 | 3300047317 | Ga0495604_0139782 | Ga0495604_0139782_399_1565 | 371 |
| 511 | 3300048919 | Ga0496116_0077563 | Ga0496116_0077563_297_1496 | 371 |
| 512 | 3300048920 | Ga0496117_0030138 | Ga0496117_0030138_1847_3046 | 371 |
| 513 | 3300048921 | Ga0496118_0060761 | Ga0496118_0060761_575_1774 | 371 |
| 514 | 3300048923 | Ga0496120_0062457 | Ga0496120_0062457_523_1722 | 371 |
| 515 | 3300048924 | Ga0496121_0122451 | Ga0496121_0122451_736_1935 | 371 |
| 516 | 3300048928 | Ga0496125_0142484 | Ga0496125_0142484_433_1632 | 371 |
| 517 | 3300049568 | Ga0501031_0095830 | Ga0501031_0095830_316_1461 | 371 |
| 518 | 3300049568 | Ga0501031_0128345 | Ga0501031_0128345_381_1526 | 371 |
| 519 | 3300049570 | Ga0501033_0068482 | Ga0501033_0068482_1300_2445 | 371 |
| 520 | 3300049570 | Ga0501033_0134394 | Ga0501033_0134394_519_1664 | 371 |
| 521 | 3300049572 | Ga0501036_0244249 | Ga0501036_0244249_323_1468 | 371 |
| 522 | 3300049573 | Ga0501037_0112937 | Ga0501037_0112937_459_1604 | 371 |
| 523 | 3300049574 | Ga0501038_0167446 | Ga0501038_0167446_341_1486 | 371 |
| 524 | 3300049574 | Ga0501038_0204837 | Ga0501038_0204837_141_1286 | 371 |
| 525 | 3300049575 | Ga0501039_0148447 | Ga0501039_0148447_307_1452 | 371 |
| 526 | 3300049575 | Ga0501039_0183910 | Ga0501039_0183910_379_1524 | 371 |
| 527 | 3300049576 | Ga0501040_0080703 | Ga0501040_0080703_479_1624 | 371 |
| 528 | 3300049577 | Ga0501041_0053540 | Ga0501041_0053540_859_2004 | 371 |
| 529 | 3300049578 | Ga0501042_0063897 | Ga0501042_0063897_1190_2335 | 371 |
| 530 | 3300049578 | Ga0501042_0096725 | Ga0501042_0096725_558_1703 | 371 |
| 531 | 3300049579 | Ga0501043_0226910 | Ga0501043_0226910_195_1340 | 371 |
| 532 | 3300049580 | Ga0501046_0048596 | Ga0501046_0048596_1752_2897 | 371 |
| 533 | 3300049580 | Ga0501046_0156915 | Ga0501046_0156915_396_1541 | 371 |
| 534 | 3300049582 | Ga0501048_0074358 | Ga0501048_0074358_1140_2285 | 371 |
| 535 | 3300049582 | Ga0501048_0116060 | Ga0501048_0116060_451_1596 | 371 |
| 536 | 3300049584 | Ga0501068_0103069 | Ga0501068_0103069_503_1648 | 371 |
| 537 | 3300049587 | Ga0501071_0086328 | Ga0501071_0086328_343_1488 | 371 |
| 538 | 3300049588 | Ga0501072_0066312 | Ga0501072_0066312_516_1661 | 371 |
| 539 | 3300049588 | Ga0501072_0073479 | Ga0501072_0073479_1449_2594 | 371 |
| 540 | 3300049590 | Ga0501074_0095876 | Ga0501074_0095876_560_1705 | 371 |
| 541 | 3300049591 | Ga0501075_0033123 | Ga0501075_0033123_1175_2320 | 371 |
| 542 | 3300049591 | Ga0501075_0126924 | Ga0501075_0126924_582_1727 | 371 |
| 543 | 3300049592 | Ga0501076_0019153 | Ga0501076_0019153_1751_2896 | 371 |
| 544 | 3300049592 | Ga0501076_0033955 | Ga0501076_0033955_1299_2444 | 371 |
| 545 | 3300049592 | Ga0501076_0296611 | Ga0501076_0296611_25_1182 | 371 |
| 546 | 3300049593 | Ga0501077_0068213 | Ga0501077_0068213_402_1547 | 371 |
| 547 | 3300049593 | Ga0501077_0113968 | Ga0501077_0113968_190_1335 | 371 |
| 548 | 3300049741 | Ga0501079_0085673 | Ga0501079_0085673_1155_2300 | 371 |
| 549 | 3300049742 | Ga0501080_0152215 | Ga0501080_0152215_387_1532 | 371 |
| 550 | 3300049742 | Ga0501080_0166416 | Ga0501080_0166416_687_1832 | 371 |
| 551 | 3300049743 | Ga0501081_0021507 | Ga0501081_0021507_2031_3176 | 371 |
| 552 | 3300049743 | Ga0501081_0037195 | Ga0501081_0037195_727_1872 | 371 |
| 553 | 3300049744 | Ga0501083_0109286 | Ga0501083_0109286_460_1605 | 371 |
| 554 | 3300049822 | Ga0501035_0138353 | Ga0501035_0138353_431_1576 | 371 |
| 555 | 3300049824 | Ga0501045_0131801 | Ga0501045_0131801_514_1659 | 371 |
| 556 | 3300050507 | nmdc:mga05p37_140359_c2 | nmdc:mga05p37_140359_c2_918_2096 | 371 |
| 557 | 3300050507 | nmdc:mga05p37_147962_c1 | nmdc:mga05p37_147962_c1_1552_2697 | 371 |
| 558 | 3300050507 | nmdc:mga05p37_18846_c1 | nmdc:mga05p37_18846_c1_4096_5241 | 371 |
| 559 | 3300050507 | nmdc:mga05p37_214241_c1 | nmdc:mga05p37_214241_c1_1036_2181 | 371 |
| 560 | 3300050507 | nmdc:mga05p37_294342_c1 | nmdc:mga05p37_294342_c1_610_1839 | 371 |
| 561 | 3300050507 | nmdc:mga05p37_296795_c1 | nmdc:mga05p37_296795_c1_568_1713 | 371 |
| 562 | 3300050507 | nmdc:mga05p37_315224_c1 | nmdc:mga05p37_315224_c1_322_1467 | 371 |
| 563 | 3300050507 | nmdc:mga05p37_325489_c1 | nmdc:mga05p37_325489_c1_477_1622 | 371 |
| 564 | 3300050507 | nmdc:mga05p37_330387_c1 | nmdc:mga05p37_330387_c1_552_1697 | 371 |
| 565 | 3300050507 | nmdc:mga05p37_388158_c1 | nmdc:mga05p37_388158_c1_151_1296 | 371 |
| 566 | 3300050507 | nmdc:mga05p37_71184_c1 | nmdc:mga05p37_71184_c1_1929_3074 | 371 |
| 567 | 3300050508 | nmdc:mga09592_113749_c1 | nmdc:mga09592_113749_c1_905_2050 | 371 |
| 568 | 3300050508 | nmdc:mga09592_121521_c1 | nmdc:mga09592_121521_c1_127_1272 | 371 |
| 569 | 3300050508 | nmdc:mga09592_14305_c1 | nmdc:mga09592_14305_c1_868_2046 | 371 |
| 570 | 3300050508 | nmdc:mga09592_176248_c1 | nmdc:mga09592_176248_c1_98_1327 | 371 |
| 571 | 3300050508 | nmdc:mga09592_198399_c1 | nmdc:mga09592_198399_c1_120_1265 | 371 |
| 572 | 3300050508 | nmdc:mga09592_23318_c1 | nmdc:mga09592_23318_c1_3102_4247 | 371 |
| 573 | 3300050508 | nmdc:mga09592_250822_c1 | nmdc:mga09592_250822_c1_11_1156 | 371 |
| 574 | 3300050508 | nmdc:mga09592_287484_c1 | nmdc:mga09592_287484_c1_95_1240 | 371 |
| 575 | 3300050508 | nmdc:mga09592_294541_c1 | nmdc:mga09592_294541_c1_237_1382 | 371 |
| 576 | 3300050508 | nmdc:mga09592_91846_c1 | nmdc:mga09592_91846_c1_1019_2164 | 371 |
| 577 | 3300050509 | nmdc:mga0qj67_171515_c1 | nmdc:mga0qj67_171515_c1_99_1244 | 371 |
| 578 | 3300050509 | nmdc:mga0qj67_173935_c1 | nmdc:mga0qj67_173935_c1_124_1269 | 371 |
| 579 | 3300050509 | nmdc:mga0qj67_174118_c1 | nmdc:mga0qj67_174118_c1_332_1477 | 371 |
| 580 | 3300050509 | nmdc:mga0qj67_85493_c1 | nmdc:mga0qj67_85493_c1_217_1362 | 371 |
| 581 | 3300050510 | nmdc:mga06r32_131178_c1 | nmdc:mga06r32_131178_c1_171_1316 | 371 |
| 582 | 3300050510 | nmdc:mga06r32_148132_c1 | nmdc:mga06r32_148132_c1_111_1256 | 371 |
| 583 | 3300050510 | nmdc:mga06r32_20735_c1 | nmdc:mga06r32_20735_c1_861_2006 | 371 |
| 584 | 3300050510 | nmdc:mga06r32_241794_c1 | nmdc:mga06r32_241794_c1_119_1264 | 371 |
| 585 | 3300050510 | nmdc:mga06r32_255754_c1 | nmdc:mga06r32_255754_c1_197_1342 | 371 |
| 586 | 3300050510 | nmdc:mga06r32_285044_c1 | nmdc:mga06r32_285044_c1_473_1618 | 371 |
| 587 | 3300050510 | nmdc:mga06r32_339117_c1 | nmdc:mga06r32_339117_c1_147_1292 | 371 |
| 588 | 3300050510 | nmdc:mga06r32_89715_c1 | nmdc:mga06r32_89715_c1_785_1963 | 371 |
| 589 | 3300050510 | nmdc:mga06r32_90360_c1 | nmdc:mga06r32_90360_c1_1752_2897 | 371 |
| 590 | 3300050510 | nmdc:mga06r32_92706_c1 | nmdc:mga06r32_92706_c1_1752_2897 | 371 |
| 591 | 3300050511 | nmdc:mga08y16_134872_c1 | nmdc:mga08y16_134872_c1_194_1339 | 371 |
| 592 | 3300050511 | nmdc:mga08y16_185560_c1 | nmdc:mga08y16_185560_c1_35_1213 | 371 |
| 593 | 3300050511 | nmdc:mga08y16_225389_c1 | nmdc:mga08y16_225389_c1_220_1365 | 371 |
| 594 | 3300050511 | nmdc:mga08y16_58655_c1 | nmdc:mga08y16_58655_c1_723_1868 | 371 |
| 595 | 3300050511 | nmdc:mga08y16_79815_c1 | nmdc:mga08y16_79815_c1_2120_3265 | 371 |
| 596 | 3300050512 | nmdc:mga0n895_142923_c1 | nmdc:mga0n895_142923_c1_1032_2210 | 371 |
| 597 | 3300050512 | nmdc:mga0n895_274843_c1 | nmdc:mga0n895_274843_c1_103_1248 | 371 |
| 598 | 3300050512 | nmdc:mga0n895_338057_c1 | nmdc:mga0n895_338057_c1_301_1446 | 371 |
| 599 | 3300050512 | nmdc:mga0n895_408776_c1 | nmdc:mga0n895_408776_c1_125_1270 | 371 |
| 600 | 3300050512 | nmdc:mga0n895_43653_c1 | nmdc:mga0n895_43653_c1_571_1716 | 371 |
| 601 | 3300050512 | nmdc:mga0n895_93056_c1 | nmdc:mga0n895_93056_c1_1551_2696 | 371 |
| 602 | 3300050515 | nmdc:mga0a205_238460_c1 | nmdc:mga0a205_238460_c1_446_1591 | 371 |
| 603 | 3300050515 | nmdc:mga0a205_294144_c1 | nmdc:mga0a205_294144_c1_242_1387 | 371 |
| 604 | 3300050515 | nmdc:mga0a205_68006_c1 | nmdc:mga0a205_68006_c1_411_1589 | 371 |
| 605 | 3300053080 | Ga0500635_0001844 | Ga0500635_0001844_1964_3127 | 371 |
| 606 | 3300053091 | Ga0500647_0055479 | Ga0500647_0055479_664_1827 | 371 |
| 607 | 3300053162 | Ga0500638_039815 | Ga0500638_039815_812_1975 | 371 |
| 608 | 3300053177 | Ga0500636_0070043 | Ga0500636_0070043_725_1888 | 371 |
| 609 | 3300053737 | Ga0500601_001109 | Ga0500601_001109_1318_2481 | 371 |
| 610 | 3300054114 | Ga0501084_0138029 | Ga0501084_0138029_403_1548 | 371 |
| 611 | 3300054114 | Ga0501084_0186111 | Ga0501084_0186111_498_1643 | 371 |
| 612 | 3300060353 | Ga0501082_0090664 | Ga0501082_0090664_123_1268 | 371 |
| 613 | 3300060353 | Ga0501082_0214945 | Ga0501082_0214945_213_1358 | 371 |
| 614 | 3300061734 | Ga0530510_0015761 | Ga0530510_0015761_116_1261 | 371 |
| 615 | 3300061734 | Ga0530510_0146364 | Ga0530510_0146364_117_1262 | 371 |
| 616 | iso_pu_bacteria | 8016583857 | 8016586139 | 371 |
| 617 | iso_pu_bacteria | 8016583857 | 8016586216 | 371 |
| 618 | iso_pu_bacteria | 2513237092 | 2513628061 | 372 |
| 619 | iso_pu_bacteria | 2904690495 | 2904691835 | 372 |
| 620 | iso_pu_bacteria | 2906626472 | 2906629480 | 372 |
| 621 | iso_pu_bacteria | 2908756301 | 2908757862 | 372 |
| 622 | 3300031010 | Ga0265771_1000388 | Ga0265771_10003881 | 373 |
| 623 | iso_pu_bacteria | 2916041962 | 2916043385 | 373 |
| 624 | iso_pu_bacteria | 2937113482 | 2937119833 | 373 |
| 625 | iso_pu_bacteria | 2957415311 | 2957417195 | 373 |
| 626 | iso_pu_bacteria | 2960610863 | 2960611930 | 373 |
| 627 | iso_pu_bacteria | 2960687367 | 2960689294 | 373 |
| 628 | iso_pu_bacteria | 2970177841 | 2970179763 | 373 |
| 629 | iso_pu_bacteria | 2977523885 | 2977525213 | 373 |
| 630 | 3300006237 | Ga0097621_100175799 | Ga0097621_1001757992 | 374 |
| 631 | 3300025893 | Ga0207682_10044128 | Ga0207682_100441282 | 374 |
| 632 | 3300025931 | Ga0207644_10095484 | Ga0207644_100954842 | 374 |
| 633 | 3300046525 | Ga0495663_0023777 | Ga0495663_0023777_512_1684 | 374 |
| 634 | 3300046542 | Ga0495597_0038306 | Ga0495597_0038306_349_1473 | 374 |
| 635 | 3300003911 | JGI25405J52794_10012956 | JGI25405J52794_100129563 | 375 |
| 636 | 3300005439 | Ga0070711_100186894 | Ga0070711_1001868941 | 375 |
| 637 | 3300005468 | Ga0070707_100149799 | Ga0070707_1001497992 | 375 |
| 638 | 3300006175 | Ga0070712_100104009 | Ga0070712_1001040091 | 375 |
| 639 | 3300006844 | Ga0075428_100269056 | Ga0075428_1002690562 | 375 |
| 640 | 3300009147 | Ga0114129_10153380 | Ga0114129_101533802 | 375 |
| 641 | 3300031251 | Ga0265327_10051715 | Ga0265327_100517151 | 375 |
| 642 | 3300046524 | Ga0495648_0015268 | Ga0495648_0015268_1879_3081 | 375 |
| 643 | 3300053085 | Ga0495619_0121574 | Ga0495619_0121574_534_1697 | 375 |
| 644 | 3300059424 | Ga0590075_024090 | Ga0590075_024090_43_1200 | 375 |
| 645 | 3300001977 | JGI24746J21847_1008261 | JGI24746J21847_10082611 | 376 |
| 646 | 3300001978 | JGI24747J21853_1003876 | JGI24747J21853_10038761 | 376 |
| 647 | 3300001989 | JGI24739J22299_10041017 | JGI24739J22299_100410171 | 376 |
| 648 | 3300001991 | JGI24743J22301_10001747 | JGI24743J22301_100017472 | 376 |
| 649 | 3300002073 | JGI24745J21846_1002341 | JGI24745J21846_10023411 | 376 |
| 650 | 3300002074 | JGI24748J21848_1004181 | JGI24748J21848_10041811 | 376 |
| 651 | 3300002077 | JGI24744J21845_10003722 | JGI24744J21845_100037221 | 376 |
| 652 | 3300002155 | JGI24033J26618_1003691 | JGI24033J26618_10036911 | 376 |
| 653 | 3300003203 | JGI25406J46586_10036361 | JGI25406J46586_100363611 | 376 |
| 654 | 3300005327 | Ga0070658_10160378 | Ga0070658_101603781 | 376 |
| 655 | 3300005328 | Ga0070676_10051561 | Ga0070676_100515612 | 376 |
| 656 | 3300005331 | Ga0070670_100046887 | Ga0070670_1000468871 | 376 |
| 657 | 3300005335 | Ga0070666_10104035 | Ga0070666_101040351 | 376 |
| 658 | 3300005337 | Ga0070682_100097005 | Ga0070682_1000970052 | 376 |
| 659 | 3300005338 | Ga0068868_100061274 | Ga0068868_1000612742 | 376 |
| 660 | 3300005339 | Ga0070660_100095957 | Ga0070660_1000959573 | 376 |
| 661 | 3300005340 | Ga0070689_100178328 | Ga0070689_1001783281 | 376 |
| 662 | 3300005343 | Ga0070687_100070198 | Ga0070687_1000701981 | 376 |
| 663 | 3300005353 | Ga0070669_100113286 | Ga0070669_1001132861 | 376 |
| 664 | 3300005354 | Ga0070675_100093991 | Ga0070675_1000939913 | 376 |
| 665 | 3300005355 | Ga0070671_100211370 | Ga0070671_1002113701 | 376 |
| 666 | 3300005364 | Ga0070673_100039577 | Ga0070673_1000395772 | 376 |
| 667 | 3300005365 | Ga0070688_100213407 | Ga0070688_1002134071 | 376 |
| 668 | 3300005440 | Ga0070705_100089861 | Ga0070705_1000898611 | 376 |
| 669 | 3300005440 | Ga0070705_100121711 | Ga0070705_1001217111 | 376 |
| 670 | 3300005441 | Ga0070700_100105665 | Ga0070700_1001056652 | 376 |
| 671 | 3300005456 | Ga0070678_100140384 | Ga0070678_1001403842 | 376 |
| 672 | 3300005457 | Ga0070662_100117374 | Ga0070662_1001173742 | 376 |
| 673 | 3300005467 | Ga0070706_100183782 | Ga0070706_1001837821 | 376 |
| 674 | 3300005518 | Ga0070699_100144774 | Ga0070699_1001447743 | 376 |
| 675 | 3300005535 | Ga0070684_100093032 | Ga0070684_1000930323 | 376 |
| 676 | 3300005539 | Ga0068853_100146627 | Ga0068853_1001466272 | 376 |
| 677 | 3300005544 | Ga0070686_100059901 | Ga0070686_1000599012 | 376 |
| 678 | 3300005547 | Ga0070693_100072847 | Ga0070693_1000728472 | 376 |
| 679 | 3300005548 | Ga0070665_100256282 | Ga0070665_1002562821 | 376 |
| 680 | 3300005549 | Ga0070704_100161089 | Ga0070704_1001610891 | 376 |
| 681 | 3300005564 | Ga0070664_100238007 | Ga0070664_1002380071 | 376 |
| 682 | 3300005578 | Ga0068854_100171959 | Ga0068854_1001719591 | 376 |
| 683 | 3300005617 | Ga0068859_100201378 | Ga0068859_1002013782 | 376 |
| 684 | 3300005618 | Ga0068864_100084529 | Ga0068864_1000845293 | 376 |
| 685 | 3300005718 | Ga0068866_10037987 | Ga0068866_100379872 | 376 |
| 686 | 3300005841 | Ga0068863_100233521 | Ga0068863_1002335212 | 376 |
| 687 | 3300005842 | Ga0068858_100444856 | Ga0068858_1004448561 | 376 |
| 688 | 3300005843 | Ga0068860_100097671 | Ga0068860_1000976712 | 376 |
| 689 | 3300005937 | Ga0081455_10037468 | Ga0081455_100374682 | 376 |
| 690 | 3300006881 | Ga0068865_100105700 | Ga0068865_1001057003 | 376 |
| 691 | 3300006931 | Ga0097620_100201376 | Ga0097620_1002013762 | 376 |
| 692 | 3300007788 | Ga0099795_10047541 | Ga0099795_100475411 | 376 |
| 693 | 3300009098 | Ga0105245_10259206 | Ga0105245_102592061 | 376 |
| 694 | 3300009148 | Ga0105243_10160804 | Ga0105243_101608041 | 376 |
| 695 | 3300009176 | Ga0105242_10136604 | Ga0105242_101366042 | 376 |
| 696 | 3300009177 | Ga0105248_10191085 | Ga0105248_101910852 | 376 |
| 697 | 3300009545 | Ga0105237_10186964 | Ga0105237_101869642 | 376 |
| 698 | 3300010375 | Ga0105239_10353954 | Ga0105239_103539542 | 376 |
| 699 | 3300013102 | Ga0157371_10138482 | Ga0157371_101384821 | 376 |
| 700 | 3300013296 | Ga0157374_10209188 | Ga0157374_102091882 | 376 |
| 701 | 3300013306 | Ga0163162_10164747 | Ga0163162_101647471 | 376 |
| 702 | 3300013308 | Ga0157375_10199452 | Ga0157375_101994522 | 376 |
| 703 | 3300013308 | Ga0157375_10226460 | Ga0157375_102264603 | 376 |
| 704 | 3300014968 | Ga0157379_10166146 | Ga0157379_101661461 | 376 |
| 705 | 3300017792 | Ga0163161_10190241 | Ga0163161_101902411 | 376 |
| 706 | 3300025315 | Ga0207697_10072691 | Ga0207697_100726911 | 376 |
| 707 | 3300025899 | Ga0207642_10037397 | Ga0207642_100373972 | 376 |
| 708 | 3300025901 | Ga0207688_10058297 | Ga0207688_100582971 | 376 |
| 709 | 3300025901 | Ga0207688_10141090 | Ga0207688_101410902 | 376 |
| 710 | 3300025906 | Ga0207699_10178134 | Ga0207699_101781341 | 376 |
| 711 | 3300025907 | Ga0207645_10082311 | Ga0207645_100823112 | 376 |
| 712 | 3300025908 | Ga0207643_10085144 | Ga0207643_100851441 | 376 |
| 713 | 3300025910 | Ga0207684_10152673 | Ga0207684_101526732 | 376 |
| 714 | 3300025918 | Ga0207662_10037067 | Ga0207662_100370672 | 376 |
| 715 | 3300025919 | Ga0207657_10202938 | Ga0207657_102029381 | 376 |
| 716 | 3300025920 | Ga0207649_10102736 | Ga0207649_101027361 | 376 |
| 717 | 3300025927 | Ga0207687_10117642 | Ga0207687_101176421 | 376 |
| 718 | 3300025928 | Ga0207700_10159642 | Ga0207700_101596421 | 376 |
| 719 | 3300025929 | Ga0207664_10153783 | Ga0207664_101537831 | 376 |
| 720 | 3300025933 | Ga0207706_10152090 | Ga0207706_101520902 | 376 |
| 721 | 3300025935 | Ga0207709_10123769 | Ga0207709_101237691 | 376 |
| 722 | 3300025938 | Ga0207704_10152334 | Ga0207704_101523341 | 376 |
| 723 | 3300025940 | Ga0207691_10158591 | Ga0207691_101585911 | 376 |
| 724 | 3300025941 | Ga0207711_10193058 | Ga0207711_101930582 | 376 |
| 725 | 3300025942 | Ga0207689_10058015 | Ga0207689_100580152 | 376 |
| 726 | 3300025945 | Ga0207679_10274016 | Ga0207679_102740161 | 376 |
| 727 | 3300025960 | Ga0207651_10165221 | Ga0207651_101652211 | 376 |
| 728 | 3300025961 | Ga0207712_10219023 | Ga0207712_102190231 | 376 |
| 729 | 3300025972 | Ga0207668_10131079 | Ga0207668_101310792 | 376 |
| 730 | 3300025981 | Ga0207640_10037158 | Ga0207640_100371582 | 376 |
| 731 | 3300026067 | Ga0207678_10105080 | Ga0207678_101050802 | 376 |
| 732 | 3300026075 | Ga0207708_10031070 | Ga0207708_100310702 | 376 |
| 733 | 3300026075 | Ga0207708_10124288 | Ga0207708_101242882 | 376 |
| 734 | 3300026095 | Ga0207676_10208348 | Ga0207676_102083481 | 376 |
| 735 | 3300026116 | Ga0207674_10074163 | Ga0207674_100741632 | 376 |
| 736 | 3300026121 | Ga0207683_10044883 | Ga0207683_100448833 | 376 |
| 737 | 3300028379 | Ga0268266_10162001 | Ga0268266_101620011 | 376 |
| 738 | 3300028380 | Ga0268265_10296635 | Ga0268265_102966351 | 376 |
| 739 | 3300028381 | Ga0268264_10181015 | Ga0268264_101810151 | 376 |
| 740 | 3300031824 | Ga0307413_10130659 | Ga0307413_101306591 | 376 |
| 741 | 3300031852 | Ga0307410_10105031 | Ga0307410_101050312 | 376 |
| 742 | 3300031901 | Ga0307406_10116285 | Ga0307406_101162852 | 376 |
| 743 | 3300031903 | Ga0307407_10126480 | Ga0307407_101264801 | 376 |
| 744 | 3300031911 | Ga0307412_10167039 | Ga0307412_101670391 | 376 |
| 745 | 3300031995 | Ga0307409_100189203 | Ga0307409_1001892032 | 376 |
| 746 | 3300032002 | Ga0307416_100208014 | Ga0307416_1002080142 | 376 |
| 747 | 3300032004 | Ga0307414_10110067 | Ga0307414_101100672 | 376 |
| 748 | 3300032005 | Ga0307411_10142978 | Ga0307411_101429781 | 376 |
| 749 | 3300032126 | Ga0307415_100150739 | Ga0307415_1001507391 | 376 |
| 750 | 3300039437 | Ga0436365_0700849 | Ga0436365_0700849_274_1434 | 376 |
| 751 | 3300039450 | Ga0436363_1156995 | Ga0436363_1156995_506_1666 | 376 |
| 752 | 3300048905 | Ga0496102_0162272 | Ga0496102_0162272_184_1344 | 376 |
| 753 | 3300048906 | Ga0496103_0079111 | Ga0496103_0079111_727_1887 | 376 |
| 754 | 3300048918 | Ga0496115_0100162 | Ga0496115_0100162_645_1805 | 376 |
| 755 | 3300049675 | Ga0501243_008819 | Ga0501243_008819_384_1544 | 376 |
| 756 | 3300050510 | nmdc:mga06r32_436412_c1 | nmdc:mga06r32_436412_c1_12_1172 | 376 |
| 757 | 3300048903 | Ga0496100_0215467 | Ga0496100_0215467_178_1347 | 377 |
| 758 | 3300005435 | Ga0070714_100170228 | Ga0070714_1001702283 | 378 |
| 759 | 3300006173 | Ga0070716_100055988 | Ga0070716_1000559882 | 378 |
| 760 | 3300025939 | Ga0207665_10085023 | Ga0207665_100850232 | 378 |
| 761 | 3300035117 | Ga0373953_0055691 | Ga0373953_0055691_103_1275 | 378 |
| 762 | 3300035170 | Ga0373943_0103169 | Ga0373943_0103169_219_1391 | 378 |
| 763 | 3300046463 | Ga0495653_0120556 | Ga0495653_0120556_464_1636 | 378 |
| 764 | 3300046477 | Ga0495664_0107819 | Ga0495664_0107819_177_1349 | 378 |
| 765 | 3300046516 | Ga0495628_0150437 | Ga0495628_0150437_145_1317 | 378 |
| 766 | 3300048906 | Ga0496103_0105904 | Ga0496103_0105904_199_1365 | 378 |
| 767 | 3300048924 | Ga0496121_0051976 | Ga0496121_0051976_877_2025 | 378 |
| 768 | 3300053085 | Ga0495619_0125732 | Ga0495619_0125732_348_1520 | 378 |
| 769 | iso_pu_bacteria | 2509276022 | 2509398767 | 378 |
| 770 | iso_pu_bacteria | 2894232714 | 2894241453 | 378 |
| 771 | 3300005985 | Ga0081539_10074538 | Ga0081539_100745382 | 379 |
| 772 | 3300007788 | Ga0099795_10014397 | Ga0099795_100143972 | 379 |
| 773 | 3300027512 | Ga0209179_1007027 | Ga0209179_10070271 | 379 |
| 774 | 3300035083 | Ga0373926_0022972 | Ga0373926_0022972_297_1460 | 379 |
| 775 | 3300035086 | Ga0373934_0029429 | Ga0373934_0029429_881_2044 | 379 |
| 776 | 3300035111 | Ga0373923_0024422 | Ga0373923_0024422_566_1729 | 379 |
| 777 | 3300035117 | Ga0373953_0037220 | Ga0373953_0037220_252_1415 | 379 |
| 778 | 3300035118 | Ga0373954_0041247 | Ga0373954_0041247_116_1279 | 379 |
| 779 | 3300035119 | Ga0373956_0039464 | Ga0373956_0039464_739_1902 | 379 |
| 780 | 3300035120 | Ga0373957_0014082 | Ga0373957_0014082_588_1751 | 379 |
| 781 | 3300035170 | Ga0373943_0054037 | Ga0373943_0054037_199_1362 | 379 |
| 782 | 3300035172 | Ga0373955_0056092 | Ga0373955_0056092_874_2037 | 379 |
| 783 | 3300035410 | Ga0373924_0041626 | Ga0373924_0041626_123_1286 | 379 |
| 784 | 3300035692 | Ga0373935_0084765 | Ga0373935_0084765_113_1276 | 379 |
| 785 | 3300035724 | Ga0373933_0062719 | Ga0373933_0062719_326_1489 | 379 |
| 786 | 3300035725 | Ga0373947_0079596 | Ga0373947_0079596_235_1398 | 379 |
| 787 | 3300036401 | Ga0373937_0220458 | Ga0373937_0220458_529_1692 | 379 |
| 788 | 3300037068 | Ga0373925_0197552 | Ga0373925_0197552_201_1364 | 379 |
| 789 | 3300046454 | Ga0495592_0071135 | Ga0495592_0071135_1255_2418 | 379 |
| 790 | 3300046459 | Ga0495629_0109758 | Ga0495629_0109758_234_1397 | 379 |
| 791 | 3300046462 | Ga0495651_0204679 | Ga0495651_0204679_100_1263 | 379 |
| 792 | 3300046463 | Ga0495653_0026804 | Ga0495653_0026804_704_1867 | 379 |
| 793 | 3300046472 | Ga0495580_0152375 | Ga0495580_0152375_188_1351 | 379 |
| 794 | 3300046473 | Ga0495582_0127731 | Ga0495582_0127731_67_1230 | 379 |
| 795 | 3300046476 | Ga0495662_0059784 | Ga0495662_0059784_209_1372 | 379 |
| 796 | 3300046477 | Ga0495664_0069996 | Ga0495664_0069996_743_1906 | 379 |
| 797 | 3300046499 | Ga0495594_0088844 | Ga0495594_0088844_304_1467 | 379 |
| 798 | 3300046511 | Ga0495608_0095145 | Ga0495608_0095145_605_1768 | 379 |
| 799 | 3300046514 | Ga0495618_0097831 | Ga0495618_0097831_589_1752 | 379 |
| 800 | 3300046516 | Ga0495628_0116639 | Ga0495628_0116639_659_1822 | 379 |
| 801 | 3300046517 | Ga0495630_0135063 | Ga0495630_0135063_196_1359 | 379 |
| 802 | 3300046529 | Ga0495652_0122944 | Ga0495652_0122944_114_1277 | 379 |
| 803 | 3300046533 | Ga0495640_0095116 | Ga0495640_0095116_277_1440 | 379 |
| 804 | 3300046536 | Ga0495587_0077923 | Ga0495587_0077923_640_1803 | 379 |
| 805 | 3300046543 | Ga0495645_0125842 | Ga0495645_0125842_115_1278 | 379 |
| 806 | 3300046559 | Ga0495667_0070204 | Ga0495667_0070204_505_1668 | 379 |
| 807 | 3300046642 | Ga0495634_0082615 | Ga0495634_0082615_832_1995 | 379 |
| 808 | 3300046663 | Ga0495635_0069964 | Ga0495635_0069964_570_1733 | 379 |
| 809 | 3300046675 | Ga0495657_0097023 | Ga0495657_0097023_184_1347 | 379 |
| 810 | 3300046678 | Ga0495599_0087520 | Ga0495599_0087520_518_1681 | 379 |
| 811 | 3300046679 | Ga0495623_0130625 | Ga0495623_0130625_112_1275 | 379 |
| 812 | 3300046680 | Ga0495646_0065162 | Ga0495646_0065162_482_1645 | 379 |
| 813 | 3300046689 | Ga0495613_0104524 | Ga0495613_0104524_339_1502 | 379 |
| 814 | 3300046690 | Ga0495624_0103569 | Ga0495624_0103569_462_1625 | 379 |
| 815 | 3300046809 | Ga0495600_0086625 | Ga0495600_0086625_584_1747 | 379 |
| 816 | 3300047317 | Ga0495604_0125798 | Ga0495604_0125798_153_1316 | 379 |
| 817 | 3300047319 | Ga0495674_0112845 | Ga0495674_0112845_133_1296 | 379 |
| 818 | 3300047321 | Ga0495676_0087846 | Ga0495676_0087846_219_1382 | 379 |
| 819 | 3300047322 | Ga0495680_0116214 | Ga0495680_0116214_111_1274 | 379 |
| 820 | 3300047444 | Ga0495675_0070438 | Ga0495675_0070438_452_1615 | 379 |
| 821 | 3300047471 | Ga0495684_0117712 | Ga0495684_0117712_741_1904 | 379 |
| 822 | 3300047673 | Ga0495593_0056823 | Ga0495593_0056823_167_1330 | 379 |
| 823 | 3300048088 | Ga0495602_0147045 | Ga0495602_0147045_153_1316 | 379 |
| 824 | 3300048089 | Ga0495614_0046798 | Ga0495614_0046798_222_1385 | 379 |
| 825 | 3300053077 | Ga0495601_0108958 | Ga0495601_0108958_94_1257 | 379 |
| 826 | 3300053084 | Ga0495595_0054233 | Ga0495595_0054233_560_1723 | 379 |
| 827 | 3300053085 | Ga0495619_0053191 | Ga0495619_0053191_972_2135 | 379 |
| 828 | iso_pu_bacteria | 2508501114 | 2509074005 | 379 |
| 829 | iso_pu_bacteria | 2517572143 | 2517896288 | 379 |
| 830 | iso_pu_bacteria | 2528768022 | 2528855657 | 379 |
| 831 | iso_pu_bacteria | 2582581315 | 2585329032 | 379 |
| 832 | iso_pu_bacteria | 2977864932 | 2977866094 | 379 |
| 833 | 3300005434 | Ga0070709_10095920 | Ga0070709_100959202 | 380 |
| 834 | 3300005435 | Ga0070714_100181083 | Ga0070714_1001810832 | 380 |
| 835 | 3300005436 | Ga0070713_100170128 | Ga0070713_1001701281 | 380 |
| 836 | 3300005437 | Ga0070710_10053386 | Ga0070710_100533862 | 380 |
| 837 | 3300005439 | Ga0070711_100036660 | Ga0070711_1000366602 | 380 |
| 838 | 3300005564 | Ga0070664_100113082 | Ga0070664_1001130824 | 380 |
| 839 | 3300006028 | Ga0070717_10173475 | Ga0070717_101734752 | 380 |
| 840 | 3300006173 | Ga0070716_100086094 | Ga0070716_1000860942 | 380 |
| 841 | 3300006175 | Ga0070712_100273002 | Ga0070712_1002730021 | 380 |
| 842 | 3300006178 | Ga0075367_10082312 | Ga0075367_100823121 | 380 |
| 843 | 3300006871 | Ga0075434_100239939 | Ga0075434_1002399392 | 380 |
| 844 | 3300021361 | Ga0213872_10046034 | Ga0213872_100460342 | 380 |
| 845 | 3300025898 | Ga0207692_10023051 | Ga0207692_100230511 | 380 |
| 846 | 3300025915 | Ga0207693_10219567 | Ga0207693_102195671 | 380 |
| 847 | 3300025916 | Ga0207663_10106052 | Ga0207663_101060521 | 380 |
| 848 | 3300025929 | Ga0207664_10012633 | Ga0207664_100126331 | 380 |
| 849 | 3300025939 | Ga0207665_10046964 | Ga0207665_100469641 | 380 |
| 850 | 3300025945 | Ga0207679_10154138 | Ga0207679_101541381 | 380 |
| 851 | 3300039438 | Ga0436360_0136438 | Ga0436360_0136438_66_1232 | 380 |
| 852 | 3300039447 | Ga0436361_0242002 | Ga0436361_0242002_427_1593 | 380 |
| 853 | 3300039453 | Ga0436362_1240782 | Ga0436362_1240782_1163_2329 | 380 |
| 854 | 3300041459 | Ga0451800_1108730 | Ga0451800_1108730_212_1384 | 380 |
| 855 | 3300048907 | Ga0496104_0188026 | Ga0496104_0188026_593_1765 | 380 |
| 856 | 3300048912 | Ga0496109_0217097 | Ga0496109_0217097_147_1319 | 380 |
| 857 | 3300048913 | Ga0496110_0061683 | Ga0496110_0061683_568_1740 | 380 |
| 858 | 3300048915 | Ga0496112_0218055 | Ga0496112_0218055_503_1675 | 380 |
| 859 | 3300048916 | Ga0496113_0186533 | Ga0496113_0186533_375_1547 | 380 |
| 860 | iso_pu_bacteria | 2508501050 | 2508728110 | 380 |
| 861 | iso_pu_bacteria | 2582581305 | 2585261060 | 380 |
| 862 | iso_pu_bacteria | 2585427528 | 2585543877 | 380 |
| 863 | iso_pu_bacteria | 2718217882 | 2719179016 | 380 |
| 864 | iso_pu_bacteria | 2718217882 | 2719184509 | 380 |
| 865 | iso_pu_bacteria | 2718218009 | 2719728529 | 380 |
| 866 | iso_pu_bacteria | 2718218009 | 2719729381 | 380 |
| 867 | iso_pu_bacteria | 2718218233 | 2720618054 | 380 |
| 868 | iso_pu_bacteria | 2718218235 | 2720634248 | 380 |
| 869 | iso_pu_bacteria | 2718218363 | 2721143628 | 380 |
| 870 | iso_pu_bacteria | 2718218363 | 2721144220 | 380 |
| 871 | iso_pu_bacteria | 2718218365 | 2721155131 | 380 |
| 872 | iso_pu_bacteria | 2718218365 | 2721155380 | 380 |
| 873 | iso_pu_bacteria | 2718218365 | 2721158614 | 380 |
| 874 | iso_pu_bacteria | 2718218366 | 2721166724 | 380 |
| 875 | iso_pu_bacteria | 2721755514 | 2722837702 | 380 |
| 876 | iso_pu_bacteria | 2721755556 | 2723030542 | 380 |
| 877 | iso_pu_bacteria | 2721755684 | 2723558603 | 380 |
| 878 | iso_pu_bacteria | 2721755684 | 2723563554 | 380 |
| 879 | iso_pu_bacteria | 2721755684 | 2723563800 | 380 |
| 880 | iso_pu_bacteria | 2721755684 | 2723564904 | 380 |
| 881 | iso_pu_bacteria | 2721755810 | 2724041274 | 380 |
| 882 | iso_pu_bacteria | 2721755810 | 2724041554 | 380 |
| 883 | iso_pu_bacteria | 2728369352 | 2730111075 | 380 |
| 884 | iso_pu_bacteria | 2728369365 | 2730161477 | 380 |
| 885 | iso_pu_bacteria | 2728369397 | 2730296013 | 380 |
| 886 | iso_pu_bacteria | 2728369397 | 2730296260 | 380 |
| 887 | iso_pu_bacteria | 2728369397 | 2730298246 | 380 |
| 888 | iso_pu_bacteria | 2751185800 | 2753361038 | 380 |
| 889 | iso_pu_bacteria | 2818991448 | 2819613895 | 380 |
| 890 | iso_pu_bacteria | 2921250672 | 2921256104 | 380 |
| 891 | iso_pu_bacteria | 8005282627 | 8005284202 | 380 |
| 892 | iso_pu_bacteria | 8005497431 | 8005500065 | 380 |
| 893 | iso_pu_bacteria | 8005497431 | 8005502321 | 380 |
| 894 | iso_pu_bacteria | 8005668836 | 8005671482 | 380 |
| 895 | iso_pu_bacteria | 8005668836 | 8005673748 | 380 |
| 896 | iso_pu_bacteria | 8005668836 | 8005674360 | 380 |
| 897 | 3300021377 | Ga0213874_10003712 | Ga0213874_100037124 | 381 |
| 898 | 3300039450 | Ga0436363_0019643 | Ga0436363_0019643_2224_3375 | 381 |
| 899 | iso_pu_bacteria | 2510917028 | 2511183881 | 381 |
| 900 | iso_pu_bacteria | 2582581867 | 2585402136 | 381 |
| 901 | iso_pu_bacteria | 2582581867 | 2585403822 | 381 |
| 902 | iso_pu_bacteria | 2582581867 | 2585404382 | 381 |
| 903 | iso_pu_bacteria | 2582581867 | 2585404457 | 381 |
| 904 | iso_pu_bacteria | 2835312727 | 2835315997 | 381 |
| 905 | iso_pu_bacteria | 2835312727 | 2835318508 | 381 |
| 906 | iso_pu_bacteria | 2835312727 | 2835319039 | 381 |
| 907 | iso_pu_bacteria | 2835312727 | 2835319621 | 381 |
| 908 | iso_pu_bacteria | 2882632389 | 2882632406 | 381 |
| 909 | 3300011119 | Ga0105246_10152185 | Ga0105246_101521852 | 382 |
| 910 | 3300025908 | Ga0207643_10102932 | Ga0207643_101029322 | 382 |
| 911 | 3300031548 | Ga0307408_100165794 | Ga0307408_1001657942 | 382 |
| 912 | 3300031852 | Ga0307410_10170955 | Ga0307410_101709551 | 382 |
| 913 | 3300031911 | Ga0307412_10216449 | Ga0307412_102164491 | 382 |
| 914 | 3300032002 | Ga0307416_100440712 | Ga0307416_1004407121 | 382 |
| 915 | 3300032004 | Ga0307414_10295592 | Ga0307414_102955921 | 382 |
| 916 | 3300035170 | Ga0373943_0069740 | Ga0373943_0069740_139_1290 | 382 |
| 917 | 3300035692 | Ga0373935_0160901 | Ga0373935_0160901_359_1510 | 382 |
| 918 | 3300035725 | Ga0373947_0054945 | Ga0373947_0054945_991_2142 | 382 |
| 919 | 3300037471 | Ga0395905_0218948 | Ga0395905_0218948_499_1665 | 382 |
| 920 | iso_pu_bacteria | 2510065059 | 2510319618 | 382 |
| 921 | iso_pu_bacteria | 2881161766 | 2881163860 | 382 |
| 922 | iso_pu_bacteria | 2881161766 | 2881165828 | 382 |
| 923 | iso_pu_bacteria | 2888350351 | 2888351580 | 382 |
| 924 | iso_pu_bacteria | 2889010040 | 2889016638 | 382 |
| 925 | iso_pu_bacteria | 2906328253 | 2906329274 | 382 |
| 926 | iso_pu_bacteria | 2977864932 | 2977870922 | 382 |
| 927 | iso_pu_bacteria | 2977864932 | 2977871717 | 382 |
| 928 | iso_pu_bacteria | 2979742915 | 2979746122 | 382 |
| 929 | 3300005288 | Ga0065714_10099650 | Ga0065714_100996501 | 383 |
| 930 | 3300005331 | Ga0070670_100307627 | Ga0070670_1003076272 | 383 |
| 931 | 3300005335 | Ga0070666_10141490 | Ga0070666_101414902 | 383 |
| 932 | 3300005339 | Ga0070660_100121771 | Ga0070660_1001217712 | 383 |
| 933 | 3300005355 | Ga0070671_100216550 | Ga0070671_1002165502 | 383 |
| 934 | 3300005364 | Ga0070673_100170657 | Ga0070673_1001706573 | 383 |
| 935 | 3300005456 | Ga0070678_100289976 | Ga0070678_1002899761 | 383 |
| 936 | 3300005459 | Ga0068867_100027947 | Ga0068867_1000279471 | 383 |
| 937 | 3300005544 | Ga0070686_100126765 | Ga0070686_1001267652 | 383 |
| 938 | 3300005841 | Ga0068863_100302161 | Ga0068863_1003021611 | 383 |
| 939 | 3300005843 | Ga0068860_100199421 | Ga0068860_1001994212 | 383 |
| 940 | 3300009098 | Ga0105245_10133327 | Ga0105245_101333273 | 383 |
| 941 | 3300009101 | Ga0105247_10153492 | Ga0105247_101534922 | 383 |
| 942 | 3300009553 | Ga0105249_10261650 | Ga0105249_102616503 | 383 |
| 943 | 3300013308 | Ga0157375_10212999 | Ga0157375_102129992 | 383 |
| 944 | 3300014968 | Ga0157379_10234219 | Ga0157379_102342191 | 383 |
| 945 | 3300017792 | Ga0163161_10182136 | Ga0163161_101821361 | 383 |
| 946 | 3300025903 | Ga0207680_10124285 | Ga0207680_101242852 | 383 |
| 947 | 3300025919 | Ga0207657_10027420 | Ga0207657_100274203 | 383 |
| 948 | 3300025927 | Ga0207687_10085062 | Ga0207687_100850623 | 383 |
| 949 | 3300025927 | Ga0207687_10188744 | Ga0207687_101887441 | 383 |
| 950 | 3300025931 | Ga0207644_10147929 | Ga0207644_101479292 | 383 |
| 951 | 3300025941 | Ga0207711_10146464 | Ga0207711_101464641 | 383 |
| 952 | 3300026088 | Ga0207641_10300848 | Ga0207641_103008482 | 383 |
| 953 | 3300026118 | Ga0207675_100304327 | Ga0207675_1003043271 | 383 |
| 954 | 3300026121 | Ga0207683_10243911 | Ga0207683_102439112 | 383 |
| 955 | 3300028800 | Ga0265338_10114313 | Ga0265338_101143132 | 383 |
| 956 | 3300031249 | Ga0265339_10119329 | Ga0265339_101193291 | 383 |
| 957 | 3300031852 | Ga0307410_10032892 | Ga0307410_100328921 | 383 |
| 958 | 3300044684 | Ga0466966_0056572 | Ga0466966_0056572_1024_2190 | 383 |
| 959 | 3300048903 | Ga0496100_0212350 | Ga0496100_0212350_157_1311 | 383 |
| 960 | 3300048905 | Ga0496102_0238395 | Ga0496102_0238395_302_1456 | 383 |
| 961 | 3300048907 | Ga0496104_0310640 | Ga0496104_0310640_176_1330 | 383 |
| 962 | 3300048908 | Ga0496105_0257579 | Ga0496105_0257579_207_1361 | 383 |
| 963 | 3300048910 | Ga0496107_0177593 | Ga0496107_0177593_278_1432 | 383 |
| 964 | 3300048911 | Ga0496108_0308227 | Ga0496108_0308227_82_1236 | 383 |
| 965 | 3300048913 | Ga0496110_0138916 | Ga0496110_0138916_133_1287 | 383 |
| 966 | 3300053102 | Ga0500554_021448 | Ga0500554_021448_501_1670 | 383 |
| 967 | 3300053136 | Ga0500559_0037907 | Ga0500559_0037907_496_1674 | 383 |
| 968 | iso_pu_bacteria | 2503198000 | 2503204429 | 383 |
| 969 | iso_pu_bacteria | 2510917028 | 2511183372 | 383 |
| 970 | iso_pu_bacteria | 2513237103 | 2513713642 | 383 |
| 971 | iso_pu_bacteria | 2516143018 | 2516207572 | 383 |
| 972 | iso_pu_bacteria | 2643221618 | 2644104678 | 383 |
| 973 | iso_pu_bacteria | 2643221655 | 2644313098 | 383 |
| 974 | iso_pu_bacteria | 2643221712 | 2644612721 | 383 |
| 975 | iso_pu_bacteria | 2882632389 | 2882640561 | 383 |
| 976 | iso_pu_bacteria | 2924754689 | 2924762770 | 383 |
| 977 | iso_pu_bacteria | 2941499720 | 2941502269 | 383 |
| 978 | iso_pu_bacteria | 2958064165 | 2958069110 | 383 |
| 979 | iso_pu_bacteria | 2977828996 | 2977832907 | 383 |
| 980 | iso_pu_bacteria | 2977864932 | 2977866360 | 383 |
| 981 | iso_pu_bacteria | 2996341866 | 2996343817 | 383 |
| 982 | iso_pu_bacteria | 643692032 | 643692287 | 383 |
| 983 | 3300002739 | JGI25158J39367_1000017 | JGI25158J39367_100001729 | 384 |
| 984 | 3300002987 | JGI25159J45721_1000239 | JGI25159J45721_100023922 | 384 |
| 985 | 3300003354 | JGI25160J50197_1000513 | JGI25160J50197_100051319 | 384 |
| 986 | 3300003374 | JGI25161J50226_1000102 | JGI25161J50226_100010243 | 384 |
| 987 | 3300003775 | Ga0055524_1005861 | Ga0055524_10058611 | 384 |
| 988 | 3300003792 | Ga0055540_1021203 | Ga0055540_10212031 | 384 |
| 989 | 3300003792 | Ga0055540_1026271 | Ga0055540_10262711 | 384 |
| 990 | 3300004625 | Ga0055543_1000016 | Ga0055543_10000164 | 384 |
| 991 | 3300005262 | Ga0065165_1001457 | Ga0065165_10014577 | 384 |
| 992 | 3300006186 | Ga0075369_10044288 | Ga0075369_100442883 | 384 |
| 993 | 3300014326 | Ga0157380_10066469 | Ga0157380_100664691 | 384 |
| 994 | 3300025208 | Ga0209436_100003 | Ga0209436_100003172 | 384 |
| 995 | 3300025273 | Ga0209673_1000638 | Ga0209673_100063829 | 384 |
| 996 | 3300025284 | Ga0209130_1000051 | Ga0209130_100005140 | 384 |
| 997 | 3300025295 | Ga0209564_1001097 | Ga0209564_100109712 | 384 |
| 998 | 3300025299 | Ga0209256_1000578 | Ga0209256_100057829 | 384 |
| 999 | 3300025299 | Ga0209256_1017981 | Ga0209256_10179813 | 384 |
| 1000 | 3300025302 | Ga0207426_1000043 | Ga0207426_1000043258 | 384 |
| 1001 | 3300025303 | Ga0209051_1004206 | Ga0209051_10042069 | 384 |
| 1002 | 3300025303 | Ga0209051_1013113 | Ga0209051_10131133 | 384 |
| 1003 | 3300041413 | Ga0439465_0031299 | Ga0439465_0031299_49_1215 | 384 |
| 1004 | 3300050489 | nmdc:mga03683_87601_c1 | nmdc:mga03683_87601_c1_70_1236 | 384 |
| 1005 | 3300050496 | nmdc:mga07m45_24001_c1 | nmdc:mga07m45_24001_c1_333_1499 | 384 |
| 1006 | 3300053093 | Ga0500651_0039906 | Ga0500651_0039906_354_1523 | 384 |
| 1007 | 3300053153 | Ga0500616_0056185 | Ga0500616_0056185_556_1722 | 384 |
| 1008 | iso_pu_bacteria | 2643221618 | 2644108266 | 384 |
| 1009 | iso_pu_bacteria | 2643221655 | 2644307285 | 384 |
| 1010 | iso_pu_bacteria | 2643221659 | 2644331301 | 384 |
| 1011 | iso_pu_bacteria | 2643221712 | 2644613374 | 384 |
| 1012 | iso_pu_bacteria | 2855839649 | 2855846186 | 384 |
| 1013 | iso_pu_bacteria | 2855839649 | 2855846192 | 384 |
| 1014 | iso_pu_bacteria | 2855839649 | 2855846369 | 384 |
| 1015 | iso_pu_bacteria | 2874123672 | 2874128924 | 384 |
| 1016 | iso_pu_bacteria | 2876808645 | 2876815429 | 384 |
| 1017 | iso_pu_bacteria | 2879110137 | 2879110441 | 384 |
| 1018 | iso_pu_bacteria | 2882632389 | 2882637974 | 384 |
| 1019 | iso_pu_bacteria | 2916028427 | 2916030709 | 384 |
| 1020 | iso_pu_bacteria | 2916055098 | 2916058652 | 384 |
| 1021 | iso_pu_bacteria | 2921201388 | 2921208424 | 384 |
| 1022 | iso_pu_bacteria | 2921263974 | 2921268934 | 384 |
| 1023 | iso_pu_bacteria | 2924158325 | 2924164426 | 384 |
| 1024 | iso_pu_bacteria | 2924172951 | 2924175208 | 384 |
| 1025 | iso_pu_bacteria | 2937042894 | 2937048201 | 384 |
| 1026 | iso_pu_bacteria | 2937106411 | 2937106645 | 384 |
| 1027 | iso_pu_bacteria | 2957478035 | 2957481281 | 384 |
| 1028 | iso_pu_bacteria | 2957498199 | 2957501192 | 384 |
| 1029 | iso_pu_bacteria | 2964628898 | 2964635841 | 384 |
| 1030 | iso_pu_bacteria | 2964670856 | 2964676747 | 384 |
| 1031 | iso_pu_bacteria | 2967664464 | 2967664884 | 384 |
| 1032 | iso_pu_bacteria | 2967678726 | 2967686020 | 384 |
| 1033 | iso_pu_bacteria | 2967714385 | 2967720304 | 384 |
| 1034 | iso_pu_bacteria | 2967775926 | 2967779262 | 384 |
| 1035 | iso_pu_bacteria | 2970054988 | 2970055543 | 384 |
| 1036 | iso_pu_bacteria | 2970156795 | 2970157264 | 384 |
| 1037 | iso_pu_bacteria | 637000159 | 637078005 | 384 |
| 1038 | iso_pu_bacteria | 8006984368 | 8006992112 | 384 |
| 1039 | 3300001990 | JGI24737J22298_10013530 | JGI24737J22298_100135301 | 385 |
| 1040 | 3300001991 | JGI24743J22301_10003049 | JGI24743J22301_100030491 | 385 |
| 1041 | 3300002070 | JGI24750J21931_1001808 | JGI24750J21931_10018083 | 385 |
| 1042 | 3300002073 | JGI24745J21846_1002996 | JGI24745J21846_10029961 | 385 |
| 1043 | 3300002075 | JGI24738J21930_10007082 | JGI24738J21930_100070821 | 385 |
| 1044 | 3300002076 | JGI24749J21850_1002463 | JGI24749J21850_10024633 | 385 |
| 1045 | 3300002239 | JGI24034J26672_10002224 | JGI24034J26672_100022241 | 385 |
| 1046 | 3300002239 | JGI24034J26672_10002409 | JGI24034J26672_100024093 | 385 |
| 1047 | 3300005330 | Ga0070690_100039305 | Ga0070690_1000393052 | 385 |
| 1048 | 3300005336 | Ga0070680_100076817 | Ga0070680_1000768171 | 385 |
| 1049 | 3300005338 | Ga0068868_100126253 | Ga0068868_1001262533 | 385 |
| 1050 | 3300005339 | Ga0070660_100065696 | Ga0070660_1000656962 | 385 |
| 1051 | 3300005341 | Ga0070691_10024936 | Ga0070691_100249364 | 385 |
| 1052 | 3300005345 | Ga0070692_10081101 | Ga0070692_100811012 | 385 |
| 1053 | 3300005347 | Ga0070668_100069633 | Ga0070668_1000696333 | 385 |
| 1054 | 3300005353 | Ga0070669_100060312 | Ga0070669_1000603123 | 385 |
| 1055 | 3300005356 | Ga0070674_100052849 | Ga0070674_1000528491 | 385 |
| 1056 | 3300005356 | Ga0070674_100157563 | Ga0070674_1001575631 | 385 |
| 1057 | 3300005365 | Ga0070688_100049876 | Ga0070688_1000498763 | 385 |
| 1058 | 3300005366 | Ga0070659_100090289 | Ga0070659_1000902892 | 385 |
| 1059 | 3300005436 | Ga0070713_100235794 | Ga0070713_1002357941 | 385 |
| 1060 | 3300005441 | Ga0070700_100052392 | Ga0070700_1000523921 | 385 |
| 1061 | 3300005457 | Ga0070662_100085487 | Ga0070662_1000854873 | 385 |
| 1062 | 3300005459 | Ga0068867_100064341 | Ga0068867_1000643411 | 385 |
| 1063 | 3300005459 | Ga0068867_100322214 | Ga0068867_1003222141 | 385 |
| 1064 | 3300005471 | Ga0070698_100224098 | Ga0070698_1002240981 | 385 |
| 1065 | 3300005535 | Ga0070684_100147199 | Ga0070684_1001471993 | 385 |
| 1066 | 3300005539 | Ga0068853_100072271 | Ga0068853_1000722711 | 385 |
| 1067 | 3300005543 | Ga0070672_100063166 | Ga0070672_1000631663 | 385 |
| 1068 | 3300005544 | Ga0070686_100052466 | Ga0070686_1000524662 | 385 |
| 1069 | 3300005545 | Ga0070695_100027876 | Ga0070695_1000278762 | 385 |
| 1070 | 3300005546 | Ga0070696_100057457 | Ga0070696_1000574571 | 385 |
| 1071 | 3300005547 | Ga0070693_100032304 | Ga0070693_1000323042 | 385 |
| 1072 | 3300005547 | Ga0070693_100035389 | Ga0070693_1000353892 | 385 |
| 1073 | 3300005548 | Ga0070665_100173567 | Ga0070665_1001735673 | 385 |
| 1074 | 3300005549 | Ga0070704_100062100 | Ga0070704_1000621003 | 385 |
| 1075 | 3300005563 | Ga0068855_100125369 | Ga0068855_1001253694 | 385 |
| 1076 | 3300005577 | Ga0068857_100337153 | Ga0068857_1003371531 | 385 |
| 1077 | 3300005616 | Ga0068852_100079887 | Ga0068852_1000798872 | 385 |
| 1078 | 3300005617 | Ga0068859_100214114 | Ga0068859_1002141142 | 385 |
| 1079 | 3300005718 | Ga0068866_10023944 | Ga0068866_100239443 | 385 |
| 1080 | 3300005719 | Ga0068861_100059763 | Ga0068861_1000597632 | 385 |
| 1081 | 3300005834 | Ga0068851_10029329 | Ga0068851_100293293 | 385 |
| 1082 | 3300005842 | Ga0068858_100194365 | Ga0068858_1001943653 | 385 |
| 1083 | 3300005843 | Ga0068860_100259413 | Ga0068860_1002594132 | 385 |
| 1084 | 3300005844 | Ga0068862_100094868 | Ga0068862_1000948683 | 385 |
| 1085 | 3300005983 | Ga0081540_1032803 | Ga0081540_10328032 | 385 |
| 1086 | 3300006028 | Ga0070717_10028590 | Ga0070717_100285906 | 385 |
| 1087 | 3300006038 | Ga0075365_10000237 | Ga0075365_1000023714 | 385 |
| 1088 | 3300006237 | Ga0097621_100369276 | Ga0097621_1003692761 | 385 |
| 1089 | 3300006358 | Ga0068871_100188192 | Ga0068871_1001881922 | 385 |
| 1090 | 3300006931 | Ga0097620_100214115 | Ga0097620_1002141152 | 385 |
| 1091 | 3300007265 | Ga0099794_10037080 | Ga0099794_100370802 | 385 |
| 1092 | 3300009176 | Ga0105242_10042694 | Ga0105242_100426941 | 385 |
| 1093 | 3300009177 | Ga0105248_10265291 | Ga0105248_102652911 | 385 |
| 1094 | 3300009551 | Ga0105238_10155951 | Ga0105238_101559512 | 385 |
| 1095 | 3300009553 | Ga0105249_10087969 | Ga0105249_100879692 | 385 |
| 1096 | 3300010159 | Ga0099796_10031997 | Ga0099796_100319971 | 385 |
| 1097 | 3300010375 | Ga0105239_10350117 | Ga0105239_103501172 | 385 |
| 1098 | 3300013100 | Ga0157373_10147401 | Ga0157373_101474012 | 385 |
| 1099 | 3300013105 | Ga0157369_10034157 | Ga0157369_100341571 | 385 |
| 1100 | 3300013306 | Ga0163162_10123215 | Ga0163162_101232152 | 385 |
| 1101 | 3300014745 | Ga0157377_10056938 | Ga0157377_100569382 | 385 |
| 1102 | 3300014968 | Ga0157379_10089881 | Ga0157379_100898812 | 385 |
| 1103 | 3300014969 | Ga0157376_10168647 | Ga0157376_101686471 | 385 |
| 1104 | 3300014969 | Ga0157376_10192738 | Ga0157376_101927382 | 385 |
| 1105 | 3300017792 | Ga0163161_10047094 | Ga0163161_100470942 | 385 |
| 1106 | 3300025315 | Ga0207697_10067500 | Ga0207697_100675001 | 385 |
| 1107 | 3300025321 | Ga0207656_10020468 | Ga0207656_100204681 | 385 |
| 1108 | 3300025901 | Ga0207688_10006342 | Ga0207688_100063424 | 385 |
| 1109 | 3300025903 | Ga0207680_10141499 | Ga0207680_101414991 | 385 |
| 1110 | 3300025904 | Ga0207647_10024961 | Ga0207647_100249614 | 385 |
| 1111 | 3300025907 | Ga0207645_10111662 | Ga0207645_101116622 | 385 |
| 1112 | 3300025913 | Ga0207695_10181228 | Ga0207695_101812282 | 385 |
| 1113 | 3300025914 | Ga0207671_10069987 | Ga0207671_100699871 | 385 |
| 1114 | 3300025918 | Ga0207662_10047126 | Ga0207662_100471262 | 385 |
| 1115 | 3300025919 | Ga0207657_10160948 | Ga0207657_101609482 | 385 |
| 1116 | 3300025923 | Ga0207681_10296772 | Ga0207681_102967721 | 385 |
| 1117 | 3300025924 | Ga0207694_10067966 | Ga0207694_100679661 | 385 |
| 1118 | 3300025932 | Ga0207690_10179921 | Ga0207690_101799211 | 385 |
| 1119 | 3300025933 | Ga0207706_10084757 | Ga0207706_100847571 | 385 |
| 1120 | 3300025936 | Ga0207670_10057092 | Ga0207670_100570922 | 385 |
| 1121 | 3300025937 | Ga0207669_10139873 | Ga0207669_101398731 | 385 |
| 1122 | 3300025940 | Ga0207691_10175945 | Ga0207691_101759451 | 385 |
| 1123 | 3300025941 | Ga0207711_10216361 | Ga0207711_102163611 | 385 |
| 1124 | 3300025942 | Ga0207689_10149536 | Ga0207689_101495361 | 385 |
| 1125 | 3300025949 | Ga0207667_10116556 | Ga0207667_101165562 | 385 |
| 1126 | 3300025961 | Ga0207712_10070453 | Ga0207712_100704531 | 385 |
| 1127 | 3300025972 | Ga0207668_10254341 | Ga0207668_102543411 | 385 |
| 1128 | 3300025981 | Ga0207640_10047237 | Ga0207640_100472372 | 385 |
| 1129 | 3300025986 | Ga0207658_10124148 | Ga0207658_101241482 | 385 |
| 1130 | 3300026035 | Ga0207703_10256407 | Ga0207703_102564071 | 385 |
| 1131 | 3300026075 | Ga0207708_10041968 | Ga0207708_100419681 | 385 |
| 1132 | 3300026078 | Ga0207702_10240583 | Ga0207702_102405832 | 385 |
| 1133 | 3300026089 | Ga0207648_10098061 | Ga0207648_100980612 | 385 |
| 1134 | 3300026116 | Ga0207674_10155203 | Ga0207674_101552032 | 385 |
| 1135 | 3300026118 | Ga0207675_100211147 | Ga0207675_1002111471 | 385 |
| 1136 | 3300026121 | Ga0207683_10155014 | Ga0207683_101550142 | 385 |
| 1137 | 3300026121 | Ga0207683_10232163 | Ga0207683_102321631 | 385 |
| 1138 | 3300026142 | Ga0207698_10172916 | Ga0207698_101729162 | 385 |
| 1139 | 3300027111 | Ga0209281_1012592 | Ga0209281_10125921 | 385 |
| 1140 | 3300027512 | Ga0209179_1013132 | Ga0209179_10131321 | 385 |
| 1141 | 3300027671 | Ga0209588_1037461 | Ga0209588_10374611 | 385 |
| 1142 | 3300028379 | Ga0268266_10256057 | Ga0268266_102560571 | 385 |
| 1143 | 3300028794 | Ga0307515_10272353 | Ga0307515_102723531 | 385 |
| 1144 | 3300035119 | Ga0373956_0097093 | Ga0373956_0097093_73_1239 | 385 |
| 1145 | 3300037312 | Ga0395899_0151556 | Ga0395899_0151556_102_1259 | 385 |
| 1146 | 3300037418 | Ga0395900_0117244 | Ga0395900_0117244_1028_2185 | 385 |
| 1147 | 3300037466 | Ga0395898_0077001 | Ga0395898_0077001_600_1757 | 385 |
| 1148 | 3300039447 | Ga0436361_0092328 | Ga0436361_0092328_598_1758 | 385 |
| 1149 | 3300046457 | Ga0495590_0003911 | Ga0495590_0003911_4151_5311 | 385 |
| 1150 | 3300046491 | Ga0495584_0012657 | Ga0495584_0012657_2078_3238 | 385 |
| 1151 | 3300046492 | Ga0495585_0078038 | Ga0495585_0078038_417_1577 | 385 |
| 1152 | 3300046506 | Ga0495583_0029184 | Ga0495583_0029184_811_1968 | 385 |
| 1153 | 3300046506 | Ga0495583_0063724 | Ga0495583_0063724_313_1515 | 385 |
| 1154 | 3300046512 | Ga0495610_0043752 | Ga0495610_0043752_767_1927 | 385 |
| 1155 | 3300046513 | Ga0495616_0000239 | Ga0495616_0000239_43113_44273 | 385 |
| 1156 | 3300046515 | Ga0495620_0022767 | Ga0495620_0022767_346_1506 | 385 |
| 1157 | 3300046516 | Ga0495628_0112734 | Ga0495628_0112734_328_1488 | 385 |
| 1158 | 3300046519 | Ga0495632_0009988 | Ga0495632_0009988_196_1356 | 385 |
| 1159 | 3300046520 | Ga0495637_0047770 | Ga0495637_0047770_209_1369 | 385 |
| 1160 | 3300046522 | Ga0495643_0003559 | Ga0495643_0003559_7236_8396 | 385 |
| 1161 | 3300046533 | Ga0495640_0058489 | Ga0495640_0058489_950_2110 | 385 |
| 1162 | 3300046536 | Ga0495587_0024811 | Ga0495587_0024811_1278_2438 | 385 |
| 1163 | 3300046542 | Ga0495597_0016421 | Ga0495597_0016421_1114_2274 | 385 |
| 1164 | 3300046558 | Ga0495633_0012801 | Ga0495633_0012801_2380_3537 | 385 |
| 1165 | 3300046648 | Ga0495611_0038485 | Ga0495611_0038485_513_1673 | 385 |
| 1166 | 3300046660 | Ga0495625_0011433 | Ga0495625_0011433_1089_2249 | 385 |
| 1167 | 3300046694 | Ga0495649_0003870 | Ga0495649_0003870_6195_7355 | 385 |
| 1168 | 3300046810 | Ga0495660_0037115 | Ga0495660_0037115_699_1859 | 385 |
| 1169 | 3300047317 | Ga0495604_0167957 | Ga0495604_0167957_305_1465 | 385 |
| 1170 | 3300047323 | Ga0495683_0017636 | Ga0495683_0017636_195_1355 | 385 |
| 1171 | 3300047443 | Ga0495687_005675 | Ga0495687_005675_1863_3023 | 385 |
| 1172 | 3300048091 | Ga0495626_0035838 | Ga0495626_0035838_679_1839 | 385 |
| 1173 | 3300048903 | Ga0496100_0049336 | Ga0496100_0049336_183_1349 | 385 |
| 1174 | 3300048904 | Ga0496101_0062655 | Ga0496101_0062655_86_1252 | 385 |
| 1175 | 3300048905 | Ga0496102_0198578 | Ga0496102_0198578_97_1263 | 385 |
| 1176 | 3300048906 | Ga0496103_0022814 | Ga0496103_0022814_2480_3646 | 385 |
| 1177 | 3300048909 | Ga0496106_0035659 | Ga0496106_0035659_1184_2350 | 385 |
| 1178 | 3300048910 | Ga0496107_0064211 | Ga0496107_0064211_93_1259 | 385 |
| 1179 | 3300048911 | Ga0496108_0082218 | Ga0496108_0082218_1417_2583 | 385 |
| 1180 | 3300048912 | Ga0496109_0093101 | Ga0496109_0093101_216_1382 | 385 |
| 1181 | 3300048913 | Ga0496110_0089496 | Ga0496110_0089496_1438_2604 | 385 |
| 1182 | 3300048920 | Ga0496117_0037958 | Ga0496117_0037958_1246_2403 | 385 |
| 1183 | 3300048924 | Ga0496121_0000190 | Ga0496121_0000190_115335_116492 | 385 |
| 1184 | 3300048929 | Ga0496126_0003079 | Ga0496126_0003079_16215_17372 | 385 |
| 1185 | 3300049460 | Ga0495682_0027510 | Ga0495682_0027510_144_1304 | 385 |
| 1186 | 3300050492 | nmdc:mga0yw44_51736_c1 | nmdc:mga0yw44_51736_c1_114_1274 | 385 |
| 1187 | 3300053094 | Ga0500566_0096029 | Ga0500566_0096029_359_1516 | 385 |
| 1188 | 3300053136 | Ga0500559_0049240 | Ga0500559_0049240_416_1576 | 385 |
| 1189 | 3300053138 | Ga0500564_108019 | Ga0500564_108019_19_1176 | 385 |
| 1190 | 3300053730 | Ga0500645_014651 | Ga0500645_014651_1029_2186 | 385 |
| 1191 | 3300005356 | Ga0070674_100140269 | Ga0070674_1001402692 | 386 |
| 1192 | 3300005467 | Ga0070706_100087796 | Ga0070706_1000877961 | 386 |
| 1193 | 3300025928 | Ga0207700_10233032 | Ga0207700_102330321 | 386 |
| 1194 | 3300031711 | Ga0265314_10058171 | Ga0265314_100581713 | 386 |
| 1195 | 3300033180 | Ga0307510_10156464 | Ga0307510_101564641 | 386 |
| 1196 | 3300035083 | Ga0373926_0010123 | Ga0373926_0010123_1554_2726 | 386 |
| 1197 | 3300035086 | Ga0373934_0066146 | Ga0373934_0066146_30_1202 | 386 |
| 1198 | 3300035111 | Ga0373923_0013618 | Ga0373923_0013618_1400_2572 | 386 |
| 1199 | 3300035116 | Ga0373945_0020878 | Ga0373945_0020878_709_1881 | 386 |
| 1200 | 3300035118 | Ga0373954_0052933 | Ga0373954_0052933_546_1718 | 386 |
| 1201 | 3300035120 | Ga0373957_0035934 | Ga0373957_0035934_520_1692 | 386 |
| 1202 | 3300035171 | Ga0373946_0044419 | Ga0373946_0044419_540_1712 | 386 |
| 1203 | 3300035172 | Ga0373955_0049563 | Ga0373955_0049563_770_1942 | 386 |
| 1204 | 3300035410 | Ga0373924_0026767 | Ga0373924_0026767_887_2059 | 386 |
| 1205 | 3300035724 | Ga0373933_0182282 | Ga0373933_0182282_28_1200 | 386 |
| 1206 | 3300036401 | Ga0373937_0294051 | Ga0373937_0294051_237_1409 | 386 |
| 1207 | 3300046454 | Ga0495592_0131939 | Ga0495592_0131939_382_1554 | 386 |
| 1208 | 3300046459 | Ga0495629_0097991 | Ga0495629_0097991_607_1779 | 386 |
| 1209 | 3300046462 | Ga0495651_0120157 | Ga0495651_0120157_210_1382 | 386 |
| 1210 | 3300046463 | Ga0495653_0101691 | Ga0495653_0101691_516_1688 | 386 |
| 1211 | 3300046472 | Ga0495580_0099626 | Ga0495580_0099626_463_1635 | 386 |
| 1212 | 3300046477 | Ga0495664_0091647 | Ga0495664_0091647_416_1588 | 386 |
| 1213 | 3300046499 | Ga0495594_0131058 | Ga0495594_0131058_90_1262 | 386 |
| 1214 | 3300046511 | Ga0495608_0062185 | Ga0495608_0062185_413_1585 | 386 |
| 1215 | 3300046514 | Ga0495618_0106589 | Ga0495618_0106589_412_1584 | 386 |
| 1216 | 3300046516 | Ga0495628_0136738 | Ga0495628_0136738_490_1662 | 386 |
| 1217 | 3300046517 | Ga0495630_0140897 | Ga0495630_0140897_206_1378 | 386 |
| 1218 | 3300046526 | Ga0495666_0036384 | Ga0495666_0036384_405_1577 | 386 |
| 1219 | 3300046529 | Ga0495652_0160158 | Ga0495652_0160158_185_1357 | 386 |
| 1220 | 3300046533 | Ga0495640_0102247 | Ga0495640_0102247_491_1663 | 386 |
| 1221 | 3300046535 | Ga0495586_0052048 | Ga0495586_0052048_406_1578 | 386 |
| 1222 | 3300046535 | Ga0495586_0111999 | Ga0495586_0111999_197_1369 | 386 |
| 1223 | 3300046536 | Ga0495587_0047790 | Ga0495587_0047790_965_2137 | 386 |
| 1224 | 3300046559 | Ga0495667_0122914 | Ga0495667_0122914_91_1263 | 386 |
| 1225 | 3300046642 | Ga0495634_0118667 | Ga0495634_0118667_432_1604 | 386 |
| 1226 | 3300046663 | Ga0495635_0117420 | Ga0495635_0117420_241_1413 | 386 |
| 1227 | 3300046675 | Ga0495657_0097182 | Ga0495657_0097182_548_1720 | 386 |
| 1228 | 3300046678 | Ga0495599_0119386 | Ga0495599_0119386_411_1583 | 386 |
| 1229 | 3300046679 | Ga0495623_0058022 | Ga0495623_0058022_394_1566 | 386 |
| 1230 | 3300046680 | Ga0495646_0090238 | Ga0495646_0090238_341_1513 | 386 |
| 1231 | 3300046681 | Ga0495647_0038784 | Ga0495647_0038784_17_1189 | 386 |
| 1232 | 3300046689 | Ga0495613_0225731 | Ga0495613_0225731_20_1192 | 386 |
| 1233 | 3300046690 | Ga0495624_0051568 | Ga0495624_0051568_933_2105 | 386 |
| 1234 | 3300047315 | Ga0495581_0110903 | Ga0495581_0110903_123_1295 | 386 |
| 1235 | 3300047317 | Ga0495604_0153214 | Ga0495604_0153214_436_1608 | 386 |
| 1236 | 3300047319 | Ga0495674_0128953 | Ga0495674_0128953_70_1242 | 386 |
| 1237 | 3300047322 | Ga0495680_0126830 | Ga0495680_0126830_126_1298 | 386 |
| 1238 | 3300047444 | Ga0495675_0133742 | Ga0495675_0133742_211_1383 | 386 |
| 1239 | 3300047469 | Ga0495673_0000025 | Ga0495673_0000025_134280_135440 | 386 |
| 1240 | 3300047471 | Ga0495684_0107933 | Ga0495684_0107933_415_1587 | 386 |
| 1241 | 3300048088 | Ga0495602_0111996 | Ga0495602_0111996_401_1573 | 386 |
| 1242 | 3300048089 | Ga0495614_0075101 | Ga0495614_0075101_188_1360 | 386 |
| 1243 | 3300049579 | Ga0501043_0039063 | Ga0501043_0039063_746_1906 | 386 |
| 1244 | 3300049823 | Ga0501044_0347322 | Ga0501044_0347322_221_1381 | 386 |
| 1245 | 3300053085 | Ga0495619_0212567 | Ga0495619_0212567_28_1200 | 386 |
| 1246 | 3300001991 | JGI24743J22301_10009186 | JGI24743J22301_100091862 | 387 |
| 1247 | 3300005329 | Ga0070683_100196421 | Ga0070683_1001964212 | 387 |
| 1248 | 3300005331 | Ga0070670_100132265 | Ga0070670_1001322652 | 387 |
| 1249 | 3300005337 | Ga0070682_100085558 | Ga0070682_1000855582 | 387 |
| 1250 | 3300005338 | Ga0068868_100098812 | Ga0068868_1000988122 | 387 |
| 1251 | 3300005339 | Ga0070660_100199812 | Ga0070660_1001998121 | 387 |
| 1252 | 3300005341 | Ga0070691_10094421 | Ga0070691_100944212 | 387 |
| 1253 | 3300005344 | Ga0070661_100168746 | Ga0070661_1001687461 | 387 |
| 1254 | 3300005355 | Ga0070671_100182528 | Ga0070671_1001825281 | 387 |
| 1255 | 3300005434 | Ga0070709_10079394 | Ga0070709_100793941 | 387 |
| 1256 | 3300005434 | Ga0070709_10126851 | Ga0070709_101268512 | 387 |
| 1257 | 3300005435 | Ga0070714_100134109 | Ga0070714_1001341092 | 387 |
| 1258 | 3300005436 | Ga0070713_100187871 | Ga0070713_1001878712 | 387 |
| 1259 | 3300005437 | Ga0070710_10087246 | Ga0070710_100872461 | 387 |
| 1260 | 3300005441 | Ga0070700_100152800 | Ga0070700_1001528001 | 387 |
| 1261 | 3300005456 | Ga0070678_100233602 | Ga0070678_1002336022 | 387 |
| 1262 | 3300005459 | Ga0068867_100177894 | Ga0068867_1001778941 | 387 |
| 1263 | 3300005518 | Ga0070699_100196855 | Ga0070699_1001968552 | 387 |
| 1264 | 3300005530 | Ga0070679_100298246 | Ga0070679_1002982462 | 387 |
| 1265 | 3300005535 | Ga0070684_100295794 | Ga0070684_1002957941 | 387 |
| 1266 | 3300005536 | Ga0070697_100207462 | Ga0070697_1002074622 | 387 |
| 1267 | 3300005545 | Ga0070695_100126396 | Ga0070695_1001263961 | 387 |
| 1268 | 3300005546 | Ga0070696_100088711 | Ga0070696_1000887112 | 387 |
| 1269 | 3300005547 | Ga0070693_100132237 | Ga0070693_1001322371 | 387 |
| 1270 | 3300005548 | Ga0070665_100282284 | Ga0070665_1002822841 | 387 |
| 1271 | 3300005563 | Ga0068855_100200293 | Ga0068855_1002002931 | 387 |
| 1272 | 3300005564 | Ga0070664_100158082 | Ga0070664_1001580821 | 387 |
| 1273 | 3300005578 | Ga0068854_100154959 | Ga0068854_1001549591 | 387 |
| 1274 | 3300005614 | Ga0068856_100127785 | Ga0068856_1001277853 | 387 |
| 1275 | 3300005614 | Ga0068856_100204652 | Ga0068856_1002046522 | 387 |
| 1276 | 3300005614 | Ga0068856_100362757 | Ga0068856_1003627571 | 387 |
| 1277 | 3300005615 | Ga0070702_100074057 | Ga0070702_1000740571 | 387 |
| 1278 | 3300005618 | Ga0068864_100219732 | Ga0068864_1002197322 | 387 |
| 1279 | 3300005618 | Ga0068864_100293770 | Ga0068864_1002937701 | 387 |
| 1280 | 3300005719 | Ga0068861_100158170 | Ga0068861_1001581701 | 387 |
| 1281 | 3300005834 | Ga0068851_10080757 | Ga0068851_100807571 | 387 |
| 1282 | 3300005840 | Ga0068870_10089223 | Ga0068870_100892232 | 387 |
| 1283 | 3300005841 | Ga0068863_100200631 | Ga0068863_1002006311 | 387 |
| 1284 | 3300005843 | Ga0068860_100272084 | Ga0068860_1002720841 | 387 |
| 1285 | 3300005937 | Ga0081455_10046581 | Ga0081455_100465812 | 387 |
| 1286 | 3300006163 | Ga0070715_10092648 | Ga0070715_100926482 | 387 |
| 1287 | 3300006175 | Ga0070712_100023822 | Ga0070712_1000238223 | 387 |
| 1288 | 3300006175 | Ga0070712_100118513 | Ga0070712_1001185132 | 387 |
| 1289 | 3300006237 | Ga0097621_100155150 | Ga0097621_1001551502 | 387 |
| 1290 | 3300006358 | Ga0068871_100239595 | Ga0068871_1002395951 | 387 |
| 1291 | 3300006871 | Ga0075434_100139403 | Ga0075434_1001394032 | 387 |
| 1292 | 3300009101 | Ga0105247_10112449 | Ga0105247_101124491 | 387 |
| 1293 | 3300009148 | Ga0105243_10154633 | Ga0105243_101546331 | 387 |
| 1294 | 3300009174 | Ga0105241_10116136 | Ga0105241_101161362 | 387 |
| 1295 | 3300010375 | Ga0105239_10296049 | Ga0105239_102960491 | 387 |
| 1296 | 3300010375 | Ga0105239_10315092 | Ga0105239_103150921 | 387 |
| 1297 | 3300011119 | Ga0105246_10179428 | Ga0105246_101794281 | 387 |
| 1298 | 3300013100 | Ga0157373_10139260 | Ga0157373_101392601 | 387 |
| 1299 | 3300013105 | Ga0157369_10194162 | Ga0157369_101941622 | 387 |
| 1300 | 3300013296 | Ga0157374_10226799 | Ga0157374_102267991 | 387 |
| 1301 | 3300013306 | Ga0163162_10259820 | Ga0163162_102598201 | 387 |
| 1302 | 3300014326 | Ga0157380_10346207 | Ga0157380_103462071 | 387 |
| 1303 | 3300015261 | Ga0182006_1037985 | Ga0182006_10379851 | 387 |
| 1304 | 3300024227 | Ga0228598_1016767 | Ga0228598_10167671 | 387 |
| 1305 | 3300025315 | Ga0207697_10057659 | Ga0207697_100576591 | 387 |
| 1306 | 3300025321 | Ga0207656_10018708 | Ga0207656_100187082 | 387 |
| 1307 | 3300025885 | Ga0207653_10010653 | Ga0207653_100106532 | 387 |
| 1308 | 3300025898 | Ga0207692_10087156 | Ga0207692_100871561 | 387 |
| 1309 | 3300025905 | Ga0207685_10090782 | Ga0207685_100907821 | 387 |
| 1310 | 3300025906 | Ga0207699_10038640 | Ga0207699_100386402 | 387 |
| 1311 | 3300025911 | Ga0207654_10134631 | Ga0207654_101346311 | 387 |
| 1312 | 3300025915 | Ga0207693_10050815 | Ga0207693_100508152 | 387 |
| 1313 | 3300025915 | Ga0207693_10054163 | Ga0207693_100541632 | 387 |
| 1314 | 3300025916 | Ga0207663_10162719 | Ga0207663_101627191 | 387 |
| 1315 | 3300025921 | Ga0207652_10191568 | Ga0207652_101915682 | 387 |
| 1316 | 3300025922 | Ga0207646_10085312 | Ga0207646_100853123 | 387 |
| 1317 | 3300025924 | Ga0207694_10167132 | Ga0207694_101671321 | 387 |
| 1318 | 3300025928 | Ga0207700_10061188 | Ga0207700_100611882 | 387 |
| 1319 | 3300025928 | Ga0207700_10084330 | Ga0207700_100843301 | 387 |
| 1320 | 3300025929 | Ga0207664_10184830 | Ga0207664_101848301 | 387 |
| 1321 | 3300025931 | Ga0207644_10155737 | Ga0207644_101557371 | 387 |
| 1322 | 3300025931 | Ga0207644_10199542 | Ga0207644_101995421 | 387 |
| 1323 | 3300025936 | Ga0207670_10176473 | Ga0207670_101764731 | 387 |
| 1324 | 3300025939 | Ga0207665_10105827 | Ga0207665_101058272 | 387 |
| 1325 | 3300025941 | Ga0207711_10265947 | Ga0207711_102659471 | 387 |
| 1326 | 3300025942 | Ga0207689_10280483 | Ga0207689_102804831 | 387 |
| 1327 | 3300025944 | Ga0207661_10144957 | Ga0207661_101449572 | 387 |
| 1328 | 3300025945 | Ga0207679_10224435 | Ga0207679_102244351 | 387 |
| 1329 | 3300025949 | Ga0207667_10293975 | Ga0207667_102939751 | 387 |
| 1330 | 3300025960 | Ga0207651_10236558 | Ga0207651_102365581 | 387 |
| 1331 | 3300025981 | Ga0207640_10126586 | Ga0207640_101265862 | 387 |
| 1332 | 3300026023 | Ga0207677_10180695 | Ga0207677_101806951 | 387 |
| 1333 | 3300026023 | Ga0207677_10217403 | Ga0207677_102174031 | 387 |
| 1334 | 3300026075 | Ga0207708_10151776 | Ga0207708_101517762 | 387 |
| 1335 | 3300026078 | Ga0207702_10257253 | Ga0207702_102572531 | 387 |
| 1336 | 3300026095 | Ga0207676_10158789 | Ga0207676_101587892 | 387 |
| 1337 | 3300027312 | Ga0209371_1014098 | Ga0209371_10140982 | 387 |
| 1338 | 3300027907 | Ga0207428_10172822 | Ga0207428_101728221 | 387 |
| 1339 | 3300028794 | Ga0307515_10159094 | Ga0307515_101590941 | 387 |
| 1340 | 3300030500 | Ga0268256_1015307 | Ga0268256_10153071 | 387 |
| 1341 | 3300035112 | Ga0373932_0022780 | Ga0373932_0022780_423_1598 | 387 |
| 1342 | 3300035207 | Ga0373942_0015044 | Ga0373942_0015044_351_1526 | 387 |
| 1343 | 3300035691 | Ga0373931_0029914 | Ga0373931_0029914_1141_2316 | 387 |
| 1344 | 3300037471 | Ga0395905_0245497 | Ga0395905_0245497_377_1540 | 387 |
| 1345 | 3300039438 | Ga0436360_1035749 | Ga0436360_1035749_311_1477 | 387 |
| 1346 | 3300039447 | Ga0436361_0020797 | Ga0436361_0020797_154_1317 | 387 |
| 1347 | 3300039447 | Ga0436361_0311593 | Ga0436361_0311593_249_1415 | 387 |
| 1348 | 3300039447 | Ga0436361_0544795 | Ga0436361_0544795_230_1396 | 387 |
| 1349 | 3300041491 | Ga0451833_1253448 | Ga0451833_1253448_813_1976 | 387 |
| 1350 | 3300046506 | Ga0495583_0026640 | Ga0495583_0026640_1343_2575 | 387 |
| 1351 | 3300046506 | Ga0495583_0083780 | Ga0495583_0083780_28_1191 | 387 |
| 1352 | 3300046515 | Ga0495620_0054010 | Ga0495620_0054010_183_1346 | 387 |
| 1353 | 3300046518 | Ga0495631_0047803 | Ga0495631_0047803_110_1273 | 387 |
| 1354 | 3300046520 | Ga0495637_0019012 | Ga0495637_0019012_1740_2903 | 387 |
| 1355 | 3300046522 | Ga0495643_0074231 | Ga0495643_0074231_467_1699 | 387 |
| 1356 | 3300046533 | Ga0495640_0162460 | Ga0495640_0162460_237_1400 | 387 |
| 1357 | 3300046538 | Ga0495609_0050774 | Ga0495609_0050774_148_1311 | 387 |
| 1358 | 3300046542 | Ga0495597_0055793 | Ga0495597_0055793_113_1276 | 387 |
| 1359 | 3300046660 | Ga0495625_0076778 | Ga0495625_0076778_484_1647 | 387 |
| 1360 | 3300046674 | Ga0495588_0012534 | Ga0495588_0012534_2361_3524 | 387 |
| 1361 | 3300046809 | Ga0495600_0062515 | Ga0495600_0062515_387_1550 | 387 |
| 1362 | 3300046810 | Ga0495660_0078778 | Ga0495660_0078778_234_1397 | 387 |
| 1363 | 3300047472 | Ga0495686_0098249 | Ga0495686_0098249_519_1682 | 387 |
| 1364 | 3300048903 | Ga0496100_0165211 | Ga0496100_0165211_183_1358 | 387 |
| 1365 | 3300048905 | Ga0496102_0297064 | Ga0496102_0297064_331_1506 | 387 |
| 1366 | 3300048908 | Ga0496105_0086155 | Ga0496105_0086155_772_1950 | 387 |
| 1367 | 3300048908 | Ga0496105_0183730 | Ga0496105_0183730_295_1470 | 387 |
| 1368 | 3300048909 | Ga0496106_0184404 | Ga0496106_0184404_155_1330 | 387 |
| 1369 | 3300048910 | Ga0496107_0140945 | Ga0496107_0140945_351_1526 | 387 |
| 1370 | 3300048910 | Ga0496107_0154013 | Ga0496107_0154013_344_1519 | 387 |
| 1371 | 3300048911 | Ga0496108_0193680 | Ga0496108_0193680_261_1436 | 387 |
| 1372 | 3300048911 | Ga0496108_0227953 | Ga0496108_0227953_125_1300 | 387 |
| 1373 | 3300048912 | Ga0496109_0176547 | Ga0496109_0176547_206_1381 | 387 |
| 1374 | 3300048912 | Ga0496109_0359981 | Ga0496109_0359981_175_1350 | 387 |
| 1375 | 3300048913 | Ga0496110_0216288 | Ga0496110_0216288_433_1608 | 387 |
| 1376 | 3300048915 | Ga0496112_0185062 | Ga0496112_0185062_538_1713 | 387 |
| 1377 | 3300048915 | Ga0496112_0228308 | Ga0496112_0228308_121_1296 | 387 |
| 1378 | 3300048916 | Ga0496113_0153181 | Ga0496113_0153181_313_1488 | 387 |
| 1379 | 3300048917 | Ga0496114_0211286 | Ga0496114_0211286_173_1348 | 387 |
| 1380 | 3300048929 | Ga0496126_0133142 | Ga0496126_0133142_751_1914 | 387 |
| 1381 | 3300050511 | nmdc:mga08y16_133291_c1 | nmdc:mga08y16_133291_c1_490_1668 | 387 |
| 1382 | 3300050512 | nmdc:mga0n895_285705_c1 | nmdc:mga0n895_285705_c1_297_1472 | 387 |
| 1383 | 3300050512 | nmdc:mga0n895_362978_c1 | nmdc:mga0n895_362978_c1_25_1203 | 387 |
| 1384 | 3300050513 | nmdc:mga0rr50_47412_c1 | nmdc:mga0rr50_47412_c1_1827_3002 | 387 |
| 1385 | 3300050514 | nmdc:mga08x19_89542_c1 | nmdc:mga08x19_89542_c1_246_1421 | 387 |
| 1386 | 3300053077 | Ga0495601_0192801 | Ga0495601_0192801_14_1180 | 387 |
| 1387 | 3300053078 | Ga0495612_0051706 | Ga0495612_0051706_382_1557 | 387 |
| 1388 | 3300053079 | Ga0500610_0072123 | Ga0500610_0072123_339_1502 | 387 |
| 1389 | 3300053083 | Ga0495655_0028530 | Ga0495655_0028530_139_1317 | 387 |
| 1390 | 3300053088 | Ga0500644_0054719 | Ga0500644_0054719_87_1250 | 387 |
| 1391 | 3300053103 | Ga0500555_002499 | Ga0500555_002499_427_1590 | 387 |
| 1392 | 3300053104 | Ga0500556_0004459 | Ga0500556_0004459_2470_3633 | 387 |
| 1393 | 3300053117 | Ga0500593_055703 | Ga0500593_055703_261_1424 | 387 |
| 1394 | 3300053130 | Ga0500642_0016575 | Ga0500642_0016575_986_2149 | 387 |
| 1395 | 3300053131 | Ga0500652_027022 | Ga0500652_027022_706_1869 | 387 |
| 1396 | 3300053133 | Ga0500655_007591 | Ga0500655_007591_462_1625 | 387 |
| 1397 | 3300053134 | Ga0500658_0059787 | Ga0500658_0059787_94_1257 | 387 |
| 1398 | 3300053136 | Ga0500559_0068892 | Ga0500559_0068892_90_1259 | 387 |
| 1399 | 3300053139 | Ga0500568_0000561 | Ga0500568_0000561_22342_23508 | 387 |
| 1400 | 2162886006 | SwRhRL3b_contig_901166 | SwRhRL3b_0776.00001330 | 388 |
| 1401 | 2162886007 | SwRhRL2b_contig_3722764 | SwRhRL2b_0630.00007200 | 388 |
| 1402 | 3300001978 | JGI24747J21853_1001542 | JGI24747J21853_10015422 | 388 |
| 1403 | 3300001979 | JGI24740J21852_10027188 | JGI24740J21852_100271882 | 388 |
| 1404 | 3300001979 | JGI24740J21852_10044782 | JGI24740J21852_100447821 | 388 |
| 1405 | 3300001989 | JGI24739J22299_10036364 | JGI24739J22299_100363641 | 388 |
| 1406 | 3300002067 | JGI24735J21928_10029427 | JGI24735J21928_100294271 | 388 |
| 1407 | 3300002074 | JGI24748J21848_1003907 | JGI24748J21848_10039072 | 388 |
| 1408 | 3300002075 | JGI24738J21930_10012844 | JGI24738J21930_100128442 | 388 |
| 1409 | 3300002076 | JGI24749J21850_1007154 | JGI24749J21850_10071542 | 388 |
| 1410 | 3300002077 | JGI24744J21845_10011910 | JGI24744J21845_100119102 | 388 |
| 1411 | 3300002704 | JGI25155J39150_1001521 | JGI25155J39150_10015211 | 388 |
| 1412 | 3300002705 | JGI25156J39149_1014887 | JGI25156J39149_10148871 | 388 |
| 1413 | 3300002738 | JGI25154J39366_1007017 | JGI25154J39366_10070171 | 388 |
| 1414 | 3300002741 | JGI25157J39369_1007435 | JGI25157J39369_10074351 | 388 |
| 1415 | 3300003187 | JGI25151J46595_10009973 | JGI25151J46595_100099732 | 388 |
| 1416 | 3300003187 | JGI25151J46595_10039500 | JGI25151J46595_100395001 | 388 |
| 1417 | 3300003775 | Ga0055524_1005219 | Ga0055524_10052195 | 388 |
| 1418 | 3300005290 | Ga0065712_10125824 | Ga0065712_101258241 | 388 |
| 1419 | 3300005293 | Ga0065715_10013205 | Ga0065715_100132051 | 388 |
| 1420 | 3300005295 | Ga0065707_10142377 | Ga0065707_101423772 | 388 |
| 1421 | 3300005295 | Ga0065707_10143099 | Ga0065707_101430992 | 388 |
| 1422 | 3300005331 | Ga0070670_100093751 | Ga0070670_1000937513 | 388 |
| 1423 | 3300005333 | Ga0070677_10041932 | Ga0070677_100419323 | 388 |
| 1424 | 3300005336 | Ga0070680_100161604 | Ga0070680_1001616042 | 388 |
| 1425 | 3300005339 | Ga0070660_100228539 | Ga0070660_1002285392 | 388 |
| 1426 | 3300005340 | Ga0070689_100167805 | Ga0070689_1001678052 | 388 |
| 1427 | 3300005343 | Ga0070687_100037081 | Ga0070687_1000370813 | 388 |
| 1428 | 3300005343 | Ga0070687_100118645 | Ga0070687_1001186451 | 388 |
| 1429 | 3300005345 | Ga0070692_10081430 | Ga0070692_100814302 | 388 |
| 1430 | 3300005353 | Ga0070669_100139391 | Ga0070669_1001393913 | 388 |
| 1431 | 3300005406 | Ga0070703_10026842 | Ga0070703_100268421 | 388 |
| 1432 | 3300005406 | Ga0070703_10030498 | Ga0070703_100304981 | 388 |
| 1433 | 3300005434 | Ga0070709_10113157 | Ga0070709_101131571 | 388 |
| 1434 | 3300005435 | Ga0070714_100124646 | Ga0070714_1001246462 | 388 |
| 1435 | 3300005437 | Ga0070710_10152923 | Ga0070710_101529231 | 388 |
| 1436 | 3300005438 | Ga0070701_10068120 | Ga0070701_100681202 | 388 |
| 1437 | 3300005439 | Ga0070711_100183368 | Ga0070711_1001833681 | 388 |
| 1438 | 3300005444 | Ga0070694_100070545 | Ga0070694_1000705452 | 388 |
| 1439 | 3300005444 | Ga0070694_100198382 | Ga0070694_1001983821 | 388 |
| 1440 | 3300005455 | Ga0070663_100150145 | Ga0070663_1001501452 | 388 |
| 1441 | 3300005456 | Ga0070678_100041137 | Ga0070678_1000411374 | 388 |
| 1442 | 3300005457 | Ga0070662_100167397 | Ga0070662_1001673972 | 388 |
| 1443 | 3300005458 | Ga0070681_10244983 | Ga0070681_102449832 | 388 |
| 1444 | 3300005518 | Ga0070699_100198739 | Ga0070699_1001987392 | 388 |
| 1445 | 3300005518 | Ga0070699_100250383 | Ga0070699_1002503832 | 388 |
| 1446 | 3300005530 | Ga0070679_100097033 | Ga0070679_1000970334 | 388 |
| 1447 | 3300005535 | Ga0070684_100140765 | Ga0070684_1001407651 | 388 |
| 1448 | 3300005536 | Ga0070697_100270405 | Ga0070697_1002704052 | 388 |
| 1449 | 3300005539 | Ga0068853_100244220 | Ga0068853_1002442202 | 388 |
| 1450 | 3300005543 | Ga0070672_100134215 | Ga0070672_1001342153 | 388 |
| 1451 | 3300005544 | Ga0070686_100109627 | Ga0070686_1001096272 | 388 |
| 1452 | 3300005547 | Ga0070693_100096992 | Ga0070693_1000969922 | 388 |
| 1453 | 3300005549 | Ga0070704_100188625 | Ga0070704_1001886252 | 388 |
| 1454 | 3300005563 | Ga0068855_100208482 | Ga0068855_1002084823 | 388 |
| 1455 | 3300005564 | Ga0070664_100063426 | Ga0070664_1000634262 | 388 |
| 1456 | 3300005578 | Ga0068854_100213748 | Ga0068854_1002137482 | 388 |
| 1457 | 3300005615 | Ga0070702_100119008 | Ga0070702_1001190082 | 388 |
| 1458 | 3300005616 | Ga0068852_100294680 | Ga0068852_1002946801 | 388 |
| 1459 | 3300005617 | Ga0068859_100458018 | Ga0068859_1004580182 | 388 |
| 1460 | 3300005618 | Ga0068864_100223167 | Ga0068864_1002231672 | 388 |
| 1461 | 3300005719 | Ga0068861_100069458 | Ga0068861_1000694584 | 388 |
| 1462 | 3300005719 | Ga0068861_100069897 | Ga0068861_1000698972 | 388 |
| 1463 | 3300005840 | Ga0068870_10123059 | Ga0068870_101230591 | 388 |
| 1464 | 3300005842 | Ga0068858_100246762 | Ga0068858_1002467622 | 388 |
| 1465 | 3300005843 | Ga0068860_100443086 | Ga0068860_1004430861 | 388 |
| 1466 | 3300005844 | Ga0068862_100155612 | Ga0068862_1001556123 | 388 |
| 1467 | 3300006163 | Ga0070715_10065874 | Ga0070715_100658741 | 388 |
| 1468 | 3300006163 | Ga0070715_10110393 | Ga0070715_101103931 | 388 |
| 1469 | 3300006175 | Ga0070712_100139273 | Ga0070712_1001392732 | 388 |
| 1470 | 3300006177 | Ga0075362_10027549 | Ga0075362_100275492 | 388 |
| 1471 | 3300006195 | Ga0075366_10098877 | Ga0075366_100988772 | 388 |
| 1472 | 3300006237 | Ga0097621_100236899 | Ga0097621_1002368992 | 388 |
| 1473 | 3300006358 | Ga0068871_100064536 | Ga0068871_1000645364 | 388 |
| 1474 | 3300006852 | Ga0075433_10168083 | Ga0075433_101680831 | 388 |
| 1475 | 3300006871 | Ga0075434_100247405 | Ga0075434_1002474052 | 388 |
| 1476 | 3300006871 | Ga0075434_100256741 | Ga0075434_1002567412 | 388 |
| 1477 | 3300006881 | Ga0068865_100234443 | Ga0068865_1002344432 | 388 |
| 1478 | 3300006914 | Ga0075436_100057442 | Ga0075436_1000574422 | 388 |
| 1479 | 3300006931 | Ga0097620_100458013 | Ga0097620_1004580131 | 388 |
| 1480 | 3300007076 | Ga0075435_100113724 | Ga0075435_1001137243 | 388 |
| 1481 | 3300007265 | Ga0099794_10055581 | Ga0099794_100555812 | 388 |
| 1482 | 3300009036 | Ga0105244_10067882 | Ga0105244_100678822 | 388 |
| 1483 | 3300009092 | Ga0105250_10036507 | Ga0105250_100365072 | 388 |
| 1484 | 3300009093 | Ga0105240_10318397 | Ga0105240_103183972 | 388 |
| 1485 | 3300009098 | Ga0105245_10224149 | Ga0105245_102241492 | 388 |
| 1486 | 3300009101 | Ga0105247_10124936 | Ga0105247_101249362 | 388 |
| 1487 | 3300009147 | Ga0114129_10256015 | Ga0114129_102560152 | 388 |
| 1488 | 3300009174 | Ga0105241_10177138 | Ga0105241_101771382 | 388 |
| 1489 | 3300009174 | Ga0105241_10200440 | Ga0105241_102004402 | 388 |
| 1490 | 3300009174 | Ga0105241_10259302 | Ga0105241_102593022 | 388 |
| 1491 | 3300009553 | Ga0105249_10362762 | Ga0105249_103627622 | 388 |
| 1492 | 3300010159 | Ga0099796_10043800 | Ga0099796_100438001 | 388 |
| 1493 | 3300010375 | Ga0105239_10447305 | Ga0105239_104473051 | 388 |
| 1494 | 3300012477 | Ga0157336_1000317 | Ga0157336_10003172 | 388 |
| 1495 | 3300012507 | Ga0157342_1001050 | Ga0157342_10010502 | 388 |
| 1496 | 3300013102 | Ga0157371_10135552 | Ga0157371_101355522 | 388 |
| 1497 | 3300013297 | Ga0157378_10226928 | Ga0157378_102269282 | 388 |
| 1498 | 3300013306 | Ga0163162_10287604 | Ga0163162_102876042 | 388 |
| 1499 | 3300013307 | Ga0157372_10439058 | Ga0157372_104390581 | 388 |
| 1500 | 3300013308 | Ga0157375_10287252 | Ga0157375_102872521 | 388 |
| 1501 | 3300014325 | Ga0163163_10346828 | Ga0163163_103468282 | 388 |
| 1502 | 3300014969 | Ga0157376_10125198 | Ga0157376_101251981 | 388 |
| 1503 | 3300014969 | Ga0157376_10269995 | Ga0157376_102699951 | 388 |
| 1504 | 3300017792 | Ga0163161_10134010 | Ga0163161_101340101 | 388 |
| 1505 | 3300021384 | Ga0213876_10074413 | Ga0213876_100744132 | 388 |
| 1506 | 3300021441 | Ga0213871_10016699 | Ga0213871_100166991 | 388 |
| 1507 | 3300024227 | Ga0228598_1011746 | Ga0228598_10117462 | 388 |
| 1508 | 3300025206 | Ga0209435_104472 | Ga0209435_1044721 | 388 |
| 1509 | 3300025223 | Ga0207672_1001655 | Ga0207672_10016552 | 388 |
| 1510 | 3300025246 | Ga0209646_1009087 | Ga0209646_10090871 | 388 |
| 1511 | 3300025250 | Ga0209026_1011565 | Ga0209026_10115651 | 388 |
| 1512 | 3300025256 | Ga0209759_1019831 | Ga0209759_10198311 | 388 |
| 1513 | 3300025273 | Ga0209673_1002243 | Ga0209673_10022434 | 388 |
| 1514 | 3300025294 | Ga0209025_1000392 | Ga0209025_100039265 | 388 |
| 1515 | 3300025295 | Ga0209564_1000881 | Ga0209564_100088134 | 388 |
| 1516 | 3300025299 | Ga0209256_1000915 | Ga0209256_100091513 | 388 |
| 1517 | 3300025315 | Ga0207697_10050798 | Ga0207697_100507981 | 388 |
| 1518 | 3300025711 | Ga0207696_1030230 | Ga0207696_10302301 | 388 |
| 1519 | 3300025885 | Ga0207653_10026461 | Ga0207653_100264612 | 388 |
| 1520 | 3300025885 | Ga0207653_10040725 | Ga0207653_100407252 | 388 |
| 1521 | 3300025893 | Ga0207682_10012714 | Ga0207682_100127143 | 388 |
| 1522 | 3300025898 | Ga0207692_10017649 | Ga0207692_100176492 | 388 |
| 1523 | 3300025899 | Ga0207642_10036628 | Ga0207642_100366283 | 388 |
| 1524 | 3300025900 | Ga0207710_10078683 | Ga0207710_100786831 | 388 |
| 1525 | 3300025901 | Ga0207688_10063796 | Ga0207688_100637962 | 388 |
| 1526 | 3300025904 | Ga0207647_10042567 | Ga0207647_100425672 | 388 |
| 1527 | 3300025905 | Ga0207685_10025557 | Ga0207685_100255572 | 388 |
| 1528 | 3300025906 | Ga0207699_10026756 | Ga0207699_100267562 | 388 |
| 1529 | 3300025907 | Ga0207645_10121052 | Ga0207645_101210522 | 388 |
| 1530 | 3300025908 | Ga0207643_10115584 | Ga0207643_101155841 | 388 |
| 1531 | 3300025911 | Ga0207654_10076110 | Ga0207654_100761101 | 388 |
| 1532 | 3300025911 | Ga0207654_10127439 | Ga0207654_101274391 | 388 |
| 1533 | 3300025913 | Ga0207695_10238628 | Ga0207695_102386281 | 388 |
| 1534 | 3300025914 | Ga0207671_10183867 | Ga0207671_101838671 | 388 |
| 1535 | 3300025915 | Ga0207693_10224793 | Ga0207693_102247931 | 388 |
| 1536 | 3300025916 | Ga0207663_10089821 | Ga0207663_100898212 | 388 |
| 1537 | 3300025916 | Ga0207663_10169279 | Ga0207663_101692791 | 388 |
| 1538 | 3300025916 | Ga0207663_10171566 | Ga0207663_101715661 | 388 |
| 1539 | 3300025918 | Ga0207662_10098498 | Ga0207662_100984982 | 388 |
| 1540 | 3300025918 | Ga0207662_10106555 | Ga0207662_101065552 | 388 |
| 1541 | 3300025919 | Ga0207657_10065538 | Ga0207657_100655382 | 388 |
| 1542 | 3300025921 | Ga0207652_10103318 | Ga0207652_101033182 | 388 |
| 1543 | 3300025923 | Ga0207681_10160383 | Ga0207681_101603831 | 388 |
| 1544 | 3300025925 | Ga0207650_10197782 | Ga0207650_101977822 | 388 |
| 1545 | 3300025927 | Ga0207687_10195667 | Ga0207687_101956671 | 388 |
| 1546 | 3300025929 | Ga0207664_10210675 | Ga0207664_102106752 | 388 |
| 1547 | 3300025931 | Ga0207644_10103020 | Ga0207644_101030202 | 388 |
| 1548 | 3300025932 | Ga0207690_10194779 | Ga0207690_101947792 | 388 |
| 1549 | 3300025933 | Ga0207706_10119918 | Ga0207706_101199181 | 388 |
| 1550 | 3300025933 | Ga0207706_10167282 | Ga0207706_101672822 | 388 |
| 1551 | 3300025933 | Ga0207706_10243283 | Ga0207706_102432831 | 388 |
| 1552 | 3300025934 | Ga0207686_10030719 | Ga0207686_100307192 | 388 |
| 1553 | 3300025935 | Ga0207709_10121758 | Ga0207709_101217582 | 388 |
| 1554 | 3300025936 | Ga0207670_10165799 | Ga0207670_101657992 | 388 |
| 1555 | 3300025936 | Ga0207670_10242793 | Ga0207670_102427931 | 388 |
| 1556 | 3300025937 | Ga0207669_10077941 | Ga0207669_100779412 | 388 |
| 1557 | 3300025938 | Ga0207704_10119108 | Ga0207704_101191082 | 388 |
| 1558 | 3300025939 | Ga0207665_10140341 | Ga0207665_101403412 | 388 |
| 1559 | 3300025939 | Ga0207665_10174844 | Ga0207665_101748441 | 388 |
| 1560 | 3300025940 | Ga0207691_10196892 | Ga0207691_101968922 | 388 |
| 1561 | 3300025942 | Ga0207689_10176177 | Ga0207689_101761772 | 388 |
| 1562 | 3300025945 | Ga0207679_10099648 | Ga0207679_100996482 | 388 |
| 1563 | 3300025960 | Ga0207651_10183438 | Ga0207651_101834382 | 388 |
| 1564 | 3300025961 | Ga0207712_10136315 | Ga0207712_101363152 | 388 |
| 1565 | 3300025972 | Ga0207668_10156768 | Ga0207668_101567682 | 388 |
| 1566 | 3300025981 | Ga0207640_10143039 | Ga0207640_101430392 | 388 |
| 1567 | 3300025986 | Ga0207658_10040031 | Ga0207658_100400313 | 388 |
| 1568 | 3300025986 | Ga0207658_10172172 | Ga0207658_101721722 | 388 |
| 1569 | 3300026035 | Ga0207703_10251480 | Ga0207703_102514801 | 388 |
| 1570 | 3300026041 | Ga0207639_10174531 | Ga0207639_101745312 | 388 |
| 1571 | 3300026067 | Ga0207678_10191923 | Ga0207678_101919232 | 388 |
| 1572 | 3300026067 | Ga0207678_10241467 | Ga0207678_102414672 | 388 |
| 1573 | 3300026075 | Ga0207708_10138892 | Ga0207708_101388923 | 388 |
| 1574 | 3300026075 | Ga0207708_10139209 | Ga0207708_101392092 | 388 |
| 1575 | 3300026078 | Ga0207702_10253620 | Ga0207702_102536201 | 388 |
| 1576 | 3300026088 | Ga0207641_10244140 | Ga0207641_102441402 | 388 |
| 1577 | 3300026089 | Ga0207648_10201139 | Ga0207648_102011392 | 388 |
| 1578 | 3300026089 | Ga0207648_10205872 | Ga0207648_102058722 | 388 |
| 1579 | 3300026095 | Ga0207676_10274742 | Ga0207676_102747421 | 388 |
| 1580 | 3300026118 | Ga0207675_100034176 | Ga0207675_1000341762 | 388 |
| 1581 | 3300026118 | Ga0207675_100278435 | Ga0207675_1002784352 | 388 |
| 1582 | 3300026121 | Ga0207683_10070908 | Ga0207683_100709081 | 388 |
| 1583 | 3300026121 | Ga0207683_10206422 | Ga0207683_102064222 | 388 |
| 1584 | 3300026142 | Ga0207698_10203129 | Ga0207698_102031292 | 388 |
| 1585 | 3300027671 | Ga0209588_1017446 | Ga0209588_10174462 | 388 |
| 1586 | 3300027671 | Ga0209588_1020444 | Ga0209588_10204441 | 388 |
| 1587 | 3300027671 | Ga0209588_1032644 | Ga0209588_10326442 | 388 |
| 1588 | 3300027671 | Ga0209588_1038131 | Ga0209588_10381311 | 388 |
| 1589 | 3300027907 | Ga0207428_10026452 | Ga0207428_100264523 | 388 |
| 1590 | 3300028380 | Ga0268265_10192999 | Ga0268265_101929992 | 388 |
| 1591 | 3300028380 | Ga0268265_10344072 | Ga0268265_103440721 | 388 |
| 1592 | 3300028381 | Ga0268264_10190924 | Ga0268264_101909243 | 388 |
| 1593 | 3300030878 | Ga0265770_1004061 | Ga0265770_10040612 | 388 |
| 1594 | 3300031090 | Ga0265760_10018460 | Ga0265760_100184601 | 388 |
| 1595 | 3300031995 | Ga0307409_100217594 | Ga0307409_1002175942 | 388 |
| 1596 | 3300034817 | Ga0373948_0009227 | Ga0373948_0009227_230_1396 | 388 |
| 1597 | 3300034820 | Ga0373959_0004703 | Ga0373959_0004703_700_1866 | 388 |
| 1598 | 3300035083 | Ga0373926_0016744 | Ga0373926_0016744_554_1720 | 388 |
| 1599 | 3300035083 | Ga0373926_0020734 | Ga0373926_0020734_721_1887 | 388 |
| 1600 | 3300035083 | Ga0373926_0077649 | Ga0373926_0077649_19_1197 | 388 |
| 1601 | 3300035084 | Ga0373928_0008027 | Ga0373928_0008027_498_1664 | 388 |
| 1602 | 3300035086 | Ga0373934_0030330 | Ga0373934_0030330_849_2015 | 388 |
| 1603 | 3300035089 | Ga0373944_0005365 | Ga0373944_0005365_1083_2249 | 388 |
| 1604 | 3300035092 | Ga0373952_0010966 | Ga0373952_0010966_254_1420 | 388 |
| 1605 | 3300035113 | Ga0373936_0027383 | Ga0373936_0027383_142_1308 | 388 |
| 1606 | 3300035118 | Ga0373954_0028298 | Ga0373954_0028298_1010_2176 | 388 |
| 1607 | 3300035118 | Ga0373954_0045218 | Ga0373954_0045218_59_1225 | 388 |
| 1608 | 3300035118 | Ga0373954_0065893 | Ga0373954_0065893_377_1555 | 388 |
| 1609 | 3300035120 | Ga0373957_0017278 | Ga0373957_0017278_1141_2307 | 388 |
| 1610 | 3300035121 | Ga0373960_0017632 | Ga0373960_0017632_124_1290 | 388 |
| 1611 | 3300035170 | Ga0373943_0072817 | Ga0373943_0072817_268_1434 | 388 |
| 1612 | 3300035170 | Ga0373943_0081537 | Ga0373943_0081537_186_1352 | 388 |
| 1613 | 3300035171 | Ga0373946_0043629 | Ga0373946_0043629_211_1377 | 388 |
| 1614 | 3300035172 | Ga0373955_0021663 | Ga0373955_0021663_709_1875 | 388 |
| 1615 | 3300035172 | Ga0373955_0032469 | Ga0373955_0032469_1549_2715 | 388 |
| 1616 | 3300035172 | Ga0373955_0079850 | Ga0373955_0079850_138_1316 | 388 |
| 1617 | 3300035172 | Ga0373955_0139938 | Ga0373955_0139938_147_1313 | 388 |
| 1618 | 3300035207 | Ga0373942_0011164 | Ga0373942_0011164_568_1734 | 388 |
| 1619 | 3300035410 | Ga0373924_0029361 | Ga0373924_0029361_832_1998 | 388 |
| 1620 | 3300035410 | Ga0373924_0037828 | Ga0373924_0037828_692_1858 | 388 |
| 1621 | 3300035691 | Ga0373931_0072573 | Ga0373931_0072573_560_1726 | 388 |
| 1622 | 3300035691 | Ga0373931_0159674 | Ga0373931_0159674_61_1227 | 388 |
| 1623 | 3300035692 | Ga0373935_0067765 | Ga0373935_0067765_96_1262 | 388 |
| 1624 | 3300035692 | Ga0373935_0086944 | Ga0373935_0086944_541_1707 | 388 |
| 1625 | 3300035692 | Ga0373935_0101033 | Ga0373935_0101033_310_1476 | 388 |
| 1626 | 3300035692 | Ga0373935_0138088 | Ga0373935_0138088_86_1252 | 388 |
| 1627 | 3300035692 | Ga0373935_0157701 | Ga0373935_0157701_126_1304 | 388 |
| 1628 | 3300035695 | Ga0373927_0040745 | Ga0373927_0040745_68_1234 | 388 |
| 1629 | 3300035695 | Ga0373927_0054162 | Ga0373927_0054162_482_1648 | 388 |
| 1630 | 3300035695 | Ga0373927_0082080 | Ga0373927_0082080_533_1711 | 388 |
| 1631 | 3300035695 | Ga0373927_0119960 | Ga0373927_0119960_310_1476 | 388 |
| 1632 | 3300035695 | Ga0373927_0127744 | Ga0373927_0127744_400_1566 | 388 |
| 1633 | 3300035724 | Ga0373933_0042382 | Ga0373933_0042382_59_1225 | 388 |
| 1634 | 3300035724 | Ga0373933_0121273 | Ga0373933_0121273_350_1528 | 388 |
| 1635 | 3300035724 | Ga0373933_0123095 | Ga0373933_0123095_204_1370 | 388 |
| 1636 | 3300035725 | Ga0373947_0152412 | Ga0373947_0152412_89_1255 | 388 |
| 1637 | 3300035725 | Ga0373947_0205775 | Ga0373947_0205775_77_1243 | 388 |
| 1638 | 3300036401 | Ga0373937_0165521 | Ga0373937_0165521_59_1225 | 388 |
| 1639 | 3300036401 | Ga0373937_0208670 | Ga0373937_0208670_410_1576 | 388 |
| 1640 | 3300036401 | Ga0373937_0214034 | Ga0373937_0214034_167_1345 | 388 |
| 1641 | 3300037068 | Ga0373925_0113162 | Ga0373925_0113162_193_1359 | 388 |
| 1642 | 3300037853 | Ga0436364_0173979 | Ga0436364_0173979_676_1842 | 388 |
| 1643 | 3300039437 | Ga0436365_0053528 | Ga0436365_0053528_1159_2325 | 388 |
| 1644 | 3300039437 | Ga0436365_1132570 | Ga0436365_1132570_969_2135 | 388 |
| 1645 | 3300039447 | Ga0436361_0287361 | Ga0436361_0287361_685_1860 | 388 |
| 1646 | 3300039453 | Ga0436362_0495641 | Ga0436362_0495641_502_1668 | 388 |
| 1647 | 3300041459 | Ga0451800_1597933 | Ga0451800_1597933_367_1533 | 388 |
| 1648 | 3300046452 | Ga0495617_020661 | Ga0495617_020661_388_1554 | 388 |
| 1649 | 3300046454 | Ga0495592_0032949 | Ga0495592_0032949_200_1366 | 388 |
| 1650 | 3300046454 | Ga0495592_0124571 | Ga0495592_0124571_466_1632 | 388 |
| 1651 | 3300046454 | Ga0495592_0138165 | Ga0495592_0138165_133_1311 | 388 |
| 1652 | 3300046455 | Ga0495603_0070881 | Ga0495603_0070881_511_1677 | 388 |
| 1653 | 3300046457 | Ga0495590_0043222 | Ga0495590_0043222_185_1351 | 388 |
| 1654 | 3300046458 | Ga0495591_021310 | Ga0495591_021310_238_1404 | 388 |
| 1655 | 3300046459 | Ga0495629_0094978 | Ga0495629_0094978_712_1878 | 388 |
| 1656 | 3300046459 | Ga0495629_0137539 | Ga0495629_0137539_160_1326 | 388 |
| 1657 | 3300046460 | Ga0495638_0053533 | Ga0495638_0053533_112_1278 | 388 |
| 1658 | 3300046461 | Ga0495641_0026586 | Ga0495641_0026586_283_1449 | 388 |
| 1659 | 3300046461 | Ga0495641_0081876 | Ga0495641_0081876_201_1367 | 388 |
| 1660 | 3300046462 | Ga0495651_0064325 | Ga0495651_0064325_1052_2218 | 388 |
| 1661 | 3300046463 | Ga0495653_0078075 | Ga0495653_0078075_1042_2208 | 388 |
| 1662 | 3300046463 | Ga0495653_0122689 | Ga0495653_0122689_429_1595 | 388 |
| 1663 | 3300046472 | Ga0495580_0098794 | Ga0495580_0098794_493_1659 | 388 |
| 1664 | 3300046472 | Ga0495580_0141829 | Ga0495580_0141829_326_1492 | 388 |
| 1665 | 3300046473 | Ga0495582_0120740 | Ga0495582_0120740_104_1270 | 388 |
| 1666 | 3300046474 | Ga0495605_0050174 | Ga0495605_0050174_187_1353 | 388 |
| 1667 | 3300046475 | Ga0495639_0021368 | Ga0495639_0021368_355_1521 | 388 |
| 1668 | 3300046475 | Ga0495639_0045183 | Ga0495639_0045183_316_1482 | 388 |
| 1669 | 3300046475 | Ga0495639_0099888 | Ga0495639_0099888_95_1261 | 388 |
| 1670 | 3300046477 | Ga0495664_0042689 | Ga0495664_0042689_98_1264 | 388 |
| 1671 | 3300046477 | Ga0495664_0115512 | Ga0495664_0115512_313_1491 | 388 |
| 1672 | 3300046492 | Ga0495585_0047739 | Ga0495585_0047739_291_1457 | 388 |
| 1673 | 3300046500 | Ga0495596_0027703 | Ga0495596_0027703_438_1604 | 388 |
| 1674 | 3300046501 | Ga0495607_0071366 | Ga0495607_0071366_109_1275 | 388 |
| 1675 | 3300046506 | Ga0495583_0046408 | Ga0495583_0046408_247_1413 | 388 |
| 1676 | 3300046511 | Ga0495608_0075441 | Ga0495608_0075441_200_1366 | 388 |
| 1677 | 3300046514 | Ga0495618_0038568 | Ga0495618_0038568_817_1983 | 388 |
| 1678 | 3300046514 | Ga0495618_0120760 | Ga0495618_0120760_264_1430 | 388 |
| 1679 | 3300046515 | Ga0495620_0041819 | Ga0495620_0041819_432_1598 | 388 |
| 1680 | 3300046516 | Ga0495628_0172132 | Ga0495628_0172132_261_1427 | 388 |
| 1681 | 3300046516 | Ga0495628_0204555 | Ga0495628_0204555_209_1387 | 388 |
| 1682 | 3300046516 | Ga0495628_0240164 | Ga0495628_0240164_33_1199 | 388 |
| 1683 | 3300046517 | Ga0495630_0037826 | Ga0495630_0037826_2007_3173 | 388 |
| 1684 | 3300046517 | Ga0495630_0125223 | Ga0495630_0125223_640_1806 | 388 |
| 1685 | 3300046517 | Ga0495630_0167475 | Ga0495630_0167475_72_1250 | 388 |
| 1686 | 3300046517 | Ga0495630_0184487 | Ga0495630_0184487_334_1500 | 388 |
| 1687 | 3300046517 | Ga0495630_0255975 | Ga0495630_0255975_77_1243 | 388 |
| 1688 | 3300046518 | Ga0495631_0025174 | Ga0495631_0025174_897_2063 | 388 |
| 1689 | 3300046520 | Ga0495637_0021558 | Ga0495637_0021558_365_1534 | 388 |
| 1690 | 3300046520 | Ga0495637_0061368 | Ga0495637_0061368_101_1267 | 388 |
| 1691 | 3300046523 | Ga0495644_0024142 | Ga0495644_0024142_903_2069 | 388 |
| 1692 | 3300046523 | Ga0495644_0057439 | Ga0495644_0057439_116_1282 | 388 |
| 1693 | 3300046525 | Ga0495663_0007708 | Ga0495663_0007708_696_1862 | 388 |
| 1694 | 3300046525 | Ga0495663_0049692 | Ga0495663_0049692_69_1235 | 388 |
| 1695 | 3300046526 | Ga0495666_0024174 | Ga0495666_0024174_1137_2303 | 388 |
| 1696 | 3300046526 | Ga0495666_0077035 | Ga0495666_0077035_174_1340 | 388 |
| 1697 | 3300046526 | Ga0495666_0091229 | Ga0495666_0091229_222_1388 | 388 |
| 1698 | 3300046528 | Ga0495642_0016786 | Ga0495642_0016786_793_1959 | 388 |
| 1699 | 3300046529 | Ga0495652_0113376 | Ga0495652_0113376_640_1806 | 388 |
| 1700 | 3300046531 | Ga0495665_0066720 | Ga0495665_0066720_483_1649 | 388 |
| 1701 | 3300046531 | Ga0495665_0096044 | Ga0495665_0096044_99_1265 | 388 |
| 1702 | 3300046533 | Ga0495640_0112676 | Ga0495640_0112676_421_1599 | 388 |
| 1703 | 3300046535 | Ga0495586_0055908 | Ga0495586_0055908_255_1421 | 388 |
| 1704 | 3300046535 | Ga0495586_0163804 | Ga0495586_0163804_69_1235 | 388 |
| 1705 | 3300046536 | Ga0495587_0028844 | Ga0495587_0028844_1304_2470 | 388 |
| 1706 | 3300046537 | Ga0495598_0006567 | Ga0495598_0006567_687_1853 | 388 |
| 1707 | 3300046537 | Ga0495598_0010983 | Ga0495598_0010983_345_1517 | 388 |
| 1708 | 3300046537 | Ga0495598_0021165 | Ga0495598_0021165_326_1492 | 388 |
| 1709 | 3300046538 | Ga0495609_0034776 | Ga0495609_0034776_873_2039 | 388 |
| 1710 | 3300046539 | Ga0495621_0014913 | Ga0495621_0014913_381_1547 | 388 |
| 1711 | 3300046542 | Ga0495597_0056454 | Ga0495597_0056454_352_1521 | 388 |
| 1712 | 3300046543 | Ga0495645_0082066 | Ga0495645_0082066_99_1265 | 388 |
| 1713 | 3300046543 | Ga0495645_0139957 | Ga0495645_0139957_342_1508 | 388 |
| 1714 | 3300046543 | Ga0495645_0142999 | Ga0495645_0142999_302_1480 | 388 |
| 1715 | 3300046558 | Ga0495633_0047004 | Ga0495633_0047004_343_1509 | 388 |
| 1716 | 3300046558 | Ga0495633_0059276 | Ga0495633_0059276_562_1728 | 388 |
| 1717 | 3300046559 | Ga0495667_0023192 | Ga0495667_0023192_1052_2218 | 388 |
| 1718 | 3300046559 | Ga0495667_0066165 | Ga0495667_0066165_1082_2260 | 388 |
| 1719 | 3300046559 | Ga0495667_0147364 | Ga0495667_0147364_180_1346 | 388 |
| 1720 | 3300046615 | Ga0495656_0010174 | Ga0495656_0010174_1290_2456 | 388 |
| 1721 | 3300046615 | Ga0495656_0084358 | Ga0495656_0084358_28_1200 | 388 |
| 1722 | 3300046616 | Ga0495668_0030783 | Ga0495668_0030783_974_2140 | 388 |
| 1723 | 3300046642 | Ga0495634_0070562 | Ga0495634_0070562_344_1510 | 388 |
| 1724 | 3300046642 | Ga0495634_0070983 | Ga0495634_0070983_195_1361 | 388 |
| 1725 | 3300046648 | Ga0495611_0025038 | Ga0495611_0025038_762_1928 | 388 |
| 1726 | 3300046660 | Ga0495625_0112239 | Ga0495625_0112239_343_1509 | 388 |
| 1727 | 3300046663 | Ga0495635_0124412 | Ga0495635_0124412_391_1557 | 388 |
| 1728 | 3300046664 | Ga0495659_0022665 | Ga0495659_0022665_400_1566 | 388 |
| 1729 | 3300046664 | Ga0495659_0044293 | Ga0495659_0044293_110_1276 | 388 |
| 1730 | 3300046665 | Ga0495661_0065872 | Ga0495661_0065872_205_1371 | 388 |
| 1731 | 3300046674 | Ga0495588_0035234 | Ga0495588_0035234_998_2164 | 388 |
| 1732 | 3300046674 | Ga0495588_0065820 | Ga0495588_0065820_672_1838 | 388 |
| 1733 | 3300046675 | Ga0495657_0047518 | Ga0495657_0047518_1401_2567 | 388 |
| 1734 | 3300046675 | Ga0495657_0131603 | Ga0495657_0131603_60_1226 | 388 |
| 1735 | 3300046679 | Ga0495623_0055331 | Ga0495623_0055331_284_1450 | 388 |
| 1736 | 3300046679 | Ga0495623_0107867 | Ga0495623_0107867_434_1600 | 388 |
| 1737 | 3300046680 | Ga0495646_0018299 | Ga0495646_0018299_1767_2933 | 388 |
| 1738 | 3300046680 | Ga0495646_0086273 | Ga0495646_0086273_308_1474 | 388 |
| 1739 | 3300046681 | Ga0495647_0022723 | Ga0495647_0022723_174_1340 | 388 |
| 1740 | 3300046681 | Ga0495647_0042393 | Ga0495647_0042393_201_1367 | 388 |
| 1741 | 3300046683 | Ga0495658_0069053 | Ga0495658_0069053_730_1896 | 388 |
| 1742 | 3300046684 | Ga0495669_0026871 | Ga0495669_0026871_69_1235 | 388 |
| 1743 | 3300046684 | Ga0495669_0033308 | Ga0495669_0033308_954_2120 | 388 |
| 1744 | 3300046689 | Ga0495613_0055351 | Ga0495613_0055351_390_1556 | 388 |
| 1745 | 3300046689 | Ga0495613_0134243 | Ga0495613_0134243_407_1573 | 388 |
| 1746 | 3300046690 | Ga0495624_0106133 | Ga0495624_0106133_484_1650 | 388 |
| 1747 | 3300046690 | Ga0495624_0106223 | Ga0495624_0106223_174_1340 | 388 |
| 1748 | 3300046691 | Ga0495670_0075631 | Ga0495670_0075631_475_1641 | 388 |
| 1749 | 3300046692 | Ga0495671_0096186 | Ga0495671_0096186_38_1207 | 388 |
| 1750 | 3300046694 | Ga0495649_0052787 | Ga0495649_0052787_81_1250 | 388 |
| 1751 | 3300046694 | Ga0495649_0070073 | Ga0495649_0070073_287_1453 | 388 |
| 1752 | 3300046809 | Ga0495600_0043926 | Ga0495600_0043926_1399_2565 | 388 |
| 1753 | 3300046810 | Ga0495660_0034715 | Ga0495660_0034715_1508_2674 | 388 |
| 1754 | 3300047315 | Ga0495581_0115315 | Ga0495581_0115315_189_1355 | 388 |
| 1755 | 3300047317 | Ga0495604_0108434 | Ga0495604_0108434_215_1381 | 388 |
| 1756 | 3300047317 | Ga0495604_0110504 | Ga0495604_0110504_636_1802 | 388 |
| 1757 | 3300047319 | Ga0495674_0166826 | Ga0495674_0166826_202_1368 | 388 |
| 1758 | 3300047319 | Ga0495674_0176094 | Ga0495674_0176094_461_1627 | 388 |
| 1759 | 3300047319 | Ga0495674_0181556 | Ga0495674_0181556_191_1357 | 388 |
| 1760 | 3300047319 | Ga0495674_0222809 | Ga0495674_0222809_72_1250 | 388 |
| 1761 | 3300047320 | Ga0495672_0107676 | Ga0495672_0107676_231_1397 | 388 |
| 1762 | 3300047321 | Ga0495676_0079335 | Ga0495676_0079335_104_1270 | 388 |
| 1763 | 3300047321 | Ga0495676_0094852 | Ga0495676_0094852_201_1367 | 388 |
| 1764 | 3300047321 | Ga0495676_0109212 | Ga0495676_0109212_49_1215 | 388 |
| 1765 | 3300047321 | Ga0495676_0120372 | Ga0495676_0120372_297_1463 | 388 |
| 1766 | 3300047322 | Ga0495680_0142090 | Ga0495680_0142090_196_1362 | 388 |
| 1767 | 3300047322 | Ga0495680_0180807 | Ga0495680_0180807_219_1397 | 388 |
| 1768 | 3300047444 | Ga0495675_0024019 | Ga0495675_0024019_1048_2214 | 388 |
| 1769 | 3300047445 | Ga0495677_0043066 | Ga0495677_0043066_366_1532 | 388 |
| 1770 | 3300047446 | Ga0495679_040661 | Ga0495679_040661_25_1191 | 388 |
| 1771 | 3300047447 | Ga0495685_012989 | Ga0495685_012989_763_1929 | 388 |
| 1772 | 3300047447 | Ga0495685_034146 | Ga0495685_034146_173_1339 | 388 |
| 1773 | 3300047469 | Ga0495673_0037896 | Ga0495673_0037896_820_1986 | 388 |
| 1774 | 3300047471 | Ga0495684_0044248 | Ga0495684_0044248_1371_2537 | 388 |
| 1775 | 3300047471 | Ga0495684_0147549 | Ga0495684_0147549_180_1346 | 388 |
| 1776 | 3300047673 | Ga0495593_0080124 | Ga0495593_0080124_429_1595 | 388 |
| 1777 | 3300048088 | Ga0495602_0099892 | Ga0495602_0099892_1028_2194 | 388 |
| 1778 | 3300048088 | Ga0495602_0145383 | Ga0495602_0145383_413_1579 | 388 |
| 1779 | 3300048090 | Ga0495615_0005598 | Ga0495615_0005598_691_1857 | 388 |
| 1780 | 3300048903 | Ga0496100_0139096 | Ga0496100_0139096_201_1367 | 388 |
| 1781 | 3300048905 | Ga0496102_0231910 | Ga0496102_0231910_390_1556 | 388 |
| 1782 | 3300048907 | Ga0496104_0000056 | Ga0496104_0000056_11870_13036 | 388 |
| 1783 | 3300048907 | Ga0496104_0036995 | Ga0496104_0036995_170_1336 | 388 |
| 1784 | 3300048907 | Ga0496104_0247250 | Ga0496104_0247250_399_1565 | 388 |
| 1785 | 3300048908 | Ga0496105_0000036 | Ga0496105_0000036_42_1208 | 388 |
| 1786 | 3300048910 | Ga0496107_0100574 | Ga0496107_0100574_512_1678 | 388 |
| 1787 | 3300048911 | Ga0496108_0200568 | Ga0496108_0200568_185_1351 | 388 |
| 1788 | 3300048911 | Ga0496108_0228256 | Ga0496108_0228256_261_1427 | 388 |
| 1789 | 3300048912 | Ga0496109_0039786 | Ga0496109_0039786_1214_2380 | 388 |
| 1790 | 3300048912 | Ga0496109_0331669 | Ga0496109_0331669_177_1343 | 388 |
| 1791 | 3300048913 | Ga0496110_0192969 | Ga0496110_0192969_279_1445 | 388 |
| 1792 | 3300048913 | Ga0496110_0219092 | Ga0496110_0219092_163_1329 | 388 |
| 1793 | 3300048914 | Ga0496111_0144157 | Ga0496111_0144157_176_1342 | 388 |
| 1794 | 3300048914 | Ga0496111_0171762 | Ga0496111_0171762_97_1263 | 388 |
| 1795 | 3300048914 | Ga0496111_0207864 | Ga0496111_0207864_99_1265 | 388 |
| 1796 | 3300048915 | Ga0496112_0001860 | Ga0496112_0001860_1630_2796 | 388 |
| 1797 | 3300048915 | Ga0496112_0015616 | Ga0496112_0015616_5486_6652 | 388 |
| 1798 | 3300048915 | Ga0496112_0240417 | Ga0496112_0240417_424_1590 | 388 |
| 1799 | 3300048916 | Ga0496113_0170895 | Ga0496113_0170895_396_1562 | 388 |
| 1800 | 3300048917 | Ga0496114_0223390 | Ga0496114_0223390_287_1453 | 388 |
| 1801 | 3300048918 | Ga0496115_0220924 | Ga0496115_0220924_239_1405 | 388 |
| 1802 | 3300049571 | Ga0501034_0063775 | Ga0501034_0063775_500_1666 | 388 |
| 1803 | 3300049572 | Ga0501036_0160018 | Ga0501036_0160018_233_1399 | 388 |
| 1804 | 3300049575 | Ga0501039_0155644 | Ga0501039_0155644_176_1342 | 388 |
| 1805 | 3300049586 | Ga0501070_0200717 | Ga0501070_0200717_46_1212 | 388 |
| 1806 | 3300049822 | Ga0501035_0160049 | Ga0501035_0160049_500_1666 | 388 |
| 1807 | 3300050489 | nmdc:mga03683_55366_c1 | nmdc:mga03683_55366_c1_402_1568 | 388 |
| 1808 | 3300050494 | nmdc:mga06z11_247_c1 | nmdc:mga06z11_247_c1_192_1370 | 388 |
| 1809 | 3300050507 | nmdc:mga05p37_343559_c1 | nmdc:mga05p37_343559_c1_421_1587 | 388 |
| 1810 | 3300050512 | nmdc:mga0n895_189659_c1 | nmdc:mga0n895_189659_c1_354_1520 | 388 |
| 1811 | 3300050512 | nmdc:mga0n895_250694_c1 | nmdc:mga0n895_250694_c1_501_1667 | 388 |
| 1812 | 3300050513 | nmdc:mga0rr50_279023_c1 | nmdc:mga0rr50_279023_c1_16_1182 | 388 |
| 1813 | 3300050513 | nmdc:mga0rr50_57695_c1 | nmdc:mga0rr50_57695_c1_750_1916 | 388 |
| 1814 | 3300050514 | nmdc:mga08x19_122370_c1 | nmdc:mga08x19_122370_c1_511_1677 | 388 |
| 1815 | 3300050515 | nmdc:mga0a205_236004_c1 | nmdc:mga0a205_236004_c1_123_1289 | 388 |
| 1816 | 3300050515 | nmdc:mga0a205_260119_c1 | nmdc:mga0a205_260119_c1_294_1460 | 388 |
| 1817 | 3300053077 | Ga0495601_0077303 | Ga0495601_0077303_585_1763 | 388 |
| 1818 | 3300053078 | Ga0495612_0027175 | Ga0495612_0027175_253_1419 | 388 |
| 1819 | 3300053078 | Ga0495612_0042479 | Ga0495612_0042479_178_1344 | 388 |
| 1820 | 3300053078 | Ga0495612_0063520 | Ga0495612_0063520_189_1355 | 388 |
| 1821 | 3300053079 | Ga0500610_0081606 | Ga0500610_0081606_338_1507 | 388 |
| 1822 | 3300053083 | Ga0495655_0002509 | Ga0495655_0002509_676_1842 | 388 |
| 1823 | 3300053085 | Ga0495619_0091761 | Ga0495619_0091761_59_1225 | 388 |
| 1824 | 3300053085 | Ga0495619_0163763 | Ga0495619_0163763_174_1340 | 388 |
| 1825 | 3300053123 | Ga0500614_006583 | Ga0500614_006583_1076_2254 | 388 |
| 1826 | 3300053130 | Ga0500642_0014056 | Ga0500642_0014056_1057_2226 | 388 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gvc-assembly1.cif.gz_B | crystal structure of flavin-containing monooxygenase (fmo)from s.pombe and substrate (methimazole) complex | 0.7197 | 21 | 49 |
| 4n2z-assembly1.cif.gz_A | crystal structure of the alpha-l-arabinofuranosidase paabf62a from podospora anserina in complex with cellotriose | 0.7027 | 23 | 51 |
| 6uj5-assembly1.cif.gz_B | crystal structure of cab1 pantothenate kinase from saccharomyces cerevisiae | 0.6795 | 21 | 111 |
| 7t1h-assembly1.cif.gz_B | crystal structure of cab1 pantothenate kinase from saccharomyces cerevisiae in complex with compound yu281445 | 0.673 | 20 | 111 |
| 2csu-assembly1.cif.gz_B | crystal structure of ph0766 from pyrococcus horikoshii ot3 | 0.6611 | 68 | 103 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ebgA01 | Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain | 0.7661 | 19 | 37 | 2.60.40.1730 |
| af_Q9CX34_135_247_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.7399 | 23 | 51 | 2.60.40.790 |
| af_Q5SPH3_283_512_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.7266 | 24 | 50 | 3.50.50.60 |
| af_Q9VCC0_206_319_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.7105 | 23 | 51 | 2.60.40.790 |
| af_P71924_1_167_1.10.287.1490 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.6922 | 113 | 248 | 1.10.287.1490 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V4YDB0-F1-model_v4 | deleted | 0.9754 | 260 | 388 |
|
| AF-A0A2V4YDB0-F1-model_v4 | deleted | 0.9607 | 260 | 388 |
|
| AF-A0A1I3WLR7-F1-model_v4 | Transposase | 0.9584 | 15 | 83 |
|
| AF-A0A450Z0S6-F1-model_v4 | Transposase IS116/IS110/IS902 family protein | 0.9466 | 258 | 388 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-A0A450Y443-F1-model_v4 | Transposase IS116/IS110/IS902 family protein | 0.9417 | 256 | 388 |
GO:0003677
GO:0004803 GO:0006313 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar