F495810

General Info

Members Datasets Scaffolds Average Seq Length
1825 594 1727 105

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_11146483|Ga0105247_111464831
Length 124
Sequence MLSGRIALVSLVVFTLVSVPARAATIRIVVEKLEFSPAAVTAKVGDTIEWVNKDALAHTATARNGDFDVTLPPSRTVSSVLKKAGTVDYYCRFHPNMKATLTIAPSSRNSQCGFSRLNVSDCSS

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
4 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
5 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
6 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
7 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
8 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
9 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
10 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
11 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
12 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
13 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
14 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
15 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
16 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
17 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
18 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
19 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
20 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
21 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
22 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
23 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
24 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
25 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
26 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
27 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
28 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
29 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
30 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
31 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
32 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
33 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
34 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
35 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
36 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
37 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
38 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
39 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
40 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
41 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
42 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
43 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
44 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
45 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
46 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
47 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
48 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
49 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
50 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
51 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
52 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
53 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
54 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
55 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
56 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
57 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
58 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
59 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
60 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
61 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
62 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
63 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
64 2904699407
65 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
66 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
67 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
68 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
69 2922368715
70 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
71 2922425934
72 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
73 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
74 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
75 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
76 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
77 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
78 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
79 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
80 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
81 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
82 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
83 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
84 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
85 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
86 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
87 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
88 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
89 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
90 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
91 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
92 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
93 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
94 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
95 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
96 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
97 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
98 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
99 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
100 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
101 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
102 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
103 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
104 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
105 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
106 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
107 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
108 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
109 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
110 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
111 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
112 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
113 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
114 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
115 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
116 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
117 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
118 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
119 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
120 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
121 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
122 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
123 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
124 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
125 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
126 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
127 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
128 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
129 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
130 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
131 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
132 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
133 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
134 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
135 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
136 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
137 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
138 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
139 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
140 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
141 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
142 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
143 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
144 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
145 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
146 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
147 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
148 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
149 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
150 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
151 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
152 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
153 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
154 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
155 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
156 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
157 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
158 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
159 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
160 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
161 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
162 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
163 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
164 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
165 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
166 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
167 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
168 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
169 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
170 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
171 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
172 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
173 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
174 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
175 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
176 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
177 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
178 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
179 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
180 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
181 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
182 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
183 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
184 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
185 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
186 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
187 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
188 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
189 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
190 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
191 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
192 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
193 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
194 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
195 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
196 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
197 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
198 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
199 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
200 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
201 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
202 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
203 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
204 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
205 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
206 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
207 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
208 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
209 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
210 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
211 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
212 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
213 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
214 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
215 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
216 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
217 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
218 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
219 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
220 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
221 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
222 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
223 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
224 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
225 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
226 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
227 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
228 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
229 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
230 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
231 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
232 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
233 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
234 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
235 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
236 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
237 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
238 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
239 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
240 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
241 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
243 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
245 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
246 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
247 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
248 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
249 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
312 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
313 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
314 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
317 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
321 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
322 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
323 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
324 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
325 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
326 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
327 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
328 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
329 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
330 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
331 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
332 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
333 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
334 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
335 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
336 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
337 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
338 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
339 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
340 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
341 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
342 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
343 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
344 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
345 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
346 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
347 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
348 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
349 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
350 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
351 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
352 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
353 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
354 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
355 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
356 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
357 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
358 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
359 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
360 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
361 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
362 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
363 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
364 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
365 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
366 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
367 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
368 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
369 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
370 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
371 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
372 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
373 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
374 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
375 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
376 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
377 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
378 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
379 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
380 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
381 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
382 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
383 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
384 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
385 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
386 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
387 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
388 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
389 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
390 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
391 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
392 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
393 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
394 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
395 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
396 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
397 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
398 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
399 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
400 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
401 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
402 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
403 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
404 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
405 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
406 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
407 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
408 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
409 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
410 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
411 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
412 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
413 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
414 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
415 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
416 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
417 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
418 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
419 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
420 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
421 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
422 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
423 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
424 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
425 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
426 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
427 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
428 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
429 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
430 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
431 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
432 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
433 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
434 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
435 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
436 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
437 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
438 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
439 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
440 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
441 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
442 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
443 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
444 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
445 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
446 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
447 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
448 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
449 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
450 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
451 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
452 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
453 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
454 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
455 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
456 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
457 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
458 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
459 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
460 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
461 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
462 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
463 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
464 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
465 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
466 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
467 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
468 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
469 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
470 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
471 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
472 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
473 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
474 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
475 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
476 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
477 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
478 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
479 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
480 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
481 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
482 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
483 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
484 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
485 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
486 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
487 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
488 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
489 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
490 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
491 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
492 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
493 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
494 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
495 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
496 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
497 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
498 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
499 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
500 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
501 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
502 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
503 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
504 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
505 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
506 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
507 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
508 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
509 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
510 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
511 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
512 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
513 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
514 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
515 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
516 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
517 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
518 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
519 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
520 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
521 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
522 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
523 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
524 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
525 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
526 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
527 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
528 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
529 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
530 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
531 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
532 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
533 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
534 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
535 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
536 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
537 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
538 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
539 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
540 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
541 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
542 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
543 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
544 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
545 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
546 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
547 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
548 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
549 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
550 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
551 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
552 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
553 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
554 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
555 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
556 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
557 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
558 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
559 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
560 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
561 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
562 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
563 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
564 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
565 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
566 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
567 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
568 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
569 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
570 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
571 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
572 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
573 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
574 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
575 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
576 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
577 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
578 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
579 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
580 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
581 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
582 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
583 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
584 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
585 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
586 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
587 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
588 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
589 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
590 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
591 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
592 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
593 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
594 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.8
Metatranscriptomes 0.99
Isolates 5.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.55
Nodule 3.78
Rhizoplane 7.12
Rhizosphere 79.01
Stem 0
Stem Tuber 0
Unclassified 5.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1005980 3300000549 Bacteria 1525
2 JGI24737J22298_10096233 3300001990 Bacteria 878
3 JGI24743J22301_10028486 3300001991 Bacteria 1093
4 JGI25153J46596_10002018 3300003215 Bacteria 11982
5 rootH1_10030930 3300003323 Bacteria 2900
6 rootH1_10115056 3300003323 Bacteria 1568
7 JGI25160J50197_1000862 3300003354 Bacteria 16124
8 Ga0055542_1007673 3300003762 Bacteria 2169
9 Ga0065165_1053237 3300005262 Bacteria 1139
10 Ga0065165_1062294 3300005262 Bacteria 1017
11 Ga0065707_10124570 3300005295 Bacteria 2041
12 Ga0065707_10677222 3300005295 Bacteria 650
13 Ga0070658_10105443 3300005327 Bacteria 2332
14 Ga0070658_10252139 3300005327 Bacteria 1497
15 Ga0070658_10357854 3300005327 Bacteria 1250
16 Ga0070658_10507806 3300005327 Bacteria 1042
17 Ga0070658_10751147 3300005327 Bacteria 847
18 Ga0070683_100051065 3300005329 Bacteria 3829
19 Ga0070683_100080636 3300005329 Bacteria 3046
20 Ga0070683_100151700 3300005329 Bacteria 2197
21 Ga0070683_100293319 3300005329 Bacteria 1547
22 Ga0070683_100386092 3300005329 Bacteria 1334
23 Ga0070683_101397291 3300005329 Bacteria 673
24 Ga0070690_100118216 3300005330 Bacteria 1777
25 Ga0070690_100413458 3300005330 Bacteria 993
26 Ga0070670_100132673 3300005331 Bacteria 2151
27 Ga0068869_101708455 3300005334 Bacteria 562
28 Ga0070666_10338038 3300005335 Bacteria 1076
29 Ga0070666_10455691 3300005335 Bacteria 924
30 Ga0070666_10457473 3300005335 Bacteria 922
31 Ga0070680_100010353 3300005336 Bacteria 7189
32 Ga0070680_100018049 3300005336 Bacteria 5573
33 Ga0070680_100060427 3300005336 Bacteria 3101
34 Ga0070680_100080487 3300005336 Bacteria 2686
35 Ga0070680_100104534 3300005336 Bacteria 2353
36 Ga0070680_100118136 3300005336 Bacteria 2212
37 Ga0070680_100207095 3300005336 Bacteria 1654
38 Ga0070680_100344015 3300005336 Bacteria 1268
39 Ga0070680_100384758 3300005336 Bacteria 1195
40 Ga0070680_101481050 3300005336 Bacteria 588
41 Ga0070682_100056593 3300005337 Bacteria 2467
42 Ga0070682_100079617 3300005337 Bacteria 2116
43 Ga0070682_100176556 3300005337 Bacteria 1488
44 Ga0068868_100084787 3300005338 Bacteria 2545
45 Ga0068868_101712231 3300005338 Bacteria 593
46 Ga0070660_100054026 3300005339 Bacteria 3100
47 Ga0070660_100214418 3300005339 Bacteria 1563
48 Ga0070660_100214853 3300005339 Bacteria 1562
49 Ga0070660_100443175 3300005339 Bacteria 1077
50 Ga0070660_100565923 3300005339 Bacteria 949
51 Ga0070689_100234567 3300005340 Bacteria 1509
52 Ga0070691_10247457 3300005341 Bacteria 955
53 Ga0070691_10563702 3300005341 Bacteria 667
54 Ga0070691_10760546 3300005341 Bacteria 587
55 Ga0070661_100008727 3300005344 Bacteria 7014
56 Ga0070661_100052268 3300005344 Bacteria 2990
57 Ga0070661_100174307 3300005344 Bacteria 1634
58 Ga0070661_100198876 3300005344 Bacteria 1531
59 Ga0070661_100429904 3300005344 Bacteria 1048
60 Ga0070661_100887195 3300005344 Bacteria 735
61 Ga0070668_100141276 3300005347 Bacteria 1940
62 Ga0070668_100434640 3300005347 Bacteria 1126
63 Ga0070668_100561624 3300005347 Bacteria 994
64 Ga0070675_100600588 3300005354 Bacteria 998
65 Ga0070675_101035157 3300005354 Bacteria 754
66 Ga0070675_102232233 3300005354 Bacteria 504
67 Ga0070671_100026694 3300005355 Bacteria 4749
68 Ga0070671_100417025 3300005355 Bacteria 1150
69 Ga0070671_100457156 3300005355 Bacteria 1096
70 Ga0070671_100503345 3300005355 Bacteria 1042
71 Ga0070671_100615772 3300005355 Bacteria 939
72 Ga0070671_100796426 3300005355 Bacteria 823
73 Ga0070671_100922812 3300005355 Bacteria 763
74 Ga0070674_100618098 3300005356 Bacteria 918
75 Ga0070688_100134037 3300005365 Bacteria 1675
76 Ga0070659_100050323 3300005366 Bacteria 3275
77 Ga0070659_100055590 3300005366 Bacteria 3120
78 Ga0070659_100161526 3300005366 Bacteria 1832
79 Ga0070659_100163174 3300005366 Bacteria 1822
80 Ga0070659_100641923 3300005366 Bacteria 915
81 Ga0070659_101458966 3300005366 Bacteria 609
82 Ga0070667_100443597 3300005367 Bacteria 1185
83 Ga0070667_100865549 3300005367 Bacteria 840
84 Ga0070667_102232280 3300005367 Bacteria 515
85 Ga0070709_10013692 3300005434 Bacteria 4566
86 Ga0070709_10216301 3300005434 Bacteria 1364
87 Ga0070709_10501740 3300005434 Bacteria 922
88 Ga0070709_10592193 3300005434 Bacteria 853
89 Ga0070709_11130917 3300005434 Bacteria 627
90 Ga0070709_11492181 3300005434 Bacteria 549
91 Ga0070709_11779940 3300005434 Bacteria 504
92 Ga0070714_100017549 3300005435 Bacteria 5800
93 Ga0070714_100034223 3300005435 Bacteria 4254
94 Ga0070714_100139175 3300005435 Bacteria 2177
95 Ga0070714_100153352 3300005435 Bacteria 2078
96 Ga0070714_100155384 3300005435 Bacteria 2064
97 Ga0070714_100171182 3300005435 Bacteria 1971
98 Ga0070714_100419155 3300005435 Bacteria 1268
99 Ga0070714_102199250 3300005435 Bacteria 537
100 Ga0070713_100014822 3300005436 Bacteria 5803
101 Ga0070713_100021104 3300005436 Bacteria 5003
102 Ga0070713_100046951 3300005436 Bacteria 3547
103 Ga0070713_100129027 3300005436 Bacteria 2227
104 Ga0070713_100392014 3300005436 Bacteria 1296
105 Ga0070713_100701799 3300005436 Bacteria 966
106 Ga0070713_102188922 3300005436 Bacteria 536
107 Ga0070710_10001588 3300005437 Bacteria 10728
108 Ga0070710_10072511 3300005437 Bacteria 1989
109 Ga0070710_10123317 3300005437 Bacteria 1571
110 Ga0070710_10130478 3300005437 Bacteria 1532
111 Ga0070710_10456609 3300005437 Bacteria 867
112 Ga0070710_10851112 3300005437 Bacteria 655
113 Ga0070710_10962561 3300005437 Bacteria 620
114 Ga0070710_11098831 3300005437 Bacteria 584
115 Ga0070711_100028547 3300005439 Bacteria 3672
116 Ga0070711_100029901 3300005439 Bacteria 3600
117 Ga0070711_100038741 3300005439 Bacteria 3207
118 Ga0070711_100691652 3300005439 Bacteria 858
119 Ga0070711_101022914 3300005439 Bacteria 709
120 Ga0070711_101407061 3300005439 Bacteria 607
121 Ga0070705_100124093 3300005440 Bacteria 1673
122 Ga0070705_100189429 3300005440 Bacteria 1400
123 Ga0070700_100438581 3300005441 Bacteria 991
124 Ga0070700_100468237 3300005441 Bacteria 963
125 Ga0070700_100655804 3300005441 Bacteria 829
126 Ga0070694_100478387 3300005444 Bacteria 988
127 Ga0070708_100750531 3300005445 Bacteria 918
128 Ga0070708_101642482 3300005445 Bacteria 598
129 Ga0070663_100024885 3300005455 Bacteria 4035
130 Ga0070663_100055427 3300005455 Bacteria 2837
131 Ga0070663_100056994 3300005455 Bacteria 2801
132 Ga0070663_100118082 3300005455 Bacteria 2000
133 Ga0070663_100118705 3300005455 Bacteria 1995
134 Ga0070663_101624809 3300005455 Bacteria 577
135 Ga0070663_101911027 3300005455 Bacteria 533
136 Ga0070678_100027340 3300005456 Bacteria 3872
137 Ga0070678_100048909 3300005456 Bacteria 3048
138 Ga0070678_100094259 3300005456 Bacteria 2304
139 Ga0070678_101959539 3300005456 Bacteria 554
140 Ga0070662_100046511 3300005457 Bacteria 3118
141 Ga0070681_10002399 3300005458 Bacteria 17119
142 Ga0070681_10015902 3300005458 Bacteria 7502
143 Ga0070681_10125097 3300005458 Bacteria 2503
144 Ga0070681_10195461 3300005458 Bacteria 1942
145 Ga0070681_10230246 3300005458 Bacteria 1768
146 Ga0070681_10324367 3300005458 Bacteria 1449
147 Ga0070681_10618034 3300005458 Bacteria 998
148 Ga0070681_10740378 3300005458 Bacteria 899
149 Ga0070681_11381969 3300005458 Bacteria 628
150 Ga0070681_11525941 3300005458 Unclassified 593
151 Ga0070681_11816256 3300005458 Bacteria 536
152 Ga0068867_100065904 3300005459 Bacteria 2696
153 Ga0068867_100683075 3300005459 Bacteria 904
154 Ga0070706_100261856 3300005467 Bacteria 1614
155 Ga0070707_100296316 3300005468 Bacteria 1572
156 Ga0070698_100057678 3300005471 Bacteria 3929
157 Ga0070698_100201891 3300005471 Bacteria 1924
158 Ga0070698_101484497 3300005471 Bacteria 629
159 Ga0070699_100374059 3300005518 Bacteria 1286
160 Ga0070679_100004715 3300005530 Bacteria 12576
161 Ga0070679_100028002 3300005530 Bacteria 5552
162 Ga0070679_100031149 3300005530 Bacteria 5269
163 Ga0070679_100183296 3300005530 Bacteria 2065
164 Ga0070679_100231443 3300005530 Bacteria 1807
165 Ga0070679_100450048 3300005530 Bacteria 1232
166 Ga0070679_100574670 3300005530 Bacteria 1071
167 Ga0070679_100876743 3300005530 Bacteria 841
168 Ga0070684_100062718 3300005535 Bacteria 3256
169 Ga0070684_100113862 3300005535 Bacteria 2428
170 Ga0070684_100534685 3300005535 Bacteria 1087
171 Ga0070684_102242961 3300005535 Bacteria 515
172 Ga0070697_100208545 3300005536 Bacteria 1663
173 Ga0070697_100813478 3300005536 Bacteria 827
174 Ga0068853_100043068 3300005539 Bacteria 3862
175 Ga0068853_100095328 3300005539 Bacteria 2624
176 Ga0068853_100164376 3300005539 Bacteria 2005
177 Ga0068853_100289257 3300005539 Bacteria 1512
178 Ga0068853_100378153 3300005539 Unclassified 1322
179 Ga0068853_101039989 3300005539 Bacteria 789
180 Ga0068853_101352192 3300005539 Bacteria 689
181 Ga0068853_101584522 3300005539 Bacteria 634
182 Ga0068853_101612872 3300005539 Bacteria 629
183 Ga0068853_101958586 3300005539 Bacteria 568
184 Ga0068853_102013506 3300005539 Bacteria 560
185 Ga0070686_100064426 3300005544 Bacteria 2377
186 Ga0070686_100080748 3300005544 Bacteria 2152
187 Ga0070695_100358513 3300005545 Bacteria 1094
188 Ga0070695_101093828 3300005545 Bacteria 652
189 Ga0070696_100257156 3300005546 Bacteria 1323
190 Ga0070696_101411030 3300005546 Bacteria 594
191 Ga0070693_100093687 3300005547 Bacteria 1816
192 Ga0070693_100122181 3300005547 Bacteria 1616
193 Ga0070693_100142645 3300005547 Bacteria 1509
194 Ga0070665_100729487 3300005548 Bacteria 1004
195 Ga0070665_101278833 3300005548 Bacteria 744
196 Ga0070665_101455492 3300005548 Bacteria 694
197 Ga0068855_100039857 3300005563 Bacteria 5576
198 Ga0068855_100043462 3300005563 Bacteria 5323
199 Ga0068855_100141643 3300005563 Bacteria 2740
200 Ga0068855_100147669 3300005563 Bacteria 2675
201 Ga0068855_100154928 3300005563 Bacteria 2603
202 Ga0068855_100190258 3300005563 Bacteria 2315
203 Ga0070664_100083336 3300005564 Bacteria 2758
204 Ga0070664_100129858 3300005564 Bacteria 2213
205 Ga0070664_100137203 3300005564 Bacteria 2152
206 Ga0070664_101025562 3300005564 Bacteria 776
207 Ga0070664_101061793 3300005564 Bacteria 762
208 Ga0068857_100181544 3300005577 Bacteria 1915
209 Ga0068857_100225376 3300005577 Bacteria 1713
210 Ga0068857_100280896 3300005577 Bacteria 1531
211 Ga0068857_101236695 3300005577 Bacteria 724
212 Ga0068854_100151642 3300005578 Bacteria 1788
213 Ga0068854_100286941 3300005578 Bacteria 1327
214 Ga0068854_101052506 3300005578 Bacteria 723
215 Ga0068854_102081773 3300005578 Bacteria 524
216 Ga0068856_100000511 3300005614 Bacteria 42929
217 Ga0068856_100091527 3300005614 Bacteria 3026
218 Ga0068856_100225258 3300005614 Bacteria 1891
219 Ga0068856_100263065 3300005614 Bacteria 1741
220 Ga0068856_100291493 3300005614 Bacteria 1649
221 Ga0068856_100385155 3300005614 Bacteria 1422
222 Ga0068856_100705249 3300005614 Bacteria 1029
223 Ga0068856_100858150 3300005614 Bacteria 927
224 Ga0068856_100893116 3300005614 Bacteria 907
225 Ga0068856_100985627 3300005614 Bacteria 861
226 Ga0068856_101418486 3300005614 Bacteria 709
227 Ga0070702_100742084 3300005615 Bacteria 753
228 Ga0068852_100020318 3300005616 Bacteria 5280
229 Ga0068852_100021775 3300005616 Bacteria 5127
230 Ga0068852_100031309 3300005616 Bacteria 4388
231 Ga0068852_100142510 3300005616 Bacteria 2219
232 Ga0068852_100230372 3300005616 Bacteria 1766
233 Ga0068852_100338197 3300005616 Bacteria 1466
234 Ga0068852_100464054 3300005616 Bacteria 1256
235 Ga0068852_101045784 3300005616 Bacteria 836
236 Ga0068852_102398868 3300005616 Bacteria 548
237 Ga0068859_100128271 3300005617 Bacteria 2607
238 Ga0068859_100599379 3300005617 Bacteria 1195
239 Ga0068859_100725235 3300005617 Bacteria 1084
240 Ga0068859_102963760 3300005617 Bacteria 519
241 Ga0068864_100047146 3300005618 Bacteria 3700
242 Ga0068864_100179912 3300005618 Bacteria 1933
243 Ga0068864_100760340 3300005618 Bacteria 950
244 Ga0068861_101062990 3300005719 Bacteria 776
245 Ga0068861_101209827 3300005719 Bacteria 731
246 Ga0068861_102003200 3300005719 Bacteria 578
247 Ga0068851_10061528 3300005834 Bacteria 1924
248 Ga0068851_10505837 3300005834 Bacteria 725
249 Ga0068863_100433467 3300005841 Bacteria 1289
250 Ga0068863_100450284 3300005841 Bacteria 1263
251 Ga0068863_100699649 3300005841 Bacteria 1007
252 Ga0068858_100156748 3300005842 Bacteria 2142
253 Ga0068858_100184258 3300005842 Bacteria 1972
254 Ga0068858_100442228 3300005842 Bacteria 1252
255 Ga0068858_100782344 3300005842 Bacteria 931
256 Ga0068860_100000081 3300005843 Bacteria 170066
257 Ga0068860_100041049 3300005843 Bacteria 4420
258 Ga0068860_100088918 3300005843 Bacteria 2940
259 Ga0068860_100127254 3300005843 Bacteria 2442
260 Ga0068860_100458082 3300005843 Bacteria 1269
261 Ga0068862_100149256 3300005844 Bacteria 2080
262 Ga0068862_100837773 3300005844 Bacteria 900
263 Ga0068862_102685710 3300005844 Bacteria 510
264 Ga0081455_10700670 3300005937 Bacteria 645
265 Ga0081540_1003483 3300005983 Bacteria 12420
266 Ga0081540_1006055 3300005983 Bacteria 8894
267 Ga0081540_1019571 3300005983 Bacteria 4106
268 Ga0081540_1049799 3300005983 Bacteria 2086
269 Ga0081540_1077673 3300005983 Bacteria 1508
270 Ga0081540_1092091 3300005983 Bacteria 1331
271 Ga0070717_10010448 3300006028 Bacteria 7011
272 Ga0070717_10109442 3300006028 Bacteria 2355
273 Ga0070717_10261019 3300006028 Bacteria 1533
274 Ga0070717_10577709 3300006028 Bacteria 1019
275 Ga0070717_10977580 3300006028 Bacteria 771
276 Ga0070717_11007961 3300006028 Bacteria 758
277 Ga0070717_11513009 3300006028 Bacteria 609
278 Ga0075365_10114936 3300006038 Bacteria 1852
279 Ga0075365_10410351 3300006038 Bacteria 956
280 Ga0075365_11087434 3300006038 Bacteria 563
281 Ga0075365_11194435 3300006038 Bacteria 535
282 Ga0075363_100139830 3300006048 Bacteria 1363
283 Ga0075363_100341198 3300006048 Bacteria 874
284 Ga0075432_10004468 3300006058 Bacteria 4769
285 Ga0070715_10003071 3300006163 Bacteria 5236
286 Ga0070715_10166790 3300006163 Bacteria 1093
287 Ga0070715_10191610 3300006163 Bacteria 1032
288 Ga0070715_10199290 3300006163 Bacteria 1016
289 Ga0070716_100002745 3300006173 Bacteria 8168
290 Ga0070716_100005922 3300006173 Bacteria 5950
291 Ga0070716_100034560 3300006173 Bacteria 2773
292 Ga0070716_100178312 3300006173 Bacteria 1393
293 Ga0070716_100216055 3300006173 Bacteria 1285
294 Ga0070716_100903109 3300006173 Bacteria 692
295 Ga0070716_101233290 3300006173 Bacteria 602
296 Ga0070712_100114950 3300006175 Bacteria 2016
297 Ga0070712_100234276 3300006175 Bacteria 1459
298 Ga0070712_101710710 3300006175 Bacteria 551
299 Ga0075362_10081493 3300006177 Bacteria 1492
300 Ga0075362_10724604 3300006177 Bacteria 520
301 Ga0075367_10875532 3300006178 Bacteria 573
302 Ga0075369_10052131 3300006186 Bacteria 1773
303 Ga0075369_10642735 3300006186 Bacteria 509
304 Ga0075427_10010640 3300006194 Bacteria 1380
305 Ga0075366_10390284 3300006195 Bacteria 856
306 Ga0097621_100025107 3300006237 Bacteria 4660
307 Ga0097621_100028310 3300006237 Bacteria 4416
308 Ga0097621_100266689 3300006237 Bacteria 1503
309 Ga0097621_101255871 3300006237 Bacteria 699
310 Ga0075370_10223509 3300006353 Bacteria 1113
311 Ga0075370_10248615 3300006353 Bacteria 1054
312 Ga0068871_100047227 3300006358 Bacteria 3471
313 Ga0068871_100129685 3300006358 Bacteria 2137
314 Ga0068871_100130756 3300006358 Bacteria 2128
315 Ga0068871_100175659 3300006358 Bacteria 1839
316 Ga0068871_100330825 3300006358 Bacteria 1344
317 Ga0068871_100648707 3300006358 Bacteria 964
318 Ga0068871_101034526 3300006358 Bacteria 766
319 Ga0075428_100020744 3300006844 Bacteria 7274
320 Ga0075430_100008477 3300006846 Bacteria 8685
321 Ga0075431_100003601 3300006847 Bacteria 15013
322 Ga0075433_10000743 3300006852 Bacteria 22360
323 Ga0075433_10774626 3300006852 Bacteria 839
324 Ga0075434_100001145 3300006871 Bacteria 21892
325 Ga0075434_100020153 3300006871 Bacteria 6463
326 Ga0075434_100190918 3300006871 Bacteria 2069
327 Ga0075434_100482552 3300006871 Bacteria 1260
328 Ga0075429_100016228 3300006880 Bacteria 6453
329 Ga0068865_100093108 3300006881 Bacteria 2191
330 Ga0068865_101490872 3300006881 Bacteria 606
331 Ga0068865_101846752 3300006881 Bacteria 547
332 Ga0075436_100069415 3300006914 Bacteria 2435
333 Ga0075436_100180295 3300006914 Bacteria 1493
334 Ga0075436_100339456 3300006914 Bacteria 1081
335 Ga0075436_100411915 3300006914 Bacteria 980
336 Ga0075436_100613272 3300006914 Bacteria 802
337 Ga0097620_100128270 3300006931 Bacteria 2607
338 Ga0097620_100599354 3300006931 Bacteria 1195
339 Ga0097620_100725144 3300006931 Bacteria 1084
340 Ga0097620_102964498 3300006931 Bacteria 519
341 Ga0099824_1016140 3300006942 Bacteria 6854
342 Ga0099824_1031119 3300006942 Bacteria 2061
343 Ga0099822_1015864 3300006943 Bacteria 8390
344 Ga0075435_100030190 3300007076 Bacteria 4260
345 Ga0075435_100038780 3300007076 Bacteria 3799
346 Ga0075435_100100575 3300007076 Bacteria 2395
347 Ga0075435_100503462 3300007076 Bacteria 1047
348 Ga0075435_100629218 3300007076 Bacteria 931
349 Ga0099794_10014612 3300007265 Bacteria 3444
350 Ga0099795_10003041 3300007788 Bacteria 4088
351 Ga0105251_10384048 3300009011 Bacteria 644
352 Ga0105240_10045935 3300009093 Bacteria 5537
353 Ga0105240_10352967 3300009093 Bacteria 1668
354 Ga0105240_10390925 3300009093 Bacteria 1569
355 Ga0105240_10404850 3300009093 Bacteria 1536
356 Ga0105240_10504776 3300009093 Bacteria 1344
357 Ga0105240_10641266 3300009093 Bacteria 1165
358 Ga0111539_10024580 3300009094 Bacteria 7390
359 Ga0111539_12114440 3300009094 Bacteria 653
360 Ga0105245_10018458 3300009098 Bacteria 6099
361 Ga0105245_10060564 3300009098 Bacteria 3409
362 Ga0105245_11359398 3300009098 Bacteria 760
363 Ga0105245_11913863 3300009098 Bacteria 646
364 Ga0105245_12510895 3300009098 Bacteria 569
365 Ga0105245_12711694 3300009098 Bacteria 548
366 Ga0105247_10005827 3300009101 Bacteria 7702
367 Ga0105247_10133094 3300009101 Bacteria 1622
368 Ga0105247_10135212 3300009101 Bacteria 1610
369 Ga0105247_10137704 3300009101 Bacteria 1597
370 Ga0105247_10164750 3300009101 Bacteria 1470
371 Ga0105247_10745413 3300009101 Bacteria 742
372 Ga0105247_10969741 3300009101 Bacteria 662
373 Ga0105247_11146483 3300009101 Bacteria 616
374 Ga0114129_10026808 3300009147 Bacteria 8160
375 Ga0114129_10034011 3300009147 Bacteria 7200
376 Ga0105243_10064279 3300009148 Bacteria 2944
377 Ga0105243_10165393 3300009148 Bacteria 1911
378 Ga0105243_10587340 3300009148 Bacteria 1070
379 Ga0105243_10621854 3300009148 Bacteria 1043
380 Ga0105243_10667421 3300009148 Bacteria 1009
381 Ga0105243_10767740 3300009148 Bacteria 947
382 Ga0105241_10244369 3300009174 Bacteria 1519
383 Ga0105241_10253124 3300009174 Bacteria 1494
384 Ga0105241_10444102 3300009174 Bacteria 1146
385 Ga0105241_10577651 3300009174 Bacteria 1013
386 Ga0105241_10702411 3300009174 Bacteria 923
387 Ga0105241_10853191 3300009174 Bacteria 842
388 Ga0105241_11136374 3300009174 Bacteria 737
389 Ga0105242_10109893 3300009176 Bacteria 2348
390 Ga0105242_10778881 3300009176 Bacteria 944
391 Ga0105242_10804104 3300009176 Bacteria 931
392 Ga0105242_11171424 3300009176 Bacteria 786
393 Ga0105242_11530291 3300009176 Bacteria 699
394 Ga0105242_11761777 3300009176 Bacteria 657
395 Ga0105248_10073696 3300009177 Bacteria 3837
396 Ga0105248_10090767 3300009177 Bacteria 3440
397 Ga0105248_10579776 3300009177 Bacteria 1266
398 Ga0105248_10592060 3300009177 Bacteria 1251
399 Ga0105248_10635314 3300009177 Bacteria 1204
400 Ga0105248_11573406 3300009177 Bacteria 744
401 Ga0105248_12700032 3300009177 Bacteria 566
402 Ga0105248_12829110 3300009177 Bacteria 553
403 Ga0105248_12872476 3300009177 Bacteria 549
404 Ga0105237_10170111 3300009545 Bacteria 2179
405 Ga0105237_10205222 3300009545 Bacteria 1971
406 Ga0105237_10243007 3300009545 Bacteria 1802
407 Ga0105237_10318916 3300009545 Bacteria 1557
408 Ga0105237_10339963 3300009545 Bacteria 1506
409 Ga0105237_10919712 3300009545 Bacteria 882
410 Ga0105237_11393345 3300009545 Bacteria 707
411 Ga0105237_11429649 3300009545 Bacteria 698
412 Ga0105237_11867400 3300009545 Bacteria 609
413 Ga0105237_12176289 3300009545 Bacteria 564
414 Ga0105237_12567438 3300009545 Bacteria 520
415 Ga0105238_10024378 3300009551 Bacteria 6166
416 Ga0105238_10063127 3300009551 Bacteria 3704
417 Ga0105238_10073250 3300009551 Bacteria 3420
418 Ga0105238_10189980 3300009551 Bacteria 2030
419 Ga0105238_10230507 3300009551 Bacteria 1829
420 Ga0105238_10672548 3300009551 Bacteria 1046
421 Ga0105238_11002631 3300009551 Bacteria 856
422 Ga0105238_11083624 3300009551 Bacteria 823
423 Ga0105238_11240178 3300009551 Bacteria 771
424 Ga0105238_11273238 3300009551 Bacteria 761
425 Ga0105238_11539261 3300009551 Bacteria 694
426 Ga0105249_10252033 3300009553 Bacteria 1751
427 Ga0105249_10473406 3300009553 Bacteria 1294
428 Ga0105249_11343906 3300009553 Bacteria 786
429 Ga0105249_12161709 3300009553 Bacteria 629
430 Ga0099796_10009589 3300010159 Bacteria 2627
431 Ga0099796_10019349 3300010159 Bacteria 2062
432 Ga0099796_10050471 3300010159 Bacteria 1442
433 Ga0105239_10061201 3300010375 Bacteria 4131
434 Ga0105239_10106838 3300010375 Bacteria 3100
435 Ga0105239_10204077 3300010375 Bacteria 2215
436 Ga0105239_10239989 3300010375 Bacteria 2034
437 Ga0105239_10245416 3300010375 Bacteria 2010
438 Ga0105239_10295853 3300010375 Bacteria 1823
439 Ga0105239_10321370 3300010375 Bacteria 1745
440 Ga0105239_10582760 3300010375 Bacteria 1275
441 Ga0105239_10725123 3300010375 Bacteria 1137
442 Ga0105239_11515558 3300010375 Bacteria 775
443 Ga0105239_12017722 3300010375 Bacteria 670
444 Ga0105239_12128132 3300010375 Bacteria 652
445 Ga0105239_12651262 3300010375 Bacteria 585
446 Ga0105239_13120575 3300010375 Bacteria 540
447 Ga0105246_10018381 3300011119 Bacteria 4455
448 Ga0105246_10038660 3300011119 Bacteria 3210
449 Ga0105246_10054033 3300011119 Bacteria 2766
450 Ga0105246_10149231 3300011119 Bacteria 1768
451 Ga0105246_10831917 3300011119 Bacteria 822
452 Ga0105246_10879514 3300011119 Bacteria 802
453 Ga0105246_12335224 3300011119 Bacteria 523
454 Ga0105246_12391373 3300011119 Bacteria 518
455 Ga0157336_1015952 3300012477 Bacteria 633
456 Ga0157347_1047842 3300012502 Bacteria 582
457 Ga0157339_1032615 3300012505 Bacteria 617
458 Ga0157316_1048891 3300012510 Bacteria 577
459 Ga0157373_10488412 3300013100 Bacteria 889
460 Ga0157371_10096507 3300013102 Bacteria 2095
461 Ga0157371_10533155 3300013102 Bacteria 869
462 Ga0157370_10037503 3300013104 Bacteria 4698
463 Ga0157370_10182418 3300013104 Bacteria 1950
464 Ga0157370_10332952 3300013104 Bacteria 1400
465 Ga0157370_10401465 3300013104 Bacteria 1262
466 Ga0157370_11528237 3300013104 Bacteria 600
467 Ga0157369_10037064 3300013105 Bacteria 5341
468 Ga0157369_10144894 3300013105 Bacteria 2512
469 Ga0157369_10536814 3300013105 Bacteria 1209
470 Ga0157369_10693935 3300013105 Bacteria 1048
471 Ga0157369_11263148 3300013105 Bacteria 753
472 Ga0157369_11820725 3300013105 Bacteria 618
473 Ga0157369_11828381 3300013105 Bacteria 617
474 Ga0157374_10077147 3300013296 Bacteria 3152
475 Ga0157374_10253496 3300013296 Bacteria 1732
476 Ga0157374_10324805 3300013296 Bacteria 1525
477 Ga0157374_10523148 3300013296 Bacteria 1192
478 Ga0157374_11104747 3300013296 Bacteria 813
479 Ga0157374_12982712 3300013296 Bacteria 500
480 Ga0157378_10047954 3300013297 Bacteria 3798
481 Ga0157378_10087971 3300013297 Bacteria 2818
482 Ga0157378_10154935 3300013297 Bacteria 2138
483 Ga0157378_10203242 3300013297 Bacteria 1874
484 Ga0157378_12682436 3300013297 Bacteria 551
485 Ga0163162_10121233 3300013306 Bacteria 2719
486 Ga0163162_10163497 3300013306 Bacteria 2349
487 Ga0163162_10167630 3300013306 Bacteria 2320
488 Ga0163162_10184315 3300013306 Bacteria 2214
489 Ga0163162_10213555 3300013306 Bacteria 2059
490 Ga0163162_10250667 3300013306 Bacteria 1902
491 Ga0163162_10478573 3300013306 Bacteria 1376
492 Ga0163162_10858045 3300013306 Bacteria 1023
493 Ga0163162_11256467 3300013306 Bacteria 841
494 Ga0163162_11280754 3300013306 Bacteria 833
495 Ga0157372_10047003 3300013307 Bacteria 4793
496 Ga0157372_10106802 3300013307 Bacteria 3203
497 Ga0157372_10454514 3300013307 Bacteria 1493
498 Ga0157372_11092402 3300013307 Bacteria 923
499 Ga0157372_12176264 3300013307 Bacteria 637
500 Ga0157372_13475999 3300013307 Bacteria 501
501 Ga0157375_10005808 3300013308 Bacteria 10737
502 Ga0157375_10285482 3300013308 Bacteria 1814
503 Ga0157375_10335069 3300013308 Bacteria 1678
504 Ga0157375_10379717 3300013308 Bacteria 1580
505 Ga0157375_10570024 3300013308 Bacteria 1293
506 Ga0157375_12141096 3300013308 Bacteria 666
507 Ga0163163_10239587 3300014325 Bacteria 1864
508 Ga0163163_11082873 3300014325 Bacteria 864
509 Ga0163163_12346894 3300014325 Bacteria 592
510 Ga0157377_10276564 3300014745 Bacteria 1099
511 Ga0157377_10788389 3300014745 Bacteria 699
512 Ga0157379_10033296 3300014968 Bacteria 4596
513 Ga0157379_10054006 3300014968 Bacteria 3590
514 Ga0157379_10327957 3300014968 Bacteria 1398
515 Ga0157376_10054066 3300014969 Bacteria 3346
516 Ga0157376_10667617 3300014969 Bacteria 1041
517 Ga0157376_11098885 3300014969 Bacteria 821
518 Ga0182006_1307806 3300015261 Bacteria 520
519 Ga0182007_10267247 3300015262 Bacteria 618
520 Ga0163161_10251815 3300017792 Bacteria 1377
521 Ga0163161_10280325 3300017792 Bacteria 1307
522 Ga0163161_10611489 3300017792 Bacteria 899
523 Ga0163161_11047926 3300017792 Bacteria 698
524 Ga0197907_10958444 3300020069 Bacteria 986
525 Ga0197907_11374702 3300020069 Bacteria 1064
526 Ga0197907_11466506 3300020069 Bacteria 901
527 Ga0206356_10164986 3300020070 Bacteria 1086
528 Ga0206356_10832790 3300020070 Bacteria 2162
529 Ga0206349_1186427 3300020075 Bacteria 1185
530 Ga0206349_1667692 3300020075 Bacteria 558
531 Ga0206355_1362714 3300020076 Bacteria 1473
532 Ga0206355_1385882 3300020076 Bacteria 701
533 Ga0206352_10462767 3300020078 Bacteria 998
534 Ga0206352_11142238 3300020078 Bacteria 650
535 Ga0206350_11031563 3300020080 Bacteria 761
536 Ga0206350_11584609 3300020080 Bacteria 2123
537 Ga0206354_10337846 3300020081 Bacteria 1088
538 Ga0206353_10975082 3300020082 Bacteria 1513
539 Ga0213874_10031557 3300021377 Bacteria 1534
540 Ga0213876_10528491 3300021384 Bacteria 628
541 Ga0224712_10004292 3300022467 Bacteria 3829
542 Ga0224712_10143675 3300022467 Bacteria 1052
543 Ga0209148_1000654 3300025254 Bacteria 29905
544 Ga0209148_1008628 3300025254 Bacteria 2038
545 Ga0209233_1003374 3300025261 Bacteria 5638
546 Ga0209455_1001585 3300025272 Bacteria 10019
547 Ga0209455_1001960 3300025272 Bacteria 8475
548 Ga0209673_1053448 3300025273 Bacteria 1053
549 Ga0209564_1021310 3300025295 Bacteria 2336
550 Ga0209758_1000320 3300025297 Bacteria 92649
551 Ga0209758_1003130 3300025297 Bacteria 15616
552 Ga0209758_1004056 3300025297 Bacteria 12618
553 Ga0209758_1038489 3300025297 Bacteria 1833
554 Ga0209256_1070500 3300025299 Bacteria 787
555 Ga0207426_1000746 3300025302 Bacteria 36609
556 Ga0209257_1035900 3300025304 Bacteria 1528
557 Ga0207656_10041676 3300025321 Bacteria 1952
558 Ga0207692_10001008 3300025898 Bacteria 10274
559 Ga0207692_10075849 3300025898 Bacteria 1785
560 Ga0207692_10098124 3300025898 Bacteria 1603
561 Ga0207692_10098340 3300025898 Bacteria 1601
562 Ga0207692_10305282 3300025898 Bacteria 970
563 Ga0207692_10639432 3300025898 Bacteria 687
564 Ga0207692_10740706 3300025898 Bacteria 640
565 Ga0207692_11179689 3300025898 Bacteria 508
566 Ga0207642_10065549 3300025899 Bacteria 1707
567 Ga0207710_10030588 3300025900 Bacteria 2350
568 Ga0207710_10078247 3300025900 Bacteria 1529
569 Ga0207710_10173380 3300025900 Bacteria 1055
570 Ga0207688_10157413 3300025901 Bacteria 1345
571 Ga0207688_10471307 3300025901 Bacteria 784
572 Ga0207680_10228873 3300025903 Bacteria 1277
573 Ga0207680_10558871 3300025903 Bacteria 817
574 Ga0207647_10198710 3300025904 Bacteria 1160
575 Ga0207647_10473410 3300025904 Bacteria 700
576 Ga0207647_10584018 3300025904 Bacteria 617
577 Ga0207685_10088273 3300025905 Bacteria 1299
578 Ga0207685_10109882 3300025905 Bacteria 1193
579 Ga0207699_10024073 3300025906 Bacteria 3324
580 Ga0207699_10024173 3300025906 Bacteria 3318
581 Ga0207699_10276229 3300025906 Bacteria 1166
582 Ga0207699_10340138 3300025906 Bacteria 1057
583 Ga0207699_10590228 3300025906 Bacteria 808
584 Ga0207699_10850084 3300025906 Bacteria 672
585 Ga0207645_10061031 3300025907 Bacteria 2408
586 Ga0207645_10449709 3300025907 Bacteria 870
587 Ga0207705_10025993 3300025909 Bacteria 4178
588 Ga0207705_10033440 3300025909 Bacteria 3673
589 Ga0207705_10061369 3300025909 Bacteria 2716
590 Ga0207705_10119606 3300025909 Bacteria 1953
591 Ga0207705_10341824 3300025909 Bacteria 1152
592 Ga0207705_10380954 3300025909 Bacteria 1089
593 Ga0207705_11221990 3300025909 Bacteria 576
594 Ga0207684_10108120 3300025910 Bacteria 2380
595 Ga0207654_10166478 3300025911 Bacteria 1428
596 Ga0207654_10481206 3300025911 Bacteria 874
597 Ga0207707_10000712 3300025912 Bacteria 33048
598 Ga0207707_10043460 3300025912 Bacteria 3920
599 Ga0207707_10086627 3300025912 Bacteria 2737
600 Ga0207707_10120081 3300025912 Bacteria 2298
601 Ga0207707_10212129 3300025912 Bacteria 1686
602 Ga0207707_10256411 3300025912 Bacteria 1518
603 Ga0207707_11082415 3300025912 Bacteria 654
604 Ga0207707_11312564 3300025912 Bacteria 581
605 Ga0207695_10098615 3300025913 Bacteria 2921
606 Ga0207695_10134456 3300025913 Bacteria 2427
607 Ga0207695_10310822 3300025913 Bacteria 1466
608 Ga0207695_10505252 3300025913 Bacteria 1091
609 Ga0207695_10535762 3300025913 Bacteria 1052
610 Ga0207695_10639022 3300025913 Bacteria 945
611 Ga0207695_10659706 3300025913 Bacteria 927
612 Ga0207695_11665894 3300025913 Bacteria 519
613 Ga0207671_10244961 3300025914 Bacteria 1409
614 Ga0207671_10274913 3300025914 Bacteria 1328
615 Ga0207671_10335614 3300025914 Bacteria 1197
616 Ga0207671_10572691 3300025914 Bacteria 900
617 Ga0207671_10645544 3300025914 Bacteria 843
618 Ga0207671_11262348 3300025914 Bacteria 576
619 Ga0207693_10007911 3300025915 Bacteria 8734
620 Ga0207693_10008718 3300025915 Bacteria 8291
621 Ga0207693_10010781 3300025915 Bacteria 7420
622 Ga0207693_10040523 3300025915 Bacteria 3669
623 Ga0207693_10054664 3300025915 Bacteria 3132
624 Ga0207693_10435258 3300025915 Bacteria 1025
625 Ga0207663_10002092 3300025916 Bacteria 9516
626 Ga0207663_10053354 3300025916 Bacteria 2525
627 Ga0207663_10060198 3300025916 Bacteria 2405
628 Ga0207663_10074335 3300025916 Bacteria 2202
629 Ga0207663_10620520 3300025916 Bacteria 851
630 Ga0207663_10772136 3300025916 Bacteria 764
631 Ga0207663_11292638 3300025916 Bacteria 587
632 Ga0207660_10004230 3300025917 Bacteria 9352
633 Ga0207660_10012387 3300025917 Bacteria 5579
634 Ga0207660_10041741 3300025917 Bacteria 3216
635 Ga0207660_10323915 3300025917 Bacteria 1231
636 Ga0207660_10356446 3300025917 Bacteria 1173
637 Ga0207660_10384268 3300025917 Bacteria 1129
638 Ga0207660_10438618 3300025917 Bacteria 1055
639 Ga0207660_10446168 3300025917 Bacteria 1046
640 Ga0207660_10534033 3300025917 Bacteria 953
641 Ga0207660_11004510 3300025917 Bacteria 680
642 Ga0207660_11219157 3300025917 Unclassified 612
643 Ga0207657_10011801 3300025919 Bacteria 8650
644 Ga0207657_10034115 3300025919 Bacteria 4580
645 Ga0207657_10144267 3300025919 Bacteria 1943
646 Ga0207657_10175605 3300025919 Bacteria 1734
647 Ga0207657_10246754 3300025919 Bacteria 1424
648 Ga0207657_10505083 3300025919 Bacteria 947
649 Ga0207649_10106212 3300025920 Bacteria 1867
650 Ga0207649_10251040 3300025920 Bacteria 1274
651 Ga0207649_10343730 3300025920 Bacteria 1102
652 Ga0207649_10441884 3300025920 Bacteria 980
653 Ga0207649_11564224 3300025920 Bacteria 522
654 Ga0207652_10013063 3300025921 Bacteria 6720
655 Ga0207652_10082507 3300025921 Bacteria 2813
656 Ga0207652_10093584 3300025921 Bacteria 2645
657 Ga0207652_10141933 3300025921 Bacteria 2148
658 Ga0207652_10147725 3300025921 Bacteria 2104
659 Ga0207652_10169575 3300025921 Bacteria 1958
660 Ga0207652_10464032 3300025921 Bacteria 1141
661 Ga0207652_10497990 3300025921 Bacteria 1097
662 Ga0207681_10655301 3300025923 Bacteria 871
663 Ga0207694_10049048 3300025924 Bacteria 3268
664 Ga0207694_10112809 3300025924 Bacteria 2164
665 Ga0207694_10117293 3300025924 Bacteria 2122
666 Ga0207694_10221598 3300025924 Bacteria 1543
667 Ga0207694_10416070 3300025924 Bacteria 1119
668 Ga0207694_10968632 3300025924 Bacteria 720
669 Ga0207694_11785666 3300025924 Bacteria 517
670 Ga0207650_11240659 3300025925 Bacteria 635
671 Ga0207659_10406453 3300025926 Bacteria 1140
672 Ga0207659_11436429 3300025926 Bacteria 591
673 Ga0207687_10425221 3300025927 Bacteria 1097
674 Ga0207687_11692232 3300025927 Bacteria 542
675 Ga0207700_10010097 3300025928 Bacteria 5936
676 Ga0207700_10040777 3300025928 Bacteria 3391
677 Ga0207700_10073686 3300025928 Bacteria 2638
678 Ga0207700_10075769 3300025928 Bacteria 2608
679 Ga0207700_10244283 3300025928 Bacteria 1531
680 Ga0207700_10428303 3300025928 Bacteria 1163
681 Ga0207700_11140587 3300025928 Bacteria 696
682 Ga0207664_10021619 3300025929 Bacteria 4789
683 Ga0207664_10087799 3300025929 Bacteria 2543
684 Ga0207664_10089899 3300025929 Bacteria 2515
685 Ga0207664_10240282 3300025929 Bacteria 1577
686 Ga0207664_10266271 3300025929 Bacteria 1500
687 Ga0207664_11499275 3300025929 Bacteria 596
688 Ga0207664_11569069 3300025929 Bacteria 580
689 Ga0207664_11973968 3300025929 Bacteria 506
690 Ga0207644_10030007 3300025931 Bacteria 3776
691 Ga0207644_10242240 3300025931 Bacteria 1436
692 Ga0207644_10473821 3300025931 Bacteria 1030
693 Ga0207644_11554496 3300025931 Bacteria 555
694 Ga0207690_10104376 3300025932 Bacteria 2030
695 Ga0207690_10531641 3300025932 Bacteria 954
696 Ga0207706_10042611 3300025933 Bacteria 4023
697 Ga0207686_10014926 3300025934 Bacteria 4336
698 Ga0207686_10070179 3300025934 Bacteria 2250
699 Ga0207686_10211002 3300025934 Bacteria 1396
700 Ga0207686_10527885 3300025934 Bacteria 919
701 Ga0207686_10634529 3300025934 Bacteria 844
702 Ga0207686_10769558 3300025934 Bacteria 770
703 Ga0207709_10157926 3300025935 Bacteria 1578
704 Ga0207709_10439488 3300025935 Bacteria 1006
705 Ga0207709_10650302 3300025935 Bacteria 839
706 Ga0207670_10029772 3300025936 Bacteria 3481
707 Ga0207669_10241887 3300025937 Bacteria 1338
708 Ga0207669_10392483 3300025937 Bacteria 1085
709 Ga0207704_10039533 3300025938 Bacteria 2748
710 Ga0207704_10132223 3300025938 Bacteria 1730
711 Ga0207704_11078754 3300025938 Bacteria 682
712 Ga0207704_11992703 3300025938 Bacteria 500
713 Ga0207665_10001678 3300025939 Bacteria 14897
714 Ga0207665_10004965 3300025939 Bacteria 8875
715 Ga0207665_10040327 3300025939 Bacteria 3115
716 Ga0207665_10058436 3300025939 Bacteria 2607
717 Ga0207691_10245407 3300025940 Bacteria 1547
718 Ga0207711_10196700 3300025941 Bacteria 1839
719 Ga0207711_10231725 3300025941 Bacteria 1691
720 Ga0207711_10331608 3300025941 Bacteria 1407
721 Ga0207711_10607104 3300025941 Bacteria 1021
722 Ga0207689_10454601 3300025942 Bacteria 1071
723 Ga0207661_10000462 3300025944 Bacteria 26255
724 Ga0207661_10018101 3300025944 Bacteria 5232
725 Ga0207661_10198214 3300025944 Bacteria 1764
726 Ga0207661_10230170 3300025944 Bacteria 1641
727 Ga0207679_10066116 3300025945 Bacteria 2708
728 Ga0207679_10293268 3300025945 Bacteria 1399
729 Ga0207679_10312704 3300025945 Bacteria 1358
730 Ga0207679_10439130 3300025945 Bacteria 1155
731 Ga0207679_10496952 3300025945 Bacteria 1088
732 Ga0207679_10918431 3300025945 Bacteria 801
733 Ga0207667_10015870 3300025949 Bacteria 8533
734 Ga0207667_10024626 3300025949 Bacteria 6604
735 Ga0207667_10076125 3300025949 Bacteria 3483
736 Ga0207667_10135083 3300025949 Bacteria 2540
737 Ga0207667_10152855 3300025949 Bacteria 2375
738 Ga0207667_10200431 3300025949 Bacteria 2048
739 Ga0207667_10313716 3300025949 Bacteria 1602
740 Ga0207667_10440822 3300025949 Bacteria 1324
741 Ga0207667_11309885 3300025949 Bacteria 701
742 Ga0207667_11678425 3300025949 Bacteria 602
743 Ga0207712_10433400 3300025961 Bacteria 1111
744 Ga0207712_11231115 3300025961 Bacteria 668
745 Ga0207668_10067714 3300025972 Bacteria 2536
746 Ga0207668_10290706 3300025972 Bacteria 1344
747 Ga0207640_10067562 3300025981 Bacteria 2393
748 Ga0207640_10077098 3300025981 Bacteria 2265
749 Ga0207640_10152482 3300025981 Bacteria 1699
750 Ga0207640_10269574 3300025981 Bacteria 1331
751 Ga0207658_10314618 3300025986 Bacteria 1353
752 Ga0207677_10070132 3300026023 Bacteria 2468
753 Ga0207677_10116123 3300026023 Bacteria 2003
754 Ga0207677_10452070 3300026023 Bacteria 1101
755 Ga0207703_10107442 3300026035 Bacteria 2375
756 Ga0207703_10120662 3300026035 Bacteria 2250
757 Ga0207703_10582716 3300026035 Bacteria 1057
758 Ga0207703_11356048 3300026035 Bacteria 684
759 Ga0207639_10203517 3300026041 Bacteria 1700
760 Ga0207639_10205930 3300026041 Bacteria 1690
761 Ga0207639_10266000 3300026041 Bacteria 1502
762 Ga0207639_10335918 3300026041 Bacteria 1346
763 Ga0207639_10465380 3300026041 Bacteria 1150
764 Ga0207639_10813727 3300026041 Bacteria 871
765 Ga0207639_11214097 3300026041 Bacteria 708
766 Ga0207639_11318663 3300026041 Bacteria 677
767 Ga0207639_11659263 3300026041 Bacteria 599
768 Ga0207678_10002923 3300026067 Bacteria 15493
769 Ga0207678_10004603 3300026067 Bacteria 12394
770 Ga0207678_10017537 3300026067 Bacteria 6288
771 Ga0207678_10049095 3300026067 Bacteria 3646
772 Ga0207678_10142656 3300026067 Bacteria 2044
773 Ga0207678_11151674 3300026067 Bacteria 687
774 Ga0207678_11537536 3300026067 Bacteria 587
775 Ga0207708_10310779 3300026075 Bacteria 1284
776 Ga0207708_11030895 3300026075 Bacteria 716
777 Ga0207702_10001649 3300026078 Bacteria 22030
778 Ga0207702_10111628 3300026078 Bacteria 2431
779 Ga0207702_10166038 3300026078 Bacteria 2020
780 Ga0207702_10189264 3300026078 Bacteria 1900
781 Ga0207702_10201326 3300026078 Bacteria 1846
782 Ga0207702_10890046 3300026078 Bacteria 882
783 Ga0207702_12384889 3300026078 Bacteria 516
784 Ga0207641_10275410 3300026088 Bacteria 1581
785 Ga0207641_11839374 3300026088 Bacteria 607
786 Ga0207641_11845709 3300026088 Bacteria 606
787 Ga0207648_10524434 3300026089 Bacteria 1086
788 Ga0207648_10702985 3300026089 Bacteria 937
789 Ga0207648_10806079 3300026089 Bacteria 874
790 Ga0207648_11499455 3300026089 Bacteria 634
791 Ga0207648_11715016 3300026089 Bacteria 590
792 Ga0207676_10030660 3300026095 Bacteria 4039
793 Ga0207676_10124550 3300026095 Bacteria 2180
794 Ga0207676_11552466 3300026095 Bacteria 659
795 Ga0207674_10132400 3300026116 Bacteria 2456
796 Ga0207674_10194765 3300026116 Bacteria 1976
797 Ga0207674_10241295 3300026116 Bacteria 1754
798 Ga0207674_11307166 3300026116 Bacteria 695
799 Ga0207675_100208150 3300026118 Bacteria 1880
800 Ga0207675_100533750 3300026118 Bacteria 1171
801 Ga0207675_101229980 3300026118 Bacteria 769
802 Ga0207683_10012932 3300026121 Bacteria 7127
803 Ga0207683_10048432 3300026121 Bacteria 3721
804 Ga0207683_10095347 3300026121 Bacteria 2653
805 Ga0207683_10936552 3300026121 Bacteria 804
806 Ga0207698_10108343 3300026142 Bacteria 2322
807 Ga0207698_10130906 3300026142 Bacteria 2143
808 Ga0207698_10303920 3300026142 Bacteria 1486
809 Ga0207698_10766917 3300026142 Bacteria 964
810 Ga0207698_10808446 3300026142 Bacteria 940
811 Ga0207698_11390661 3300026142 Bacteria 717
812 Ga0207698_11657264 3300026142 Bacteria 655
813 Ga0207698_11796151 3300026142 Bacteria 628
814 Ga0207698_11835589 3300026142 Bacteria 621
815 Ga0209589_1000015 3300027357 Bacteria 225913
816 Ga0209489_100015 3300027361 Bacteria 225913
817 Ga0209489_100085 3300027361 Bacteria 126199
818 Ga0209700_100025 3300027363 Bacteria 225913
819 Ga0209179_1005876 3300027512 Bacteria 1946
820 Ga0209588_1041104 3300027671 Bacteria 1492
821 Ga0207428_10004326 3300027907 Bacteria 13557
822 Ga0268266_10024737 3300028379 Bacteria 5109
823 Ga0268266_10048039 3300028379 Bacteria 3658
824 Ga0268266_10547385 3300028379 Bacteria 1109
825 Ga0268265_11873508 3300028380 Bacteria 606
826 Ga0268264_10000048 3300028381 Bacteria 334457
827 Ga0268264_10395954 3300028381 Bacteria 1326
828 Ga0268264_10706694 3300028381 Bacteria 1001
829 Ga0265337_1011548 3300028556 Bacteria 3038
830 Ga0265319_1060919 3300028563 Bacteria 1224
831 Ga0265334_10002347 3300028573 Bacteria 8904
832 Ga0265334_10006108 3300028573 Bacteria 5223
833 Ga0265318_10007048 3300028577 Bacteria 5118
834 Ga0265323_10002902 3300028653 Bacteria 7689
835 Ga0265322_10002295 3300028654 Bacteria 5928
836 Ga0265336_10000960 3300028666 Bacteria 14406
837 Ga0307517_10228674 3300028786 Bacteria 1120
838 Ga0265338_10000155 3300028800 Bacteria 125121
839 Ga0265338_10023891 3300028800 Bacteria 6266
840 Ga0265324_10007896 3300029957 Bacteria 4268
841 Ga0307511_10332597 3300030521 Bacteria 664
842 Ga0265330_10014531 3300031235 Bacteria 3654
843 Ga0265332_10048807 3300031238 Bacteria 1820
844 Ga0265332_10122204 3300031238 Bacteria 1093
845 Ga0265332_10430720 3300031238 Bacteria 545
846 Ga0265328_10104527 3300031239 Bacteria 1050
847 Ga0265325_10000264 3300031241 Bacteria 37210
848 Ga0265325_10038377 3300031241 Bacteria 2528
849 Ga0265340_10071225 3300031247 Bacteria 1648
850 Ga0265340_10102986 3300031247 Bacteria 1325
851 Ga0265339_10008369 3300031249 Bacteria 6587
852 Ga0265339_10234116 3300031249 Bacteria 894
853 Ga0265331_10104682 3300031250 Bacteria 1300
854 Ga0265316_10581806 3300031344 Bacteria 795
855 Ga0307509_10005003 3300031507 Bacteria 18702
856 Ga0307509_10374871 3300031507 Bacteria 1138
857 Ga0307509_10633099 3300031507 Bacteria 739
858 Ga0265313_10010055 3300031595 Bacteria 6051
859 Ga0265313_10010775 3300031595 Bacteria 5746
860 Ga0307508_10000120 3300031616 Bacteria 93316
861 Ga0307508_10038844 3300031616 Bacteria 4277
862 Ga0307508_10173980 3300031616 Bacteria 1756
863 Ga0307508_10314541 3300031616 Bacteria 1158
864 Ga0265314_10015133 3300031711 Bacteria 6135
865 Ga0265342_10001944 3300031712 Bacteria 18500
866 Ga0307516_10220860 3300031730 Bacteria 1604
867 Ga0307516_10558289 3300031730 Bacteria 799
868 Ga0307406_10790574 3300031901 Bacteria 800
869 Ga0307406_12057670 3300031901 Bacteria 511
870 Ga0307407_11063995 3300031903 Bacteria 628
871 Ga0307412_12067570 3300031911 Bacteria 528
872 Ga0307415_101245086 3300032126 Bacteria 703
873 Ga0307507_10081029 3300033179 Bacteria 2857
874 Ga0307510_10080874 3300033180 Bacteria 3156
875 Ga0307510_10140199 3300033180 Bacteria 2063
876 Ga0307510_10241634 3300033180 Bacteria 1300
877 Ga0315911_1000037 3300033442 Bacteria 62198
878 Ga0373948_0015453 3300034817 Bacteria 1402
879 Ga0373938_0001879 3300034957 Bacteria 3358
880 Ga0373926_0190295 3300035083 Bacteria 788
881 Ga0373928_0014591 3300035084 Bacteria 1591
882 Ga0373934_0011292 3300035086 Bacteria 3361
883 Ga0373940_0114916 3300035088 Bacteria 830
884 Ga0373944_0015987 3300035089 Bacteria 2111
885 Ga0373944_0036114 3300035089 Bacteria 1508
886 Ga0373944_0064339 3300035089 Bacteria 1182
887 Ga0373944_0174901 3300035089 Bacteria 767
888 Ga0373944_0208175 3300035089 Bacteria 710
889 Ga0373949_0040775 3300035090 Bacteria 1141
890 Ga0373951_0024795 3300035091 Bacteria 1391
891 Ga0373923_0010977 3300035111 Bacteria 3312
892 Ga0373923_0049121 3300035111 Bacteria 1764
893 Ga0373923_0062813 3300035111 Bacteria 1581
894 Ga0373923_0200989 3300035111 Bacteria 921
895 Ga0373923_0233778 3300035111 Bacteria 857
896 Ga0373923_0420251 3300035111 Bacteria 645
897 Ga0373932_0007300 3300035112 Bacteria 2632
898 Ga0373932_0018087 3300035112 Bacteria 1818
899 Ga0373932_0093635 3300035112 Bacteria 968
900 Ga0373936_0006155 3300035113 Bacteria 4522
901 Ga0373936_0012541 3300035113 Bacteria 3226
902 Ga0373936_0020917 3300035113 Bacteria 2544
903 Ga0373936_0279144 3300035113 Bacteria 751
904 Ga0373936_0596410 3300035113 Bacteria 518
905 Ga0373939_0035780 3300035114 Bacteria 1465
906 Ga0373941_0184903 3300035115 Bacteria 784
907 Ga0373945_0009865 3300035116 Bacteria 3133
908 Ga0373945_0030032 3300035116 Bacteria 1913
909 Ga0373945_0040426 3300035116 Bacteria 1684
910 Ga0373953_0043457 3300035117 Bacteria 1794
911 Ga0373953_0144421 3300035117 Bacteria 1018
912 Ga0373953_0277537 3300035117 Bacteria 730
913 Ga0373953_0416272 3300035117 Bacteria 592
914 Ga0373954_0005696 3300035118 Bacteria 5405
915 Ga0373954_0091635 3300035118 Bacteria 1460
916 Ga0373954_0102517 3300035118 Bacteria 1382
917 Ga0373954_0177873 3300035118 Bacteria 1043
918 Ga0373954_0193776 3300035118 Bacteria 998
919 Ga0373956_0131645 3300035119 Bacteria 1171
920 Ga0373956_0232124 3300035119 Bacteria 876
921 Ga0373956_0411191 3300035119 Bacteria 645
922 Ga0373957_0001391 3300035120 Bacteria 6517
923 Ga0373957_0018656 3300035120 Bacteria 2433
924 Ga0373957_0205777 3300035120 Bacteria 821
925 Ga0373960_0191648 3300035121 Bacteria 719
926 Ga0373943_0000144 3300035170 Bacteria 27337
927 Ga0373943_0007179 3300035170 Bacteria 4998
928 Ga0373943_0194196 3300035170 Bacteria 1121
929 Ga0373943_0588703 3300035170 Bacteria 654
930 Ga0373946_0000438 3300035171 Bacteria 13642
931 Ga0373946_0014352 3300035171 Bacteria 2987
932 Ga0373946_0045813 3300035171 Bacteria 1810
933 Ga0373946_0076222 3300035171 Bacteria 1459
934 Ga0373946_0408165 3300035171 Bacteria 687
935 Ga0373946_0579215 3300035171 Bacteria 581
936 Ga0373955_0022095 3300035172 Bacteria 3222
937 Ga0373955_0080822 3300035172 Bacteria 1836
938 Ga0373955_0205042 3300035172 Bacteria 1174
939 Ga0373955_0944938 3300035172 Bacteria 531
940 Ga0373955_1015698 3300035172 Bacteria 511
941 Ga0373942_0070696 3300035207 Bacteria 1019
942 Ga0373961_0048559 3300035241 Bacteria 1251
943 Ga0373961_0329052 3300035241 Bacteria 572
944 Ga0373962_0049076 3300035242 Bacteria 1212
945 Ga0373962_0160264 3300035242 Bacteria 742
946 Ga0373924_0036763 3300035410 Bacteria 1991
947 Ga0373924_0107119 3300035410 Bacteria 1205
948 Ga0373924_0221035 3300035410 Bacteria 837
949 Ga0373924_0349197 3300035410 Bacteria 659
950 Ga0373931_0004597 3300035691 Bacteria 6314
951 Ga0373931_0021136 3300035691 Bacteria 3263
952 Ga0373931_0046260 3300035691 Bacteria 2300
953 Ga0373931_0379611 3300035691 Bacteria 891
954 Ga0373931_0453470 3300035691 Bacteria 821
955 Ga0373935_0015705 3300035692 Bacteria 4579
956 Ga0373935_0041807 3300035692 Bacteria 2880
957 Ga0373935_0157342 3300035692 Bacteria 1546
958 Ga0373935_0189906 3300035692 Bacteria 1414
959 Ga0373935_0302721 3300035692 Bacteria 1130
960 Ga0373935_0328014 3300035692 Bacteria 1087
961 Ga0373935_0443982 3300035692 Bacteria 936
962 Ga0373935_0714525 3300035692 Bacteria 737
963 Ga0373927_0002813 3300035695 Bacteria 12703
964 Ga0373927_0007182 3300035695 Bacteria 7558
965 Ga0373927_0012358 3300035695 Bacteria 5682
966 Ga0373927_0025771 3300035695 Bacteria 3844
967 Ga0373927_0029537 3300035695 Bacteria 3574
968 Ga0373927_0031642 3300035695 Bacteria 3447
969 Ga0373927_0053846 3300035695 Bacteria 2603
970 Ga0373927_0199414 3300035695 Bacteria 1314
971 Ga0373927_0261770 3300035695 Bacteria 1137
972 Ga0373927_0274383 3300035695 Bacteria 1109
973 Ga0373927_0398016 3300035695 Bacteria 908
974 Ga0373927_0768864 3300035695 Bacteria 636
975 Ga0373933_0009823 3300035724 Bacteria 5237
976 Ga0373933_0062945 3300035724 Bacteria 2242
977 Ga0373933_0202179 3300035724 Bacteria 1271
978 Ga0373933_0264379 3300035724 Bacteria 1110
979 Ga0373933_0965938 3300035724 Bacteria 561
980 Ga0373947_0000318 3300035725 Bacteria 27274
981 Ga0373947_0000441 3300035725 Bacteria 23573
982 Ga0373947_0002945 3300035725 Bacteria 10158
983 Ga0373947_0020629 3300035725 Bacteria 3807
984 Ga0373947_0135053 3300035725 Bacteria 1578
985 Ga0373947_0149542 3300035725 Bacteria 1503
986 Ga0373947_0203506 3300035725 Bacteria 1296
987 Ga0373947_0299163 3300035725 Bacteria 1072
988 Ga0373947_0391873 3300035725 Bacteria 936
989 Ga0373947_0447616 3300035725 Bacteria 874
990 Ga0373947_0632229 3300035725 Bacteria 730
991 Ga0373947_0745813 3300035725 Bacteria 668
992 Ga0373937_0011747 3300036401 Bacteria 7682
993 Ga0373937_0018978 3300036401 Bacteria 6150
994 Ga0373937_0036246 3300036401 Bacteria 4494
995 Ga0373937_0049701 3300036401 Bacteria 3840
996 Ga0373937_0348558 3300036401 Bacteria 1402
997 Ga0373937_0657914 3300036401 Bacteria 993
998 Ga0373925_0005350 3300037068 Bacteria 9577
999 Ga0373925_0006658 3300037068 Bacteria 8482
1000 Ga0373925_0011278 3300037068 Bacteria 6482
1001 Ga0373925_0064209 3300037068 Bacteria 2763
1002 Ga0373925_0115147 3300037068 Bacteria 2081
1003 Ga0373925_0122845 3300037068 Bacteria 2017
1004 Ga0373925_0200783 3300037068 Bacteria 1585
1005 Ga0373925_0234168 3300037068 Bacteria 1469
1006 Ga0373925_0280610 3300037068 Bacteria 1342
1007 Ga0373925_0519647 3300037068 Bacteria 978
1008 Ga0373925_0709463 3300037068 Bacteria 829
1009 Ga0373925_1131835 3300037068 Bacteria 644
1010 Ga0373925_1298022 3300037068 Bacteria 597
1011 Ga0373925_1302716 3300037068 Bacteria 596
1012 Ga0395899_0132099 3300037312 Bacteria 1782
1013 Ga0395899_0398123 3300037312 Bacteria 912
1014 Ga0395900_0241956 3300037418 Bacteria 1810
1015 Ga0395900_0786756 3300037418 Bacteria 880
1016 Ga0395900_0885683 3300037418 Bacteria 817
1017 Ga0395900_1220826 3300037418 Bacteria 667
1018 Ga0395898_0059775 3300037466 Bacteria 3706
1019 Ga0395898_0161064 3300037466 Bacteria 2146
1020 Ga0395898_0369074 3300037466 Bacteria 1369
1021 Ga0395898_0782343 3300037466 Bacteria 895
1022 Ga0395898_1797011 3300037466 Bacteria 534
1023 Ga0395905_0002843 3300037471 Bacteria 18958
1024 Ga0395905_0049780 3300037471 Bacteria 3927
1025 Ga0395905_0875396 3300037471 Bacteria 801
1026 Ga0395901_0182081 3300038443 Bacteria 2204
1027 Ga0395901_0237430 3300038443 Bacteria 1902
1028 Ga0436365_0665617 3300039437 Bacteria 2094
1029 Ga0436361_0791285 3300039447 Bacteria 5434
1030 Ga0436363_0957639 3300039450 Bacteria 2145
1031 Ga0436363_1497734 3300039450 Bacteria 1734
1032 Ga0451793_0896835 3300041452 Bacteria 560
1033 Ga0451839_0733614 3300041496 Bacteria 828
1034 Ga0451841_0398551 3300041498 Bacteria 510
1035 Ga0451845_0594181 3300041501 Bacteria 686
1036 Ga0451843_0386018 3300041509 Bacteria 662
1037 Ga0451853_0940955 3300041512 Bacteria 1301
1038 Ga0466972_0000363 3300044658 Bacteria 24488
1039 Ga0466972_0011812 3300044658 Bacteria 4387
1040 Ga0466972_0565265 3300044658 Bacteria 537
1041 Ga0466965_0100435 3300044683 Bacteria 1479
1042 Ga0466965_0131665 3300044683 Bacteria 1297
1043 Ga0466966_0019601 3300044684 Bacteria 4451
1044 Ga0466966_0200430 3300044684 Bacteria 1208
1045 Ga0466966_0686505 3300044684 Bacteria 617
1046 Ga0466963_0468649 3300044694 Bacteria 889
1047 Ga0466963_0626705 3300044694 Bacteria 759
1048 Ga0466968_0009383 3300044735 Bacteria 3762
1049 Ga0466968_0128951 3300044735 Bacteria 1150
1050 Ga0466968_0339911 3300044735 Bacteria 728
1051 Ga0466968_0387058 3300044735 Bacteria 684
1052 Ga0466957_0377431 3300044842 Bacteria 966
1053 Ga0466957_0419183 3300044842 Bacteria 918
1054 Ga0466960_0198744 3300044901 Bacteria 1094
1055 Ga0466960_0265198 3300044901 Bacteria 958
1056 Ga0466960_0649943 3300044901 Bacteria 629
1057 Ga0466960_0673594 3300044901 Bacteria 619
1058 Ga0466959_0099286 3300045049 Bacteria 2085
1059 Ga0466959_0246554 3300045049 Bacteria 1232
1060 Ga0466959_0281625 3300045049 Bacteria 1141
1061 Ga0466959_0681106 3300045049 Bacteria 690
1062 Ga0466959_0938756 3300045049 Archaea 577
1063 Ga0466958_0449999 3300045836 Bacteria 834
1064 Ga0466967_0107132 3300045976 Bacteria 2563
1065 Ga0466967_0222396 3300045976 Bacteria 1795
1066 Ga0466967_0245173 3300045976 Bacteria 1710
1067 Ga0466967_0938216 3300045976 Bacteria 861
1068 Ga0466967_2082548 3300045976 Bacteria 564
1069 Ga0495592_0038972 3300046454 Bacteria 3572
1070 Ga0495592_0047517 3300046454 Bacteria 3196
1071 Ga0495592_0079397 3300046454 Bacteria 2375
1072 Ga0495592_0128989 3300046454 Bacteria 1771
1073 Ga0495592_0175126 3300046454 Bacteria 1466
1074 Ga0495592_0583941 3300046454 Bacteria 683
1075 Ga0495603_0000066 3300046455 Bacteria 45635
1076 Ga0495603_0017017 3300046455 Bacteria 4399
1077 Ga0495603_0040267 3300046455 Bacteria 2797
1078 Ga0495603_0065087 3300046455 Bacteria 2148
1079 Ga0495603_0067733 3300046455 Bacteria 2101
1080 Ga0495603_0112701 3300046455 Bacteria 1586
1081 Ga0495603_0182357 3300046455 Bacteria 1214
1082 Ga0495603_0205097 3300046455 Bacteria 1139
1083 Ga0495591_015002 3300046458 Bacteria 2755
1084 Ga0495629_0000984 3300046459 Bacteria 22885
1085 Ga0495629_0010691 3300046459 Bacteria 6673
1086 Ga0495629_0015204 3300046459 Bacteria 5530
1087 Ga0495629_0063174 3300046459 Bacteria 2586
1088 Ga0495629_0197668 3300046459 Bacteria 1390
1089 Ga0495629_0211770 3300046459 Bacteria 1338
1090 Ga0495629_0731968 3300046459 Bacteria 655
1091 Ga0495629_0754476 3300046459 Bacteria 644
1092 Ga0495629_1071204 3300046459 Bacteria 522
1093 Ga0495641_0004776 3300046461 Bacteria 9430
1094 Ga0495641_0014002 3300046461 Bacteria 4365
1095 Ga0495641_0050560 3300046461 Bacteria 1899
1096 Ga0495651_0011447 3300046462 Bacteria 6814
1097 Ga0495651_0021274 3300046462 Bacteria 5041
1098 Ga0495651_0201744 3300046462 Bacteria 1391
1099 Ga0495651_0314377 3300046462 Bacteria 1046
1100 Ga0495651_0457638 3300046462 Bacteria 823
1101 Ga0495651_0600284 3300046462 Bacteria 694
1102 Ga0495653_0017838 3300046463 Bacteria 5771
1103 Ga0495653_0061762 3300046463 Bacteria 2834
1104 Ga0495653_0105594 3300046463 Bacteria 2033
1105 Ga0495653_0265726 3300046463 Bacteria 1132
1106 Ga0495653_0269426 3300046463 Bacteria 1122
1107 Ga0495653_0474347 3300046463 Bacteria 783
1108 Ga0495653_0483002 3300046463 Bacteria 775
1109 Ga0495580_0001382 3300046472 Bacteria 21285
1110 Ga0495580_0090655 3300046472 Bacteria 2128
1111 Ga0495580_0181469 3300046472 Bacteria 1453
1112 Ga0495580_0300963 3300046472 Bacteria 1092
1113 Ga0495580_0785264 3300046472 Bacteria 618
1114 Ga0495582_0000298 3300046473 Bacteria 27399
1115 Ga0495582_0107351 3300046473 Bacteria 1567
1116 Ga0495582_0656351 3300046473 Bacteria 607
1117 Ga0495582_0859393 3300046473 Bacteria 524
1118 Ga0495605_0123625 3300046474 Bacteria 1172
1119 Ga0495639_0010975 3300046475 Bacteria 3900
1120 Ga0495639_0031933 3300046475 Bacteria 2347
1121 Ga0495639_0098650 3300046475 Bacteria 1377
1122 Ga0495639_0121796 3300046475 Bacteria 1244
1123 Ga0495639_0135706 3300046475 Bacteria 1180
1124 Ga0495639_0151332 3300046475 Bacteria 1119
1125 Ga0495639_0394058 3300046475 Bacteria 699
1126 Ga0495662_0000058 3300046476 Bacteria 37987
1127 Ga0495662_0020780 3300046476 Bacteria 3175
1128 Ga0495662_0085216 3300046476 Bacteria 1538
1129 Ga0495664_0008861 3300046477 Bacteria 5621
1130 Ga0495664_0013688 3300046477 Bacteria 4602
1131 Ga0495664_0062834 3300046477 Bacteria 2212
1132 Ga0495664_0084647 3300046477 Bacteria 1903
1133 Ga0495664_0120544 3300046477 Bacteria 1587
1134 Ga0495664_0120890 3300046477 Bacteria 1584
1135 Ga0495664_0156535 3300046477 Bacteria 1382
1136 Ga0495664_0181236 3300046477 Bacteria 1277
1137 Ga0495664_0290156 3300046477 Bacteria 988
1138 Ga0495584_0050448 3300046491 Bacteria 2095
1139 Ga0495585_0005331 3300046492 Bacteria 8121
1140 Ga0495585_0136548 3300046492 Bacteria 1287
1141 Ga0495594_0000706 3300046499 Bacteria 17171
1142 Ga0495594_0089880 3300046499 Bacteria 1720
1143 Ga0495594_0217109 3300046499 Bacteria 1090
1144 Ga0495594_0849835 3300046499 Bacteria 514
1145 Ga0495607_0038517 3300046501 Bacteria 2863
1146 Ga0495607_0172293 3300046501 Bacteria 1092
1147 Ga0495606_0019312 3300046507 Bacteria 5076
1148 Ga0495606_0207993 3300046507 Bacteria 1110
1149 Ga0495606_0306624 3300046507 Bacteria 858
1150 Ga0495608_0004308 3300046511 Bacteria 10191
1151 Ga0495608_0043820 3300046511 Bacteria 2989
1152 Ga0495608_0119507 3300046511 Bacteria 1690
1153 Ga0495608_0534556 3300046511 Bacteria 707
1154 Ga0495610_0151305 3300046512 Bacteria 990
1155 Ga0495616_0311406 3300046513 Bacteria 663
1156 Ga0495616_0420293 3300046513 Bacteria 546
1157 Ga0495618_0068394 3300046514 Bacteria 2258
1158 Ga0495618_0086241 3300046514 Bacteria 2007
1159 Ga0495618_0106699 3300046514 Bacteria 1793
1160 Ga0495618_0297202 3300046514 Bacteria 1004
1161 Ga0495628_0000319 3300046516 Bacteria 43414
1162 Ga0495628_0033779 3300046516 Bacteria 4119
1163 Ga0495628_0105729 3300046516 Bacteria 2168
1164 Ga0495628_0143186 3300046516 Bacteria 1824
1165 Ga0495628_0161727 3300046516 Bacteria 1701
1166 Ga0495628_1254484 3300046516 Unclassified 501
1167 Ga0495630_0000460 3300046517 Bacteria 30750
1168 Ga0495630_0001425 3300046517 Bacteria 16552
1169 Ga0495630_0033619 3300046517 Bacteria 3824
1170 Ga0495630_0186544 3300046517 Bacteria 1582
1171 Ga0495630_0479669 3300046517 Bacteria 953
1172 Ga0495630_0554486 3300046517 Bacteria 881
1173 Ga0495630_0804036 3300046517 Bacteria 718
1174 Ga0495643_0264815 3300046522 Bacteria 797
1175 Ga0495644_0004455 3300046523 Bacteria 5504
1176 Ga0495648_0021173 3300046524 Bacteria 4511
1177 Ga0495663_0382664 3300046525 Bacteria 516
1178 Ga0495666_0024749 3300046526 Bacteria 2965
1179 Ga0495652_0024377 3300046529 Bacteria 5356
1180 Ga0495652_0047392 3300046529 Bacteria 3686
1181 Ga0495652_0067576 3300046529 Bacteria 2996
1182 Ga0495652_0094063 3300046529 Bacteria 2445
1183 Ga0495652_0123399 3300046529 Bacteria 2061
1184 Ga0495652_0365283 3300046529 Bacteria 1030
1185 Ga0495652_0411455 3300046529 Bacteria 955
1186 Ga0495652_0562882 3300046529 Bacteria 782
1187 Ga0495665_0000373 3300046531 Bacteria 22557
1188 Ga0495665_0018597 3300046531 Bacteria 3733
1189 Ga0495665_0024530 3300046531 Bacteria 3239
1190 Ga0495665_0259984 3300046531 Bacteria 893
1191 Ga0495665_0706220 3300046531 Bacteria 500
1192 Ga0495640_0002731 3300046533 Bacteria 14194
1193 Ga0495640_0022168 3300046533 Bacteria 4648
1194 Ga0495640_0027866 3300046533 Bacteria 4069
1195 Ga0495640_0045438 3300046533 Bacteria 3047
1196 Ga0495640_0048620 3300046533 Bacteria 2930
1197 Ga0495640_0073602 3300046533 Bacteria 2287
1198 Ga0495640_0087228 3300046533 Bacteria 2064
1199 Ga0495640_0716743 3300046533 Bacteria 599
1200 Ga0495586_0009720 3300046535 Bacteria 5123
1201 Ga0495586_0045341 3300046535 Bacteria 2369
1202 Ga0495586_0210429 3300046535 Bacteria 1103
1203 Ga0495587_0002631 3300046536 Bacteria 11998
1204 Ga0495587_0006700 3300046536 Bacteria 7501
1205 Ga0495587_0090468 3300046536 Bacteria 1768
1206 Ga0495587_0225075 3300046536 Bacteria 1057
1207 Ga0495587_0238482 3300046536 Bacteria 1023
1208 Ga0495587_0461645 3300046536 Bacteria 703
1209 Ga0495598_0192702 3300046537 Bacteria 732
1210 Ga0495609_0182374 3300046538 Bacteria 883
1211 Ga0495645_0002294 3300046543 Bacteria 12998
1212 Ga0495645_0006904 3300046543 Bacteria 7888
1213 Ga0495645_0015966 3300046543 Bacteria 5350
1214 Ga0495645_0053231 3300046543 Bacteria 2943
1215 Ga0495645_0098691 3300046543 Bacteria 2078
1216 Ga0495645_0768853 3300046543 Unclassified 580
1217 Ga0495645_0964790 3300046543 Bacteria 503
1218 Ga0495622_0007642 3300046557 Bacteria 5021
1219 Ga0495622_0013154 3300046557 Bacteria 3841
1220 Ga0495622_0018157 3300046557 Bacteria 3276
1221 Ga0495622_0038008 3300046557 Bacteria 2241
1222 Ga0495622_0129665 3300046557 Bacteria 1149
1223 Ga0495633_0020440 3300046558 Bacteria 3330
1224 Ga0495667_0004119 3300046559 Bacteria 9769
1225 Ga0495667_0007433 3300046559 Bacteria 7428
1226 Ga0495667_0020636 3300046559 Bacteria 4445
1227 Ga0495667_0309936 3300046559 Bacteria 999
1228 Ga0495667_0412806 3300046559 Bacteria 850
1229 Ga0495667_0605272 3300046559 Bacteria 682
1230 Ga0495656_0004069 3300046615 Bacteria 4978
1231 Ga0495634_0000502 3300046642 Bacteria 38371
1232 Ga0495634_0020332 3300046642 Bacteria 4709
1233 Ga0495634_0066850 3300046642 Bacteria 2379
1234 Ga0495634_0205717 3300046642 Bacteria 1220
1235 Ga0495634_0333928 3300046642 Bacteria 910
1236 Ga0495634_0342943 3300046642 Bacteria 896
1237 Ga0495634_0425212 3300046642 Bacteria 786
1238 Ga0495634_0453220 3300046642 Bacteria 756
1239 Ga0495611_0024058 3300046648 Bacteria 2647
1240 Ga0495625_0195604 3300046660 Bacteria 1337
1241 Ga0495625_0348394 3300046660 Bacteria 937
1242 Ga0495635_0021312 3300046663 Bacteria 4516
1243 Ga0495635_0023714 3300046663 Bacteria 4275
1244 Ga0495635_0088610 3300046663 Bacteria 2117
1245 Ga0495635_0102903 3300046663 Bacteria 1951
1246 Ga0495635_0128371 3300046663 Bacteria 1728
1247 Ga0495635_0226154 3300046663 Bacteria 1264
1248 Ga0495635_0231754 3300046663 Bacteria 1247
1249 Ga0495635_0257524 3300046663 Bacteria 1175
1250 Ga0495635_0848122 3300046663 Bacteria 587
1251 Ga0495635_0905329 3300046663 Bacteria 565
1252 Ga0495659_0023500 3300046664 Bacteria 2095
1253 Ga0495661_0037544 3300046665 Bacteria 3024
1254 Ga0495661_0081769 3300046665 Bacteria 1861
1255 Ga0495588_0033151 3300046674 Bacteria 2607
1256 Ga0495588_0077422 3300046674 Bacteria 1734
1257 Ga0495588_0103291 3300046674 Bacteria 1498
1258 Ga0495657_0014712 3300046675 Bacteria 5742
1259 Ga0495657_0029162 3300046675 Bacteria 3873
1260 Ga0495657_0043085 3300046675 Bacteria 3079
1261 Ga0495657_0049829 3300046675 Bacteria 2819
1262 Ga0495657_0073439 3300046675 Bacteria 2228
1263 Ga0495599_0007174 3300046678 Bacteria 6748
1264 Ga0495599_0038422 3300046678 Bacteria 3008
1265 Ga0495599_0056898 3300046678 Bacteria 2447
1266 Ga0495599_0137110 3300046678 Bacteria 1518
1267 Ga0495599_0333861 3300046678 Bacteria 911
1268 Ga0495599_0406293 3300046678 Bacteria 810
1269 Ga0495599_0494273 3300046678 Bacteria 721
1270 Ga0495599_0510458 3300046678 Bacteria 707
1271 Ga0495623_0000561 3300046679 Bacteria 24733
1272 Ga0495623_0006722 3300046679 Bacteria 7486
1273 Ga0495623_0148515 3300046679 Bacteria 1387
1274 Ga0495623_0271943 3300046679 Bacteria 946
1275 Ga0495646_0022284 3300046680 Bacteria 3997
1276 Ga0495646_0030802 3300046680 Bacteria 3347
1277 Ga0495646_0072330 3300046680 Bacteria 2028
1278 Ga0495646_0423335 3300046680 Bacteria 690
1279 Ga0495647_0003354 3300046681 Bacteria 5131
1280 Ga0495647_0021361 3300046681 Bacteria 2329
1281 Ga0495647_0030920 3300046681 Bacteria 1989
1282 Ga0495647_0248021 3300046681 Bacteria 792
1283 Ga0495647_0394626 3300046681 Bacteria 635
1284 Ga0495658_0000368 3300046683 Bacteria 25300
1285 Ga0495658_0097198 3300046683 Bacteria 1752
1286 Ga0495658_0116679 3300046683 Bacteria 1610
1287 Ga0495658_0745148 3300046683 Bacteria 627
1288 Ga0495658_1016586 3300046683 Bacteria 529
1289 Ga0495669_0102850 3300046684 Bacteria 1328
1290 Ga0495669_0201782 3300046684 Bacteria 951
1291 Ga0495669_0296086 3300046684 Bacteria 780
1292 Ga0495613_0014196 3300046689 Bacteria 5909
1293 Ga0495613_0036607 3300046689 Bacteria 3639
1294 Ga0495613_0047221 3300046689 Bacteria 3181
1295 Ga0495613_0091995 3300046689 Bacteria 2196
1296 Ga0495613_0382676 3300046689 Bacteria 962
1297 Ga0495624_0008081 3300046690 Bacteria 7365
1298 Ga0495624_0035664 3300046690 Bacteria 3211
1299 Ga0495624_0074466 3300046690 Bacteria 2109
1300 Ga0495624_0120727 3300046690 Bacteria 1609
1301 Ga0495624_0205948 3300046690 Bacteria 1194
1302 Ga0495624_0778508 3300046690 Bacteria 566
1303 Ga0495670_0029218 3300046691 Bacteria 2735
1304 Ga0495671_0047950 3300046692 Bacteria 2132
1305 Ga0495671_0232054 3300046692 Bacteria 892
1306 Ga0495649_0134751 3300046694 Bacteria 1302
1307 Ga0495589_0057394 3300046794 Bacteria 1915
1308 Ga0495589_0060805 3300046794 Bacteria 1855
1309 Ga0495589_0329369 3300046794 Bacteria 705
1310 Ga0495600_0011871 3300046809 Bacteria 5439
1311 Ga0495600_0011917 3300046809 Bacteria 5431
1312 Ga0495600_0030700 3300046809 Bacteria 3481
1313 Ga0495600_0034797 3300046809 Bacteria 3271
1314 Ga0495600_0076875 3300046809 Bacteria 2180
1315 Ga0495600_0271510 3300046809 Bacteria 1075
1316 Ga0495600_0745144 3300046809 Bacteria 587
1317 Ga0495581_0000111 3300047315 Bacteria 34508
1318 Ga0495581_0001700 3300047315 Bacteria 12251
1319 Ga0495581_0073591 3300047315 Bacteria 1977
1320 Ga0495581_0215942 3300047315 Bacteria 1121
1321 Ga0495581_0416587 3300047315 Bacteria 783
1322 Ga0495581_0595895 3300047315 Bacteria 640
1323 Ga0495581_0712442 3300047315 Bacteria 578
1324 Ga0495604_0010591 3300047317 Bacteria 7311
1325 Ga0495604_0010885 3300047317 Bacteria 7222
1326 Ga0495604_0015047 3300047317 Bacteria 6172
1327 Ga0495604_0045227 3300047317 Bacteria 3436
1328 Ga0495604_0103228 3300047317 Bacteria 2092
1329 Ga0495604_0123120 3300047317 Bacteria 1874
1330 Ga0495604_0380282 3300047317 Bacteria 933
1331 Ga0495636_0127572 3300047318 Bacteria 1130
1332 Ga0495674_0004341 3300047319 Bacteria 13630
1333 Ga0495674_0077544 3300047319 Bacteria 2856
1334 Ga0495674_0136513 3300047319 Bacteria 2063
1335 Ga0495674_0138447 3300047319 Bacteria 2047
1336 Ga0495674_0152415 3300047319 Bacteria 1938
1337 Ga0495674_0170662 3300047319 Bacteria 1815
1338 Ga0495674_0216552 3300047319 Bacteria 1584
1339 Ga0495674_0542741 3300047319 Bacteria 926
1340 Ga0495674_0918984 3300047319 Bacteria 674
1341 Ga0495674_1407136 3300047319 Bacteria 519
1342 Ga0495672_0182734 3300047320 Bacteria 1061
1343 Ga0495676_0018517 3300047321 Bacteria 6140
1344 Ga0495676_0079737 3300047321 Bacteria 2488
1345 Ga0495676_0083794 3300047321 Bacteria 2408
1346 Ga0495676_0124586 3300047321 Bacteria 1869
1347 Ga0495676_0200832 3300047321 Bacteria 1385
1348 Ga0495680_0039523 3300047322 Bacteria 3762
1349 Ga0495680_0052359 3300047322 Bacteria 3182
1350 Ga0495680_0071985 3300047322 Bacteria 2630
1351 Ga0495680_0086764 3300047322 Bacteria 2354
1352 Ga0495680_0414303 3300047322 Bacteria 928
1353 Ga0495680_0672535 3300047322 Bacteria 686
1354 Ga0495683_0486336 3300047323 Bacteria 502
1355 Ga0495675_0004565 3300047444 Bacteria 8398
1356 Ga0495675_0019021 3300047444 Bacteria 4362
1357 Ga0495675_0050347 3300047444 Bacteria 2647
1358 Ga0495675_0152464 3300047444 Bacteria 1427
1359 Ga0495675_0720311 3300047444 Bacteria 557
1360 Ga0495677_0338840 3300047445 Bacteria 593
1361 Ga0495679_025907 3300047446 Bacteria 1954
1362 Ga0495673_0102172 3300047469 Bacteria 1157
1363 Ga0495684_0025696 3300047471 Bacteria 4524
1364 Ga0495684_0106142 3300047471 Bacteria 2122
1365 Ga0495684_0161876 3300047471 Bacteria 1668
1366 Ga0495686_0125312 3300047472 Bacteria 1528
1367 Ga0495593_0000210 3300047673 Bacteria 30957
1368 Ga0495593_0018230 3300047673 Bacteria 3947
1369 Ga0495593_0052747 3300047673 Bacteria 2148
1370 Ga0495593_0054268 3300047673 Bacteria 2113
1371 Ga0495593_0077811 3300047673 Bacteria 1718
1372 Ga0495593_0622480 3300047673 Bacteria 542
1373 Ga0495602_0000991 3300048088 Bacteria 27536
1374 Ga0495602_0025952 3300048088 Bacteria 5660
1375 Ga0495602_0085736 3300048088 Bacteria 2631
1376 Ga0495602_0120954 3300048088 Bacteria 2107
1377 Ga0495602_0132871 3300048088 Bacteria 1982
1378 Ga0495602_0191464 3300048088 Bacteria 1568
1379 Ga0495602_0227235 3300048088 Bacteria 1404
1380 Ga0495602_0525164 3300048088 Bacteria 824
1381 Ga0495602_0580411 3300048088 Bacteria 773
1382 Ga0495614_0042446 3300048089 Bacteria 1950
1383 Ga0495614_0054948 3300048089 Bacteria 1708
1384 Ga0496100_0013868 3300048903 Bacteria 4663
1385 Ga0496100_0031298 3300048903 Bacteria 3307
1386 Ga0496100_0039813 3300048903 Bacteria 2986
1387 Ga0496100_0274677 3300048903 Bacteria 1254
1388 Ga0496100_0534923 3300048903 Bacteria 905
1389 Ga0496101_0010824 3300048904 Bacteria 6033
1390 Ga0496101_0048045 3300048904 Bacteria 3065
1391 Ga0496101_0082543 3300048904 Bacteria 2378
1392 Ga0496101_0121273 3300048904 Bacteria 1977
1393 Ga0496101_0805030 3300048904 Bacteria 741
1394 Ga0496101_1130617 3300048904 Bacteria 615
1395 Ga0496101_1373245 3300048904 Bacteria 551
1396 Ga0496102_0003826 3300048905 Bacteria 12731
1397 Ga0496102_0041685 3300048905 Bacteria 4158
1398 Ga0496102_0053738 3300048905 Bacteria 3671
1399 Ga0496102_0084735 3300048905 Bacteria 2926
1400 Ga0496102_0121374 3300048905 Bacteria 2441
1401 Ga0496102_0234601 3300048905 Bacteria 1729
1402 Ga0496102_0560670 3300048905 Bacteria 1065
1403 Ga0496103_0027030 3300048906 Bacteria 3474
1404 Ga0496103_0047160 3300048906 Bacteria 2661
1405 Ga0496103_0082735 3300048906 Bacteria 2020
1406 Ga0496103_0303892 3300048906 Bacteria 1026
1407 Ga0496103_0512031 3300048906 Bacteria 767
1408 Ga0496103_0908707 3300048906 Unclassified 551
1409 Ga0496104_0000092 3300048907 Bacteria 87232
1410 Ga0496104_0024236 3300048907 Bacteria 5581
1411 Ga0496104_0054677 3300048907 Bacteria 3773
1412 Ga0496104_0068662 3300048907 Bacteria 3368
1413 Ga0496104_0083527 3300048907 Bacteria 3045
1414 Ga0496104_0258891 3300048907 Bacteria 1653
1415 Ga0496104_0309441 3300048907 Bacteria 1492
1416 Ga0496104_0487136 3300048907 Bacteria 1144
1417 Ga0496104_0556565 3300048907 Bacteria 1058
1418 Ga0496104_0789995 3300048907 Bacteria 855
1419 Ga0496104_1490563 3300048907 Bacteria 579
1420 Ga0496105_0010163 3300048908 Bacteria 7395
1421 Ga0496105_0014761 3300048908 Bacteria 6218
1422 Ga0496105_0032738 3300048908 Bacteria 4267
1423 Ga0496105_0064561 3300048908 Bacteria 3021
1424 Ga0496105_0073166 3300048908 Bacteria 2832
1425 Ga0496105_0115766 3300048908 Bacteria 2211
1426 Ga0496105_0136962 3300048908 Bacteria 2016
1427 Ga0496105_0149675 3300048908 Bacteria 1919
1428 Ga0496105_0161980 3300048908 Bacteria 1836
1429 Ga0496105_0297294 3300048908 Bacteria 1299
1430 Ga0496106_0018269 3300048909 Bacteria 5183
1431 Ga0496106_0026335 3300048909 Bacteria 4330
1432 Ga0496106_0042886 3300048909 Bacteria 3393
1433 Ga0496106_0089299 3300048909 Bacteria 2376
1434 Ga0496106_0151026 3300048909 Bacteria 1832
1435 Ga0496106_0187436 3300048909 Bacteria 1644
1436 Ga0496107_0000413 3300048910 Bacteria 23209
1437 Ga0496107_0027280 3300048910 Bacteria 4055
1438 Ga0496107_0137191 3300048910 Bacteria 1807
1439 Ga0496107_0141780 3300048910 Bacteria 1776
1440 Ga0496107_0806668 3300048910 Bacteria 687
1441 Ga0496108_0036352 3300048911 Bacteria 4097
1442 Ga0496108_0072631 3300048911 Bacteria 2904
1443 Ga0496108_0131555 3300048911 Bacteria 2151
1444 Ga0496108_0170603 3300048911 Bacteria 1882
1445 Ga0496108_0417106 3300048911 Bacteria 1172
1446 Ga0496108_0617765 3300048911 Bacteria 944
1447 Ga0496108_0820633 3300048911 Bacteria 802
1448 Ga0496109_0041987 3300048912 Bacteria 4142
1449 Ga0496109_0064124 3300048912 Bacteria 3361
1450 Ga0496109_0090522 3300048912 Bacteria 2829
1451 Ga0496109_0136268 3300048912 Bacteria 2294
1452 Ga0496109_0313116 3300048912 Bacteria 1481
1453 Ga0496109_0313362 3300048912 Bacteria 1480
1454 Ga0496109_0451777 3300048912 Bacteria 1214
1455 Ga0496109_0529823 3300048912 Bacteria 1112
1456 Ga0496109_1086961 3300048912 Bacteria 737
1457 Ga0496109_1364268 3300048912 Bacteria 645
1458 Ga0496110_0008222 3300048913 Bacteria 8385
1459 Ga0496110_0085905 3300048913 Bacteria 2808
1460 Ga0496110_0124245 3300048913 Bacteria 2327
1461 Ga0496110_0271367 3300048913 Bacteria 1544
1462 Ga0496110_0589019 3300048913 Bacteria 1009
1463 Ga0496110_1164176 3300048913 Bacteria 680
1464 Ga0496111_0047883 3300048914 Bacteria 3079
1465 Ga0496111_0204487 3300048914 Bacteria 1467
1466 Ga0496111_0398433 3300048914 Bacteria 1017
1467 Ga0496111_0430716 3300048914 Bacteria 974
1468 Ga0496111_0797355 3300048914 Bacteria 684
1469 Ga0496111_0966625 3300048914 Bacteria 611
1470 Ga0496111_1345805 3300048914 Bacteria 502
1471 Ga0496112_0000019 3300048915 Bacteria 185531
1472 Ga0496112_0007240 3300048915 Bacteria 9833
1473 Ga0496112_0035449 3300048915 Bacteria 4861
1474 Ga0496112_0091791 3300048915 Bacteria 3005
1475 Ga0496112_0115123 3300048915 Bacteria 2659
1476 Ga0496112_0115995 3300048915 Bacteria 2648
1477 Ga0496112_0121752 3300048915 Bacteria 2579
1478 Ga0496112_0425994 3300048915 Bacteria 1265
1479 Ga0496112_0774251 3300048915 Bacteria 885
1480 Ga0496112_1138301 3300048915 Bacteria 698
1481 Ga0496113_0006958 3300048916 Bacteria 7228
1482 Ga0496113_0012816 3300048916 Bacteria 5650
1483 Ga0496113_0082214 3300048916 Bacteria 2470
1484 Ga0496113_0082950 3300048916 Bacteria 2459
1485 Ga0496113_0134271 3300048916 Bacteria 1944
1486 Ga0496113_0184951 3300048916 Bacteria 1652
1487 Ga0496113_0223045 3300048916 Bacteria 1502
1488 Ga0496113_0288685 3300048916 Bacteria 1312
1489 Ga0496113_0304018 3300048916 Bacteria 1277
1490 Ga0496113_1027193 3300048916 Bacteria 648
1491 Ga0496114_0020155 3300048917 Bacteria 5410
1492 Ga0496114_0029656 3300048917 Bacteria 4498
1493 Ga0496114_0073299 3300048917 Bacteria 2881
1494 Ga0496114_0118237 3300048917 Bacteria 2277
1495 Ga0496114_0189966 3300048917 Bacteria 1797
1496 Ga0496114_0270402 3300048917 Bacteria 1497
1497 Ga0496114_0276241 3300048917 Bacteria 1481
1498 Ga0496114_1452523 3300048917 Bacteria 573
1499 Ga0496115_0005968 3300048918 Bacteria 8892
1500 Ga0496115_0041613 3300048918 Bacteria 3657
1501 Ga0496115_0045835 3300048918 Bacteria 3492
1502 Ga0496115_0059325 3300048918 Bacteria 3081
1503 Ga0496115_0088634 3300048918 Bacteria 2526
1504 Ga0496115_0108131 3300048918 Bacteria 2283
1505 Ga0496115_0122044 3300048918 Bacteria 2144
1506 Ga0496115_0190903 3300048918 Bacteria 1692
1507 Ga0496115_0243471 3300048918 Bacteria 1482
1508 Ga0496115_0250232 3300048918 Bacteria 1459
1509 Ga0496115_0255674 3300048918 Bacteria 1441
1510 Ga0496115_0340906 3300048918 Bacteria 1223
1511 Ga0496115_0902836 3300048918 Bacteria 681
1512 Ga0496115_1236461 3300048918 Bacteria 559
1513 Ga0496116_0040494 3300048919 Bacteria 3208
1514 Ga0496116_0441923 3300048919 Bacteria 560
1515 Ga0496116_0455043 3300048919 Bacteria 547
1516 Ga0496117_0179356 3300048920 Bacteria 1219
1517 Ga0496117_0214816 3300048920 Bacteria 1075
1518 Ga0496118_0001892 3300048921 Bacteria 29856
1519 Ga0496118_0142679 3300048921 Bacteria 1515
1520 Ga0496118_0151702 3300048921 Bacteria 1449
1521 Ga0496118_0164114 3300048921 Bacteria 1368
1522 Ga0496119_0020200 3300048922 Bacteria 4866
1523 Ga0496119_0031735 3300048922 Bacteria 3534
1524 Ga0496119_0061217 3300048922 Bacteria 2250
1525 Ga0496120_0015151 3300048923 Bacteria 5099
1526 Ga0496121_0000041 3300048924 Bacteria 346686
1527 Ga0496121_0004381 3300048924 Bacteria 19069
1528 Ga0496121_0105901 3300048924 Bacteria 2157
1529 Ga0496121_0353887 3300048924 Bacteria 977
1530 Ga0496121_0592095 3300048924 Bacteria 686
1531 Ga0496121_0794759 3300048924 Bacteria 557
1532 Ga0496121_0805520 3300048924 Bacteria 551
1533 Ga0496124_0183059 3300048927 Bacteria 1610
1534 Ga0496124_0250808 3300048927 Bacteria 1309
1535 Ga0496125_0088001 3300048928 Bacteria 2343
1536 Ga0496125_0102390 3300048928 Bacteria 2104
1537 Ga0496125_0290992 3300048928 Bacteria 1006
1538 Ga0496125_0352506 3300048928 Bacteria 878
1539 Ga0496125_0588439 3300048928 Bacteria 610
1540 Ga0496126_0002010 3300048929 Bacteria 28750
1541 Ga0496126_0010298 3300048929 Bacteria 9818
1542 Ga0496126_0026801 3300048929 Bacteria 5518
1543 Ga0496126_0097001 3300048929 Bacteria 2584
1544 Ga0496126_0113225 3300048929 Bacteria 2362
1545 Ga0496126_0176456 3300048929 Bacteria 1817
1546 Ga0496126_0182765 3300048929 Bacteria 1780
1547 Ga0496126_0272844 3300048929 Bacteria 1403
1548 Ga0496126_0694995 3300048929 Bacteria 791
1549 Ga0496126_1182108 3300048929 Bacteria 563
1550 Ga0495682_0047641 3300049460 Bacteria 1563
1551 Ga0495682_0331107 3300049460 Bacteria 537
1552 Ga0501032_0073895 3300049569 Bacteria 2271
1553 Ga0501032_0118250 3300049569 Bacteria 1752
1554 Ga0501032_0236688 3300049569 Bacteria 1186
1555 Ga0501033_0048837 3300049570 Bacteria 3142
1556 Ga0501033_0261281 3300049570 Bacteria 1225
1557 Ga0501033_0274827 3300049570 Unclassified 1190
1558 Ga0501034_0046005 3300049571 Bacteria 4409
1559 Ga0501034_0258566 3300049571 Bacteria 1684
1560 Ga0501034_0278744 3300049571 Bacteria 1611
1561 Ga0501034_0404340 3300049571 Bacteria 1288
1562 Ga0501036_0143846 3300049572 Bacteria 2011
1563 Ga0501036_0182007 3300049572 Bacteria 1769
1564 Ga0501036_0334170 3300049572 Bacteria 1265
1565 Ga0501036_0878718 3300049572 Bacteria 736
1566 Ga0501036_1337539 3300049572 Bacteria 582
1567 Ga0501037_0019397 3300049573 Bacteria 5016
1568 Ga0501037_0118942 3300049573 Bacteria 1900
1569 Ga0501037_0247711 3300049573 Bacteria 1247
1570 Ga0501037_0330848 3300049573 Bacteria 1053
1571 Ga0501038_0063535 3300049574 Bacteria 3150
1572 Ga0501038_0121563 3300049574 Bacteria 2152
1573 Ga0501038_0200513 3300049574 Bacteria 1601
1574 Ga0501039_0179014 3300049575 Bacteria 1667
1575 Ga0501039_1154861 3300049575 Bacteria 599
1576 Ga0501040_0137307 3300049576 Bacteria 1721
1577 Ga0501041_0095285 3300049577 Bacteria 1839
1578 Ga0501042_0020819 3300049578 Bacteria 4566
1579 Ga0501042_0974046 3300049578 Bacteria 618
1580 Ga0501043_0018279 3300049579 Bacteria 5496
1581 Ga0501043_0029042 3300049579 Bacteria 4342
1582 Ga0501043_0107633 3300049579 Bacteria 2189
1583 Ga0501047_0238990 3300049581 Bacteria 1667
1584 Ga0501047_0533656 3300049581 Bacteria 999
1585 Ga0501048_0075385 3300049582 Bacteria 2379
1586 Ga0501067_0010940 3300049583 Bacteria 5023
1587 Ga0501067_0110420 3300049583 Bacteria 1529
1588 Ga0501068_0088800 3300049584 Bacteria 1904
1589 Ga0501068_0389574 3300049584 Bacteria 898
1590 Ga0501068_0597721 3300049584 Bacteria 719
1591 Ga0501070_0031148 3300049586 Bacteria 4468
1592 Ga0501070_0114633 3300049586 Bacteria 2226
1593 Ga0501070_0380627 3300049586 Bacteria 1143
1594 Ga0501071_0394640 3300049587 Bacteria 1056
1595 Ga0501071_0420739 3300049587 Bacteria 1021
1596 Ga0501072_0484753 3300049588 Bacteria 978
1597 Ga0501073_0336774 3300049589 Bacteria 1041
1598 Ga0501074_0117282 3300049590 Bacteria 1904
1599 Ga0501077_0199337 3300049593 Bacteria 1271
1600 Ga0501079_0384411 3300049741 Bacteria 1100
1601 Ga0501080_0065291 3300049742 Bacteria 3385
1602 Ga0501080_0122948 3300049742 Bacteria 2404
1603 Ga0501080_0536158 3300049742 Bacteria 1043
1604 Ga0501080_0654349 3300049742 Bacteria 929
1605 Ga0501083_0258729 3300049744 Bacteria 1132
1606 Ga0501083_0747523 3300049744 Bacteria 636
1607 Ga0501035_0015014 3300049822 Bacteria 7148
1608 Ga0501035_0107312 3300049822 Bacteria 2448
1609 Ga0501035_0110370 3300049822 Bacteria 2410
1610 Ga0501035_0437050 3300049822 Bacteria 1084
1611 Ga0501035_1381363 3300049822 Bacteria 540
1612 Ga0501035_1454003 3300049822 Bacteria 524
1613 Ga0501044_0053440 3300049823 Bacteria 4156
1614 Ga0501044_0075576 3300049823 Bacteria 3420
1615 Ga0501044_0132447 3300049823 Bacteria 2486
1616 Ga0501044_0138041 3300049823 Bacteria 2428
1617 Ga0501044_0229484 3300049823 Bacteria 1804
1618 Ga0501044_1179208 3300049823 Bacteria 634
1619 Ga0501045_0134196 3300049824 Bacteria 1840
1620 Ga0501045_0340240 3300049824 Bacteria 1117
1621 nmdc:mga03n38_57464_c1 3300050490 Bacteria 1453
1622 nmdc:mga00v17_96508_c1 3300050491 Bacteria 1862
1623 nmdc:mga0yw44_234003_c1 3300050492 Bacteria 1220
1624 nmdc:mga0yw44_30141_c1 3300050492 Bacteria 3140
1625 nmdc:mga0yw44_864775_c1 3300050492 Bacteria 613
1626 nmdc:mga06z11_433121_c1 3300050494 Bacteria 793
1627 nmdc:mga07m45_58522_c1 3300050496 Bacteria 2180
1628 nmdc:mga07m45_609043_c1 3300050496 Bacteria 630
1629 nmdc:mga05p37_11710_c1 3300050507 Bacteria 10454
1630 nmdc:mga05p37_7187_c1 3300050507 Bacteria 13133
1631 nmdc:mga09592_6809_c1 3300050508 Bacteria 9301
1632 nmdc:mga0qj67_11019_c1 3300050509 Bacteria 6769
1633 nmdc:mga06r32_6474_c1 3300050510 Bacteria 10523
1634 nmdc:mga08y16_2995_c1 3300050511 Bacteria 17425
1635 nmdc:mga0n895_168789_c1 3300050512 Bacteria 2220
1636 nmdc:mga0n895_428558_c1 3300050512 Bacteria 1337
1637 nmdc:mga0n895_470326_c1 3300050512 Bacteria 1268
1638 nmdc:mga0n895_6162_c1 3300050512 Bacteria 10137
1639 nmdc:mga0n895_705_c1 3300050512 Bacteria 23492
1640 nmdc:mga0rr50_1747_c1 3300050513 Bacteria 11989
1641 nmdc:mga0rr50_18584_c1 3300050513 Bacteria 4673
1642 nmdc:mga0rr50_31699_c1 3300050513 Bacteria 3758
1643 nmdc:mga0rr50_610323_c1 3300050513 Bacteria 930
1644 nmdc:mga08x19_159734_c1 3300050514 Bacteria 1530
1645 nmdc:mga08x19_37303_c1 3300050514 Bacteria 3084
1646 nmdc:mga08x19_601014_c1 3300050514 Bacteria 780
1647 nmdc:mga08x19_61472_c1 3300050514 Bacteria 2434
1648 nmdc:mga0a205_326869_c1 3300050515 Bacteria 1403
1649 nmdc:mga0a205_7362_c1 3300050515 Bacteria 9968
1650 nmdc:mga0sz30_198316_c1 3300050516 Bacteria 891
1651 nmdc:mga0sz30_22090_c1 3300050516 Bacteria 2580
1652 nmdc:mga0sz30_596715_c1 3300050516 Bacteria 500
1653 Ga0495601_0000220 3300053077 Bacteria 30519
1654 Ga0495601_0005470 3300053077 Bacteria 7402
1655 Ga0495601_0009462 3300053077 Bacteria 5765
1656 Ga0495601_0044953 3300053077 Bacteria 2776
1657 Ga0495601_0095397 3300053077 Bacteria 1918
1658 Ga0495601_0134345 3300053077 Bacteria 1612
1659 Ga0495601_0211937 3300053077 Bacteria 1265
1660 Ga0495601_0279906 3300053077 Bacteria 1087
1661 Ga0495601_0679727 3300053077 Bacteria 657
1662 Ga0495601_0850526 3300053077 Bacteria 578
1663 Ga0495612_0004506 3300053078 Bacteria 5783
1664 Ga0495612_0004983 3300053078 Bacteria 5496
1665 Ga0495612_0136125 3300053078 Bacteria 1063
1666 Ga0495612_0174893 3300053078 Bacteria 941
1667 Ga0495612_0229939 3300053078 Bacteria 822
1668 Ga0500635_0006552 3300053080 Bacteria 3116
1669 Ga0500635_0011829 3300053080 Bacteria 2490
1670 Ga0495655_0087546 3300053083 Bacteria 902
1671 Ga0495655_0172283 3300053083 Bacteria 693
1672 Ga0495655_0282750 3300053083 Bacteria 566
1673 Ga0495595_0001761 3300053084 Bacteria 8460
1674 Ga0495595_0010491 3300053084 Bacteria 3851
1675 Ga0495595_0039038 3300053084 Bacteria 2165
1676 Ga0495595_0101489 3300053084 Bacteria 1389
1677 Ga0495595_0357574 3300053084 Bacteria 737
1678 Ga0495595_0551109 3300053084 Bacteria 589
1679 Ga0495619_0001147 3300053085 Bacteria 17396
1680 Ga0495619_0002969 3300053085 Bacteria 11009
1681 Ga0495619_0007969 3300053085 Bacteria 6703
1682 Ga0495619_0104451 3300053085 Bacteria 1931
1683 Ga0495619_0140375 3300053085 Bacteria 1663
1684 Ga0495619_0191657 3300053085 Bacteria 1415
1685 Ga0495619_0218526 3300053085 Bacteria 1320
1686 Ga0495619_1145041 3300053085 Bacteria 516
1687 Ga0500578_0151308 3300053086 Bacteria 1445
1688 Ga0500647_0118789 3300053091 Bacteria 1252
1689 Ga0500651_0191125 3300053093 Bacteria 1212
1690 Ga0500651_0365221 3300053093 Bacteria 817
1691 Ga0500566_0127826 3300053094 Bacteria 1363
1692 Ga0500566_0128042 3300053094 Bacteria 1362
1693 Ga0500648_089452 3300053097 Bacteria 1724
1694 Ga0500650_0260768 3300053098 Bacteria 775
1695 Ga0500554_002996 3300053102 Bacteria 3394
1696 Ga0500595_024231 3300053119 Bacteria 2121
1697 Ga0500595_096273 3300053119 Bacteria 852
1698 Ga0500595_178266 3300053119 Bacteria 589
1699 Ga0500559_0169335 3300053136 Bacteria 1027
1700 Ga0500559_0280622 3300053136 Bacteria 783
1701 Ga0500573_0119855 3300053140 Bacteria 1465
1702 Ga0500590_106387 3300053148 Bacteria 1338
1703 Ga0500590_245341 3300053148 Bacteria 717
1704 Ga0500603_000727 3300053150 Bacteria 8020
1705 Ga0500603_037659 3300053150 Bacteria 1277
1706 Ga0500622_0189472 3300053156 Bacteria 944
1707 Ga0500627_0080484 3300053158 Bacteria 1452
1708 Ga0500638_154885 3300053162 Bacteria 1015
1709 Ga0500639_031991 3300053163 Bacteria 2783
1710 Ga0500636_0005004 3300053177 Bacteria 7522
1711 Ga0500636_0028275 3300053177 Bacteria 3312
1712 Ga0500636_0083515 3300053177 Bacteria 1837
1713 Ga0500636_0125961 3300053177 Bacteria 1432
1714 Ga0500636_0198948 3300053177 Bacteria 1062
1715 Ga0500636_0322580 3300053177 Bacteria 750
1716 Ga0500637_0009481 3300053178 Bacteria 4957
1717 Ga0500637_0095999 3300053178 Bacteria 1717
1718 Ga0500570_187718 3300053724 Bacteria 653
1719 Ga0500657_183780 3300053728 Bacteria 720
1720 Ga0500596_000832 3300053735 Bacteria 6123
1721 Ga0500601_000078 3300053737 Bacteria 20015
1722 Ga0500661_012697 3300055283 Bacteria 1520
1723 Ga0500661_118145 3300055283 Bacteria 511
1724 Ga0587066_220672 3300059490 Bacteria 508
1725 Ga0501082_0098833 3300060353 Bacteria 2523
1726 Ga0501082_0142522 3300060353 Bacteria 2080
1727 Ga0501082_0788722 3300060353 Bacteria 831

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8046767195 8046773642 77
2 3300046499 Ga0495594_0849835 Ga0495594_0849835_68_373 92
3 3300049574 Ga0501038_0063535 Ga0501038_0063535_2820_3137 97
4 iso_pu_bacteria 2503198000 2503203209 98
5 iso_pu_bacteria 2852387548 2852393365 98
6 3300046678 Ga0495599_0494273 Ga0495599_0494273_337_660 99
7 3300048088 Ga0495602_0120954 Ga0495602_0120954_1724_2047 99
8 3300013306 Ga0163162_10163497 Ga0163162_101634974 100
9 3300037418 Ga0395900_0885683 Ga0395900_0885683_383_724 100
10 3300038443 Ga0395901_0237430 Ga0395901_0237430_586_927 100
11 3300049571 Ga0501034_0404340 Ga0501034_0404340_848_1189 100
12 3300049572 Ga0501036_1337539 Ga0501036_1337539_125_466 100
13 3300049573 Ga0501037_0019397 Ga0501037_0019397_1315_1656 100
14 3300049822 Ga0501035_0015014 Ga0501035_0015014_2657_2998 100
15 iso_pu_bacteria 2881364244 2881370341 100
16 3300003323 rootH1_10115056 rootH1_101150563 101
17 3300009098 Ga0105245_11359398 Ga0105245_113593982 101
18 3300009551 Ga0105238_11273238 Ga0105238_112732382 101
19 3300011119 Ga0105246_10831917 Ga0105246_108319172 101
20 3300046678 Ga0495599_0333861 Ga0495599_0333861_155_460 101
21 3300050490 nmdc:mga03n38_57464_c1 nmdc:mga03n38_57464_c1_1057_1362 101
22 3300050494 nmdc:mga06z11_433121_c1 nmdc:mga06z11_433121_c1_366_671 101
23 iso_pu_bacteria 2508501128 2509149991 101
24 iso_pu_bacteria 2513237092 2513626374 101
25 iso_pu_bacteria 2513237098 2513676081 101
26 iso_pu_bacteria 2513237141 2513889714 101
27 iso_pu_bacteria 2513237161 2514012303 101
28 iso_pu_bacteria 2517093001 2517104787 101
29 iso_pu_bacteria 2524023210 2524465690 101
30 iso_pu_bacteria 2617270735 2617350325 101
31 iso_pu_bacteria 2802429603 2805918632 101
32 iso_pu_bacteria 2824671348 2824678113 101
33 iso_pu_bacteria 2824687955 2824694255 101
34 iso_pu_bacteria 2824696289 2824703085 101
35 iso_pu_bacteria 2824773399 2824779674 101
36 iso_pu_bacteria 2841974524 2841981017 101
37 iso_pu_bacteria 2841983080 2841987230 101
38 iso_pu_bacteria 2847939898 2847948157 101
39 iso_pu_bacteria 2885383462 2885388677 101
40 iso_pu_bacteria 2903768456 2903772435 101
41 iso_pu_bacteria 2932794094 2932797706 101
42 iso_pu_bacteria 2932801729 2932804224 101
43 iso_pu_bacteria 2935883170 2935890419 101
44 3300005437 Ga0070710_10130478 Ga0070710_101304782 102
45 3300005545 Ga0070695_101093828 Ga0070695_1010938281 102
46 3300025898 Ga0207692_10075849 Ga0207692_100758492 102
47 3300035089 Ga0373944_0036114 Ga0373944_0036114_60_374 102
48 3300035111 Ga0373923_0200989 Ga0373923_0200989_552_887 102
49 3300035113 Ga0373936_0006155 Ga0373936_0006155_2121_2456 102
50 3300035116 Ga0373945_0009865 Ga0373945_0009865_2272_2586 102
51 3300035118 Ga0373954_0102517 Ga0373954_0102517_416_730 102
52 3300035170 Ga0373943_0000144 Ga0373943_0000144_10994_11308 102
53 3300035171 Ga0373946_0000438 Ga0373946_0000438_2605_2919 102
54 3300035725 Ga0373947_0000318 Ga0373947_0000318_264_599 102
55 3300035725 Ga0373947_0002945 Ga0373947_0002945_60_374 102
56 3300037068 Ga0373925_0011278 Ga0373925_0011278_544_879 102
57 3300041501 Ga0451845_0594181 Ga0451845_0594181_216_539 102
58 3300046459 Ga0495629_0211770 Ga0495629_0211770_767_1081 102
59 3300046472 Ga0495580_0181469 Ga0495580_0181469_60_374 102
60 3300046475 Ga0495639_0135706 Ga0495639_0135706_329_643 102
61 3300046476 Ga0495662_0085216 Ga0495662_0085216_916_1251 102
62 3300046477 Ga0495664_0008861 Ga0495664_0008861_627_962 102
63 3300046514 Ga0495618_0068394 Ga0495618_0068394_1609_1944 102
64 3300046517 Ga0495630_0000460 Ga0495630_0000460_4959_5294 102
65 3300046531 Ga0495665_0018597 Ga0495665_0018597_527_862 102
66 3300046533 Ga0495640_0002731 Ga0495640_0002731_7591_7926 102
67 3300046535 Ga0495586_0210429 Ga0495586_0210429_259_594 102
68 3300046543 Ga0495645_0053231 Ga0495645_0053231_725_1060 102
69 3300046642 Ga0495634_0020332 Ga0495634_0020332_1679_2014 102
70 3300046663 Ga0495635_0128371 Ga0495635_0128371_767_1102 102
71 3300046681 Ga0495647_0030920 Ga0495647_0030920_505_819 102
72 3300046683 Ga0495658_0116679 Ga0495658_0116679_413_727 102
73 3300046689 Ga0495613_0036607 Ga0495613_0036607_562_876 102
74 3300046690 Ga0495624_0035664 Ga0495624_0035664_2557_2871 102
75 3300047315 Ga0495581_0001700 Ga0495581_0001700_2685_2999 102
76 3300047317 Ga0495604_0103228 Ga0495604_0103228_747_1082 102
77 3300047319 Ga0495674_0216552 Ga0495674_0216552_914_1249 102
78 3300047321 Ga0495676_0083794 Ga0495676_0083794_1488_1823 102
79 3300047471 Ga0495684_0161876 Ga0495684_0161876_859_1194 102
80 3300047673 Ga0495593_0054268 Ga0495593_0054268_661_975 102
81 3300049569 Ga0501032_0073895 Ga0501032_0073895_1778_2119 102
82 3300049570 Ga0501033_0261281 Ga0501033_0261281_474_815 102
83 3300049571 Ga0501034_0278744 Ga0501034_0278744_131_472 102
84 3300049572 Ga0501036_0143846 Ga0501036_0143846_503_844 102
85 3300049573 Ga0501037_0330848 Ga0501037_0330848_227_568 102
86 3300049574 Ga0501038_0200513 Ga0501038_0200513_500_841 102
87 3300049579 Ga0501043_0029042 Ga0501043_0029042_1210_1551 102
88 3300049583 Ga0501067_0110420 Ga0501067_0110420_682_1023 102
89 3300049584 Ga0501068_0389574 Ga0501068_0389574_319_660 102
90 3300049586 Ga0501070_0380627 Ga0501070_0380627_540_881 102
91 3300049587 Ga0501071_0394640 Ga0501071_0394640_305_646 102
92 3300049742 Ga0501080_0536158 Ga0501080_0536158_342_683 102
93 3300049822 Ga0501035_0437050 Ga0501035_0437050_122_463 102
94 3300049823 Ga0501044_0132447 Ga0501044_0132447_1646_1987 102
95 3300049824 Ga0501045_0340240 Ga0501045_0340240_341_682 102
96 3300053077 Ga0495601_0211937 Ga0495601_0211937_664_999 102
97 3300053078 Ga0495612_0004983 Ga0495612_0004983_798_1133 102
98 3300053084 Ga0495595_0101489 Ga0495595_0101489_414_749 102
99 3300053085 Ga0495619_0140375 Ga0495619_0140375_789_1124 102
100 iso_pu_bacteria 2513237095 2513652532 102
101 iso_pu_bacteria 2513237096 2513657378 102
102 iso_pu_bacteria 2513237137 2513857194 102
103 iso_pu_bacteria 2513237139 2513876652 102
104 iso_pu_bacteria 2513237145 2513916631 102
105 iso_pu_bacteria 2517572143 2517888133 102
106 iso_pu_bacteria 2524023205 2524440595 102
107 iso_pu_bacteria 2524023228 2524533314 102
108 iso_pu_bacteria 2728368998 2728753791 102
109 iso_pu_bacteria 2744054633 2745078572 102
110 iso_pu_bacteria 2791355196 2793061259 102
111 iso_pu_bacteria 2791355197 2793073483 102
112 iso_pu_bacteria 2816332527 2818236968 102
113 iso_pu_bacteria 2824600985 2824608564 102
114 iso_pu_bacteria 2824609381 2824613728 102
115 iso_pu_bacteria 2824617872 2824625785 102
116 iso_pu_bacteria 2824626560 2824633803 102
117 iso_pu_bacteria 2824635225 2824642182 102
118 iso_pu_bacteria 2824644064 2824649586 102
119 iso_pu_bacteria 2824653114 2824660272 102
120 iso_pu_bacteria 2824661429 2824670333 102
121 iso_pu_bacteria 2824679649 2824686641 102
122 iso_pu_bacteria 2824714736 2824719545 102
123 iso_pu_bacteria 2824723954 2824729988 102
124 iso_pu_bacteria 2838122688 2838127130 102
125 iso_pu_bacteria 2841941048 2841947367 102
126 iso_pu_bacteria 2841949485 2841955844 102
127 iso_pu_bacteria 2841966195 2841974323 102
128 iso_pu_bacteria 2842038055 2842041140 102
129 iso_pu_bacteria 2842045827 2842045915 102
130 iso_pu_bacteria 2874612657 2874618507 102
131 iso_pu_bacteria 2874620515 2874625733 102
132 iso_pu_bacteria 2874628541 2874632927 102
133 iso_pu_bacteria 2876761206 2876762661 102
134 iso_pu_bacteria 2879099564 2879105415 102
135 iso_pu_bacteria 2881665667 2881673576 102
136 iso_pu_bacteria 2885374607 2885379990 102
137 iso_pu_bacteria 2885409591 2885409957 102
138 iso_pu_bacteria 2888378607 2888385893 102
139 iso_pu_bacteria 2888419890 2888425999 102
140 iso_pu_bacteria 2904666416 2904673906 102
141 iso_pu_bacteria 2904690495 2904695716 102
142 iso_pu_bacteria 2904699407 2904710068 102
143 iso_pu_bacteria 2906635258 2906639953 102
144 iso_pu_bacteria 2906660503 2906666559 102
145 iso_pu_bacteria 2908756301 2908764230 102
146 iso_pu_bacteria 2922361189 2922366849 102
147 iso_pu_bacteria 2922368715 2922376201 102
148 iso_pu_bacteria 2922393267 2922393595 102
149 iso_pu_bacteria 2922425934 2922426377 102
150 iso_pu_bacteria 2929615660 2929622979 102
151 iso_pu_bacteria 2929624759 2929631574 102
152 iso_pu_bacteria 2932809354 2932816410 102
153 iso_pu_bacteria 2932818245 2932821993 102
154 iso_pu_bacteria 2933577622 2933584817 102
155 iso_pu_bacteria 2935630451 2935632721 102
156 iso_pu_bacteria 2935675223 2935683679 102
157 iso_pu_bacteria 2935760218 2935767385 102
158 iso_pu_bacteria 2935810662 2935815723 102
159 iso_pu_bacteria 2936037263 2936040961 102
160 iso_pu_bacteria 2941507105 2941508615 102
161 iso_pu_bacteria 2941515067 2941516445 102
162 iso_pu_bacteria 2941523033 2941524539 102
163 iso_pu_bacteria 3005474847 3005475714 102
164 iso_pu_bacteria 3005587118 3005588467 102
165 iso_pu_bacteria 3005594810 3005600767 102
166 iso_pu_bacteria 8006933436 8006937044 102
167 iso_pu_bacteria 8006973647 8006977009 102
168 iso_pu_bacteria 8019555841 8019561634 102
169 iso_pu_bacteria 8019565922 8019571706 102
170 iso_pu_bacteria 8019648815 8019655660 102
171 iso_pu_bacteria 8055742211 8055744659 102
172 3300005336 Ga0070680_100384758 Ga0070680_1003847582 103
173 3300005458 Ga0070681_10618034 Ga0070681_106180342 103
174 3300005614 Ga0068856_100858150 Ga0068856_1008581502 103
175 3300006038 Ga0075365_10410351 Ga0075365_104103512 103
176 3300006175 Ga0070712_101710710 Ga0070712_1017107101 103
177 3300006186 Ga0075369_10642735 Ga0075369_106427352 103
178 3300006871 Ga0075434_100190918 Ga0075434_1001909182 103
179 3300007076 Ga0075435_100629218 Ga0075435_1006292182 103
180 3300009093 Ga0105240_10641266 Ga0105240_106412662 103
181 3300025912 Ga0207707_11312564 Ga0207707_113125642 103
182 3300025917 Ga0207660_10438618 Ga0207660_104386182 103
183 3300025917 Ga0207660_10446168 Ga0207660_104461682 103
184 3300025945 Ga0207679_10293268 Ga0207679_102932683 103
185 3300031249 Ga0265339_10008369 Ga0265339_100083692 103
186 3300031616 Ga0307508_10000120 Ga0307508_1000012075 103
187 3300049570 Ga0501033_0274827 Ga0501033_0274827_783_1115 103
188 3300050512 nmdc:mga0n895_470326_c1 nmdc:mga0n895_470326_c1_467_778 103
189 3300003762 Ga0055542_1007673 Ga0055542_10076734 104
190 3300005295 Ga0065707_10124570 Ga0065707_101245703 104
191 3300005327 Ga0070658_10507806 Ga0070658_105078062 104
192 3300005329 Ga0070683_100151700 Ga0070683_1001517002 104
193 3300005329 Ga0070683_100386092 Ga0070683_1003860921 104
194 3300005329 Ga0070683_101397291 Ga0070683_1013972911 104
195 3300005330 Ga0070690_100118216 Ga0070690_1001182162 104
196 3300005331 Ga0070670_100132673 Ga0070670_1001326732 104
197 3300005336 Ga0070680_101481050 Ga0070680_1014810501 104
198 3300005340 Ga0070689_100234567 Ga0070689_1002345671 104
199 3300005341 Ga0070691_10760546 Ga0070691_107605462 104
200 3300005344 Ga0070661_100887195 Ga0070661_1008871951 104
201 3300005354 Ga0070675_102232233 Ga0070675_1022322332 104
202 3300005355 Ga0070671_100503345 Ga0070671_1005033452 104
203 3300005355 Ga0070671_100922812 Ga0070671_1009228122 104
204 3300005365 Ga0070688_100134037 Ga0070688_1001340372 104
205 3300005366 Ga0070659_100161526 Ga0070659_1001615263 104
206 3300005367 Ga0070667_102232280 Ga0070667_1022322801 104
207 3300005434 Ga0070709_11130917 Ga0070709_111309171 104
208 3300005435 Ga0070714_100139175 Ga0070714_1001391752 104
209 3300005435 Ga0070714_102199250 Ga0070714_1021992501 104
210 3300005437 Ga0070710_10072511 Ga0070710_100725111 104
211 3300005437 Ga0070710_10962561 Ga0070710_109625611 104
212 3300005439 Ga0070711_101022914 Ga0070711_1010229142 104
213 3300005439 Ga0070711_101407061 Ga0070711_1014070611 104
214 3300005440 Ga0070705_100189429 Ga0070705_1001894293 104
215 3300005441 Ga0070700_100468237 Ga0070700_1004682372 104
216 3300005455 Ga0070663_100056994 Ga0070663_1000569942 104
217 3300005455 Ga0070663_100118082 Ga0070663_1001180822 104
218 3300005457 Ga0070662_100046511 Ga0070662_1000465114 104
219 3300005458 Ga0070681_10195461 Ga0070681_101954612 104
220 3300005458 Ga0070681_11381969 Ga0070681_113819691 104
221 3300005530 Ga0070679_100183296 Ga0070679_1001832962 104
222 3300005530 Ga0070679_100574670 Ga0070679_1005746701 104
223 3300005530 Ga0070679_100876743 Ga0070679_1008767432 104
224 3300005535 Ga0070684_100534685 Ga0070684_1005346851 104
225 3300005539 Ga0068853_101958586 Ga0068853_1019585861 104
226 3300005539 Ga0068853_102013506 Ga0068853_1020135062 104
227 3300005544 Ga0070686_100064426 Ga0070686_1000644263 104
228 3300005545 Ga0070695_100358513 Ga0070695_1003585132 104
229 3300005548 Ga0070665_101278833 Ga0070665_1012788332 104
230 3300005563 Ga0068855_100154928 Ga0068855_1001549282 104
231 3300005564 Ga0070664_101061793 Ga0070664_1010617932 104
232 3300005577 Ga0068857_101236695 Ga0068857_1012366952 104
233 3300005578 Ga0068854_100286941 Ga0068854_1002869411 104
234 3300005614 Ga0068856_100000511 Ga0068856_10000051132 104
235 3300005614 Ga0068856_100985627 Ga0068856_1009856272 104
236 3300005616 Ga0068852_100464054 Ga0068852_1004640542 104
237 3300005616 Ga0068852_102398868 Ga0068852_1023988682 104
238 3300005617 Ga0068859_100599379 Ga0068859_1005993792 104
239 3300005618 Ga0068864_100760340 Ga0068864_1007603402 104
240 3300005719 Ga0068861_102003200 Ga0068861_1020032002 104
241 3300005841 Ga0068863_100450284 Ga0068863_1004502842 104
242 3300005841 Ga0068863_100699649 Ga0068863_1006996492 104
243 3300005842 Ga0068858_100442228 Ga0068858_1004422283 104
244 3300005843 Ga0068860_100000081 Ga0068860_10000008161 104
245 3300005843 Ga0068860_100088918 Ga0068860_1000889182 104
246 3300005844 Ga0068862_100149256 Ga0068862_1001492562 104
247 3300006028 Ga0070717_10261019 Ga0070717_102610192 104
248 3300006028 Ga0070717_10977580 Ga0070717_109775802 104
249 3300006173 Ga0070716_100002745 Ga0070716_10000274511 104
250 3300006237 Ga0097621_100025107 Ga0097621_1000251078 104
251 3300006353 Ga0075370_10223509 Ga0075370_102235091 104
252 3300006358 Ga0068871_100175659 Ga0068871_1001756592 104
253 3300006852 Ga0075433_10774626 Ga0075433_107746261 104
254 3300006871 Ga0075434_100482552 Ga0075434_1004825522 104
255 3300006881 Ga0068865_101490872 Ga0068865_1014908722 104
256 3300006914 Ga0075436_100180295 Ga0075436_1001802952 104
257 3300006931 Ga0097620_100599354 Ga0097620_1005993542 104
258 3300007076 Ga0075435_100100575 Ga0075435_1001005752 104
259 3300007076 Ga0075435_100503462 Ga0075435_1005034622 104
260 3300009094 Ga0111539_12114440 Ga0111539_121144402 104
261 3300009101 Ga0105247_10133094 Ga0105247_101330943 104
262 3300009101 Ga0105247_10969741 Ga0105247_109697411 104
263 3300009148 Ga0105243_10064279 Ga0105243_100642793 104
264 3300009148 Ga0105243_10767740 Ga0105243_107677401 104
265 3300009174 Ga0105241_10253124 Ga0105241_102531242 104
266 3300009174 Ga0105241_10702411 Ga0105241_107024111 104
267 3300009176 Ga0105242_10778881 Ga0105242_107788812 104
268 3300009176 Ga0105242_11530291 Ga0105242_115302911 104
269 3300009177 Ga0105248_12700032 Ga0105248_127000322 104
270 3300009545 Ga0105237_10919712 Ga0105237_109197121 104
271 3300009545 Ga0105237_11429649 Ga0105237_114296492 104
272 3300009545 Ga0105237_12567438 Ga0105237_125674381 104
273 3300009551 Ga0105238_11002631 Ga0105238_110026313 104
274 3300009551 Ga0105238_11083624 Ga0105238_110836242 104
275 3300009551 Ga0105238_11240178 Ga0105238_112401782 104
276 3300010375 Ga0105239_10295853 Ga0105239_102958531 104
277 3300010375 Ga0105239_10321370 Ga0105239_103213702 104
278 3300010375 Ga0105239_11515558 Ga0105239_115155582 104
279 3300011119 Ga0105246_10149231 Ga0105246_101492313 104
280 3300011119 Ga0105246_12335224 Ga0105246_123352241 104
281 3300012477 Ga0157336_1015952 Ga0157336_10159521 104
282 3300012502 Ga0157347_1047842 Ga0157347_10478422 104
283 3300012505 Ga0157339_1032615 Ga0157339_10326152 104
284 3300013105 Ga0157369_11828381 Ga0157369_118283812 104
285 3300013296 Ga0157374_10324805 Ga0157374_103248052 104
286 3300013296 Ga0157374_10523148 Ga0157374_105231483 104
287 3300013296 Ga0157374_12982712 Ga0157374_129827122 104
288 3300013306 Ga0163162_10167630 Ga0163162_101676302 104
289 3300013306 Ga0163162_10184315 Ga0163162_101843153 104
290 3300013306 Ga0163162_10478573 Ga0163162_104785732 104
291 3300013306 Ga0163162_11280754 Ga0163162_112807541 104
292 3300013307 Ga0157372_13475999 Ga0157372_134759991 104
293 3300013308 Ga0157375_10570024 Ga0157375_105700242 104
294 3300013308 Ga0157375_12141096 Ga0157375_121410962 104
295 3300014325 Ga0163163_12346894 Ga0163163_123468942 104
296 3300014968 Ga0157379_10054006 Ga0157379_100540063 104
297 3300014969 Ga0157376_11098885 Ga0157376_110988852 104
298 3300020069 Ga0197907_11374702 Ga0197907_113747022 104
299 3300020078 Ga0206352_11142238 Ga0206352_111422382 104
300 3300020080 Ga0206350_11031563 Ga0206350_110315632 104
301 3300022467 Ga0224712_10143675 Ga0224712_101436751 104
302 3300025254 Ga0209148_1000654 Ga0209148_100065417 104
303 3300025272 Ga0209455_1001585 Ga0209455_100158510 104
304 3300025297 Ga0209758_1003130 Ga0209758_100313010 104
305 3300025901 Ga0207688_10471307 Ga0207688_104713072 104
306 3300025903 Ga0207680_10558871 Ga0207680_105588712 104
307 3300025906 Ga0207699_10590228 Ga0207699_105902281 104
308 3300025911 Ga0207654_10481206 Ga0207654_104812062 104
309 3300025912 Ga0207707_10120081 Ga0207707_101200812 104
310 3300025913 Ga0207695_10505252 Ga0207695_105052522 104
311 3300025915 Ga0207693_10054664 Ga0207693_100546642 104
312 3300025916 Ga0207663_11292638 Ga0207663_112926382 104
313 3300025917 Ga0207660_10384268 Ga0207660_103842682 104
314 3300025921 Ga0207652_10082507 Ga0207652_100825074 104
315 3300025923 Ga0207681_10655301 Ga0207681_106553012 104
316 3300025926 Ga0207659_11436429 Ga0207659_114364292 104
317 3300025928 Ga0207700_10073686 Ga0207700_100736862 104
318 3300025929 Ga0207664_11973968 Ga0207664_119739681 104
319 3300025931 Ga0207644_11554496 Ga0207644_115544961 104
320 3300025934 Ga0207686_10070179 Ga0207686_100701794 104
321 3300025936 Ga0207670_10029772 Ga0207670_100297724 104
322 3300025938 Ga0207704_11992703 Ga0207704_119927031 104
323 3300025939 Ga0207665_10004965 Ga0207665_100049654 104
324 3300025944 Ga0207661_10000462 Ga0207661_100004626 104
325 3300025944 Ga0207661_10230170 Ga0207661_102301702 104
326 3300025945 Ga0207679_10918431 Ga0207679_109184312 104
327 3300025949 Ga0207667_10135083 Ga0207667_101350832 104
328 3300025972 Ga0207668_10067714 Ga0207668_100677144 104
329 3300025981 Ga0207640_10269574 Ga0207640_102695741 104
330 3300026041 Ga0207639_10203517 Ga0207639_102035172 104
331 3300026041 Ga0207639_10813727 Ga0207639_108137272 104
332 3300026067 Ga0207678_10049095 Ga0207678_100490955 104
333 3300026075 Ga0207708_11030895 Ga0207708_110308951 104
334 3300026078 Ga0207702_10001649 Ga0207702_1000164914 104
335 3300026078 Ga0207702_10166038 Ga0207702_101660382 104
336 3300026078 Ga0207702_10890046 Ga0207702_108900462 104
337 3300026088 Ga0207641_11839374 Ga0207641_118393741 104
338 3300026088 Ga0207641_11845709 Ga0207641_118457092 104
339 3300026089 Ga0207648_10702985 Ga0207648_107029852 104
340 3300026095 Ga0207676_11552466 Ga0207676_115524661 104
341 3300026116 Ga0207674_11307166 Ga0207674_113071661 104
342 3300026118 Ga0207675_100533750 Ga0207675_1005337502 104
343 3300026121 Ga0207683_10936552 Ga0207683_109365522 104
344 3300026142 Ga0207698_10130906 Ga0207698_101309062 104
345 3300026142 Ga0207698_10808446 Ga0207698_108084461 104
346 3300028381 Ga0268264_10000048 Ga0268264_1000004857 104
347 3300028381 Ga0268264_10706694 Ga0268264_107066942 104
348 3300028556 Ga0265337_1011548 Ga0265337_10115482 104
349 3300028563 Ga0265319_1060919 Ga0265319_10609191 104
350 3300028573 Ga0265334_10002347 Ga0265334_100023475 104
351 3300028577 Ga0265318_10007048 Ga0265318_100070485 104
352 3300028653 Ga0265323_10002902 Ga0265323_100029024 104
353 3300028654 Ga0265322_10002295 Ga0265322_100022953 104
354 3300028666 Ga0265336_10000960 Ga0265336_100009606 104
355 3300028800 Ga0265338_10000155 Ga0265338_1000015574 104
356 3300029957 Ga0265324_10007896 Ga0265324_100078964 104
357 3300031238 Ga0265332_10430720 Ga0265332_104307201 104
358 3300031241 Ga0265325_10000264 Ga0265325_100002647 104
359 3300031595 Ga0265313_10010055 Ga0265313_100100558 104
360 3300031616 Ga0307508_10314541 Ga0307508_103145412 104
361 3300031711 Ga0265314_10015133 Ga0265314_100151337 104
362 3300035089 Ga0373944_0015987 Ga0373944_0015987_699_1013 104
363 3300035089 Ga0373944_0174901 Ga0373944_0174901_253_567 104
364 3300035111 Ga0373923_0010977 Ga0373923_0010977_1895_2209 104
365 3300035111 Ga0373923_0049121 Ga0373923_0049121_515_829 104
366 3300035112 Ga0373932_0018087 Ga0373932_0018087_625_939 104
367 3300035113 Ga0373936_0012541 Ga0373936_0012541_2604_2918 104
368 3300035115 Ga0373941_0184903 Ga0373941_0184903_201_515 104
369 3300035116 Ga0373945_0030032 Ga0373945_0030032_107_421 104
370 3300035117 Ga0373953_0043457 Ga0373953_0043457_59_373 104
371 3300035117 Ga0373953_0277537 Ga0373953_0277537_345_659 104
372 3300035118 Ga0373954_0177873 Ga0373954_0177873_35_349 104
373 3300035119 Ga0373956_0232124 Ga0373956_0232124_336_650 104
374 3300035120 Ga0373957_0205777 Ga0373957_0205777_347_661 104
375 3300035170 Ga0373943_0588703 Ga0373943_0588703_252_566 104
376 3300035172 Ga0373955_0080822 Ga0373955_0080822_105_419 104
377 3300035241 Ga0373961_0329052 Ga0373961_0329052_247_561 104
378 3300035242 Ga0373962_0049076 Ga0373962_0049076_201_515 104
379 3300035410 Ga0373924_0107119 Ga0373924_0107119_875_1189 104
380 3300035410 Ga0373924_0221035 Ga0373924_0221035_159_473 104
381 3300035691 Ga0373931_0021136 Ga0373931_0021136_1605_1919 104
382 3300035691 Ga0373931_0046260 Ga0373931_0046260_1576_1890 104
383 3300035692 Ga0373935_0041807 Ga0373935_0041807_14_328 104
384 3300035695 Ga0373927_0274383 Ga0373927_0274383_86_400 104
385 3300035695 Ga0373927_0398016 Ga0373927_0398016_252_566 104
386 3300035724 Ga0373933_0009823 Ga0373933_0009823_1386_1700 104
387 3300035724 Ga0373933_0202179 Ga0373933_0202179_203_517 104
388 3300035725 Ga0373947_0203506 Ga0373947_0203506_608_922 104
389 3300035725 Ga0373947_0299163 Ga0373947_0299163_656_970 104
390 3300036401 Ga0373937_0018978 Ga0373937_0018978_4893_5207 104
391 3300037068 Ga0373925_0006658 Ga0373925_0006658_8134_8448 104
392 3300037068 Ga0373925_0115147 Ga0373925_0115147_1517_1831 104
393 3300044658 Ga0466972_0000363 Ga0466972_0000363_19321_19635 104
394 3300044683 Ga0466965_0100435 Ga0466965_0100435_475_789 104
395 3300044735 Ga0466968_0387058 Ga0466968_0387058_55_369 104
396 3300044842 Ga0466957_0419183 Ga0466957_0419183_43_357 104
397 3300044901 Ga0466960_0673594 Ga0466960_0673594_278_592 104
398 3300045049 Ga0466959_0099286 Ga0466959_0099286_135_449 104
399 3300045049 Ga0466959_0281625 Ga0466959_0281625_688_1002 104
400 3300046454 Ga0495592_0079397 Ga0495592_0079397_1198_1512 104
401 3300046454 Ga0495592_0128989 Ga0495592_0128989_67_381 104
402 3300046455 Ga0495603_0182357 Ga0495603_0182357_71_385 104
403 3300046458 Ga0495591_015002 Ga0495591_015002_2397_2711 104
404 3300046459 Ga0495629_0010691 Ga0495629_0010691_356_670 104
405 3300046459 Ga0495629_0015204 Ga0495629_0015204_2804_3118 104
406 3300046461 Ga0495641_0014002 Ga0495641_0014002_2634_2948 104
407 3300046462 Ga0495651_0021274 Ga0495651_0021274_102_416 104
408 3300046462 Ga0495651_0201744 Ga0495651_0201744_696_1010 104
409 3300046462 Ga0495651_0314377 Ga0495651_0314377_139_453 104
410 3300046463 Ga0495653_0017838 Ga0495653_0017838_1768_2082 104
411 3300046463 Ga0495653_0061762 Ga0495653_0061762_1567_1881 104
412 3300046463 Ga0495653_0265726 Ga0495653_0265726_284_598 104
413 3300046472 Ga0495580_0090655 Ga0495580_0090655_748_1062 104
414 3300046473 Ga0495582_0859393 Ga0495582_0859393_97_411 104
415 3300046475 Ga0495639_0121796 Ga0495639_0121796_14_328 104
416 3300046476 Ga0495662_0020780 Ga0495662_0020780_1190_1504 104
417 3300046477 Ga0495664_0084647 Ga0495664_0084647_876_1190 104
418 3300046477 Ga0495664_0120890 Ga0495664_0120890_28_342 104
419 3300046491 Ga0495584_0050448 Ga0495584_0050448_1429_1743 104
420 3300046492 Ga0495585_0005331 Ga0495585_0005331_2171_2485 104
421 3300046499 Ga0495594_0089880 Ga0495594_0089880_490_804 104
422 3300046501 Ga0495607_0038517 Ga0495607_0038517_2073_2387 104
423 3300046511 Ga0495608_0043820 Ga0495608_0043820_35_349 104
424 3300046511 Ga0495608_0119507 Ga0495608_0119507_1200_1514 104
425 3300046512 Ga0495610_0151305 Ga0495610_0151305_558_872 104
426 3300046513 Ga0495616_0420293 Ga0495616_0420293_167_481 104
427 3300046514 Ga0495618_0106699 Ga0495618_0106699_1073_1387 104
428 3300046514 Ga0495618_0297202 Ga0495618_0297202_617_931 104
429 3300046516 Ga0495628_0000319 Ga0495628_0000319_27243_27557 104
430 3300046516 Ga0495628_0161727 Ga0495628_0161727_875_1189 104
431 3300046517 Ga0495630_0033619 Ga0495630_0033619_3152_3466 104
432 3300046523 Ga0495644_0004455 Ga0495644_0004455_2602_2916 104
433 3300046526 Ga0495666_0024749 Ga0495666_0024749_203_517 104
434 3300046529 Ga0495652_0024377 Ga0495652_0024377_1102_1416 104
435 3300046531 Ga0495665_0024530 Ga0495665_0024530_2339_2653 104
436 3300046533 Ga0495640_0027866 Ga0495640_0027866_1467_1781 104
437 3300046533 Ga0495640_0048620 Ga0495640_0048620_180_494 104
438 3300046535 Ga0495586_0009720 Ga0495586_0009720_3750_4064 104
439 3300046536 Ga0495587_0002631 Ga0495587_0002631_942_1256 104
440 3300046536 Ga0495587_0238482 Ga0495587_0238482_585_899 104
441 3300046537 Ga0495598_0192702 Ga0495598_0192702_40_354 104
442 3300046538 Ga0495609_0182374 Ga0495609_0182374_222_536 104
443 3300046543 Ga0495645_0002294 Ga0495645_0002294_7764_8078 104
444 3300046557 Ga0495622_0018157 Ga0495622_0018157_1589_1903 104
445 3300046558 Ga0495633_0020440 Ga0495633_0020440_2208_2522 104
446 3300046559 Ga0495667_0007433 Ga0495667_0007433_6451_6765 104
447 3300046559 Ga0495667_0412806 Ga0495667_0412806_103_417 104
448 3300046559 Ga0495667_0605272 Ga0495667_0605272_164_478 104
449 3300046615 Ga0495656_0004069 Ga0495656_0004069_2099_2413 104
450 3300046642 Ga0495634_0066850 Ga0495634_0066850_1646_1960 104
451 3300046642 Ga0495634_0205717 Ga0495634_0205717_725_1039 104
452 3300046642 Ga0495634_0453220 Ga0495634_0453220_238_552 104
453 3300046648 Ga0495611_0024058 Ga0495611_0024058_1852_2166 104
454 3300046663 Ga0495635_0021312 Ga0495635_0021312_2790_3104 104
455 3300046663 Ga0495635_0023714 Ga0495635_0023714_1394_1708 104
456 3300046663 Ga0495635_0088610 Ga0495635_0088610_108_422 104
457 3300046664 Ga0495659_0023500 Ga0495659_0023500_1590_1904 104
458 3300046665 Ga0495661_0037544 Ga0495661_0037544_2166_2480 104
459 3300046674 Ga0495588_0103291 Ga0495588_0103291_763_1077 104
460 3300046675 Ga0495657_0029162 Ga0495657_0029162_561_875 104
461 3300046675 Ga0495657_0073439 Ga0495657_0073439_1331_1645 104
462 3300046678 Ga0495599_0137110 Ga0495599_0137110_762_1076 104
463 3300046678 Ga0495599_0510458 Ga0495599_0510458_192_506 104
464 3300046679 Ga0495623_0006722 Ga0495623_0006722_1013_1327 104
465 3300046679 Ga0495623_0271943 Ga0495623_0271943_47_361 104
466 3300046680 Ga0495646_0030802 Ga0495646_0030802_2135_2449 104
467 3300046680 Ga0495646_0072330 Ga0495646_0072330_152_466 104
468 3300046680 Ga0495646_0423335 Ga0495646_0423335_89_403 104
469 3300046683 Ga0495658_0097198 Ga0495658_0097198_239_553 104
470 3300046683 Ga0495658_1016586 Ga0495658_1016586_51_365 104
471 3300046684 Ga0495669_0102850 Ga0495669_0102850_665_979 104
472 3300046684 Ga0495669_0201782 Ga0495669_0201782_130_444 104
473 3300046689 Ga0495613_0047221 Ga0495613_0047221_2385_2699 104
474 3300046689 Ga0495613_0091995 Ga0495613_0091995_1319_1633 104
475 3300046689 Ga0495613_0382676 Ga0495613_0382676_65_379 104
476 3300046690 Ga0495624_0074466 Ga0495624_0074466_519_833 104
477 3300046691 Ga0495670_0029218 Ga0495670_0029218_2099_2413 104
478 3300046794 Ga0495589_0060805 Ga0495589_0060805_724_1038 104
479 3300046809 Ga0495600_0011871 Ga0495600_0011871_45_359 104
480 3300046809 Ga0495600_0030700 Ga0495600_0030700_2790_3104 104
481 3300046809 Ga0495600_0034797 Ga0495600_0034797_62_376 104
482 3300047317 Ga0495604_0010591 Ga0495604_0010591_6853_7167 104
483 3300047317 Ga0495604_0015047 Ga0495604_0015047_2436_2750 104
484 3300047317 Ga0495604_0123120 Ga0495604_0123120_45_359 104
485 3300047318 Ga0495636_0127572 Ga0495636_0127572_629_943 104
486 3300047319 Ga0495674_0152415 Ga0495674_0152415_1292_1606 104
487 3300047319 Ga0495674_0542741 Ga0495674_0542741_232_546 104
488 3300047319 Ga0495674_0918984 Ga0495674_0918984_108_422 104
489 3300047319 Ga0495674_1407136 Ga0495674_1407136_108_422 104
490 3300047321 Ga0495676_0018517 Ga0495676_0018517_19_333 104
491 3300047321 Ga0495676_0124586 Ga0495676_0124586_1037_1351 104
492 3300047322 Ga0495680_0039523 Ga0495680_0039523_486_800 104
493 3300047323 Ga0495683_0486336 Ga0495683_0486336_25_339 104
494 3300047444 Ga0495675_0019021 Ga0495675_0019021_2729_3043 104
495 3300047445 Ga0495677_0338840 Ga0495677_0338840_268_582 104
496 3300047446 Ga0495679_025907 Ga0495679_025907_991_1305 104
497 3300047471 Ga0495684_0025696 Ga0495684_0025696_1470_1784 104
498 3300047472 Ga0495686_0125312 Ga0495686_0125312_304_618 104
499 3300047673 Ga0495593_0018230 Ga0495593_0018230_2320_2634 104
500 3300048088 Ga0495602_0000991 Ga0495602_0000991_8534_8848 104
501 3300048088 Ga0495602_0132871 Ga0495602_0132871_1109_1423 104
502 3300048088 Ga0495602_0525164 Ga0495602_0525164_124_438 104
503 3300048089 Ga0495614_0054948 Ga0495614_0054948_1374_1688 104
504 3300048903 Ga0496100_0534923 Ga0496100_0534923_216_533 104
505 3300048904 Ga0496101_0082543 Ga0496101_0082543_1957_2271 104
506 3300048904 Ga0496101_0121273 Ga0496101_0121273_836_1150 104
507 3300048905 Ga0496102_0041685 Ga0496102_0041685_1979_2293 104
508 3300048905 Ga0496102_0121374 Ga0496102_0121374_1663_1977 104
509 3300048907 Ga0496104_0000092 Ga0496104_0000092_77427_77741 104
510 3300048907 Ga0496104_0024236 Ga0496104_0024236_3355_3669 104
511 3300048907 Ga0496104_0068662 Ga0496104_0068662_2463_2777 104
512 3300048907 Ga0496104_0309441 Ga0496104_0309441_1048_1362 104
513 3300048907 Ga0496104_0556565 Ga0496104_0556565_66_380 104
514 3300048907 Ga0496104_0789995 Ga0496104_0789995_30_344 104
515 3300048908 Ga0496105_0032738 Ga0496105_0032738_3275_3589 104
516 3300048908 Ga0496105_0064561 Ga0496105_0064561_371_685 104
517 3300048908 Ga0496105_0073166 Ga0496105_0073166_2088_2402 104
518 3300048908 Ga0496105_0115766 Ga0496105_0115766_284_598 104
519 3300048908 Ga0496105_0136962 Ga0496105_0136962_330_644 104
520 3300048909 Ga0496106_0089299 Ga0496106_0089299_169_483 104
521 3300048911 Ga0496108_0036352 Ga0496108_0036352_1791_2105 104
522 3300048912 Ga0496109_0090522 Ga0496109_0090522_2486_2800 104
523 3300048913 Ga0496110_0085905 Ga0496110_0085905_2470_2784 104
524 3300048914 Ga0496111_0430716 Ga0496111_0430716_246_560 104
525 3300048915 Ga0496112_0007240 Ga0496112_0007240_5196_5510 104
526 3300048915 Ga0496112_0115123 Ga0496112_0115123_455_769 104
527 3300048916 Ga0496113_0082950 Ga0496113_0082950_1762_2076 104
528 3300048916 Ga0496113_0184951 Ga0496113_0184951_1137_1451 104
529 3300048916 Ga0496113_1027193 Ga0496113_1027193_169_483 104
530 3300048917 Ga0496114_0189966 Ga0496114_0189966_125_439 104
531 3300048917 Ga0496114_0270402 Ga0496114_0270402_130_444 104
532 3300048917 Ga0496114_1452523 Ga0496114_1452523_86_400 104
533 3300048918 Ga0496115_0045835 Ga0496115_0045835_327_641 104
534 3300048918 Ga0496115_0122044 Ga0496115_0122044_1373_1687 104
535 3300048918 Ga0496115_0243471 Ga0496115_0243471_621_935 104
536 3300048922 Ga0496119_0020200 Ga0496119_0020200_829_1143 104
537 3300048923 Ga0496120_0015151 Ga0496120_0015151_2244_2558 104
538 3300048927 Ga0496124_0250808 Ga0496124_0250808_226_540 104
539 3300048928 Ga0496125_0088001 Ga0496125_0088001_989_1303 104
540 3300048929 Ga0496126_0026801 Ga0496126_0026801_2791_3105 104
541 3300048929 Ga0496126_1182108 Ga0496126_1182108_159_476 104
542 3300049460 Ga0495682_0331107 Ga0495682_0331107_99_413 104
543 3300050512 nmdc:mga0n895_428558_c1 nmdc:mga0n895_428558_c1_292_606 104
544 3300050513 nmdc:mga0rr50_18584_c1 nmdc:mga0rr50_18584_c1_4096_4410 104
545 3300050513 nmdc:mga0rr50_610323_c1 nmdc:mga0rr50_610323_c1_86_400 104
546 3300050514 nmdc:mga08x19_37303_c1 nmdc:mga08x19_37303_c1_450_764 104
547 3300050515 nmdc:mga0a205_326869_c1 nmdc:mga0a205_326869_c1_522_836 104
548 3300050516 nmdc:mga0sz30_198316_c1 nmdc:mga0sz30_198316_c1_147_461 104
549 3300053077 Ga0495601_0000220 Ga0495601_0000220_9781_10095 104
550 3300053077 Ga0495601_0279906 Ga0495601_0279906_108_422 104
551 3300053077 Ga0495601_0679727 Ga0495601_0679727_108_422 104
552 3300053078 Ga0495612_0004506 Ga0495612_0004506_1311_1625 104
553 3300053084 Ga0495595_0001761 Ga0495595_0001761_6962_7276 104
554 3300053084 Ga0495595_0010491 Ga0495595_0010491_3333_3647 104
555 3300053085 Ga0495619_0001147 Ga0495619_0001147_10217_10531 104
556 3300053085 Ga0495619_0002969 Ga0495619_0002969_915_1229 104
557 3300053085 Ga0495619_0104451 Ga0495619_0104451_714_1028 104
558 3300053094 Ga0500566_0128042 Ga0500566_0128042_496_810 104
559 3300053136 Ga0500559_0169335 Ga0500559_0169335_652_966 104
560 3300053148 Ga0500590_245341 Ga0500590_245341_52_366 104
561 3300053162 Ga0500638_154885 Ga0500638_154885_133_447 104
562 3300053177 Ga0500636_0322580 Ga0500636_0322580_394_708 104
563 3300055283 Ga0500661_118145 Ga0500661_118145_160_474 104
564 3300003215 JGI25153J46596_10002018 JGI25153J46596_1000201813 105
565 3300005295 Ga0065707_10677222 Ga0065707_106772222 105
566 3300005327 Ga0070658_10105443 Ga0070658_101054432 105
567 3300005327 Ga0070658_10252139 Ga0070658_102521392 105
568 3300005327 Ga0070658_10357854 Ga0070658_103578542 105
569 3300005327 Ga0070658_10751147 Ga0070658_107511472 105
570 3300005329 Ga0070683_100080636 Ga0070683_1000806363 105
571 3300005329 Ga0070683_100293319 Ga0070683_1002933193 105
572 3300005335 Ga0070666_10338038 Ga0070666_103380382 105
573 3300005336 Ga0070680_100010353 Ga0070680_1000103535 105
574 3300005336 Ga0070680_100060427 Ga0070680_1000604272 105
575 3300005336 Ga0070680_100104534 Ga0070680_1001045343 105
576 3300005336 Ga0070680_100118136 Ga0070680_1001181363 105
577 3300005336 Ga0070680_100207095 Ga0070680_1002070953 105
578 3300005336 Ga0070680_100344015 Ga0070680_1003440152 105
579 3300005337 Ga0070682_100176556 Ga0070682_1001765562 105
580 3300005339 Ga0070660_100054026 Ga0070660_1000540265 105
581 3300005339 Ga0070660_100214418 Ga0070660_1002144182 105
582 3300005339 Ga0070660_100214853 Ga0070660_1002148531 105
583 3300005339 Ga0070660_100443175 Ga0070660_1004431752 105
584 3300005339 Ga0070660_100565923 Ga0070660_1005659232 105
585 3300005341 Ga0070691_10563702 Ga0070691_105637022 105
586 3300005344 Ga0070661_100052268 Ga0070661_1000522684 105
587 3300005344 Ga0070661_100174307 Ga0070661_1001743072 105
588 3300005344 Ga0070661_100198876 Ga0070661_1001988762 105
589 3300005354 Ga0070675_101035157 Ga0070675_1010351572 105
590 3300005355 Ga0070671_100026694 Ga0070671_1000266945 105
591 3300005355 Ga0070671_100615772 Ga0070671_1006157722 105
592 3300005356 Ga0070674_100618098 Ga0070674_1006180982 105
593 3300005366 Ga0070659_100050323 Ga0070659_1000503231 105
594 3300005366 Ga0070659_100163174 Ga0070659_1001631742 105
595 3300005366 Ga0070659_100641923 Ga0070659_1006419232 105
596 3300005366 Ga0070659_101458966 Ga0070659_1014589661 105
597 3300005367 Ga0070667_100443597 Ga0070667_1004435972 105
598 3300005434 Ga0070709_10216301 Ga0070709_102163012 105
599 3300005434 Ga0070709_10501740 Ga0070709_105017402 105
600 3300005434 Ga0070709_10592193 Ga0070709_105921932 105
601 3300005434 Ga0070709_11492181 Ga0070709_114921811 105
602 3300005435 Ga0070714_100017549 Ga0070714_1000175497 105
603 3300005435 Ga0070714_100034223 Ga0070714_1000342235 105
604 3300005435 Ga0070714_100155384 Ga0070714_1001553842 105
605 3300005435 Ga0070714_100171182 Ga0070714_1001711821 105
606 3300005435 Ga0070714_100419155 Ga0070714_1004191552 105
607 3300005436 Ga0070713_100014822 Ga0070713_1000148225 105
608 3300005436 Ga0070713_100021104 Ga0070713_1000211043 105
609 3300005436 Ga0070713_100046951 Ga0070713_1000469515 105
610 3300005436 Ga0070713_100129027 Ga0070713_1001290272 105
611 3300005436 Ga0070713_100392014 Ga0070713_1003920142 105
612 3300005436 Ga0070713_102188922 Ga0070713_1021889221 105
613 3300005437 Ga0070710_10001588 Ga0070710_1000158810 105
614 3300005437 Ga0070710_11098831 Ga0070710_110988311 105
615 3300005439 Ga0070711_100029901 Ga0070711_1000299014 105
616 3300005440 Ga0070705_100124093 Ga0070705_1001240932 105
617 3300005441 Ga0070700_100438581 Ga0070700_1004385812 105
618 3300005444 Ga0070694_100478387 Ga0070694_1004783872 105
619 3300005445 Ga0070708_100750531 Ga0070708_1007505312 105
620 3300005445 Ga0070708_101642482 Ga0070708_1016424821 105
621 3300005455 Ga0070663_100024885 Ga0070663_1000248855 105
622 3300005455 Ga0070663_101911027 Ga0070663_1019110272 105
623 3300005456 Ga0070678_100048909 Ga0070678_1000489094 105
624 3300005456 Ga0070678_101959539 Ga0070678_1019595391 105
625 3300005458 Ga0070681_10015902 Ga0070681_100159025 105
626 3300005458 Ga0070681_10230246 Ga0070681_102302462 105
627 3300005458 Ga0070681_10324367 Ga0070681_103243672 105
628 3300005458 Ga0070681_10740378 Ga0070681_107403782 105
629 3300005458 Ga0070681_11525941 Ga0070681_115259412 105
630 3300005458 Ga0070681_11816256 Ga0070681_118162561 105
631 3300005459 Ga0068867_100065904 Ga0068867_1000659042 105
632 3300005468 Ga0070707_100296316 Ga0070707_1002963162 105
633 3300005471 Ga0070698_101484497 Ga0070698_1014844972 105
634 3300005530 Ga0070679_100031149 Ga0070679_1000311494 105
635 3300005530 Ga0070679_100231443 Ga0070679_1002314433 105
636 3300005530 Ga0070679_100450048 Ga0070679_1004500482 105
637 3300005535 Ga0070684_100062718 Ga0070684_1000627182 105
638 3300005536 Ga0070697_100208545 Ga0070697_1002085452 105
639 3300005539 Ga0068853_100043068 Ga0068853_1000430685 105
640 3300005539 Ga0068853_100289257 Ga0068853_1002892573 105
641 3300005539 Ga0068853_100378153 Ga0068853_1003781532 105
642 3300005539 Ga0068853_101039989 Ga0068853_1010399891 105
643 3300005539 Ga0068853_101352192 Ga0068853_1013521921 105
644 3300005544 Ga0070686_100080748 Ga0070686_1000807483 105
645 3300005546 Ga0070696_100257156 Ga0070696_1002571562 105
646 3300005546 Ga0070696_101411030 Ga0070696_1014110301 105
647 3300005547 Ga0070693_100142645 Ga0070693_1001426452 105
648 3300005548 Ga0070665_100729487 Ga0070665_1007294872 105
649 3300005563 Ga0068855_100039857 Ga0068855_1000398572 105
650 3300005563 Ga0068855_100141643 Ga0068855_1001416433 105
651 3300005563 Ga0068855_100190258 Ga0068855_1001902582 105
652 3300005564 Ga0070664_100129858 Ga0070664_1001298581 105
653 3300005564 Ga0070664_101025562 Ga0070664_1010255622 105
654 3300005577 Ga0068857_100181544 Ga0068857_1001815443 105
655 3300005577 Ga0068857_100225376 Ga0068857_1002253763 105
656 3300005578 Ga0068854_100151642 Ga0068854_1001516423 105
657 3300005578 Ga0068854_101052506 Ga0068854_1010525062 105
658 3300005614 Ga0068856_100091527 Ga0068856_1000915275 105
659 3300005614 Ga0068856_100893116 Ga0068856_1008931162 105
660 3300005615 Ga0070702_100742084 Ga0070702_1007420842 105
661 3300005616 Ga0068852_100020318 Ga0068852_1000203186 105
662 3300005616 Ga0068852_100031309 Ga0068852_1000313095 105
663 3300005616 Ga0068852_100142510 Ga0068852_1001425102 105
664 3300005616 Ga0068852_100338197 Ga0068852_1003381972 105
665 3300005617 Ga0068859_100128271 Ga0068859_1001282712 105
666 3300005617 Ga0068859_102963760 Ga0068859_1029637602 105
667 3300005834 Ga0068851_10061528 Ga0068851_100615283 105
668 3300005834 Ga0068851_10505837 Ga0068851_105058372 105
669 3300005842 Ga0068858_100184258 Ga0068858_1001842583 105
670 3300005842 Ga0068858_100782344 Ga0068858_1007823442 105
671 3300005843 Ga0068860_100127254 Ga0068860_1001272542 105
672 3300005983 Ga0081540_1077673 Ga0081540_10776731 105
673 3300006028 Ga0070717_10010448 Ga0070717_100104488 105
674 3300006028 Ga0070717_10109442 Ga0070717_101094421 105
675 3300006028 Ga0070717_10577709 Ga0070717_105777092 105
676 3300006028 Ga0070717_11007961 Ga0070717_110079611 105
677 3300006028 Ga0070717_11513009 Ga0070717_115130092 105
678 3300006038 Ga0075365_10114936 Ga0075365_101149362 105
679 3300006048 Ga0075363_100139830 Ga0075363_1001398302 105
680 3300006058 Ga0075432_10004468 Ga0075432_100044684 105
681 3300006163 Ga0070715_10003071 Ga0070715_100030712 105
682 3300006163 Ga0070715_10191610 Ga0070715_101916103 105
683 3300006173 Ga0070716_100005922 Ga0070716_1000059228 105
684 3300006173 Ga0070716_100034560 Ga0070716_1000345603 105
685 3300006173 Ga0070716_100903109 Ga0070716_1009031092 105
686 3300006175 Ga0070712_100114950 Ga0070712_1001149503 105
687 3300006178 Ga0075367_10875532 Ga0075367_108755322 105
688 3300006194 Ga0075427_10010640 Ga0075427_100106402 105
689 3300006195 Ga0075366_10390284 Ga0075366_103902842 105
690 3300006237 Ga0097621_100028310 Ga0097621_1000283104 105
691 3300006237 Ga0097621_101255871 Ga0097621_1012558711 105
692 3300006353 Ga0075370_10248615 Ga0075370_102486152 105
693 3300006358 Ga0068871_100047227 Ga0068871_1000472273 105
694 3300006358 Ga0068871_100330825 Ga0068871_1003308252 105
695 3300006844 Ga0075428_100020744 Ga0075428_1000207447 105
696 3300006846 Ga0075430_100008477 Ga0075430_10000847710 105
697 3300006847 Ga0075431_100003601 Ga0075431_1000036017 105
698 3300006852 Ga0075433_10000743 Ga0075433_1000074312 105
699 3300006871 Ga0075434_100001145 Ga0075434_10000114517 105
700 3300006871 Ga0075434_100020153 Ga0075434_1000201539 105
701 3300006880 Ga0075429_100016228 Ga0075429_1000162287 105
702 3300006914 Ga0075436_100069415 Ga0075436_1000694152 105
703 3300006914 Ga0075436_100339456 Ga0075436_1003394562 105
704 3300006914 Ga0075436_100411915 Ga0075436_1004119152 105
705 3300006914 Ga0075436_100613272 Ga0075436_1006132722 105
706 3300006931 Ga0097620_100128270 Ga0097620_1001282702 105
707 3300006931 Ga0097620_102964498 Ga0097620_1029644981 105
708 3300007076 Ga0075435_100030190 Ga0075435_1000301905 105
709 3300007076 Ga0075435_100038780 Ga0075435_1000387802 105
710 3300007265 Ga0099794_10014612 Ga0099794_100146124 105
711 3300007788 Ga0099795_10003041 Ga0099795_100030415 105
712 3300009093 Ga0105240_10045935 Ga0105240_100459354 105
713 3300009093 Ga0105240_10390925 Ga0105240_103909252 105
714 3300009093 Ga0105240_10404850 Ga0105240_104048502 105
715 3300009093 Ga0105240_10504776 Ga0105240_105047762 105
716 3300009094 Ga0111539_10024580 Ga0111539_100245805 105
717 3300009098 Ga0105245_10060564 Ga0105245_100605642 105
718 3300009098 Ga0105245_11913863 Ga0105245_119138632 105
719 3300009101 Ga0105247_10005827 Ga0105247_100058276 105
720 3300009101 Ga0105247_10164750 Ga0105247_101647502 105
721 3300009101 Ga0105247_11146483 Ga0105247_111464831 105
722 3300009147 Ga0114129_10026808 Ga0114129_100268089 105
723 3300009147 Ga0114129_10034011 Ga0114129_100340117 105
724 3300009148 Ga0105243_10587340 Ga0105243_105873402 105
725 3300009148 Ga0105243_10667421 Ga0105243_106674212 105
726 3300009174 Ga0105241_10444102 Ga0105241_104441022 105
727 3300009174 Ga0105241_10577651 Ga0105241_105776512 105
728 3300009176 Ga0105242_10804104 Ga0105242_108041042 105
729 3300009176 Ga0105242_11761777 Ga0105242_117617771 105
730 3300009177 Ga0105248_10073696 Ga0105248_100736964 105
731 3300009177 Ga0105248_10635314 Ga0105248_106353142 105
732 3300009177 Ga0105248_11573406 Ga0105248_115734062 105
733 3300009177 Ga0105248_12829110 Ga0105248_128291102 105
734 3300009177 Ga0105248_12872476 Ga0105248_128724762 105
735 3300009545 Ga0105237_10170111 Ga0105237_101701112 105
736 3300009545 Ga0105237_10205222 Ga0105237_102052224 105
737 3300009545 Ga0105237_10243007 Ga0105237_102430072 105
738 3300009545 Ga0105237_11393345 Ga0105237_113933452 105
739 3300009545 Ga0105237_11867400 Ga0105237_118674002 105
740 3300009545 Ga0105237_12176289 Ga0105237_121762891 105
741 3300009551 Ga0105238_10063127 Ga0105238_100631272 105
742 3300009551 Ga0105238_10073250 Ga0105238_100732504 105
743 3300009551 Ga0105238_10189980 Ga0105238_101899804 105
744 3300009553 Ga0105249_10252033 Ga0105249_102520333 105
745 3300009553 Ga0105249_10473406 Ga0105249_104734063 105
746 3300009553 Ga0105249_11343906 Ga0105249_113439062 105
747 3300010159 Ga0099796_10009589 Ga0099796_100095893 105
748 3300010159 Ga0099796_10019349 Ga0099796_100193494 105
749 3300010159 Ga0099796_10050471 Ga0099796_100504714 105
750 3300010375 Ga0105239_10106838 Ga0105239_101068384 105
751 3300010375 Ga0105239_10204077 Ga0105239_102040772 105
752 3300010375 Ga0105239_10725123 Ga0105239_107251231 105
753 3300010375 Ga0105239_12128132 Ga0105239_121281322 105
754 3300010375 Ga0105239_12651262 Ga0105239_126512622 105
755 3300011119 Ga0105246_10054033 Ga0105246_100540332 105
756 3300013102 Ga0157371_10096507 Ga0157371_100965072 105
757 3300013102 Ga0157371_10533155 Ga0157371_105331552 105
758 3300013104 Ga0157370_10037503 Ga0157370_100375035 105
759 3300013104 Ga0157370_10332952 Ga0157370_103329522 105
760 3300013104 Ga0157370_10401465 Ga0157370_104014652 105
761 3300013104 Ga0157370_11528237 Ga0157370_115282372 105
762 3300013105 Ga0157369_10037064 Ga0157369_100370647 105
763 3300013105 Ga0157369_10144894 Ga0157369_101448943 105
764 3300013105 Ga0157369_10536814 Ga0157369_105368142 105
765 3300013105 Ga0157369_10693935 Ga0157369_106939352 105
766 3300013105 Ga0157369_11820725 Ga0157369_118207251 105
767 3300013296 Ga0157374_10253496 Ga0157374_102534963 105
768 3300013297 Ga0157378_10087971 Ga0157378_100879713 105
769 3300013297 Ga0157378_10203242 Ga0157378_102032423 105
770 3300013297 Ga0157378_12682436 Ga0157378_126824362 105
771 3300013306 Ga0163162_10213555 Ga0163162_102135553 105
772 3300013306 Ga0163162_10858045 Ga0163162_108580452 105
773 3300013307 Ga0157372_10106802 Ga0157372_101068022 105
774 3300013307 Ga0157372_11092402 Ga0157372_110924022 105
775 3300013307 Ga0157372_12176264 Ga0157372_121762642 105
776 3300013308 Ga0157375_10285482 Ga0157375_102854822 105
777 3300014745 Ga0157377_10788389 Ga0157377_107883892 105
778 3300014968 Ga0157379_10033296 Ga0157379_100332962 105
779 3300014968 Ga0157379_10327957 Ga0157379_103279572 105
780 3300014969 Ga0157376_10054066 Ga0157376_100540662 105
781 3300017792 Ga0163161_11047926 Ga0163161_110479262 105
782 3300020069 Ga0197907_10958444 Ga0197907_109584441 105
783 3300020069 Ga0197907_11466506 Ga0197907_114665062 105
784 3300020070 Ga0206356_10164986 Ga0206356_101649862 105
785 3300020070 Ga0206356_10832790 Ga0206356_108327903 105
786 3300020075 Ga0206349_1186427 Ga0206349_11864272 105
787 3300020075 Ga0206349_1667692 Ga0206349_16676921 105
788 3300020076 Ga0206355_1362714 Ga0206355_13627142 105
789 3300020076 Ga0206355_1385882 Ga0206355_13858822 105
790 3300020078 Ga0206352_10462767 Ga0206352_104627672 105
791 3300020080 Ga0206350_11584609 Ga0206350_115846093 105
792 3300020081 Ga0206354_10337846 Ga0206354_103378462 105
793 3300020082 Ga0206353_10975082 Ga0206353_109750822 105
794 3300021377 Ga0213874_10031557 Ga0213874_100315572 105
795 3300021384 Ga0213876_10528491 Ga0213876_105284911 105
796 3300022467 Ga0224712_10004292 Ga0224712_100042923 105
797 3300025321 Ga0207656_10041676 Ga0207656_100416762 105
798 3300025898 Ga0207692_10001008 Ga0207692_1000100811 105
799 3300025898 Ga0207692_10098340 Ga0207692_100983402 105
800 3300025898 Ga0207692_10305282 Ga0207692_103052822 105
801 3300025898 Ga0207692_10639432 Ga0207692_106394321 105
802 3300025898 Ga0207692_11179689 Ga0207692_111796892 105
803 3300025900 Ga0207710_10030588 Ga0207710_100305881 105
804 3300025900 Ga0207710_10078247 Ga0207710_100782472 105
805 3300025904 Ga0207647_10584018 Ga0207647_105840182 105
806 3300025905 Ga0207685_10109882 Ga0207685_101098821 105
807 3300025906 Ga0207699_10024073 Ga0207699_100240734 105
808 3300025906 Ga0207699_10024173 Ga0207699_100241736 105
809 3300025906 Ga0207699_10276229 Ga0207699_102762292 105
810 3300025906 Ga0207699_10850084 Ga0207699_108500842 105
811 3300025907 Ga0207645_10061031 Ga0207645_100610313 105
812 3300025909 Ga0207705_10025993 Ga0207705_100259933 105
813 3300025909 Ga0207705_10033440 Ga0207705_100334402 105
814 3300025909 Ga0207705_10119606 Ga0207705_101196062 105
815 3300025909 Ga0207705_10341824 Ga0207705_103418242 105
816 3300025909 Ga0207705_10380954 Ga0207705_103809542 105
817 3300025912 Ga0207707_10043460 Ga0207707_100434602 105
818 3300025912 Ga0207707_10086627 Ga0207707_100866273 105
819 3300025912 Ga0207707_10212129 Ga0207707_102121292 105
820 3300025912 Ga0207707_10256411 Ga0207707_102564113 105
821 3300025913 Ga0207695_10098615 Ga0207695_100986153 105
822 3300025913 Ga0207695_10310822 Ga0207695_103108222 105
823 3300025913 Ga0207695_10535762 Ga0207695_105357622 105
824 3300025913 Ga0207695_10659706 Ga0207695_106597062 105
825 3300025913 Ga0207695_11665894 Ga0207695_116658941 105
826 3300025914 Ga0207671_10244961 Ga0207671_102449612 105
827 3300025914 Ga0207671_10274913 Ga0207671_102749132 105
828 3300025914 Ga0207671_10572691 Ga0207671_105726911 105
829 3300025914 Ga0207671_10645544 Ga0207671_106455441 105
830 3300025915 Ga0207693_10007911 Ga0207693_100079112 105
831 3300025915 Ga0207693_10010781 Ga0207693_100107816 105
832 3300025915 Ga0207693_10040523 Ga0207693_100405235 105
833 3300025916 Ga0207663_10002092 Ga0207663_1000209210 105
834 3300025916 Ga0207663_10053354 Ga0207663_100533542 105
835 3300025917 Ga0207660_10004230 Ga0207660_100042304 105
836 3300025917 Ga0207660_10041741 Ga0207660_100417412 105
837 3300025917 Ga0207660_10323915 Ga0207660_103239152 105
838 3300025917 Ga0207660_10356446 Ga0207660_103564462 105
839 3300025917 Ga0207660_10534033 Ga0207660_105340332 105
840 3300025917 Ga0207660_11219157 Ga0207660_112191572 105
841 3300025919 Ga0207657_10011801 Ga0207657_1001180110 105
842 3300025919 Ga0207657_10034115 Ga0207657_100341153 105
843 3300025919 Ga0207657_10175605 Ga0207657_101756052 105
844 3300025919 Ga0207657_10246754 Ga0207657_102467542 105
845 3300025920 Ga0207649_10106212 Ga0207649_101062123 105
846 3300025920 Ga0207649_10251040 Ga0207649_102510402 105
847 3300025920 Ga0207649_10441884 Ga0207649_104418842 105
848 3300025920 Ga0207649_11564224 Ga0207649_115642242 105
849 3300025921 Ga0207652_10013063 Ga0207652_100130637 105
850 3300025921 Ga0207652_10147725 Ga0207652_101477252 105
851 3300025921 Ga0207652_10169575 Ga0207652_101695752 105
852 3300025921 Ga0207652_10464032 Ga0207652_104640321 105
853 3300025921 Ga0207652_10497990 Ga0207652_104979902 105
854 3300025924 Ga0207694_10117293 Ga0207694_101172933 105
855 3300025924 Ga0207694_10416070 Ga0207694_104160701 105
856 3300025925 Ga0207650_11240659 Ga0207650_112406592 105
857 3300025927 Ga0207687_10425221 Ga0207687_104252212 105
858 3300025927 Ga0207687_11692232 Ga0207687_116922322 105
859 3300025928 Ga0207700_10010097 Ga0207700_100100975 105
860 3300025928 Ga0207700_10040777 Ga0207700_100407773 105
861 3300025928 Ga0207700_10075769 Ga0207700_100757693 105
862 3300025928 Ga0207700_10244283 Ga0207700_102442831 105
863 3300025928 Ga0207700_10428303 Ga0207700_104283032 105
864 3300025928 Ga0207700_11140587 Ga0207700_111405872 105
865 3300025929 Ga0207664_10021619 Ga0207664_100216193 105
866 3300025929 Ga0207664_10087799 Ga0207664_100877992 105
867 3300025929 Ga0207664_10089899 Ga0207664_100898991 105
868 3300025929 Ga0207664_10240282 Ga0207664_102402823 105
869 3300025929 Ga0207664_10266271 Ga0207664_102662713 105
870 3300025929 Ga0207664_11569069 Ga0207664_115690692 105
871 3300025931 Ga0207644_10030007 Ga0207644_100300073 105
872 3300025932 Ga0207690_10104376 Ga0207690_101043763 105
873 3300025932 Ga0207690_10531641 Ga0207690_105316412 105
874 3300025933 Ga0207706_10042611 Ga0207706_100426113 105
875 3300025934 Ga0207686_10014926 Ga0207686_100149267 105
876 3300025935 Ga0207709_10157926 Ga0207709_101579262 105
877 3300025937 Ga0207669_10241887 Ga0207669_102418872 105
878 3300025938 Ga0207704_10132223 Ga0207704_101322233 105
879 3300025939 Ga0207665_10001678 Ga0207665_1000167812 105
880 3300025939 Ga0207665_10040327 Ga0207665_100403272 105
881 3300025939 Ga0207665_10058436 Ga0207665_100584361 105
882 3300025940 Ga0207691_10245407 Ga0207691_102454072 105
883 3300025941 Ga0207711_10196700 Ga0207711_101967003 105
884 3300025941 Ga0207711_10331608 Ga0207711_103316083 105
885 3300025942 Ga0207689_10454601 Ga0207689_104546012 105
886 3300025944 Ga0207661_10198214 Ga0207661_101982143 105
887 3300025945 Ga0207679_10312704 Ga0207679_103127043 105
888 3300025949 Ga0207667_10015870 Ga0207667_100158702 105
889 3300025949 Ga0207667_10024626 Ga0207667_1002462610 105
890 3300025949 Ga0207667_10152855 Ga0207667_101528552 105
891 3300025949 Ga0207667_10313716 Ga0207667_103137163 105
892 3300025949 Ga0207667_10440822 Ga0207667_104408222 105
893 3300025961 Ga0207712_10433400 Ga0207712_104334002 105
894 3300025981 Ga0207640_10067562 Ga0207640_100675624 105
895 3300025981 Ga0207640_10152482 Ga0207640_101524823 105
896 3300025986 Ga0207658_10314618 Ga0207658_103146182 105
897 3300026023 Ga0207677_10070132 Ga0207677_100701323 105
898 3300026035 Ga0207703_10120662 Ga0207703_101206622 105
899 3300026035 Ga0207703_10582716 Ga0207703_105827162 105
900 3300026035 Ga0207703_11356048 Ga0207703_113560482 105
901 3300026041 Ga0207639_10266000 Ga0207639_102660002 105
902 3300026041 Ga0207639_10465380 Ga0207639_104653802 105
903 3300026041 Ga0207639_11214097 Ga0207639_112140972 105
904 3300026067 Ga0207678_10002923 Ga0207678_1000292315 105
905 3300026067 Ga0207678_10017537 Ga0207678_100175376 105
906 3300026075 Ga0207708_10310779 Ga0207708_103107793 105
907 3300026078 Ga0207702_12384889 Ga0207702_123848891 105
908 3300026089 Ga0207648_10524434 Ga0207648_105244342 105
909 3300026116 Ga0207674_10194765 Ga0207674_101947653 105
910 3300026116 Ga0207674_10241295 Ga0207674_102412953 105
911 3300026121 Ga0207683_10012932 Ga0207683_100129328 105
912 3300026142 Ga0207698_10303920 Ga0207698_103039202 105
913 3300026142 Ga0207698_10766917 Ga0207698_107669172 105
914 3300026142 Ga0207698_11657264 Ga0207698_116572641 105
915 3300026142 Ga0207698_11796151 Ga0207698_117961511 105
916 3300027512 Ga0209179_1005876 Ga0209179_10058762 105
917 3300027671 Ga0209588_1041104 Ga0209588_10411042 105
918 3300027907 Ga0207428_10004326 Ga0207428_1000432612 105
919 3300028573 Ga0265334_10006108 Ga0265334_100061085 105
920 3300028800 Ga0265338_10023891 Ga0265338_100238913 105
921 3300030521 Ga0307511_10332597 Ga0307511_103325972 105
922 3300031235 Ga0265330_10014531 Ga0265330_100145312 105
923 3300031238 Ga0265332_10048807 Ga0265332_100488071 105
924 3300031238 Ga0265332_10122204 Ga0265332_101222042 105
925 3300031239 Ga0265328_10104527 Ga0265328_101045271 105
926 3300031241 Ga0265325_10038377 Ga0265325_100383774 105
927 3300031247 Ga0265340_10071225 Ga0265340_100712252 105
928 3300031247 Ga0265340_10102986 Ga0265340_101029862 105
929 3300031249 Ga0265339_10234116 Ga0265339_102341162 105
930 3300031250 Ga0265331_10104682 Ga0265331_101046822 105
931 3300031344 Ga0265316_10581806 Ga0265316_105818062 105
932 3300031507 Ga0307509_10005003 Ga0307509_100050034 105
933 3300031507 Ga0307509_10374871 Ga0307509_103748711 105
934 3300031507 Ga0307509_10633099 Ga0307509_106330991 105
935 3300031595 Ga0265313_10010775 Ga0265313_100107759 105
936 3300031712 Ga0265342_10001944 Ga0265342_1000194416 105
937 3300031730 Ga0307516_10220860 Ga0307516_102208601 105
938 3300033179 Ga0307507_10081029 Ga0307507_100810291 105
939 3300033180 Ga0307510_10080874 Ga0307510_100808743 105
940 3300033180 Ga0307510_10241634 Ga0307510_102416343 105
941 3300035083 Ga0373926_0190295 Ga0373926_0190295_223_540 105
942 3300035086 Ga0373934_0011292 Ga0373934_0011292_491_808 105
943 3300035089 Ga0373944_0064339 Ga0373944_0064339_318_635 105
944 3300035089 Ga0373944_0208175 Ga0373944_0208175_227_544 105
945 3300035090 Ga0373949_0040775 Ga0373949_0040775_785_1102 105
946 3300035111 Ga0373923_0062813 Ga0373923_0062813_153_470 105
947 3300035111 Ga0373923_0233778 Ga0373923_0233778_24_341 105
948 3300035111 Ga0373923_0420251 Ga0373923_0420251_119_436 105
949 3300035112 Ga0373932_0093635 Ga0373932_0093635_209_526 105
950 3300035113 Ga0373936_0020917 Ga0373936_0020917_1049_1366 105
951 3300035113 Ga0373936_0279144 Ga0373936_0279144_383_700 105
952 3300035116 Ga0373945_0040426 Ga0373945_0040426_1319_1636 105
953 3300035117 Ga0373953_0144421 Ga0373953_0144421_161_478 105
954 3300035117 Ga0373953_0416272 Ga0373953_0416272_109_426 105
955 3300035118 Ga0373954_0005696 Ga0373954_0005696_2803_3120 105
956 3300035118 Ga0373954_0091635 Ga0373954_0091635_784_1101 105
957 3300035118 Ga0373954_0193776 Ga0373954_0193776_476_793 105
958 3300035119 Ga0373956_0131645 Ga0373956_0131645_108_425 105
959 3300035120 Ga0373957_0001391 Ga0373957_0001391_1660_1977 105
960 3300035120 Ga0373957_0018656 Ga0373957_0018656_263_580 105
961 3300035121 Ga0373960_0191648 Ga0373960_0191648_266_583 105
962 3300035170 Ga0373943_0007179 Ga0373943_0007179_2626_2943 105
963 3300035170 Ga0373943_0194196 Ga0373943_0194196_378_695 105
964 3300035171 Ga0373946_0014352 Ga0373946_0014352_1389_1706 105
965 3300035171 Ga0373946_0045813 Ga0373946_0045813_938_1255 105
966 3300035171 Ga0373946_0076222 Ga0373946_0076222_293_610 105
967 3300035172 Ga0373955_0022095 Ga0373955_0022095_691_1023 105
968 3300035172 Ga0373955_0205042 Ga0373955_0205042_487_804 105
969 3300035172 Ga0373955_0944938 Ga0373955_0944938_197_517 105
970 3300035172 Ga0373955_1015698 Ga0373955_1015698_53_370 105
971 3300035242 Ga0373962_0160264 Ga0373962_0160264_399_716 105
972 3300035410 Ga0373924_0036763 Ga0373924_0036763_758_1075 105
973 3300035410 Ga0373924_0349197 Ga0373924_0349197_103_420 105
974 3300035691 Ga0373931_0379611 Ga0373931_0379611_100_423 105
975 3300035691 Ga0373931_0453470 Ga0373931_0453470_277_594 105
976 3300035692 Ga0373935_0015705 Ga0373935_0015705_656_973 105
977 3300035692 Ga0373935_0157342 Ga0373935_0157342_204_521 105
978 3300035692 Ga0373935_0189906 Ga0373935_0189906_1057_1374 105
979 3300035692 Ga0373935_0302721 Ga0373935_0302721_41_358 105
980 3300035692 Ga0373935_0443982 Ga0373935_0443982_20_337 105
981 3300035695 Ga0373927_0002813 Ga0373927_0002813_3651_3968 105
982 3300035695 Ga0373927_0007182 Ga0373927_0007182_4587_4904 105
983 3300035695 Ga0373927_0012358 Ga0373927_0012358_4173_4490 105
984 3300035695 Ga0373927_0025771 Ga0373927_0025771_3170_3487 105
985 3300035695 Ga0373927_0261770 Ga0373927_0261770_574_891 105
986 3300035724 Ga0373933_0062945 Ga0373933_0062945_130_447 105
987 3300035724 Ga0373933_0264379 Ga0373933_0264379_442_798 105
988 3300035725 Ga0373947_0000441 Ga0373947_0000441_4490_4807 105
989 3300035725 Ga0373947_0020629 Ga0373947_0020629_232_549 105
990 3300035725 Ga0373947_0135053 Ga0373947_0135053_1041_1358 105
991 3300035725 Ga0373947_0447616 Ga0373947_0447616_311_628 105
992 3300035725 Ga0373947_0632229 Ga0373947_0632229_358_675 105
993 3300035725 Ga0373947_0745813 Ga0373947_0745813_340_657 105
994 3300036401 Ga0373937_0011747 Ga0373937_0011747_5535_5852 105
995 3300036401 Ga0373937_0049701 Ga0373937_0049701_2576_2893 105
996 3300036401 Ga0373937_0348558 Ga0373937_0348558_1054_1371 105
997 3300036401 Ga0373937_0657914 Ga0373937_0657914_174_491 105
998 3300037068 Ga0373925_0005350 Ga0373925_0005350_7901_8218 105
999 3300037068 Ga0373925_0064209 Ga0373925_0064209_2245_2562 105
1000 3300037068 Ga0373925_0200783 Ga0373925_0200783_230_547 105
1001 3300037068 Ga0373925_0234168 Ga0373925_0234168_960_1277 105
1002 3300037068 Ga0373925_0519647 Ga0373925_0519647_59_376 105
1003 3300037068 Ga0373925_0709463 Ga0373925_0709463_398_715 105
1004 3300037068 Ga0373925_1302716 Ga0373925_1302716_93_410 105
1005 3300037312 Ga0395899_0132099 Ga0395899_0132099_212_535 105
1006 3300037418 Ga0395900_0786756 Ga0395900_0786756_231_554 105
1007 3300037466 Ga0395898_0059775 Ga0395898_0059775_233_556 105
1008 3300037466 Ga0395898_1797011 Ga0395898_1797011_48_365 105
1009 3300037471 Ga0395905_0875396 Ga0395905_0875396_293_610 105
1010 3300038443 Ga0395901_0182081 Ga0395901_0182081_530_853 105
1011 3300039437 Ga0436365_0665617 Ga0436365_0665617_651_968 105
1012 3300039450 Ga0436363_1497734 Ga0436363_1497734_960_1280 105
1013 3300041452 Ga0451793_0896835 Ga0451793_0896835_85_402 105
1014 3300041496 Ga0451839_0733614 Ga0451839_0733614_246_563 105
1015 3300041498 Ga0451841_0398551 Ga0451841_0398551_111_428 105
1016 3300041512 Ga0451853_0940955 Ga0451853_0940955_257_574 105
1017 3300044684 Ga0466966_0019601 Ga0466966_0019601_686_1003 105
1018 3300044684 Ga0466966_0200430 Ga0466966_0200430_406_726 105
1019 3300044684 Ga0466966_0686505 Ga0466966_0686505_71_388 105
1020 3300044694 Ga0466963_0468649 Ga0466963_0468649_245_562 105
1021 3300045049 Ga0466959_0246554 Ga0466959_0246554_780_1100 105
1022 3300045049 Ga0466959_0938756 Ga0466959_0938756_124_441 105
1023 3300045836 Ga0466958_0449999 Ga0466958_0449999_401_721 105
1024 3300045976 Ga0466967_0938216 Ga0466967_0938216_375_692 105
1025 3300046454 Ga0495592_0038972 Ga0495592_0038972_1918_2235 105
1026 3300046454 Ga0495592_0047517 Ga0495592_0047517_2666_2983 105
1027 3300046454 Ga0495592_0175126 Ga0495592_0175126_889_1206 105
1028 3300046454 Ga0495592_0583941 Ga0495592_0583941_176_493 105
1029 3300046455 Ga0495603_0000066 Ga0495603_0000066_27303_27620 105
1030 3300046455 Ga0495603_0017017 Ga0495603_0017017_2695_3012 105
1031 3300046455 Ga0495603_0040267 Ga0495603_0040267_341_658 105
1032 3300046455 Ga0495603_0065087 Ga0495603_0065087_1248_1565 105
1033 3300046459 Ga0495629_0000984 Ga0495629_0000984_21484_21801 105
1034 3300046459 Ga0495629_0063174 Ga0495629_0063174_778_1095 105
1035 3300046459 Ga0495629_0197668 Ga0495629_0197668_134_451 105
1036 3300046459 Ga0495629_0754476 Ga0495629_0754476_285_602 105
1037 3300046461 Ga0495641_0004776 Ga0495641_0004776_6747_7064 105
1038 3300046461 Ga0495641_0050560 Ga0495641_0050560_1016_1333 105
1039 3300046462 Ga0495651_0011447 Ga0495651_0011447_5678_5995 105
1040 3300046462 Ga0495651_0600284 Ga0495651_0600284_108_425 105
1041 3300046463 Ga0495653_0105594 Ga0495653_0105594_277_594 105
1042 3300046463 Ga0495653_0269426 Ga0495653_0269426_422_739 105
1043 3300046463 Ga0495653_0474347 Ga0495653_0474347_326_643 105
1044 3300046472 Ga0495580_0001382 Ga0495580_0001382_15844_16161 105
1045 3300046473 Ga0495582_0000298 Ga0495582_0000298_7813_8130 105
1046 3300046473 Ga0495582_0107351 Ga0495582_0107351_1058_1375 105
1047 3300046475 Ga0495639_0010975 Ga0495639_0010975_2499_2816 105
1048 3300046475 Ga0495639_0098650 Ga0495639_0098650_224_541 105
1049 3300046475 Ga0495639_0151332 Ga0495639_0151332_506_823 105
1050 3300046475 Ga0495639_0394058 Ga0495639_0394058_349_666 105
1051 3300046476 Ga0495662_0000058 Ga0495662_0000058_13715_14032 105
1052 3300046477 Ga0495664_0013688 Ga0495664_0013688_2588_2905 105
1053 3300046477 Ga0495664_0062834 Ga0495664_0062834_335_652 105
1054 3300046477 Ga0495664_0120544 Ga0495664_0120544_972_1289 105
1055 3300046477 Ga0495664_0181236 Ga0495664_0181236_64_381 105
1056 3300046477 Ga0495664_0290156 Ga0495664_0290156_198_515 105
1057 3300046499 Ga0495594_0000706 Ga0495594_0000706_5750_6067 105
1058 3300046499 Ga0495594_0217109 Ga0495594_0217109_533_850 105
1059 3300046511 Ga0495608_0004308 Ga0495608_0004308_5124_5441 105
1060 3300046511 Ga0495608_0534556 Ga0495608_0534556_238_555 105
1061 3300046514 Ga0495618_0086241 Ga0495618_0086241_999_1316 105
1062 3300046516 Ga0495628_0033779 Ga0495628_0033779_2539_2856 105
1063 3300046516 Ga0495628_0105729 Ga0495628_0105729_1603_1920 105
1064 3300046516 Ga0495628_1254484 Ga0495628_1254484_124_441 105
1065 3300046517 Ga0495630_0001425 Ga0495630_0001425_11616_11933 105
1066 3300046517 Ga0495630_0186544 Ga0495630_0186544_1009_1326 105
1067 3300046517 Ga0495630_0479669 Ga0495630_0479669_507_824 105
1068 3300046517 Ga0495630_0554486 Ga0495630_0554486_267_584 105
1069 3300046517 Ga0495630_0804036 Ga0495630_0804036_229_546 105
1070 3300046529 Ga0495652_0047392 Ga0495652_0047392_940_1257 105
1071 3300046529 Ga0495652_0067576 Ga0495652_0067576_162_479 105
1072 3300046529 Ga0495652_0094063 Ga0495652_0094063_1745_2062 105
1073 3300046529 Ga0495652_0123399 Ga0495652_0123399_241_558 105
1074 3300046529 Ga0495652_0365283 Ga0495652_0365283_316_633 105
1075 3300046531 Ga0495665_0000373 Ga0495665_0000373_9581_9898 105
1076 3300046531 Ga0495665_0259984 Ga0495665_0259984_348_665 105
1077 3300046533 Ga0495640_0022168 Ga0495640_0022168_1513_1830 105
1078 3300046533 Ga0495640_0045438 Ga0495640_0045438_2538_2855 105
1079 3300046533 Ga0495640_0087228 Ga0495640_0087228_965_1282 105
1080 3300046535 Ga0495586_0045341 Ga0495586_0045341_1227_1544 105
1081 3300046536 Ga0495587_0006700 Ga0495587_0006700_4708_5025 105
1082 3300046536 Ga0495587_0090468 Ga0495587_0090468_61_378 105
1083 3300046536 Ga0495587_0225075 Ga0495587_0225075_236_553 105
1084 3300046536 Ga0495587_0461645 Ga0495587_0461645_230_547 105
1085 3300046543 Ga0495645_0006904 Ga0495645_0006904_5368_5685 105
1086 3300046543 Ga0495645_0098691 Ga0495645_0098691_1600_1917 105
1087 3300046543 Ga0495645_0768853 Ga0495645_0768853_218_535 105
1088 3300046557 Ga0495622_0007642 Ga0495622_0007642_253_570 105
1089 3300046557 Ga0495622_0038008 Ga0495622_0038008_1488_1805 105
1090 3300046559 Ga0495667_0004119 Ga0495667_0004119_4523_4840 105
1091 3300046559 Ga0495667_0020636 Ga0495667_0020636_1772_2089 105
1092 3300046559 Ga0495667_0309936 Ga0495667_0309936_380_697 105
1093 3300046642 Ga0495634_0000502 Ga0495634_0000502_8792_9109 105
1094 3300046642 Ga0495634_0333928 Ga0495634_0333928_371_688 105
1095 3300046663 Ga0495635_0102903 Ga0495635_0102903_35_352 105
1096 3300046663 Ga0495635_0226154 Ga0495635_0226154_778_1095 105
1097 3300046663 Ga0495635_0231754 Ga0495635_0231754_441_758 105
1098 3300046663 Ga0495635_0257524 Ga0495635_0257524_287_604 105
1099 3300046663 Ga0495635_0905329 Ga0495635_0905329_150_467 105
1100 3300046674 Ga0495588_0033151 Ga0495588_0033151_950_1267 105
1101 3300046675 Ga0495657_0014712 Ga0495657_0014712_1182_1499 105
1102 3300046675 Ga0495657_0043085 Ga0495657_0043085_2298_2615 105
1103 3300046675 Ga0495657_0049829 Ga0495657_0049829_1285_1602 105
1104 3300046678 Ga0495599_0007174 Ga0495599_0007174_4193_4510 105
1105 3300046678 Ga0495599_0056898 Ga0495599_0056898_1266_1583 105
1106 3300046678 Ga0495599_0406293 Ga0495599_0406293_408_725 105
1107 3300046679 Ga0495623_0000561 Ga0495623_0000561_4577_4894 105
1108 3300046679 Ga0495623_0148515 Ga0495623_0148515_74_391 105
1109 3300046680 Ga0495646_0022284 Ga0495646_0022284_1053_1370 105
1110 3300046681 Ga0495647_0003354 Ga0495647_0003354_1308_1625 105
1111 3300046681 Ga0495647_0021361 Ga0495647_0021361_1308_1625 105
1112 3300046683 Ga0495658_0000368 Ga0495658_0000368_13895_14212 105
1113 3300046684 Ga0495669_0296086 Ga0495669_0296086_411_728 105
1114 3300046689 Ga0495613_0014196 Ga0495613_0014196_1334_1651 105
1115 3300046690 Ga0495624_0008081 Ga0495624_0008081_1701_2018 105
1116 3300046690 Ga0495624_0120727 Ga0495624_0120727_978_1295 105
1117 3300046690 Ga0495624_0205948 Ga0495624_0205948_518_835 105
1118 3300046690 Ga0495624_0778508 Ga0495624_0778508_42_359 105
1119 3300046809 Ga0495600_0011917 Ga0495600_0011917_4464_4781 105
1120 3300046809 Ga0495600_0076875 Ga0495600_0076875_1437_1754 105
1121 3300046809 Ga0495600_0271510 Ga0495600_0271510_635_952 105
1122 3300046809 Ga0495600_0745144 Ga0495600_0745144_140_457 105
1123 3300047315 Ga0495581_0000111 Ga0495581_0000111_26380_26697 105
1124 3300047315 Ga0495581_0073591 Ga0495581_0073591_1477_1794 105
1125 3300047315 Ga0495581_0595895 Ga0495581_0595895_159_476 105
1126 3300047315 Ga0495581_0712442 Ga0495581_0712442_20_337 105
1127 3300047317 Ga0495604_0010885 Ga0495604_0010885_1443_1760 105
1128 3300047317 Ga0495604_0045227 Ga0495604_0045227_1006_1323 105
1129 3300047317 Ga0495604_0380282 Ga0495604_0380282_362_679 105
1130 3300047319 Ga0495674_0004341 Ga0495674_0004341_8709_9026 105
1131 3300047319 Ga0495674_0077544 Ga0495674_0077544_1356_1673 105
1132 3300047319 Ga0495674_0136513 Ga0495674_0136513_840_1157 105
1133 3300047319 Ga0495674_0170662 Ga0495674_0170662_19_336 105
1134 3300047321 Ga0495676_0079737 Ga0495676_0079737_970_1287 105
1135 3300047321 Ga0495676_0200832 Ga0495676_0200832_934_1251 105
1136 3300047322 Ga0495680_0052359 Ga0495680_0052359_1040_1357 105
1137 3300047322 Ga0495680_0071985 Ga0495680_0071985_2086_2403 105
1138 3300047322 Ga0495680_0086764 Ga0495680_0086764_862_1179 105
1139 3300047322 Ga0495680_0414303 Ga0495680_0414303_127_444 105
1140 3300047322 Ga0495680_0672535 Ga0495680_0672535_230_547 105
1141 3300047444 Ga0495675_0004565 Ga0495675_0004565_2931_3248 105
1142 3300047444 Ga0495675_0050347 Ga0495675_0050347_1615_1932 105
1143 3300047444 Ga0495675_0152464 Ga0495675_0152464_129_446 105
1144 3300047444 Ga0495675_0720311 Ga0495675_0720311_65_382 105
1145 3300047471 Ga0495684_0106142 Ga0495684_0106142_572_889 105
1146 3300047673 Ga0495593_0000210 Ga0495593_0000210_12661_12978 105
1147 3300047673 Ga0495593_0052747 Ga0495593_0052747_1444_1761 105
1148 3300047673 Ga0495593_0077811 Ga0495593_0077811_587_904 105
1149 3300048088 Ga0495602_0025952 Ga0495602_0025952_290_607 105
1150 3300048088 Ga0495602_0085736 Ga0495602_0085736_842_1159 105
1151 3300048088 Ga0495602_0191464 Ga0495602_0191464_106_423 105
1152 3300048088 Ga0495602_0227235 Ga0495602_0227235_50_367 105
1153 3300048089 Ga0495614_0042446 Ga0495614_0042446_1589_1906 105
1154 3300048903 Ga0496100_0013868 Ga0496100_0013868_862_1179 105
1155 3300048904 Ga0496101_0010824 Ga0496101_0010824_4619_4936 105
1156 3300048905 Ga0496102_0053738 Ga0496102_0053738_1300_1617 105
1157 3300048906 Ga0496103_0027030 Ga0496103_0027030_2855_3172 105
1158 3300048906 Ga0496103_0908707 Ga0496103_0908707_13_330 105
1159 3300048907 Ga0496104_0054677 Ga0496104_0054677_2899_3216 105
1160 3300048907 Ga0496104_0258891 Ga0496104_0258891_716_1033 105
1161 3300048907 Ga0496104_1490563 Ga0496104_1490563_147_464 105
1162 3300048908 Ga0496105_0014761 Ga0496105_0014761_5224_5541 105
1163 3300048908 Ga0496105_0149675 Ga0496105_0149675_382_699 105
1164 3300048909 Ga0496106_0018269 Ga0496106_0018269_2290_2607 105
1165 3300048909 Ga0496106_0187436 Ga0496106_0187436_682_999 105
1166 3300048910 Ga0496107_0027280 Ga0496107_0027280_2008_2325 105
1167 3300048911 Ga0496108_0131555 Ga0496108_0131555_1463_1780 105
1168 3300048911 Ga0496108_0170603 Ga0496108_0170603_592_909 105
1169 3300048911 Ga0496108_0617765 Ga0496108_0617765_537_854 105
1170 3300048912 Ga0496109_0041987 Ga0496109_0041987_754_1071 105
1171 3300048912 Ga0496109_0313116 Ga0496109_0313116_290_607 105
1172 3300048912 Ga0496109_0529823 Ga0496109_0529823_609_926 105
1173 3300048912 Ga0496109_1086961 Ga0496109_1086961_59_376 105
1174 3300048913 Ga0496110_0271367 Ga0496110_0271367_83_400 105
1175 3300048913 Ga0496110_0589019 Ga0496110_0589019_613_930 105
1176 3300048914 Ga0496111_0398433 Ga0496111_0398433_284_601 105
1177 3300048914 Ga0496111_0966625 Ga0496111_0966625_161_478 105
1178 3300048915 Ga0496112_0000019 Ga0496112_0000019_18312_18629 105
1179 3300048915 Ga0496112_0035449 Ga0496112_0035449_2374_2691 105
1180 3300048915 Ga0496112_0425994 Ga0496112_0425994_910_1227 105
1181 3300048915 Ga0496112_1138301 Ga0496112_1138301_67_384 105
1182 3300048916 Ga0496113_0082214 Ga0496113_0082214_1374_1691 105
1183 3300048916 Ga0496113_0134271 Ga0496113_0134271_1532_1849 105
1184 3300048916 Ga0496113_0288685 Ga0496113_0288685_39_356 105
1185 3300048917 Ga0496114_0029656 Ga0496114_0029656_1958_2275 105
1186 3300048917 Ga0496114_0276241 Ga0496114_0276241_790_1110 105
1187 3300048918 Ga0496115_0041613 Ga0496115_0041613_802_1119 105
1188 3300048918 Ga0496115_0059325 Ga0496115_0059325_131_454 105
1189 3300048918 Ga0496115_0108131 Ga0496115_0108131_1509_1826 105
1190 3300048918 Ga0496115_0190903 Ga0496115_0190903_1100_1417 105
1191 3300048918 Ga0496115_0340906 Ga0496115_0340906_623_940 105
1192 3300048918 Ga0496115_0902836 Ga0496115_0902836_198_515 105
1193 3300048919 Ga0496116_0441923 Ga0496116_0441923_89_406 105
1194 3300048920 Ga0496117_0179356 Ga0496117_0179356_175_492 105
1195 3300048921 Ga0496118_0001892 Ga0496118_0001892_15285_15602 105
1196 3300048921 Ga0496118_0142679 Ga0496118_0142679_1131_1448 105
1197 3300048924 Ga0496121_0000041 Ga0496121_0000041_230131_230448 105
1198 3300048924 Ga0496121_0105901 Ga0496121_0105901_280_597 105
1199 3300048927 Ga0496124_0183059 Ga0496124_0183059_901_1218 105
1200 3300048928 Ga0496125_0290992 Ga0496125_0290992_557_874 105
1201 3300048928 Ga0496125_0352506 Ga0496125_0352506_483_800 105
1202 3300048928 Ga0496125_0588439 Ga0496125_0588439_165_482 105
1203 3300048929 Ga0496126_0002010 Ga0496126_0002010_12227_12544 105
1204 3300048929 Ga0496126_0010298 Ga0496126_0010298_6010_6327 105
1205 3300048929 Ga0496126_0113225 Ga0496126_0113225_1661_1978 105
1206 3300048929 Ga0496126_0182765 Ga0496126_0182765_134_454 105
1207 3300049569 Ga0501032_0118250 Ga0501032_0118250_818_1159 105
1208 3300049569 Ga0501032_0236688 Ga0501032_0236688_276_617 105
1209 3300049570 Ga0501033_0048837 Ga0501033_0048837_2678_3019 105
1210 3300049571 Ga0501034_0046005 Ga0501034_0046005_744_1085 105
1211 3300049571 Ga0501034_0258566 Ga0501034_0258566_1097_1438 105
1212 3300049572 Ga0501036_0334170 Ga0501036_0334170_227_568 105
1213 3300049572 Ga0501036_0878718 Ga0501036_0878718_307_648 105
1214 3300049573 Ga0501037_0118942 Ga0501037_0118942_1105_1446 105
1215 3300049573 Ga0501037_0247711 Ga0501037_0247711_173_514 105
1216 3300049574 Ga0501038_0121563 Ga0501038_0121563_906_1247 105
1217 3300049575 Ga0501039_0179014 Ga0501039_0179014_1105_1446 105
1218 3300049575 Ga0501039_1154861 Ga0501039_1154861_187_528 105
1219 3300049576 Ga0501040_0137307 Ga0501040_0137307_272_613 105
1220 3300049577 Ga0501041_0095285 Ga0501041_0095285_546_887 105
1221 3300049578 Ga0501042_0020819 Ga0501042_0020819_1722_2063 105
1222 3300049578 Ga0501042_0974046 Ga0501042_0974046_128_469 105
1223 3300049579 Ga0501043_0018279 Ga0501043_0018279_196_537 105
1224 3300049579 Ga0501043_0107633 Ga0501043_0107633_1105_1446 105
1225 3300049581 Ga0501047_0238990 Ga0501047_0238990_222_563 105
1226 3300049581 Ga0501047_0533656 Ga0501047_0533656_58_378 105
1227 3300049582 Ga0501048_0075385 Ga0501048_0075385_671_1012 105
1228 3300049583 Ga0501067_0010940 Ga0501067_0010940_1657_1998 105
1229 3300049584 Ga0501068_0088800 Ga0501068_0088800_878_1219 105
1230 3300049584 Ga0501068_0597721 Ga0501068_0597721_94_435 105
1231 3300049586 Ga0501070_0031148 Ga0501070_0031148_4106_4423 105
1232 3300049586 Ga0501070_0114633 Ga0501070_0114633_1007_1348 105
1233 3300049587 Ga0501071_0420739 Ga0501071_0420739_536_853 105
1234 3300049588 Ga0501072_0484753 Ga0501072_0484753_32_373 105
1235 3300049589 Ga0501073_0336774 Ga0501073_0336774_131_472 105
1236 3300049590 Ga0501074_0117282 Ga0501074_0117282_222_563 105
1237 3300049593 Ga0501077_0199337 Ga0501077_0199337_172_513 105
1238 3300049741 Ga0501079_0384411 Ga0501079_0384411_637_978 105
1239 3300049742 Ga0501080_0065291 Ga0501080_0065291_778_1119 105
1240 3300049742 Ga0501080_0122948 Ga0501080_0122948_1820_2146 105
1241 3300049742 Ga0501080_0654349 Ga0501080_0654349_479_802 105
1242 3300049744 Ga0501083_0258729 Ga0501083_0258729_222_563 105
1243 3300049744 Ga0501083_0747523 Ga0501083_0747523_175_498 105
1244 3300049822 Ga0501035_0107312 Ga0501035_0107312_405_731 105
1245 3300049822 Ga0501035_0110370 Ga0501035_0110370_253_594 105
1246 3300049822 Ga0501035_1381363 Ga0501035_1381363_85_402 105
1247 3300049823 Ga0501044_0053440 Ga0501044_0053440_1338_1679 105
1248 3300049823 Ga0501044_0075576 Ga0501044_0075576_14_343 105
1249 3300049823 Ga0501044_0138041 Ga0501044_0138041_180_497 105
1250 3300049823 Ga0501044_0229484 Ga0501044_0229484_879_1220 105
1251 3300049823 Ga0501044_1179208 Ga0501044_1179208_62_379 105
1252 3300049824 Ga0501045_0134196 Ga0501045_0134196_930_1271 105
1253 3300050492 nmdc:mga0yw44_234003_c1 nmdc:mga0yw44_234003_c1_822_1139 105
1254 3300050496 nmdc:mga07m45_609043_c1 nmdc:mga07m45_609043_c1_129_446 105
1255 3300050507 nmdc:mga05p37_11710_c1 nmdc:mga05p37_11710_c1_4869_5234 105
1256 3300050507 nmdc:mga05p37_7187_c1 nmdc:mga05p37_7187_c1_9183_9500 105
1257 3300050508 nmdc:mga09592_6809_c1 nmdc:mga09592_6809_c1_5351_5668 105
1258 3300050509 nmdc:mga0qj67_11019_c1 nmdc:mga0qj67_11019_c1_3392_3709 105
1259 3300050510 nmdc:mga06r32_6474_c1 nmdc:mga06r32_6474_c1_3634_3951 105
1260 3300050511 nmdc:mga08y16_2995_c1 nmdc:mga08y16_2995_c1_13358_13675 105
1261 3300050512 nmdc:mga0n895_168789_c1 nmdc:mga0n895_168789_c1_1469_1786 105
1262 3300050512 nmdc:mga0n895_6162_c1 nmdc:mga0n895_6162_c1_4626_4982 105
1263 3300050512 nmdc:mga0n895_705_c1 nmdc:mga0n895_705_c1_9818_10135 105
1264 3300050513 nmdc:mga0rr50_1747_c1 nmdc:mga0rr50_1747_c1_5980_6297 105
1265 3300050513 nmdc:mga0rr50_31699_c1 nmdc:mga0rr50_31699_c1_949_1266 105
1266 3300050514 nmdc:mga08x19_159734_c1 nmdc:mga08x19_159734_c1_152_475 105
1267 3300050514 nmdc:mga08x19_601014_c1 nmdc:mga08x19_601014_c1_245_562 105
1268 3300050514 nmdc:mga08x19_61472_c1 nmdc:mga08x19_61472_c1_136_453 105
1269 3300050515 nmdc:mga0a205_7362_c1 nmdc:mga0a205_7362_c1_469_786 105
1270 3300053077 Ga0495601_0005470 Ga0495601_0005470_3114_3431 105
1271 3300053077 Ga0495601_0009462 Ga0495601_0009462_2518_2835 105
1272 3300053077 Ga0495601_0044953 Ga0495601_0044953_644_961 105
1273 3300053077 Ga0495601_0095397 Ga0495601_0095397_256_573 105
1274 3300053078 Ga0495612_0174893 Ga0495612_0174893_236_553 105
1275 3300053078 Ga0495612_0229939 Ga0495612_0229939_487_804 105
1276 3300053080 Ga0500635_0006552 Ga0500635_0006552_2743_3060 105
1277 3300053080 Ga0500635_0011829 Ga0500635_0011829_1964_2281 105
1278 3300053083 Ga0495655_0087546 Ga0495655_0087546_477_794 105
1279 3300053084 Ga0495595_0039038 Ga0495595_0039038_209_526 105
1280 3300053084 Ga0495595_0357574 Ga0495595_0357574_291_608 105
1281 3300053084 Ga0495595_0551109 Ga0495595_0551109_70_387 105
1282 3300053085 Ga0495619_0007969 Ga0495619_0007969_6039_6356 105
1283 3300053085 Ga0495619_0191657 Ga0495619_0191657_460_777 105
1284 3300053085 Ga0495619_0218526 Ga0495619_0218526_473_790 105
1285 3300053085 Ga0495619_1145041 Ga0495619_1145041_70_387 105
1286 3300053091 Ga0500647_0118789 Ga0500647_0118789_847_1164 105
1287 3300053093 Ga0500651_0365221 Ga0500651_0365221_92_409 105
1288 3300053094 Ga0500566_0127826 Ga0500566_0127826_70_387 105
1289 3300053097 Ga0500648_089452 Ga0500648_089452_1379_1696 105
1290 3300053102 Ga0500554_002996 Ga0500554_002996_2083_2400 105
1291 3300053119 Ga0500595_024231 Ga0500595_024231_340_657 105
1292 3300053119 Ga0500595_178266 Ga0500595_178266_34_351 105
1293 3300053136 Ga0500559_0280622 Ga0500559_0280622_131_448 105
1294 3300053140 Ga0500573_0119855 Ga0500573_0119855_848_1165 105
1295 3300053148 Ga0500590_106387 Ga0500590_106387_846_1163 105
1296 3300053150 Ga0500603_000727 Ga0500603_000727_2310_2627 105
1297 3300053150 Ga0500603_037659 Ga0500603_037659_360_677 105
1298 3300053163 Ga0500639_031991 Ga0500639_031991_466_783 105
1299 3300053177 Ga0500636_0005004 Ga0500636_0005004_396_713 105
1300 3300053177 Ga0500636_0083515 Ga0500636_0083515_734_1051 105
1301 3300053177 Ga0500636_0125961 Ga0500636_0125961_805_1122 105
1302 3300053177 Ga0500636_0198948 Ga0500636_0198948_481_798 105
1303 3300053178 Ga0500637_0009481 Ga0500637_0009481_2005_2322 105
1304 3300053178 Ga0500637_0095999 Ga0500637_0095999_1180_1497 105
1305 3300053728 Ga0500657_183780 Ga0500657_183780_186_503 105
1306 3300053735 Ga0500596_000832 Ga0500596_000832_5710_6027 105
1307 3300060353 Ga0501082_0098833 Ga0501082_0098833_2109_2450 105
1308 3300060353 Ga0501082_0142522 Ga0501082_0142522_446_769 105
1309 3300060353 Ga0501082_0788722 Ga0501082_0788722_187_504 105
1310 iso_pu_bacteria 2941531003 2941531579 105
1311 3300000549 LJQas_1005980 LJQas_10059803 106
1312 3300001990 JGI24737J22298_10096233 JGI24737J22298_100962332 106
1313 3300001991 JGI24743J22301_10028486 JGI24743J22301_100284862 106
1314 3300003323 rootH1_10030930 rootH1_100309306 106
1315 3300003354 JGI25160J50197_1000862 JGI25160J50197_10008628 106
1316 3300005262 Ga0065165_1053237 Ga0065165_10532372 106
1317 3300005262 Ga0065165_1062294 Ga0065165_10622941 106
1318 3300005329 Ga0070683_100051065 Ga0070683_1000510654 106
1319 3300005330 Ga0070690_100413458 Ga0070690_1004134581 106
1320 3300005334 Ga0068869_101708455 Ga0068869_1017084552 106
1321 3300005335 Ga0070666_10455691 Ga0070666_104556912 106
1322 3300005335 Ga0070666_10457473 Ga0070666_104574732 106
1323 3300005336 Ga0070680_100018049 Ga0070680_1000180493 106
1324 3300005336 Ga0070680_100080487 Ga0070680_1000804871 106
1325 3300005337 Ga0070682_100056593 Ga0070682_1000565933 106
1326 3300005337 Ga0070682_100079617 Ga0070682_1000796172 106
1327 3300005338 Ga0068868_100084787 Ga0068868_1000847873 106
1328 3300005338 Ga0068868_101712231 Ga0068868_1017122311 106
1329 3300005341 Ga0070691_10247457 Ga0070691_102474572 106
1330 3300005344 Ga0070661_100008727 Ga0070661_1000087277 106
1331 3300005344 Ga0070661_100429904 Ga0070661_1004299042 106
1332 3300005347 Ga0070668_100141276 Ga0070668_1001412764 106
1333 3300005347 Ga0070668_100434640 Ga0070668_1004346402 106
1334 3300005347 Ga0070668_100561624 Ga0070668_1005616241 106
1335 3300005354 Ga0070675_100600588 Ga0070675_1006005882 106
1336 3300005355 Ga0070671_100417025 Ga0070671_1004170251 106
1337 3300005355 Ga0070671_100457156 Ga0070671_1004571563 106
1338 3300005355 Ga0070671_100796426 Ga0070671_1007964262 106
1339 3300005366 Ga0070659_100055590 Ga0070659_1000555905 106
1340 3300005367 Ga0070667_100865549 Ga0070667_1008655491 106
1341 3300005434 Ga0070709_10013692 Ga0070709_100136923 106
1342 3300005434 Ga0070709_11779940 Ga0070709_117799401 106
1343 3300005435 Ga0070714_100153352 Ga0070714_1001533523 106
1344 3300005436 Ga0070713_100701799 Ga0070713_1007017992 106
1345 3300005437 Ga0070710_10123317 Ga0070710_101233173 106
1346 3300005437 Ga0070710_10456609 Ga0070710_104566092 106
1347 3300005437 Ga0070710_10851112 Ga0070710_108511122 106
1348 3300005439 Ga0070711_100028547 Ga0070711_1000285476 106
1349 3300005439 Ga0070711_100038741 Ga0070711_1000387411 106
1350 3300005439 Ga0070711_100691652 Ga0070711_1006916522 106
1351 3300005441 Ga0070700_100655804 Ga0070700_1006558041 106
1352 3300005455 Ga0070663_100055427 Ga0070663_1000554274 106
1353 3300005455 Ga0070663_100118705 Ga0070663_1001187053 106
1354 3300005455 Ga0070663_101624809 Ga0070663_1016248091 106
1355 3300005456 Ga0070678_100027340 Ga0070678_1000273403 106
1356 3300005456 Ga0070678_100094259 Ga0070678_1000942592 106
1357 3300005458 Ga0070681_10002399 Ga0070681_100023993 106
1358 3300005458 Ga0070681_10125097 Ga0070681_101250973 106
1359 3300005459 Ga0068867_100683075 Ga0068867_1006830752 106
1360 3300005467 Ga0070706_100261856 Ga0070706_1002618563 106
1361 3300005471 Ga0070698_100057678 Ga0070698_1000576784 106
1362 3300005471 Ga0070698_100201891 Ga0070698_1002018911 106
1363 3300005518 Ga0070699_100374059 Ga0070699_1003740591 106
1364 3300005530 Ga0070679_100004715 Ga0070679_1000047153 106
1365 3300005530 Ga0070679_100028002 Ga0070679_1000280027 106
1366 3300005535 Ga0070684_100113862 Ga0070684_1001138623 106
1367 3300005535 Ga0070684_102242961 Ga0070684_1022429611 106
1368 3300005536 Ga0070697_100813478 Ga0070697_1008134782 106
1369 3300005539 Ga0068853_100095328 Ga0068853_1000953282 106
1370 3300005539 Ga0068853_100164376 Ga0068853_1001643763 106
1371 3300005539 Ga0068853_101584522 Ga0068853_1015845222 106
1372 3300005539 Ga0068853_101612872 Ga0068853_1016128721 106
1373 3300005547 Ga0070693_100093687 Ga0070693_1000936873 106
1374 3300005547 Ga0070693_100122181 Ga0070693_1001221813 106
1375 3300005548 Ga0070665_101455492 Ga0070665_1014554921 106
1376 3300005563 Ga0068855_100043462 Ga0068855_1000434625 106
1377 3300005563 Ga0068855_100147669 Ga0068855_1001476692 106
1378 3300005564 Ga0070664_100083336 Ga0070664_1000833364 106
1379 3300005564 Ga0070664_100137203 Ga0070664_1001372032 106
1380 3300005577 Ga0068857_100280896 Ga0068857_1002808962 106
1381 3300005578 Ga0068854_102081773 Ga0068854_1020817732 106
1382 3300005614 Ga0068856_100225258 Ga0068856_1002252583 106
1383 3300005614 Ga0068856_100263065 Ga0068856_1002630652 106
1384 3300005614 Ga0068856_100291493 Ga0068856_1002914932 106
1385 3300005614 Ga0068856_100385155 Ga0068856_1003851552 106
1386 3300005614 Ga0068856_100705249 Ga0068856_1007052491 106
1387 3300005614 Ga0068856_101418486 Ga0068856_1014184862 106
1388 3300005616 Ga0068852_100021775 Ga0068852_1000217754 106
1389 3300005616 Ga0068852_100230372 Ga0068852_1002303721 106
1390 3300005616 Ga0068852_101045784 Ga0068852_1010457841 106
1391 3300005617 Ga0068859_100725235 Ga0068859_1007252352 106
1392 3300005618 Ga0068864_100047146 Ga0068864_1000471464 106
1393 3300005618 Ga0068864_100179912 Ga0068864_1001799124 106
1394 3300005719 Ga0068861_101062990 Ga0068861_1010629902 106
1395 3300005719 Ga0068861_101209827 Ga0068861_1012098272 106
1396 3300005841 Ga0068863_100433467 Ga0068863_1004334671 106
1397 3300005842 Ga0068858_100156748 Ga0068858_1001567483 106
1398 3300005843 Ga0068860_100041049 Ga0068860_1000410494 106
1399 3300005843 Ga0068860_100458082 Ga0068860_1004580822 106
1400 3300005844 Ga0068862_100837773 Ga0068862_1008377731 106
1401 3300005844 Ga0068862_102685710 Ga0068862_1026857101 106
1402 3300005937 Ga0081455_10700670 Ga0081455_107006701 106
1403 3300005983 Ga0081540_1003483 Ga0081540_10034834 106
1404 3300005983 Ga0081540_1006055 Ga0081540_10060556 106
1405 3300005983 Ga0081540_1019571 Ga0081540_10195713 106
1406 3300005983 Ga0081540_1049799 Ga0081540_10497992 106
1407 3300005983 Ga0081540_1092091 Ga0081540_10920912 106
1408 3300006038 Ga0075365_11087434 Ga0075365_110874342 106
1409 3300006038 Ga0075365_11194435 Ga0075365_111944351 106
1410 3300006048 Ga0075363_100341198 Ga0075363_1003411981 106
1411 3300006163 Ga0070715_10166790 Ga0070715_101667902 106
1412 3300006163 Ga0070715_10199290 Ga0070715_101992902 106
1413 3300006173 Ga0070716_100178312 Ga0070716_1001783123 106
1414 3300006173 Ga0070716_100216055 Ga0070716_1002160552 106
1415 3300006173 Ga0070716_101233290 Ga0070716_1012332902 106
1416 3300006175 Ga0070712_100234276 Ga0070712_1002342762 106
1417 3300006177 Ga0075362_10081493 Ga0075362_100814931 106
1418 3300006177 Ga0075362_10724604 Ga0075362_107246042 106
1419 3300006186 Ga0075369_10052131 Ga0075369_100521313 106
1420 3300006237 Ga0097621_100266689 Ga0097621_1002666892 106
1421 3300006358 Ga0068871_100129685 Ga0068871_1001296853 106
1422 3300006358 Ga0068871_100130756 Ga0068871_1001307562 106
1423 3300006358 Ga0068871_100648707 Ga0068871_1006487072 106
1424 3300006358 Ga0068871_101034526 Ga0068871_1010345262 106
1425 3300006881 Ga0068865_100093108 Ga0068865_1000931082 106
1426 3300006881 Ga0068865_101846752 Ga0068865_1018467522 106
1427 3300006931 Ga0097620_100725144 Ga0097620_1007251442 106
1428 3300006942 Ga0099824_1016140 Ga0099824_10161407 106
1429 3300006942 Ga0099824_1031119 Ga0099824_10311191 106
1430 3300006943 Ga0099822_1015864 Ga0099822_10158649 106
1431 3300009011 Ga0105251_10384048 Ga0105251_103840481 106
1432 3300009093 Ga0105240_10352967 Ga0105240_103529671 106
1433 3300009098 Ga0105245_10018458 Ga0105245_100184586 106
1434 3300009098 Ga0105245_12510895 Ga0105245_125108951 106
1435 3300009098 Ga0105245_12711694 Ga0105245_127116942 106
1436 3300009101 Ga0105247_10135212 Ga0105247_101352122 106
1437 3300009101 Ga0105247_10137704 Ga0105247_101377042 106
1438 3300009101 Ga0105247_10745413 Ga0105247_107454131 106
1439 3300009148 Ga0105243_10165393 Ga0105243_101653933 106
1440 3300009148 Ga0105243_10621854 Ga0105243_106218541 106
1441 3300009174 Ga0105241_10244369 Ga0105241_102443692 106
1442 3300009174 Ga0105241_10853191 Ga0105241_108531912 106
1443 3300009174 Ga0105241_11136374 Ga0105241_111363742 106
1444 3300009176 Ga0105242_10109893 Ga0105242_101098932 106
1445 3300009176 Ga0105242_11171424 Ga0105242_111714241 106
1446 3300009177 Ga0105248_10090767 Ga0105248_100907674 106
1447 3300009177 Ga0105248_10579776 Ga0105248_105797762 106
1448 3300009177 Ga0105248_10592060 Ga0105248_105920602 106
1449 3300009545 Ga0105237_10318916 Ga0105237_103189162 106
1450 3300009545 Ga0105237_10339963 Ga0105237_103399632 106
1451 3300009551 Ga0105238_10024378 Ga0105238_100243783 106
1452 3300009551 Ga0105238_10230507 Ga0105238_102305072 106
1453 3300009551 Ga0105238_10672548 Ga0105238_106725482 106
1454 3300009551 Ga0105238_11539261 Ga0105238_115392612 106
1455 3300009553 Ga0105249_12161709 Ga0105249_121617092 106
1456 3300010375 Ga0105239_10061201 Ga0105239_100612014 106
1457 3300010375 Ga0105239_10239989 Ga0105239_102399893 106
1458 3300010375 Ga0105239_10245416 Ga0105239_102454162 106
1459 3300010375 Ga0105239_10582760 Ga0105239_105827602 106
1460 3300010375 Ga0105239_12017722 Ga0105239_120177221 106
1461 3300010375 Ga0105239_13120575 Ga0105239_131205752 106
1462 3300011119 Ga0105246_10018381 Ga0105246_100183812 106
1463 3300011119 Ga0105246_10038660 Ga0105246_100386602 106
1464 3300011119 Ga0105246_10879514 Ga0105246_108795142 106
1465 3300011119 Ga0105246_12391373 Ga0105246_123913732 106
1466 3300012510 Ga0157316_1048891 Ga0157316_10488912 106
1467 3300013100 Ga0157373_10488412 Ga0157373_104884122 106
1468 3300013104 Ga0157370_10182418 Ga0157370_101824181 106
1469 3300013105 Ga0157369_11263148 Ga0157369_112631481 106
1470 3300013296 Ga0157374_10077147 Ga0157374_100771472 106
1471 3300013296 Ga0157374_11104747 Ga0157374_111047472 106
1472 3300013297 Ga0157378_10047954 Ga0157378_100479546 106
1473 3300013297 Ga0157378_10154935 Ga0157378_101549352 106
1474 3300013306 Ga0163162_10121233 Ga0163162_101212335 106
1475 3300013306 Ga0163162_10250667 Ga0163162_102506672 106
1476 3300013306 Ga0163162_11256467 Ga0163162_112564672 106
1477 3300013307 Ga0157372_10047003 Ga0157372_100470034 106
1478 3300013307 Ga0157372_10454514 Ga0157372_104545142 106
1479 3300013308 Ga0157375_10005808 Ga0157375_100058085 106
1480 3300013308 Ga0157375_10335069 Ga0157375_103350691 106
1481 3300013308 Ga0157375_10379717 Ga0157375_103797171 106
1482 3300014325 Ga0163163_10239587 Ga0163163_102395872 106
1483 3300014325 Ga0163163_11082873 Ga0163163_110828732 106
1484 3300014745 Ga0157377_10276564 Ga0157377_102765642 106
1485 3300014969 Ga0157376_10667617 Ga0157376_106676172 106
1486 3300015261 Ga0182006_1307806 Ga0182006_13078061 106
1487 3300015262 Ga0182007_10267247 Ga0182007_102672472 106
1488 3300017792 Ga0163161_10251815 Ga0163161_102518152 106
1489 3300017792 Ga0163161_10280325 Ga0163161_102803252 106
1490 3300017792 Ga0163161_10611489 Ga0163161_106114892 106
1491 3300025254 Ga0209148_1008628 Ga0209148_10086283 106
1492 3300025261 Ga0209233_1003374 Ga0209233_10033744 106
1493 3300025272 Ga0209455_1001960 Ga0209455_10019605 106
1494 3300025273 Ga0209673_1053448 Ga0209673_10534482 106
1495 3300025295 Ga0209564_1021310 Ga0209564_10213103 106
1496 3300025297 Ga0209758_1000320 Ga0209758_100032075 106
1497 3300025297 Ga0209758_1004056 Ga0209758_100405613 106
1498 3300025297 Ga0209758_1038489 Ga0209758_10384892 106
1499 3300025299 Ga0209256_1070500 Ga0209256_10705002 106
1500 3300025302 Ga0207426_1000746 Ga0207426_10007469 106
1501 3300025304 Ga0209257_1035900 Ga0209257_10359002 106
1502 3300025898 Ga0207692_10098124 Ga0207692_100981243 106
1503 3300025898 Ga0207692_10740706 Ga0207692_107407062 106
1504 3300025899 Ga0207642_10065549 Ga0207642_100655493 106
1505 3300025900 Ga0207710_10173380 Ga0207710_101733802 106
1506 3300025901 Ga0207688_10157413 Ga0207688_101574132 106
1507 3300025903 Ga0207680_10228873 Ga0207680_102288732 106
1508 3300025904 Ga0207647_10198710 Ga0207647_101987101 106
1509 3300025904 Ga0207647_10473410 Ga0207647_104734101 106
1510 3300025905 Ga0207685_10088273 Ga0207685_100882732 106
1511 3300025906 Ga0207699_10340138 Ga0207699_103401382 106
1512 3300025907 Ga0207645_10449709 Ga0207645_104497092 106
1513 3300025909 Ga0207705_10061369 Ga0207705_100613693 106
1514 3300025909 Ga0207705_11221990 Ga0207705_112219902 106
1515 3300025910 Ga0207684_10108120 Ga0207684_101081202 106
1516 3300025911 Ga0207654_10166478 Ga0207654_101664782 106
1517 3300025912 Ga0207707_10000712 Ga0207707_100007123 106
1518 3300025912 Ga0207707_11082415 Ga0207707_110824152 106
1519 3300025913 Ga0207695_10134456 Ga0207695_101344562 106
1520 3300025913 Ga0207695_10639022 Ga0207695_106390221 106
1521 3300025914 Ga0207671_10335614 Ga0207671_103356142 106
1522 3300025914 Ga0207671_11262348 Ga0207671_112623481 106
1523 3300025915 Ga0207693_10008718 Ga0207693_1000871811 106
1524 3300025915 Ga0207693_10435258 Ga0207693_104352582 106
1525 3300025916 Ga0207663_10060198 Ga0207663_100601984 106
1526 3300025916 Ga0207663_10074335 Ga0207663_100743353 106
1527 3300025916 Ga0207663_10620520 Ga0207663_106205202 106
1528 3300025916 Ga0207663_10772136 Ga0207663_107721362 106
1529 3300025917 Ga0207660_10012387 Ga0207660_100123875 106
1530 3300025917 Ga0207660_11004510 Ga0207660_110045101 106
1531 3300025919 Ga0207657_10144267 Ga0207657_101442673 106
1532 3300025919 Ga0207657_10505083 Ga0207657_105050832 106
1533 3300025920 Ga0207649_10343730 Ga0207649_103437302 106
1534 3300025921 Ga0207652_10093584 Ga0207652_100935844 106
1535 3300025921 Ga0207652_10141933 Ga0207652_101419333 106
1536 3300025924 Ga0207694_10049048 Ga0207694_100490483 106
1537 3300025924 Ga0207694_10112809 Ga0207694_101128092 106
1538 3300025924 Ga0207694_10221598 Ga0207694_102215982 106
1539 3300025924 Ga0207694_10968632 Ga0207694_109686322 106
1540 3300025924 Ga0207694_11785666 Ga0207694_117856661 106
1541 3300025926 Ga0207659_10406453 Ga0207659_104064532 106
1542 3300025929 Ga0207664_11499275 Ga0207664_114992752 106
1543 3300025931 Ga0207644_10242240 Ga0207644_102422402 106
1544 3300025931 Ga0207644_10473821 Ga0207644_104738212 106
1545 3300025934 Ga0207686_10211002 Ga0207686_102110023 106
1546 3300025934 Ga0207686_10527885 Ga0207686_105278852 106
1547 3300025934 Ga0207686_10634529 Ga0207686_106345292 106
1548 3300025934 Ga0207686_10769558 Ga0207686_107695581 106
1549 3300025935 Ga0207709_10439488 Ga0207709_104394881 106
1550 3300025935 Ga0207709_10650302 Ga0207709_106503022 106
1551 3300025937 Ga0207669_10392483 Ga0207669_103924832 106
1552 3300025938 Ga0207704_10039533 Ga0207704_100395332 106
1553 3300025938 Ga0207704_11078754 Ga0207704_110787542 106
1554 3300025941 Ga0207711_10231725 Ga0207711_102317252 106
1555 3300025941 Ga0207711_10607104 Ga0207711_106071042 106
1556 3300025944 Ga0207661_10018101 Ga0207661_100181013 106
1557 3300025945 Ga0207679_10066116 Ga0207679_100661162 106
1558 3300025945 Ga0207679_10439130 Ga0207679_104391302 106
1559 3300025945 Ga0207679_10496952 Ga0207679_104969522 106
1560 3300025949 Ga0207667_10076125 Ga0207667_100761252 106
1561 3300025949 Ga0207667_10200431 Ga0207667_102004311 106
1562 3300025949 Ga0207667_11309885 Ga0207667_113098852 106
1563 3300025949 Ga0207667_11678425 Ga0207667_116784252 106
1564 3300025961 Ga0207712_11231115 Ga0207712_112311151 106
1565 3300025972 Ga0207668_10290706 Ga0207668_102907063 106
1566 3300025981 Ga0207640_10077098 Ga0207640_100770983 106
1567 3300026023 Ga0207677_10116123 Ga0207677_101161233 106
1568 3300026023 Ga0207677_10452070 Ga0207677_104520702 106
1569 3300026035 Ga0207703_10107442 Ga0207703_101074423 106
1570 3300026041 Ga0207639_10205930 Ga0207639_102059302 106
1571 3300026041 Ga0207639_10335918 Ga0207639_103359182 106
1572 3300026041 Ga0207639_11318663 Ga0207639_113186632 106
1573 3300026041 Ga0207639_11659263 Ga0207639_116592631 106
1574 3300026067 Ga0207678_10004603 Ga0207678_100046033 106
1575 3300026067 Ga0207678_10142656 Ga0207678_101426563 106
1576 3300026067 Ga0207678_11151674 Ga0207678_111516742 106
1577 3300026067 Ga0207678_11537536 Ga0207678_115375362 106
1578 3300026078 Ga0207702_10111628 Ga0207702_101116283 106
1579 3300026078 Ga0207702_10189264 Ga0207702_101892642 106
1580 3300026078 Ga0207702_10201326 Ga0207702_102013263 106
1581 3300026088 Ga0207641_10275410 Ga0207641_102754102 106
1582 3300026089 Ga0207648_10806079 Ga0207648_108060792 106
1583 3300026089 Ga0207648_11499455 Ga0207648_114994552 106
1584 3300026089 Ga0207648_11715016 Ga0207648_117150162 106
1585 3300026095 Ga0207676_10030660 Ga0207676_100306604 106
1586 3300026095 Ga0207676_10124550 Ga0207676_101245503 106
1587 3300026116 Ga0207674_10132400 Ga0207674_101324002 106
1588 3300026118 Ga0207675_100208150 Ga0207675_1002081502 106
1589 3300026118 Ga0207675_101229980 Ga0207675_1012299802 106
1590 3300026121 Ga0207683_10048432 Ga0207683_100484324 106
1591 3300026121 Ga0207683_10095347 Ga0207683_100953474 106
1592 3300026142 Ga0207698_10108343 Ga0207698_101083432 106
1593 3300026142 Ga0207698_11390661 Ga0207698_113906612 106
1594 3300026142 Ga0207698_11835589 Ga0207698_118355891 106
1595 3300027357 Ga0209589_1000015 Ga0209589_1000015188 106
1596 3300027361 Ga0209489_100015 Ga0209489_100015188 106
1597 3300027361 Ga0209489_100085 Ga0209489_1000852 106
1598 3300027363 Ga0209700_100025 Ga0209700_100025188 106
1599 3300028379 Ga0268266_10024737 Ga0268266_100247376 106
1600 3300028379 Ga0268266_10048039 Ga0268266_100480392 106
1601 3300028379 Ga0268266_10547385 Ga0268266_105473852 106
1602 3300028380 Ga0268265_11873508 Ga0268265_118735082 106
1603 3300028381 Ga0268264_10395954 Ga0268264_103959542 106
1604 3300028786 Ga0307517_10228674 Ga0307517_102286742 106
1605 3300031616 Ga0307508_10038844 Ga0307508_100388445 106
1606 3300031616 Ga0307508_10173980 Ga0307508_101739803 106
1607 3300031730 Ga0307516_10558289 Ga0307516_105582892 106
1608 3300031901 Ga0307406_10790574 Ga0307406_107905742 106
1609 3300031901 Ga0307406_12057670 Ga0307406_120576701 106
1610 3300031903 Ga0307407_11063995 Ga0307407_110639952 106
1611 3300031911 Ga0307412_12067570 Ga0307412_120675702 106
1612 3300032126 Ga0307415_101245086 Ga0307415_1012450861 106
1613 3300033180 Ga0307510_10140199 Ga0307510_101401994 106
1614 3300033442 Ga0315911_1000037 Ga0315911_100003748 106
1615 3300034817 Ga0373948_0015453 Ga0373948_0015453_832_1152 106
1616 3300034957 Ga0373938_0001879 Ga0373938_0001879_2956_3276 106
1617 3300035084 Ga0373928_0014591 Ga0373928_0014591_998_1318 106
1618 3300035088 Ga0373940_0114916 Ga0373940_0114916_230_550 106
1619 3300035091 Ga0373951_0024795 Ga0373951_0024795_635_955 106
1620 3300035112 Ga0373932_0007300 Ga0373932_0007300_1876_2196 106
1621 3300035113 Ga0373936_0596410 Ga0373936_0596410_17_352 106
1622 3300035114 Ga0373939_0035780 Ga0373939_0035780_518_838 106
1623 3300035119 Ga0373956_0411191 Ga0373956_0411191_132_467 106
1624 3300035171 Ga0373946_0408165 Ga0373946_0408165_229_549 106
1625 3300035171 Ga0373946_0579215 Ga0373946_0579215_201_521 106
1626 3300035207 Ga0373942_0070696 Ga0373942_0070696_213_533 106
1627 3300035241 Ga0373961_0048559 Ga0373961_0048559_41_361 106
1628 3300035691 Ga0373931_0004597 Ga0373931_0004597_1079_1399 106
1629 3300035692 Ga0373935_0328014 Ga0373935_0328014_252_572 106
1630 3300035692 Ga0373935_0714525 Ga0373935_0714525_114_449 106
1631 3300035695 Ga0373927_0029537 Ga0373927_0029537_724_1044 106
1632 3300035695 Ga0373927_0031642 Ga0373927_0031642_2621_2941 106
1633 3300035695 Ga0373927_0053846 Ga0373927_0053846_787_1107 106
1634 3300035695 Ga0373927_0199414 Ga0373927_0199414_771_1091 106
1635 3300035695 Ga0373927_0768864 Ga0373927_0768864_294_614 106
1636 3300035724 Ga0373933_0965938 Ga0373933_0965938_39_374 106
1637 3300035725 Ga0373947_0149542 Ga0373947_0149542_972_1292 106
1638 3300035725 Ga0373947_0391873 Ga0373947_0391873_334_654 106
1639 3300036401 Ga0373937_0036246 Ga0373937_0036246_3775_4110 106
1640 3300037068 Ga0373925_0122845 Ga0373925_0122845_982_1302 106
1641 3300037068 Ga0373925_0280610 Ga0373925_0280610_511_831 106
1642 3300037068 Ga0373925_1131835 Ga0373925_1131835_141_461 106
1643 3300037068 Ga0373925_1298022 Ga0373925_1298022_217_573 106
1644 3300037312 Ga0395899_0398123 Ga0395899_0398123_64_384 106
1645 3300037418 Ga0395900_0241956 Ga0395900_0241956_1279_1599 106
1646 3300037418 Ga0395900_1220826 Ga0395900_1220826_123_443 106
1647 3300037466 Ga0395898_0161064 Ga0395898_0161064_589_909 106
1648 3300037466 Ga0395898_0369074 Ga0395898_0369074_551_871 106
1649 3300037466 Ga0395898_0782343 Ga0395898_0782343_539_859 106
1650 3300037471 Ga0395905_0002843 Ga0395905_0002843_4247_4567 106
1651 3300037471 Ga0395905_0049780 Ga0395905_0049780_3292_3612 106
1652 3300039447 Ga0436361_0791285 Ga0436361_0791285_4832_5152 106
1653 3300039450 Ga0436363_0957639 Ga0436363_0957639_1237_1557 106
1654 3300041509 Ga0451843_0386018 Ga0451843_0386018_259_579 106
1655 3300044658 Ga0466972_0011812 Ga0466972_0011812_3409_3729 106
1656 3300044658 Ga0466972_0565265 Ga0466972_0565265_184_504 106
1657 3300044683 Ga0466965_0131665 Ga0466965_0131665_466_786 106
1658 3300044694 Ga0466963_0626705 Ga0466963_0626705_193_513 106
1659 3300044735 Ga0466968_0009383 Ga0466968_0009383_769_1089 106
1660 3300044735 Ga0466968_0128951 Ga0466968_0128951_744_1064 106
1661 3300044735 Ga0466968_0339911 Ga0466968_0339911_336_659 106
1662 3300044842 Ga0466957_0377431 Ga0466957_0377431_561_881 106
1663 3300044901 Ga0466960_0198744 Ga0466960_0198744_156_476 106
1664 3300044901 Ga0466960_0265198 Ga0466960_0265198_451_774 106
1665 3300044901 Ga0466960_0649943 Ga0466960_0649943_156_476 106
1666 3300045049 Ga0466959_0681106 Ga0466959_0681106_261_581 106
1667 3300045976 Ga0466967_0107132 Ga0466967_0107132_563_883 106
1668 3300045976 Ga0466967_0222396 Ga0466967_0222396_1070_1390 106
1669 3300045976 Ga0466967_0245173 Ga0466967_0245173_366_686 106
1670 3300045976 Ga0466967_2082548 Ga0466967_2082548_143_463 106
1671 3300046455 Ga0495603_0067733 Ga0495603_0067733_671_991 106
1672 3300046455 Ga0495603_0112701 Ga0495603_0112701_1090_1410 106
1673 3300046455 Ga0495603_0205097 Ga0495603_0205097_482_817 106
1674 3300046459 Ga0495629_0731968 Ga0495629_0731968_162_482 106
1675 3300046459 Ga0495629_1071204 Ga0495629_1071204_158_493 106
1676 3300046462 Ga0495651_0457638 Ga0495651_0457638_427_747 106
1677 3300046463 Ga0495653_0483002 Ga0495653_0483002_158_493 106
1678 3300046472 Ga0495580_0300963 Ga0495580_0300963_220_540 106
1679 3300046472 Ga0495580_0785264 Ga0495580_0785264_240_560 106
1680 3300046473 Ga0495582_0656351 Ga0495582_0656351_80_400 106
1681 3300046474 Ga0495605_0123625 Ga0495605_0123625_192_512 106
1682 3300046475 Ga0495639_0031933 Ga0495639_0031933_232_552 106
1683 3300046477 Ga0495664_0156535 Ga0495664_0156535_817_1137 106
1684 3300046492 Ga0495585_0136548 Ga0495585_0136548_510_830 106
1685 3300046501 Ga0495607_0172293 Ga0495607_0172293_216_536 106
1686 3300046507 Ga0495606_0019312 Ga0495606_0019312_2740_3060 106
1687 3300046507 Ga0495606_0207993 Ga0495606_0207993_569_889 106
1688 3300046507 Ga0495606_0306624 Ga0495606_0306624_369_689 106
1689 3300046513 Ga0495616_0311406 Ga0495616_0311406_160_480 106
1690 3300046516 Ga0495628_0143186 Ga0495628_0143186_1402_1722 106
1691 3300046522 Ga0495643_0264815 Ga0495643_0264815_310_630 106
1692 3300046524 Ga0495648_0021173 Ga0495648_0021173_829_1149 106
1693 3300046525 Ga0495663_0382664 Ga0495663_0382664_24_344 106
1694 3300046529 Ga0495652_0411455 Ga0495652_0411455_168_503 106
1695 3300046529 Ga0495652_0562882 Ga0495652_0562882_329_649 106
1696 3300046531 Ga0495665_0706220 Ga0495665_0706220_94_414 106
1697 3300046533 Ga0495640_0073602 Ga0495640_0073602_219_554 106
1698 3300046533 Ga0495640_0716743 Ga0495640_0716743_151_471 106
1699 3300046543 Ga0495645_0015966 Ga0495645_0015966_2115_2435 106
1700 3300046543 Ga0495645_0964790 Ga0495645_0964790_66_386 106
1701 3300046557 Ga0495622_0013154 Ga0495622_0013154_2875_3195 106
1702 3300046557 Ga0495622_0129665 Ga0495622_0129665_671_991 106
1703 3300046642 Ga0495634_0342943 Ga0495634_0342943_534_854 106
1704 3300046642 Ga0495634_0425212 Ga0495634_0425212_164_499 106
1705 3300046660 Ga0495625_0195604 Ga0495625_0195604_888_1208 106
1706 3300046660 Ga0495625_0348394 Ga0495625_0348394_479_799 106
1707 3300046663 Ga0495635_0848122 Ga0495635_0848122_165_485 106
1708 3300046665 Ga0495661_0081769 Ga0495661_0081769_47_367 106
1709 3300046674 Ga0495588_0077422 Ga0495588_0077422_77_397 106
1710 3300046678 Ga0495599_0038422 Ga0495599_0038422_1257_1577 106
1711 3300046681 Ga0495647_0248021 Ga0495647_0248021_86_406 106
1712 3300046681 Ga0495647_0394626 Ga0495647_0394626_85_405 106
1713 3300046683 Ga0495658_0745148 Ga0495658_0745148_115_435 106
1714 3300046692 Ga0495671_0047950 Ga0495671_0047950_1130_1450 106
1715 3300046692 Ga0495671_0232054 Ga0495671_0232054_149_469 106
1716 3300046694 Ga0495649_0134751 Ga0495649_0134751_446_766 106
1717 3300046794 Ga0495589_0057394 Ga0495589_0057394_1542_1862 106
1718 3300046794 Ga0495589_0329369 Ga0495589_0329369_287_607 106
1719 3300047315 Ga0495581_0215942 Ga0495581_0215942_210_530 106
1720 3300047315 Ga0495581_0416587 Ga0495581_0416587_105_425 106
1721 3300047319 Ga0495674_0138447 Ga0495674_0138447_720_1055 106
1722 3300047320 Ga0495672_0182734 Ga0495672_0182734_231_551 106
1723 3300047469 Ga0495673_0102172 Ga0495673_0102172_350_670 106
1724 3300047673 Ga0495593_0622480 Ga0495593_0622480_16_336 106
1725 3300048088 Ga0495602_0580411 Ga0495602_0580411_22_342 106
1726 3300048903 Ga0496100_0031298 Ga0496100_0031298_2510_2830 106
1727 3300048903 Ga0496100_0039813 Ga0496100_0039813_1237_1557 106
1728 3300048903 Ga0496100_0274677 Ga0496100_0274677_665_985 106
1729 3300048904 Ga0496101_0048045 Ga0496101_0048045_1201_1521 106
1730 3300048904 Ga0496101_0805030 Ga0496101_0805030_345_665 106
1731 3300048904 Ga0496101_1130617 Ga0496101_1130617_85_405 106
1732 3300048904 Ga0496101_1373245 Ga0496101_1373245_25_345 106
1733 3300048905 Ga0496102_0003826 Ga0496102_0003826_3102_3422 106
1734 3300048905 Ga0496102_0084735 Ga0496102_0084735_1728_2048 106
1735 3300048905 Ga0496102_0234601 Ga0496102_0234601_406_726 106
1736 3300048905 Ga0496102_0560670 Ga0496102_0560670_709_1029 106
1737 3300048906 Ga0496103_0047160 Ga0496103_0047160_1707_2027 106
1738 3300048906 Ga0496103_0082735 Ga0496103_0082735_1124_1444 106
1739 3300048906 Ga0496103_0303892 Ga0496103_0303892_652_972 106
1740 3300048906 Ga0496103_0512031 Ga0496103_0512031_404_724 106
1741 3300048907 Ga0496104_0083527 Ga0496104_0083527_1371_1691 106
1742 3300048907 Ga0496104_0487136 Ga0496104_0487136_583_903 106
1743 3300048908 Ga0496105_0010163 Ga0496105_0010163_4638_4958 106
1744 3300048908 Ga0496105_0161980 Ga0496105_0161980_1111_1431 106
1745 3300048908 Ga0496105_0297294 Ga0496105_0297294_657_977 106
1746 3300048909 Ga0496106_0026335 Ga0496106_0026335_3607_3927 106
1747 3300048909 Ga0496106_0042886 Ga0496106_0042886_1541_1861 106
1748 3300048909 Ga0496106_0151026 Ga0496106_0151026_765_1085 106
1749 3300048910 Ga0496107_0000413 Ga0496107_0000413_19011_19331 106
1750 3300048910 Ga0496107_0137191 Ga0496107_0137191_912_1232 106
1751 3300048910 Ga0496107_0141780 Ga0496107_0141780_709_1029 106
1752 3300048910 Ga0496107_0806668 Ga0496107_0806668_193_513 106
1753 3300048911 Ga0496108_0072631 Ga0496108_0072631_1056_1376 106
1754 3300048911 Ga0496108_0417106 Ga0496108_0417106_24_344 106
1755 3300048911 Ga0496108_0820633 Ga0496108_0820633_161_481 106
1756 3300048912 Ga0496109_0064124 Ga0496109_0064124_1537_1857 106
1757 3300048912 Ga0496109_0136268 Ga0496109_0136268_1569_1889 106
1758 3300048912 Ga0496109_0313362 Ga0496109_0313362_451_771 106
1759 3300048912 Ga0496109_0451777 Ga0496109_0451777_396_716 106
1760 3300048912 Ga0496109_1364268 Ga0496109_1364268_168_488 106
1761 3300048913 Ga0496110_0008222 Ga0496110_0008222_5561_5881 106
1762 3300048913 Ga0496110_0124245 Ga0496110_0124245_1462_1782 106
1763 3300048913 Ga0496110_1164176 Ga0496110_1164176_251_571 106
1764 3300048914 Ga0496111_0047883 Ga0496111_0047883_2262_2582 106
1765 3300048914 Ga0496111_0204487 Ga0496111_0204487_944_1264 106
1766 3300048914 Ga0496111_0797355 Ga0496111_0797355_30_350 106
1767 3300048914 Ga0496111_1345805 Ga0496111_1345805_141_461 106
1768 3300048915 Ga0496112_0091791 Ga0496112_0091791_1959_2279 106
1769 3300048915 Ga0496112_0115995 Ga0496112_0115995_638_958 106
1770 3300048915 Ga0496112_0121752 Ga0496112_0121752_655_975 106
1771 3300048915 Ga0496112_0774251 Ga0496112_0774251_299_619 106
1772 3300048916 Ga0496113_0006958 Ga0496113_0006958_6172_6492 106
1773 3300048916 Ga0496113_0012816 Ga0496113_0012816_709_1029 106
1774 3300048916 Ga0496113_0223045 Ga0496113_0223045_367_687 106
1775 3300048916 Ga0496113_0304018 Ga0496113_0304018_184_504 106
1776 3300048917 Ga0496114_0020155 Ga0496114_0020155_5052_5372 106
1777 3300048917 Ga0496114_0073299 Ga0496114_0073299_584_904 106
1778 3300048917 Ga0496114_0118237 Ga0496114_0118237_716_1036 106
1779 3300048918 Ga0496115_0005968 Ga0496115_0005968_5546_5866 106
1780 3300048918 Ga0496115_0088634 Ga0496115_0088634_1327_1647 106
1781 3300048918 Ga0496115_0250232 Ga0496115_0250232_568_888 106
1782 3300048918 Ga0496115_0255674 Ga0496115_0255674_1081_1401 106
1783 3300048918 Ga0496115_1236461 Ga0496115_1236461_135_455 106
1784 3300048919 Ga0496116_0040494 Ga0496116_0040494_1247_1567 106
1785 3300048919 Ga0496116_0455043 Ga0496116_0455043_187_507 106
1786 3300048920 Ga0496117_0214816 Ga0496117_0214816_254_574 106
1787 3300048921 Ga0496118_0151702 Ga0496118_0151702_18_338 106
1788 3300048921 Ga0496118_0164114 Ga0496118_0164114_522_842 106
1789 3300048922 Ga0496119_0031735 Ga0496119_0031735_1986_2309 106
1790 3300048922 Ga0496119_0061217 Ga0496119_0061217_965_1285 106
1791 3300048924 Ga0496121_0004381 Ga0496121_0004381_7870_8190 106
1792 3300048924 Ga0496121_0353887 Ga0496121_0353887_211_531 106
1793 3300048924 Ga0496121_0592095 Ga0496121_0592095_223_543 106
1794 3300048924 Ga0496121_0794759 Ga0496121_0794759_102_425 106
1795 3300048924 Ga0496121_0805520 Ga0496121_0805520_115_435 106
1796 3300048928 Ga0496125_0102390 Ga0496125_0102390_1277_1597 106
1797 3300048929 Ga0496126_0097001 Ga0496126_0097001_1093_1416 106
1798 3300048929 Ga0496126_0176456 Ga0496126_0176456_782_1102 106
1799 3300048929 Ga0496126_0272844 Ga0496126_0272844_986_1306 106
1800 3300048929 Ga0496126_0694995 Ga0496126_0694995_50_370 106
1801 3300049460 Ga0495682_0047641 Ga0495682_0047641_185_505 106
1802 3300049572 Ga0501036_0182007 Ga0501036_0182007_1304_1660 106
1803 3300049822 Ga0501035_1454003 Ga0501035_1454003_57_413 106
1804 3300050491 nmdc:mga00v17_96508_c1 nmdc:mga00v17_96508_c1_76_396 106
1805 3300050492 nmdc:mga0yw44_30141_c1 nmdc:mga0yw44_30141_c1_1576_1896 106
1806 3300050492 nmdc:mga0yw44_864775_c1 nmdc:mga0yw44_864775_c1_56_376 106
1807 3300050496 nmdc:mga07m45_58522_c1 nmdc:mga07m45_58522_c1_1520_1840 106
1808 3300050516 nmdc:mga0sz30_22090_c1 nmdc:mga0sz30_22090_c1_755_1075 106
1809 3300050516 nmdc:mga0sz30_596715_c1 nmdc:mga0sz30_596715_c1_20_340 106
1810 3300053077 Ga0495601_0134345 Ga0495601_0134345_1273_1593 106
1811 3300053077 Ga0495601_0850526 Ga0495601_0850526_150_470 106
1812 3300053078 Ga0495612_0136125 Ga0495612_0136125_516_836 106
1813 3300053083 Ga0495655_0172283 Ga0495655_0172283_66_386 106
1814 3300053083 Ga0495655_0282750 Ga0495655_0282750_137_457 106
1815 3300053086 Ga0500578_0151308 Ga0500578_0151308_942_1262 106
1816 3300053093 Ga0500651_0191125 Ga0500651_0191125_210_533 106
1817 3300053098 Ga0500650_0260768 Ga0500650_0260768_24_344 106
1818 3300053119 Ga0500595_096273 Ga0500595_096273_288_608 106
1819 3300053156 Ga0500622_0189472 Ga0500622_0189472_187_510 106
1820 3300053158 Ga0500627_0080484 Ga0500627_0080484_195_518 106
1821 3300053177 Ga0500636_0028275 Ga0500636_0028275_674_997 106
1822 3300053724 Ga0500570_187718 Ga0500570_187718_228_551 106
1823 3300053737 Ga0500601_000078 Ga0500601_000078_16821_17141 106
1824 3300055283 Ga0500661_012697 Ga0500661_012697_526_846 106
1825 3300059490 Ga0587066_220672 Ga0587066_220672_68_388 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13473

Cupredoxin_1

Cupredoxin-like domain

4

103

0.92

PF00127

Copper-bind

Copper binding proteins, plastocyanin/azurin family

23

104

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ie9-assembly1.cif.gz_A structure of oxidized m98l mutant of amicyanin 0.8725 27 105
6hbe-assembly1.cif.gz_B cu-containing nitrite reductase (nirk) from thermus scotoductus sa-01 0.869 26 106
2ids-assembly1.cif.gz_A structure of m98a mutant of amicyanin, cu(i) 0.8511 26 105
1sf3-assembly1.cif.gz_A structure of the reduced form of the p94a mutant of amicyanin 0.8487 26 105
2gba-assembly1.cif.gz_A reduced cu(i) form at ph 4 of p52g mutant of amicyanin 0.8486 26 105
ID Description Score Start End Superfamily
5fc9B00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8451 27 105 2.60.40.420
1b3iA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8443 26 105 2.60.40.420
5ysgA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8329 26 105 2.60.40.420
af_Q54VX3_19_99_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8327 25 105 2.60.40.420
4hcfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8291 25 105 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A1J5PIE5-F1-model_v4 Plastocyanin 0.9995 31 106
AF-A0A1J5PIE5-F1-model_v4 Plastocyanin 0.9865 31 106
AF-A0A101VH28-F1-model_v4 EfeO-type cupredoxin-like domain-containing protein 0.976 41 106
AF-A0A7S7U404-F1-model_v4 Amicyanin 0.9756 14 106
AF-A0A844SCQ4-F1-model_v4 Amicyanin 0.975 13 106

Feature Viewer

pLDDT pTM Quality
89.76 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map