F495788

General Info

Members Datasets Scaffolds Average Seq Length
1819 401 1819 97

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10159910|Ga0157374_101599103
Length 111
Sequence MLAMNFGGDGEVVISGRLDASQCAAALAFLEKVNGTVSLDCRGLEYISSAGLGVLLKTQKRLAGGGGKLRLTGVNRHLEDIFRYSGFDQIFEIAPAPYIVPTFRLAGCNWG

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
113 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
114 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
115 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
116 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
220 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
221 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
222 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
223 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
224 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
225 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
226 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
227 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
228 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
229 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
230 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
231 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
232 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
235 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
236 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
237 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
238 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
239 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
240 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
241 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
242 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
243 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
244 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
245 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
246 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
247 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
248 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
249 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
250 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
251 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
252 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
253 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
254 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
255 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
256 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
257 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
258 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
260 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
261 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
262 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
263 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
264 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
265 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
266 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
267 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
268 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
269 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
270 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
271 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
272 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
273 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
274 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
276 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
277 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
278 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
279 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
280 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
281 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
282 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
283 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
284 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
285 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
286 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
287 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
288 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
289 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
290 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
291 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
292 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
293 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
294 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
295 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
296 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
297 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
298 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
299 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
300 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
301 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
302 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
303 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
304 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
305 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
306 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
307 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
308 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
309 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
310 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
311 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
312 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
313 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
314 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
315 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
316 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
317 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
318 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
319 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
320 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
321 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
322 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
323 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
324 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
325 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
326 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
327 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
328 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
329 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
330 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
331 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
332 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
333 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
334 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
335 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
336 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
337 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
338 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
339 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
340 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
341 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
342 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
343 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
344 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
345 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
346 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
347 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
348 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
349 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
350 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
351 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
352 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
353 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
354 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
355 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
356 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
357 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
358 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
359 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
360 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
361 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
362 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
363 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
373 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
374 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
375 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
376 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
377 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
378 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
379 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
380 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
381 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
382 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
383 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
384 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
386 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
387 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
388 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
389 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
390 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
391 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
392 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
393 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
394 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
395 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
396 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
397 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
398 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
399 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
400 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
401 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.95
Metatranscriptomes 0.05
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.85
Rhizosphere 95.55
Stem 0
Stem Tuber 0
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_9864180 2162886012 Bacteria 1255
2 Ga0065712_10542608 3300005290 Unclassified 622
3 Ga0065715_10100272 3300005293 Bacteria 3321
4 Ga0065707_10145400 3300005295 Unclassified 1720
5 Ga0065707_10397702 3300005295 Unclassified 857
6 Ga0070658_10094378 3300005327 Unclassified 2468
7 Ga0070658_10206452 3300005327 Bacteria 1659
8 Ga0070658_10822346 3300005327 Unclassified 807
9 Ga0070658_11288025 3300005327 Unclassified 635
10 Ga0070658_11493427 3300005327 Bacteria 586
11 Ga0070676_10000211 3300005328 Bacteria 24876
12 Ga0070676_10025275 3300005328 Bacteria 3355
13 Ga0070676_10055500 3300005328 Bacteria 2338
14 Ga0070676_10114273 3300005328 Bacteria 1685
15 Ga0070676_10638306 3300005328 Unclassified 772
16 Ga0070676_10807230 3300005328 Unclassified 693
17 Ga0070676_10819939 3300005328 Unclassified 688
18 Ga0070676_10832548 3300005328 Bacteria 683
19 Ga0070676_11346053 3300005328 Unclassified 546
20 Ga0070683_100090336 3300005329 Bacteria 2876
21 Ga0070683_100125606 3300005329 Bacteria 2425
22 Ga0070683_100140591 3300005329 Unclassified 2287
23 Ga0070683_100196522 3300005329 Unclassified 1915
24 Ga0070690_100005661 3300005330 Bacteria 7031
25 Ga0070690_100102823 3300005330 Bacteria 1896
26 Ga0070690_100488347 3300005330 Bacteria 919
27 Ga0070690_100851163 3300005330 Bacteria 710
28 Ga0070690_101760989 3300005330 Bacteria 504
29 Ga0070670_100003580 3300005331 Bacteria 12928
30 Ga0070670_100087442 3300005331 Bacteria 2678
31 Ga0070670_100112887 3300005331 Unclassified 2342
32 Ga0070670_100196124 3300005331 Bacteria 1754
33 Ga0070670_100208479 3300005331 Bacteria 1699
34 Ga0070670_100381174 3300005331 Unclassified 1242
35 Ga0070670_100476436 3300005331 Unclassified 1108
36 Ga0070670_100528780 3300005331 Bacteria 1051
37 Ga0070670_101437665 3300005331 Bacteria 632
38 Ga0070670_101586733 3300005331 Bacteria 601
39 Ga0070677_10042108 3300005333 Bacteria 1806
40 Ga0070677_10055555 3300005333 Bacteria 1617
41 Ga0070677_10101894 3300005333 Bacteria 1267
42 Ga0070677_10831166 3300005333 Unclassified 529
43 Ga0068869_100001217 3300005334 Bacteria 15147
44 Ga0068869_100004711 3300005334 Bacteria 8512
45 Ga0068869_100018986 3300005334 Bacteria 4689
46 Ga0068869_100098254 3300005334 Unclassified 2211
47 Ga0068869_100133068 3300005334 Unclassified 1913
48 Ga0068869_100226317 3300005334 Unclassified 1484
49 Ga0068869_100253298 3300005334 Bacteria 1407
50 Ga0068869_101190788 3300005334 Bacteria 669
51 Ga0068869_101930842 3300005334 Unclassified 529
52 Ga0070666_10011323 3300005335 Bacteria 5597
53 Ga0070666_10104249 3300005335 Bacteria 1957
54 Ga0070666_10116869 3300005335 Bacteria 1847
55 Ga0070666_10959008 3300005335 Unclassified 633
56 Ga0070680_100179087 3300005336 Unclassified 1785
57 Ga0070680_100179992 3300005336 Unclassified 1780
58 Ga0070680_100470603 3300005336 Bacteria 1074
59 Ga0070680_100479408 3300005336 Bacteria 1063
60 Ga0070680_100644816 3300005336 Bacteria 910
61 Ga0070680_100939180 3300005336 Bacteria 746
62 Ga0070680_101027316 3300005336 Unclassified 712
63 Ga0070680_101133140 3300005336 Bacteria 676
64 Ga0070680_101259262 3300005336 Bacteria 640
65 Ga0070680_101642702 3300005336 Unclassified 557
66 Ga0070682_100079248 3300005337 Unclassified 2121
67 Ga0070682_100141338 3300005337 Bacteria 1641
68 Ga0070682_100153895 3300005337 Unclassified 1581
69 Ga0070682_100677841 3300005337 Unclassified 824
70 Ga0068868_100004450 3300005338 Bacteria 9830
71 Ga0068868_100045990 3300005338 Bacteria 3416
72 Ga0068868_100076091 3300005338 Bacteria 2683
73 Ga0068868_100139220 3300005338 Bacteria 1991
74 Ga0068868_100236246 3300005338 Unclassified 1534
75 Ga0068868_100425549 3300005338 Unclassified 1150
76 Ga0068868_100805042 3300005338 Bacteria 848
77 Ga0068868_101494040 3300005338 Unclassified 632
78 Ga0068868_102047439 3300005338 Unclassified 544
79 Ga0070660_100003500 3300005339 Bacteria 10820
80 Ga0070660_100005880 3300005339 Bacteria 8488
81 Ga0070660_100093994 3300005339 Bacteria 2368
82 Ga0070660_100113437 3300005339 Unclassified 2158
83 Ga0070660_100241040 3300005339 Unclassified 1473
84 Ga0070660_100514892 3300005339 Bacteria 996
85 Ga0070660_100713737 3300005339 Unclassified 841
86 Ga0070660_101239651 3300005339 Bacteria 632
87 Ga0070660_101777417 3300005339 Unclassified 525
88 Ga0070689_100025395 3300005340 Bacteria 4450
89 Ga0070689_100061093 3300005340 Bacteria 2930
90 Ga0070689_100117772 3300005340 Unclassified 2119
91 Ga0070689_100127313 3300005340 Unclassified 2039
92 Ga0070689_100162475 3300005340 Bacteria 1806
93 Ga0070689_100417069 3300005340 Bacteria 1137
94 Ga0070691_10061583 3300005341 Unclassified 1805
95 Ga0070691_10354306 3300005341 Unclassified 816
96 Ga0070691_10866007 3300005341 Unclassified 555
97 Ga0070687_100045775 3300005343 Bacteria 2236
98 Ga0070687_100047605 3300005343 Unclassified 2200
99 Ga0070687_100082310 3300005343 Bacteria 1760
100 Ga0070687_100195423 3300005343 Unclassified 1222
101 Ga0070687_100663317 3300005343 Unclassified 724
102 Ga0070687_100759345 3300005343 Bacteria 683
103 Ga0070687_100780189 3300005343 Unclassified 675
104 Ga0070661_100007884 3300005344 Bacteria 7353
105 Ga0070661_100038383 3300005344 Bacteria 3486
106 Ga0070661_100104277 3300005344 Unclassified 2112
107 Ga0070661_100139938 3300005344 Unclassified 1823
108 Ga0070661_100237909 3300005344 Bacteria 1401
109 Ga0070661_100487460 3300005344 Bacteria 985
110 Ga0070661_100758277 3300005344 Unclassified 794
111 Ga0070661_101047619 3300005344 Unclassified 678
112 Ga0070661_101571147 3300005344 Bacteria 556
113 Ga0070692_10010072 3300005345 Bacteria 4288
114 Ga0070692_10030332 3300005345 Unclassified 2703
115 Ga0070692_10066134 3300005345 Unclassified 1915
116 Ga0070692_10136624 3300005345 Bacteria 1383
117 Ga0070692_10299887 3300005345 Bacteria 981
118 Ga0070692_10446247 3300005345 Bacteria 827
119 Ga0070692_10684439 3300005345 Bacteria 688
120 Ga0070692_10974427 3300005345 Bacteria 591
121 Ga0070668_100002186 3300005347 Bacteria 14339
122 Ga0070668_100007036 3300005347 Bacteria 8335
123 Ga0070668_100033821 3300005347 Bacteria 3895
124 Ga0070668_100046205 3300005347 Bacteria 3342
125 Ga0070668_100082243 3300005347 Unclassified 2526
126 Ga0070668_100102662 3300005347 Unclassified 2267
127 Ga0070669_100036373 3300005353 Bacteria 3567
128 Ga0070669_100045618 3300005353 Bacteria 3195
129 Ga0070669_100050446 3300005353 Unclassified 3040
130 Ga0070669_100090158 3300005353 Unclassified 2298
131 Ga0070669_100107000 3300005353 Bacteria 2118
132 Ga0070669_100128836 3300005353 Bacteria 1939
133 Ga0070669_100290352 3300005353 Unclassified 1313
134 Ga0070669_100403302 3300005353 Unclassified 1119
135 Ga0070669_100924270 3300005353 Bacteria 746
136 Ga0070675_100006516 3300005354 Bacteria 8969
137 Ga0070675_100046616 3300005354 Bacteria 3550
138 Ga0070675_100063178 3300005354 Bacteria 3060
139 Ga0070675_100100598 3300005354 Unclassified 2434
140 Ga0070675_100113405 3300005354 Unclassified 2296
141 Ga0070675_100167478 3300005354 Bacteria 1893
142 Ga0070675_100309595 3300005354 Unclassified 1393
143 Ga0070675_100354527 3300005354 Unclassified 1301
144 Ga0070675_100458880 3300005354 Bacteria 1143
145 Ga0070675_100637287 3300005354 Bacteria 968
146 Ga0070675_100780113 3300005354 Bacteria 873
147 Ga0070675_101139829 3300005354 Bacteria 717
148 Ga0070671_100004012 3300005355 Bacteria 11601
149 Ga0070671_100011149 3300005355 Bacteria 7219
150 Ga0070671_100031851 3300005355 Bacteria 4358
151 Ga0070671_100073618 3300005355 Bacteria 2853
152 Ga0070671_100101430 3300005355 Unclassified 2415
153 Ga0070671_100249869 3300005355 Bacteria 1506
154 Ga0070671_100314929 3300005355 Bacteria 1333
155 Ga0070671_100624332 3300005355 Bacteria 932
156 Ga0070671_100835766 3300005355 Bacteria 803
157 Ga0070674_100040495 3300005356 Bacteria 3153
158 Ga0070674_100081773 3300005356 Bacteria 2309
159 Ga0070674_100096666 3300005356 Unclassified 2144
160 Ga0070674_100097462 3300005356 Bacteria 2135
161 Ga0070674_100108336 3300005356 Bacteria 2036
162 Ga0070674_100671804 3300005356 Bacteria 883
163 Ga0070674_100745190 3300005356 Bacteria 841
164 Ga0070674_101999486 3300005356 Unclassified 528
165 Ga0070673_100003990 3300005364 Bacteria 9286
166 Ga0070673_100004734 3300005364 Bacteria 8643
167 Ga0070673_100005609 3300005364 Bacteria 8049
168 Ga0070673_100085211 3300005364 Unclassified 2572
169 Ga0070673_100112338 3300005364 Unclassified 2261
170 Ga0070673_100290052 3300005364 Unclassified 1437
171 Ga0070673_100318342 3300005364 Bacteria 1374
172 Ga0070673_100390966 3300005364 Unclassified 1242
173 Ga0070673_101877538 3300005364 Unclassified 568
174 Ga0070688_100000557 3300005365 Bacteria 18874
175 Ga0070688_100009729 3300005365 Bacteria 5277
176 Ga0070688_100037032 3300005365 Bacteria 2970
177 Ga0070688_100703082 3300005365 Unclassified 783
178 Ga0070659_100027196 3300005366 Bacteria 4405
179 Ga0070659_100027947 3300005366 Bacteria 4351
180 Ga0070659_100097047 3300005366 Unclassified 2368
181 Ga0070659_100097628 3300005366 Bacteria 2361
182 Ga0070659_100123855 3300005366 Unclassified 2096
183 Ga0070659_100399058 3300005366 Bacteria 1161
184 Ga0070659_100420994 3300005366 Unclassified 1130
185 Ga0070659_100767447 3300005366 Unclassified 837
186 Ga0070667_100011739 3300005367 Bacteria 7239
187 Ga0070667_100065382 3300005367 Bacteria 3088
188 Ga0070667_100133336 3300005367 Bacteria 2170
189 Ga0070667_100155200 3300005367 Bacteria 2013
190 Ga0070667_100232746 3300005367 Bacteria 1643
191 Ga0070667_100238942 3300005367 Unclassified 1621
192 Ga0070667_100333201 3300005367 Unclassified 1371
193 Ga0070667_100372645 3300005367 Bacteria 1296
194 Ga0070667_100519288 3300005367 Unclassified 1093
195 Ga0070709_10011236 3300005434 Bacteria 4982
196 Ga0070709_10118659 3300005434 Unclassified 1789
197 Ga0070709_10194418 3300005434 Bacteria 1433
198 Ga0070709_10195015 3300005434 Bacteria 1431
199 Ga0070709_10272279 3300005434 Bacteria 1227
200 Ga0070709_10393048 3300005434 Unclassified 1034
201 Ga0070709_10641698 3300005434 Unclassified 821
202 Ga0070714_100005797 3300005435 Bacteria 9471
203 Ga0070714_100024453 3300005435 Bacteria 4975
204 Ga0070714_100994195 3300005435 Bacteria 816
205 Ga0070713_100002362 3300005436 Bacteria 12311
206 Ga0070713_100007179 3300005436 Bacteria 7794
207 Ga0070713_100554708 3300005436 Bacteria 1088
208 Ga0070713_100728033 3300005436 Bacteria 948
209 Ga0070713_102315527 3300005436 Bacteria 520
210 Ga0070710_10003230 3300005437 Bacteria 7717
211 Ga0070710_10019099 3300005437 Bacteria 3538
212 Ga0070710_10049622 3300005437 Unclassified 2348
213 Ga0070710_10410569 3300005437 Bacteria 910
214 Ga0070701_10041658 3300005438 Unclassified 2341
215 Ga0070701_10063235 3300005438 Unclassified 1958
216 Ga0070701_10082441 3300005438 Bacteria 1744
217 Ga0070701_10143470 3300005438 Bacteria 1368
218 Ga0070701_10449006 3300005438 Bacteria 827
219 Ga0070701_10478610 3300005438 Bacteria 804
220 Ga0070701_10728393 3300005438 Unclassified 670
221 Ga0070711_100104268 3300005439 Bacteria 2068
222 Ga0070711_100176774 3300005439 Bacteria 1631
223 Ga0070711_100240399 3300005439 Bacteria 1416
224 Ga0070711_100274116 3300005439 Bacteria 1332
225 Ga0070711_100274333 3300005439 Bacteria 1332
226 Ga0070711_100582609 3300005439 Unclassified 931
227 Ga0070711_101095740 3300005439 Bacteria 686
228 Ga0070711_101204176 3300005439 Bacteria 655
229 Ga0070705_100014396 3300005440 Bacteria 4067
230 Ga0070705_100054471 3300005440 Unclassified 2346
231 Ga0070705_100424623 3300005440 Bacteria 991
232 Ga0070705_100424741 3300005440 Unclassified 990
233 Ga0070705_100868167 3300005440 Bacteria 723
234 Ga0070705_101387406 3300005440 Unclassified 585
235 Ga0070705_101402566 3300005440 Unclassified 582
236 Ga0070705_101506925 3300005440 Bacteria 563
237 Ga0070705_101619819 3300005440 Unclassified 545
238 Ga0070700_100014520 3300005441 Bacteria 4447
239 Ga0070700_100207922 3300005441 Bacteria 1379
240 Ga0070700_100217420 3300005441 Unclassified 1352
241 Ga0070700_100813629 3300005441 Bacteria 753
242 Ga0070700_101003806 3300005441 Bacteria 686
243 Ga0070694_100014219 3300005444 Bacteria 4981
244 Ga0070694_100026011 3300005444 Bacteria 3790
245 Ga0070694_100049224 3300005444 Bacteria 2838
246 Ga0070694_100176678 3300005444 Bacteria 1577
247 Ga0070694_100316088 3300005444 Bacteria 1201
248 Ga0070694_100949352 3300005444 Unclassified 712
249 Ga0070708_100000683 3300005445 Bacteria 25789
250 Ga0070708_100154259 3300005445 Bacteria 2137
251 Ga0070663_100077453 3300005455 Unclassified 2434
252 Ga0070663_100105931 3300005455 Unclassified 2105
253 Ga0070663_100123078 3300005455 Bacteria 1961
254 Ga0070663_100253026 3300005455 Unclassified 1395
255 Ga0070663_100297822 3300005455 Unclassified 1290
256 Ga0070663_100682265 3300005455 Unclassified 872
257 Ga0070663_101543572 3300005455 Unclassified 591
258 Ga0070663_101687593 3300005455 Bacteria 566
259 Ga0070678_100001883 3300005456 Bacteria 11324
260 Ga0070678_100010302 3300005456 Bacteria 5702
261 Ga0070678_100045591 3300005456 Bacteria 3138
262 Ga0070678_100064189 3300005456 Bacteria 2720
263 Ga0070678_100103735 3300005456 Bacteria 2210
264 Ga0070678_100145022 3300005456 Bacteria 1905
265 Ga0070678_100668698 3300005456 Bacteria 933
266 Ga0070678_101318531 3300005456 Unclassified 672
267 Ga0070678_101365960 3300005456 Unclassified 661
268 Ga0070662_100001043 3300005457 Bacteria 16937
269 Ga0070662_100072452 3300005457 Bacteria 2543
270 Ga0070662_100128156 3300005457 Unclassified 1953
271 Ga0070662_100159878 3300005457 Bacteria 1761
272 Ga0070662_100181545 3300005457 Bacteria 1659
273 Ga0070662_100286648 3300005457 Bacteria 1334
274 Ga0070662_100412010 3300005457 Unclassified 1117
275 Ga0070662_100642241 3300005457 Bacteria 895
276 Ga0070662_100726440 3300005457 Bacteria 841
277 Ga0070662_101324469 3300005457 Unclassified 620
278 Ga0070662_101724008 3300005457 Bacteria 541
279 Ga0070681_10134071 3300005458 Bacteria 2407
280 Ga0070681_10139327 3300005458 Unclassified 2356
281 Ga0070681_10179397 3300005458 Bacteria 2039
282 Ga0070681_10556623 3300005458 Bacteria 1061
283 Ga0068867_100008824 3300005459 Bacteria 7116
284 Ga0068867_100010852 3300005459 Bacteria 6425
285 Ga0068867_100037549 3300005459 Bacteria 3521
286 Ga0068867_100129200 3300005459 Bacteria 1962
287 Ga0068867_100230853 3300005459 Bacteria 1496
288 Ga0068867_100268657 3300005459 Bacteria 1393
289 Ga0068867_100577481 3300005459 Unclassified 977
290 Ga0070685_10004731 3300005466 Bacteria 6892
291 Ga0070685_10080866 3300005466 Unclassified 1948
292 Ga0070685_10192066 3300005466 Unclassified 1322
293 Ga0070685_10375698 3300005466 Unclassified 978
294 Ga0070706_100197408 3300005467 Unclassified 1880
295 Ga0070706_100323888 3300005467 Bacteria 1437
296 Ga0070706_101248701 3300005467 Unclassified 682
297 Ga0070707_100038066 3300005468 Bacteria 4593
298 Ga0070707_100179302 3300005468 Unclassified 2065
299 Ga0070707_100215895 3300005468 Bacteria 1869
300 Ga0070707_101302103 3300005468 Unclassified 693
301 Ga0070698_100002731 3300005471 Bacteria 19403
302 Ga0070698_100066623 3300005471 Bacteria 3623
303 Ga0070698_100252024 3300005471 Bacteria 1698
304 Ga0070698_100592664 3300005471 Bacteria 1049
305 Ga0070698_101026283 3300005471 Bacteria 772
306 Ga0070698_101314976 3300005471 Bacteria 673
307 Ga0070699_100034559 3300005518 Bacteria 4370
308 Ga0070699_100078559 3300005518 Bacteria 2874
309 Ga0070699_100358771 3300005518 Bacteria 1314
310 Ga0070699_100437578 3300005518 Bacteria 1185
311 Ga0070699_100539103 3300005518 Bacteria 1062
312 Ga0070699_100938050 3300005518 Bacteria 793
313 Ga0070699_101892382 3300005518 Unclassified 546
314 Ga0070679_100008441 3300005530 Bacteria 9697
315 Ga0070679_100042847 3300005530 Bacteria 4508
316 Ga0070679_100076461 3300005530 Bacteria 3338
317 Ga0070679_100080173 3300005530 Bacteria 3253
318 Ga0070679_100125474 3300005530 Bacteria 2549
319 Ga0070679_100251947 3300005530 Bacteria 1722
320 Ga0070679_100259128 3300005530 Unclassified 1694
321 Ga0070679_100301444 3300005530 Unclassified 1553
322 Ga0070679_100319813 3300005530 Bacteria 1501
323 Ga0070679_100596183 3300005530 Bacteria 1048
324 Ga0070684_100096875 3300005535 Bacteria 2630
325 Ga0070684_100159725 3300005535 Unclassified 2044
326 Ga0070697_101528259 3300005536 Unclassified 597
327 Ga0070697_102024739 3300005536 Unclassified 515
328 Ga0070697_102127823 3300005536 Unclassified 502
329 Ga0068853_100019451 3300005539 Bacteria 5629
330 Ga0068853_100022517 3300005539 Bacteria 5263
331 Ga0068853_100052514 3300005539 Bacteria 3511
332 Ga0068853_100103359 3300005539 Bacteria 2522
333 Ga0068853_100158080 3300005539 Unclassified 2043
334 Ga0068853_100206402 3300005539 Bacteria 1789
335 Ga0068853_100280532 3300005539 Unclassified 1536
336 Ga0068853_100298682 3300005539 Bacteria 1488
337 Ga0068853_100411231 3300005539 Unclassified 1267
338 Ga0068853_100521878 3300005539 Unclassified 1123
339 Ga0068853_100927427 3300005539 Bacteria 837
340 Ga0068853_102215221 3300005539 Unclassified 533
341 Ga0070672_100013833 3300005543 Bacteria 5706
342 Ga0070672_100015091 3300005543 Bacteria 5491
343 Ga0070672_100079583 3300005543 Bacteria 2624
344 Ga0070672_100095050 3300005543 Bacteria 2410
345 Ga0070672_100121800 3300005543 Unclassified 2136
346 Ga0070672_100127589 3300005543 Bacteria 2088
347 Ga0070672_100215099 3300005543 Bacteria 1611
348 Ga0070672_102110348 3300005543 Unclassified 508
349 Ga0070686_100005635 3300005544 Bacteria 6937
350 Ga0070686_100060398 3300005544 Bacteria 2446
351 Ga0070686_100097759 3300005544 Unclassified 1977
352 Ga0070695_100023917 3300005545 Bacteria 3761
353 Ga0070695_100050540 3300005545 Bacteria 2664
354 Ga0070695_100157197 3300005545 Bacteria 1592
355 Ga0070695_100378936 3300005545 Unclassified 1067
356 Ga0070695_100835014 3300005545 Bacteria 740
357 Ga0070695_101074094 3300005545 Unclassified 658
358 Ga0070695_101139591 3300005545 Unclassified 640
359 Ga0070695_101299476 3300005545 Unclassified 601
360 Ga0070696_100004634 3300005546 Bacteria 9181
361 Ga0070696_100038973 3300005546 Unclassified 3281
362 Ga0070696_100227187 3300005546 Bacteria 1403
363 Ga0070696_100288623 3300005546 Bacteria 1253
364 Ga0070696_100362629 3300005546 Unclassified 1125
365 Ga0070696_100462227 3300005546 Bacteria 1003
366 Ga0070696_100773568 3300005546 Unclassified 788
367 Ga0070696_100858165 3300005546 Bacteria 751
368 Ga0070696_101511106 3300005546 Bacteria 575
369 Ga0070693_100004817 3300005547 Bacteria 6431
370 Ga0070693_100065501 3300005547 Bacteria 2124
371 Ga0070693_100196826 3300005547 Unclassified 1306
372 Ga0070693_100227622 3300005547 Bacteria 1225
373 Ga0070693_100306885 3300005547 Unclassified 1072
374 Ga0070693_100400481 3300005547 Bacteria 951
375 Ga0070693_100626973 3300005547 Unclassified 779
376 Ga0070693_100840614 3300005547 Unclassified 683
377 Ga0070693_100899669 3300005547 Bacteria 663
378 Ga0070665_100012865 3300005548 Bacteria 8426
379 Ga0070665_100013219 3300005548 Bacteria 8315
380 Ga0070665_100035715 3300005548 Bacteria 4999
381 Ga0070665_100107758 3300005548 Bacteria 2789
382 Ga0070665_100116962 3300005548 Bacteria 2669
383 Ga0070665_100199146 3300005548 Bacteria 2003
384 Ga0070665_100430312 3300005548 Unclassified 1329
385 Ga0070665_100709487 3300005548 Bacteria 1019
386 Ga0070665_101142108 3300005548 Bacteria 790
387 Ga0070704_100026286 3300005549 Bacteria 3844
388 Ga0070704_100090377 3300005549 Bacteria 2280
389 Ga0070704_100114743 3300005549 Unclassified 2057
390 Ga0070704_100208655 3300005549 Unclassified 1582
391 Ga0070704_100313604 3300005549 Bacteria 1311
392 Ga0070704_100477121 3300005549 Unclassified 1078
393 Ga0070704_100827580 3300005549 Unclassified 829
394 Ga0070704_101044853 3300005549 Bacteria 740
395 Ga0068855_100002546 3300005563 Bacteria 22453
396 Ga0068855_100105240 3300005563 Bacteria 3244
397 Ga0068855_100290198 3300005563 Unclassified 1814
398 Ga0068855_100357242 3300005563 Bacteria 1608
399 Ga0068855_100484186 3300005563 Unclassified 1346
400 Ga0068855_100509770 3300005563 Unclassified 1306
401 Ga0068855_100887707 3300005563 Bacteria 942
402 Ga0068855_101511400 3300005563 Unclassified 689
403 Ga0068855_102242162 3300005563 Bacteria 547
404 Ga0068855_102324797 3300005563 Bacteria 536
405 Ga0070664_100001257 3300005564 Bacteria 20297
406 Ga0070664_100031737 3300005564 Bacteria 4416
407 Ga0070664_100064284 3300005564 Unclassified 3129
408 Ga0070664_100123104 3300005564 Bacteria 2272
409 Ga0070664_100141352 3300005564 Bacteria 2120
410 Ga0070664_100215992 3300005564 Bacteria 1715
411 Ga0070664_100272223 3300005564 Unclassified 1526
412 Ga0070664_100308626 3300005564 Bacteria 1431
413 Ga0070664_100369237 3300005564 Bacteria 1308
414 Ga0070664_100413530 3300005564 Unclassified 1234
415 Ga0070664_100827069 3300005564 Unclassified 867
416 Ga0070664_100937555 3300005564 Bacteria 812
417 Ga0070664_101182474 3300005564 Unclassified 721
418 Ga0070664_101282059 3300005564 Unclassified 692
419 Ga0068857_100005948 3300005577 Bacteria 10419
420 Ga0068857_100083566 3300005577 Bacteria 2852
421 Ga0068857_100098329 3300005577 Unclassified 2625
422 Ga0068857_100159206 3300005577 Unclassified 2048
423 Ga0068857_100721645 3300005577 Unclassified 948
424 Ga0068857_100735486 3300005577 Bacteria 939
425 Ga0068857_100955879 3300005577 Bacteria 823
426 Ga0068857_101447389 3300005577 Bacteria 669
427 Ga0068854_100006199 3300005578 Bacteria 7594
428 Ga0068854_100038550 3300005578 Bacteria 3362
429 Ga0068854_100087867 3300005578 Unclassified 2307
430 Ga0068854_100101714 3300005578 Bacteria 2155
431 Ga0068854_100102421 3300005578 Unclassified 2148
432 Ga0068854_100445694 3300005578 Bacteria 1080
433 Ga0068854_100464339 3300005578 Bacteria 1060
434 Ga0068854_100512922 3300005578 Unclassified 1011
435 Ga0068856_100001602 3300005614 Bacteria 23652
436 Ga0068856_100002156 3300005614 Bacteria 20390
437 Ga0068856_100047408 3300005614 Bacteria 4232
438 Ga0068856_100385278 3300005614 Unclassified 1421
439 Ga0068856_100568860 3300005614 Unclassified 1155
440 Ga0068856_100669447 3300005614 Bacteria 1058
441 Ga0068856_100927148 3300005614 Unclassified 890
442 Ga0068856_101268313 3300005614 Unclassified 752
443 Ga0070702_100040186 3300005615 Bacteria 2615
444 Ga0070702_100051126 3300005615 Bacteria 2364
445 Ga0070702_100061823 3300005615 Bacteria 2182
446 Ga0070702_100086126 3300005615 Unclassified 1894
447 Ga0070702_100187184 3300005615 Bacteria 1359
448 Ga0070702_100856062 3300005615 Bacteria 708
449 Ga0070702_101290026 3300005615 Unclassified 592
450 Ga0070702_101553111 3300005615 Unclassified 546
451 Ga0068852_100042663 3300005616 Unclassified 3842
452 Ga0068852_100046641 3300005616 Bacteria 3693
453 Ga0068852_100083858 3300005616 Bacteria 2835
454 Ga0068852_100115314 3300005616 Bacteria 2449
455 Ga0068852_100144376 3300005616 Unclassified 2206
456 Ga0068852_100174862 3300005616 Unclassified 2015
457 Ga0068852_100210494 3300005616 Bacteria 1844
458 Ga0068852_100407373 3300005616 Bacteria 1339
459 Ga0068852_100526494 3300005616 Bacteria 1180
460 Ga0068852_100796811 3300005616 Unclassified 959
461 Ga0068852_101947952 3300005616 Bacteria 610
462 Ga0068852_102298120 3300005616 Unclassified 560
463 Ga0068852_102429556 3300005616 Bacteria 545
464 Ga0068852_102826679 3300005616 Unclassified 504
465 Ga0068859_100015827 3300005617 Bacteria 7579
466 Ga0068859_100018029 3300005617 Bacteria 7094
467 Ga0068859_100019812 3300005617 Bacteria 6753
468 Ga0068859_100049072 3300005617 Bacteria 4239
469 Ga0068859_100059335 3300005617 Unclassified 3855
470 Ga0068859_100069544 3300005617 Bacteria 3555
471 Ga0068859_100092241 3300005617 Bacteria 3080
472 Ga0068859_100321720 3300005617 Bacteria 1641
473 Ga0068859_100467999 3300005617 Bacteria 1356
474 Ga0068859_100789960 3300005617 Unclassified 1037
475 Ga0068859_101892456 3300005617 Bacteria 659
476 Ga0068859_102873878 3300005617 Unclassified 528
477 Ga0068864_100001539 3300005618 Bacteria 18988
478 Ga0068864_100016527 3300005618 Bacteria 6140
479 Ga0068864_100018763 3300005618 Bacteria 5780
480 Ga0068864_100028441 3300005618 Bacteria 4725
481 Ga0068864_100122680 3300005618 Unclassified 2325
482 Ga0068864_100124920 3300005618 Unclassified 2305
483 Ga0068864_100200613 3300005618 Bacteria 1832
484 Ga0068864_100232640 3300005618 Unclassified 1705
485 Ga0068864_100401042 3300005618 Bacteria 1303
486 Ga0068864_100402929 3300005618 Unclassified 1300
487 Ga0068864_100408947 3300005618 Unclassified 1291
488 Ga0068866_10011830 3300005718 Bacteria 3788
489 Ga0068866_10036515 3300005718 Bacteria 2408
490 Ga0068866_10118687 3300005718 Bacteria 1487
491 Ga0068861_100048747 3300005719 Bacteria 3203
492 Ga0068861_100061831 3300005719 Unclassified 2875
493 Ga0068861_100065544 3300005719 Bacteria 2798
494 Ga0068861_100135341 3300005719 Unclassified 2004
495 Ga0068861_100158484 3300005719 Bacteria 1865
496 Ga0068861_100203510 3300005719 Unclassified 1663
497 Ga0068861_100918846 3300005719 Bacteria 830
498 Ga0068861_102214356 3300005719 Unclassified 551
499 Ga0068851_10001999 3300005834 Bacteria 8979
500 Ga0068851_10013816 3300005834 Bacteria 3823
501 Ga0068851_10057043 3300005834 Unclassified 1993
502 Ga0068851_10082535 3300005834 Unclassified 1680
503 Ga0068851_10084891 3300005834 Unclassified 1659
504 Ga0068851_10130056 3300005834 Unclassified 1361
505 Ga0068851_10625733 3300005834 Bacteria 657
506 Ga0068870_10039515 3300005840 Bacteria 2442
507 Ga0068870_10051306 3300005840 Bacteria 2183
508 Ga0068870_10066628 3300005840 Unclassified 1951
509 Ga0068870_10213101 3300005840 Bacteria 1178
510 Ga0068870_10587058 3300005840 Bacteria 755
511 Ga0068870_10898749 3300005840 Unclassified 625
512 Ga0068863_100001441 3300005841 Bacteria 23595
513 Ga0068863_100017237 3300005841 Bacteria 6926
514 Ga0068863_100087034 3300005841 Bacteria 2960
515 Ga0068863_100156045 3300005841 Unclassified 2185
516 Ga0068863_100194943 3300005841 Bacteria 1947
517 Ga0068863_100200742 3300005841 Bacteria 1918
518 Ga0068863_100374532 3300005841 Bacteria 1390
519 Ga0068863_100379177 3300005841 Unclassified 1381
520 Ga0068863_100488900 3300005841 Unclassified 1211
521 Ga0068863_100735119 3300005841 Unclassified 982
522 Ga0068863_100791620 3300005841 Unclassified 945
523 Ga0068863_100813053 3300005841 Unclassified 932
524 Ga0068863_101544961 3300005841 Bacteria 672
525 Ga0068863_101785510 3300005841 Bacteria 625
526 Ga0068863_102273297 3300005841 Bacteria 552
527 Ga0068863_102414734 3300005841 Unclassified 535
528 Ga0068858_100000589 3300005842 Bacteria 38060
529 Ga0068858_100004799 3300005842 Bacteria 13246
530 Ga0068858_100012334 3300005842 Bacteria 8058
531 Ga0068858_100014404 3300005842 Bacteria 7456
532 Ga0068858_100022592 3300005842 Bacteria 5867
533 Ga0068858_100118132 3300005842 Unclassified 2479
534 Ga0068858_100129579 3300005842 Bacteria 2364
535 Ga0068858_100256931 3300005842 Bacteria 1660
536 Ga0068858_102134332 3300005842 Bacteria 554
537 Ga0068860_100010291 3300005843 Bacteria 9252
538 Ga0068860_100017765 3300005843 Bacteria 6931
539 Ga0068860_100074438 3300005843 Bacteria 3230
540 Ga0068860_100095639 3300005843 Unclassified 2831
541 Ga0068860_100118830 3300005843 Bacteria 2530
542 Ga0068860_100153783 3300005843 Unclassified 2216
543 Ga0068860_100267939 3300005843 Unclassified 1666
544 Ga0068860_100290606 3300005843 Unclassified 1599
545 Ga0068860_100310900 3300005843 Bacteria 1545
546 Ga0068860_101464426 3300005843 Unclassified 704
547 Ga0068860_102643343 3300005843 Unclassified 521
548 Ga0068862_100016720 3300005844 Bacteria 6109
549 Ga0068862_100059648 3300005844 Bacteria 3277
550 Ga0068862_100067790 3300005844 Bacteria 3077
551 Ga0068862_100117170 3300005844 Bacteria 2344
552 Ga0068862_100189901 3300005844 Unclassified 1848
553 Ga0068862_100498901 3300005844 Bacteria 1155
554 Ga0068862_100728902 3300005844 Bacteria 963
555 Ga0081455_10310480 3300005937 Unclassified 1127
556 Ga0070717_11060748 3300006028 Bacteria 738
557 Ga0070715_10164408 3300006163 Bacteria 1099
558 Ga0070715_10657133 3300006163 Bacteria 621
559 Ga0070716_100330565 3300006173 Bacteria 1071
560 Ga0070716_100385526 3300006173 Unclassified 1003
561 Ga0070716_100681644 3300006173 Bacteria 783
562 Ga0070716_100886144 3300006173 Unclassified 697
563 Ga0070716_101040773 3300006173 Unclassified 649
564 Ga0070716_101486219 3300006173 Unclassified 553
565 Ga0070712_100033292 3300006175 Bacteria 3486
566 Ga0070712_100225924 3300006175 Unclassified 1484
567 Ga0097621_100004089 3300006237 Bacteria 10117
568 Ga0097621_100014593 3300006237 Bacteria 5886
569 Ga0097621_100041031 3300006237 Bacteria 3723
570 Ga0097621_100128865 3300006237 Unclassified 2152
571 Ga0097621_100232294 3300006237 Bacteria 1610
572 Ga0097621_100297583 3300006237 Unclassified 1424
573 Ga0097621_100487297 3300006237 Unclassified 1115
574 Ga0097621_100487823 3300006237 Bacteria 1115
575 Ga0097621_100825656 3300006237 Bacteria 860
576 Ga0097621_100997665 3300006237 Bacteria 783
577 Ga0097621_101306896 3300006237 Unclassified 685
578 Ga0097621_101391913 3300006237 Bacteria 664
579 Ga0097621_101708842 3300006237 Unclassified 599
580 Ga0097621_102289254 3300006237 Bacteria 517
581 Ga0068871_100003130 3300006358 Bacteria 11355
582 Ga0068871_100007688 3300006358 Bacteria 7711
583 Ga0068871_100015714 3300006358 Bacteria 5678
584 Ga0068871_100078886 3300006358 Unclassified 2723
585 Ga0068871_100141572 3300006358 Bacteria 2045
586 Ga0068871_100215163 3300006358 Unclassified 1663
587 Ga0068871_100409287 3300006358 Bacteria 1209
588 Ga0068871_100533183 3300006358 Bacteria 1061
589 Ga0068871_100909574 3300006358 Bacteria 816
590 Ga0068871_101269018 3300006358 Bacteria 692
591 Ga0075428_100007543 3300006844 Bacteria 12057
592 Ga0075428_100144257 3300006844 Bacteria 2588
593 Ga0075430_100532232 3300006846 Bacteria 969
594 Ga0075431_100011566 3300006847 Bacteria 8900
595 Ga0075433_10135402 3300006852 Bacteria 2189
596 Ga0075433_10252791 3300006852 Bacteria 1563
597 Ga0075433_10583903 3300006852 Unclassified 981
598 Ga0075433_10710338 3300006852 Bacteria 880
599 Ga0075433_10957242 3300006852 Bacteria 746
600 Ga0075434_100078429 3300006871 Unclassified 3298
601 Ga0075434_100332115 3300006871 Bacteria 1541
602 Ga0075434_100370216 3300006871 Bacteria 1454
603 Ga0075434_100462540 3300006871 Unclassified 1290
604 Ga0075434_100996301 3300006871 Bacteria 852
605 Ga0075434_101746568 3300006871 Unclassified 629
606 Ga0075429_100000246 3300006880 Bacteria 37274
607 Ga0075429_100127995 3300006880 Bacteria 2221
608 Ga0075429_101377954 3300006880 Unclassified 614
609 Ga0075429_101458584 3300006880 Unclassified 596
610 Ga0075429_101983230 3300006880 Bacteria 504
611 Ga0068865_100009442 3300006881 Bacteria 6050
612 Ga0068865_100037493 3300006881 Bacteria 3273
613 Ga0068865_100060849 3300006881 Bacteria 2645
614 Ga0068865_100084423 3300006881 Bacteria 2288
615 Ga0068865_100254632 3300006881 Bacteria 1387
616 Ga0068865_101488558 3300006881 Unclassified 606
617 Ga0068865_101965812 3300006881 Unclassified 530
618 Ga0075436_100012918 3300006914 Bacteria 5727
619 Ga0075436_100014067 3300006914 Bacteria 5477
620 Ga0075436_100129577 3300006914 Bacteria 1768
621 Ga0075436_100214359 3300006914 Unclassified 1365
622 Ga0075436_100235336 3300006914 Unclassified 1301
623 Ga0075436_100387679 3300006914 Bacteria 1011
624 Ga0097620_100015827 3300006931 Bacteria 7579
625 Ga0097620_100018029 3300006931 Bacteria 7094
626 Ga0097620_100019813 3300006931 Bacteria 6753
627 Ga0097620_100049072 3300006931 Bacteria 4239
628 Ga0097620_100059334 3300006931 Unclassified 3855
629 Ga0097620_100069545 3300006931 Bacteria 3555
630 Ga0097620_100092242 3300006931 Bacteria 3080
631 Ga0097620_100321694 3300006931 Bacteria 1641
632 Ga0097620_100468034 3300006931 Bacteria 1356
633 Ga0097620_100789939 3300006931 Unclassified 1037
634 Ga0097620_101892484 3300006931 Bacteria 659
635 Ga0097620_102873951 3300006931 Unclassified 528
636 Ga0075435_100042533 3300007076 Bacteria 3635
637 Ga0075435_100062154 3300007076 Unclassified 3030
638 Ga0075435_100143977 3300007076 Bacteria 2001
639 Ga0075435_100146420 3300007076 Bacteria 1984
640 Ga0075435_100204015 3300007076 Bacteria 1676
641 Ga0075435_100595083 3300007076 Unclassified 959
642 Ga0099794_10016305 3300007265 Bacteria 3291
643 Ga0099794_10764129 3300007265 Bacteria 516
644 Ga0105251_10265511 3300009011 Bacteria 775
645 Ga0105251_10443538 3300009011 Unclassified 601
646 Ga0105240_10031680 3300009093 Bacteria 6852
647 Ga0105240_10101076 3300009093 Bacteria 3508
648 Ga0105240_10198538 3300009093 Unclassified 2353
649 Ga0105240_10233150 3300009093 Bacteria 2138
650 Ga0105240_10796005 3300009093 Unclassified 1024
651 Ga0105240_11688454 3300009093 Unclassified 661
652 Ga0111539_10000195 3300009094 Bacteria 71206
653 Ga0111539_10023013 3300009094 Bacteria 7652
654 Ga0111539_10164278 3300009094 Bacteria 2597
655 Ga0111539_10399830 3300009094 Bacteria 1600
656 Ga0111539_10452577 3300009094 Unclassified 1495
657 Ga0105245_10077347 3300009098 Bacteria 3033
658 Ga0105245_10114911 3300009098 Unclassified 2507
659 Ga0105245_10214936 3300009098 Unclassified 1852
660 Ga0105245_10325837 3300009098 Bacteria 1515
661 Ga0105245_10397794 3300009098 Bacteria 1376
662 Ga0105245_10745328 3300009098 Bacteria 1015
663 Ga0105245_11222456 3300009098 Unclassified 799
664 Ga0105245_11447549 3300009098 Unclassified 737
665 Ga0105245_11829198 3300009098 Bacteria 660
666 Ga0105245_12056515 3300009098 Bacteria 625
667 Ga0105247_10076918 3300009101 Bacteria 2096
668 Ga0105247_10123240 3300009101 Bacteria 1682
669 Ga0105247_10536275 3300009101 Unclassified 858
670 Ga0114129_10183138 3300009147 Bacteria 2849
671 Ga0114129_10694310 3300009147 Bacteria 1309
672 Ga0114129_10703512 3300009147 Bacteria 1298
673 Ga0114129_11277426 3300009147 Unclassified 911
674 Ga0105243_10082290 3300009148 Bacteria 2631
675 Ga0105243_10308179 3300009148 Unclassified 1438
676 Ga0105243_10899719 3300009148 Unclassified 880
677 Ga0105243_12275536 3300009148 Unclassified 579
678 Ga0105243_12516822 3300009148 Unclassified 554
679 Ga0105241_10043591 3300009174 Bacteria 3398
680 Ga0105241_10115898 3300009174 Unclassified 2151
681 Ga0105241_10336854 3300009174 Bacteria 1306
682 Ga0105241_10635409 3300009174 Unclassified 968
683 Ga0105241_10863777 3300009174 Bacteria 838
684 Ga0105241_11347129 3300009174 Bacteria 681
685 Ga0105242_10002633 3300009176 Bacteria 14068
686 Ga0105242_10010752 3300009176 Bacteria 7026
687 Ga0105242_10017032 3300009176 Bacteria 5659
688 Ga0105242_10260704 3300009176 Unclassified 1566
689 Ga0105242_10261351 3300009176 Unclassified 1564
690 Ga0105242_10867696 3300009176 Unclassified 899
691 Ga0105242_11629262 3300009176 Unclassified 680
692 Ga0105248_10003518 3300009177 Bacteria 17377
693 Ga0105248_10010942 3300009177 Bacteria 10012
694 Ga0105248_10017598 3300009177 Bacteria 7882
695 Ga0105248_10019421 3300009177 Bacteria 7519
696 Ga0105248_10051863 3300009177 Bacteria 4603
697 Ga0105248_10293213 3300009177 Unclassified 1832
698 Ga0105248_10304481 3300009177 Unclassified 1795
699 Ga0105248_10343616 3300009177 Bacteria 1680
700 Ga0105248_10713621 3300009177 Bacteria 1131
701 Ga0105248_11684961 3300009177 Unclassified 719
702 Ga0105248_12471720 3300009177 Bacteria 592
703 Ga0105237_10203754 3300009545 Unclassified 1979
704 Ga0105237_10487301 3300009545 Unclassified 1239
705 Ga0105237_11633417 3300009545 Unclassified 651
706 Ga0105238_10024374 3300009551 Bacteria 6167
707 Ga0105238_10156061 3300009551 Unclassified 2258
708 Ga0105238_10667544 3300009551 Bacteria 1050
709 Ga0105249_10014175 3300009553 Bacteria 7047
710 Ga0105249_10092230 3300009553 Bacteria 2835
711 Ga0105249_10255081 3300009553 Unclassified 1740
712 Ga0105249_10332451 3300009553 Bacteria 1534
713 Ga0105249_10418227 3300009553 Unclassified 1374
714 Ga0105249_10509027 3300009553 Bacteria 1250
715 Ga0105239_10117283 3300010375 Bacteria 2955
716 Ga0105239_10422625 3300010375 Bacteria 1510
717 Ga0105239_10521632 3300010375 Bacteria 1352
718 Ga0105239_10859399 3300010375 Bacteria 1041
719 Ga0105239_10866022 3300010375 Bacteria 1036
720 Ga0105239_10935396 3300010375 Bacteria 995
721 Ga0105239_11115700 3300010375 Unclassified 908
722 Ga0105239_11462060 3300010375 Bacteria 789
723 Ga0105239_11482063 3300010375 Unclassified 784
724 Ga0105246_10112024 3300011119 Unclassified 2006
725 Ga0105246_10205189 3300011119 Unclassified 1535
726 Ga0105246_11199352 3300011119 Unclassified 698
727 Ga0105246_11337520 3300011119 Unclassified 666
728 Ga0105246_12231043 3300011119 Unclassified 533
729 Ga0157346_1024513 3300012480 Bacteria 550
730 Ga0157347_1071702 3300012502 Bacteria 513
731 Ga0157315_1055998 3300012508 Bacteria 543
732 Ga0157327_1002323 3300012512 Unclassified 1300
733 Ga0157327_1028783 3300012512 Unclassified 680
734 Ga0157326_1012603 3300012513 Bacteria 966
735 Ga0157373_10000924 3300013100 Bacteria 22752
736 Ga0157373_10004866 3300013100 Bacteria 10109
737 Ga0157373_10010017 3300013100 Bacteria 6985
738 Ga0157373_10087676 3300013100 Bacteria 2192
739 Ga0157373_10097260 3300013100 Bacteria 2072
740 Ga0157373_10315923 3300013100 Unclassified 1111
741 Ga0157373_10366929 3300013100 Unclassified 1028
742 Ga0157373_10765268 3300013100 Bacteria 710
743 Ga0157373_11112349 3300013100 Unclassified 593
744 Ga0157371_10000522 3300013102 Bacteria 45892
745 Ga0157371_10095066 3300013102 Bacteria 2112
746 Ga0157371_10106920 3300013102 Unclassified 1985
747 Ga0157371_10207796 3300013102 Unclassified 1404
748 Ga0157371_10275225 3300013102 Unclassified 1215
749 Ga0157370_10008483 3300013104 Bacteria 11083
750 Ga0157370_10017692 3300013104 Bacteria 7185
751 Ga0157370_10025706 3300013104 Bacteria 5826
752 Ga0157370_10040137 3300013104 Bacteria 4520
753 Ga0157370_10058192 3300013104 Bacteria 3674
754 Ga0157370_10086348 3300013104 Bacteria 2948
755 Ga0157370_10192649 3300013104 Bacteria 1892
756 Ga0157370_10216045 3300013104 Unclassified 1777
757 Ga0157370_10234210 3300013104 Unclassified 1699
758 Ga0157370_10828646 3300013104 Bacteria 841
759 Ga0157370_10843052 3300013104 Bacteria 833
760 Ga0157370_10859511 3300013104 Bacteria 824
761 Ga0157370_11188711 3300013104 Bacteria 688
762 Ga0157370_11954372 3300013104 Unclassified 526
763 Ga0157369_10008534 3300013105 Bacteria 11752
764 Ga0157369_10028175 3300013105 Bacteria 6217
765 Ga0157369_10210740 3300013105 Unclassified 2037
766 Ga0157369_10537086 3300013105 Bacteria 1209
767 Ga0157369_10591334 3300013105 Unclassified 1146
768 Ga0157369_10969805 3300013105 Unclassified 871
769 Ga0157369_12606799 3300013105 Bacteria 511
770 Ga0157374_10014172 3300013296 Bacteria 6970
771 Ga0157374_10015548 3300013296 Bacteria 6676
772 Ga0157374_10159910 3300013296 Bacteria 2194
773 Ga0157374_10216117 3300013296 Unclassified 1880
774 Ga0157374_10449387 3300013296 Unclassified 1290
775 Ga0157374_10750388 3300013296 Unclassified 990
776 Ga0157378_10022416 3300013297 Bacteria 5560
777 Ga0157378_10030813 3300013297 Bacteria 4736
778 Ga0157378_10063819 3300013297 Bacteria 3292
779 Ga0157378_10093932 3300013297 Bacteria 2731
780 Ga0157378_10137664 3300013297 Unclassified 2265
781 Ga0157378_10193198 3300013297 Bacteria 1921
782 Ga0157378_10258969 3300013297 Unclassified 1668
783 Ga0157378_10562485 3300013297 Unclassified 1147
784 Ga0157378_10848758 3300013297 Bacteria 941
785 Ga0157378_11579720 3300013297 Unclassified 701
786 Ga0157378_11682060 3300013297 Unclassified 681
787 Ga0157378_12837149 3300013297 Unclassified 537
788 Ga0163162_10003693 3300013306 Bacteria 14684
789 Ga0163162_10015795 3300013306 Bacteria 7379
790 Ga0163162_10016299 3300013306 Bacteria 7265
791 Ga0163162_10047059 3300013306 Bacteria 4324
792 Ga0163162_10173212 3300013306 Unclassified 2283
793 Ga0163162_10247203 3300013306 Bacteria 1915
794 Ga0163162_10301193 3300013306 Bacteria 1735
795 Ga0163162_10317641 3300013306 Unclassified 1690
796 Ga0163162_10333030 3300013306 Unclassified 1650
797 Ga0163162_10366269 3300013306 Bacteria 1574
798 Ga0163162_10400164 3300013306 Bacteria 1506
799 Ga0163162_10438274 3300013306 Unclassified 1439
800 Ga0163162_10581640 3300013306 Bacteria 1247
801 Ga0163162_10660065 3300013306 Bacteria 1169
802 Ga0157372_10000791 3300013307 Bacteria 34366
803 Ga0157372_10037987 3300013307 Bacteria 5313
804 Ga0157372_10067738 3300013307 Bacteria 4012
805 Ga0157372_10091093 3300013307 Bacteria 3468
806 Ga0157372_10155687 3300013307 Bacteria 2639
807 Ga0157372_10208264 3300013307 Bacteria 2266
808 Ga0157372_10228524 3300013307 Bacteria 2157
809 Ga0157372_10327178 3300013307 Bacteria 1784
810 Ga0157372_10361317 3300013307 Bacteria 1692
811 Ga0157372_10484782 3300013307 Bacteria 1441
812 Ga0157372_10546423 3300013307 Unclassified 1350
813 Ga0157372_10667312 3300013307 Unclassified 1210
814 Ga0157372_10903519 3300013307 Bacteria 1025
815 Ga0157372_11291431 3300013307 Unclassified 842
816 Ga0157372_11512751 3300013307 Unclassified 773
817 Ga0157372_12393826 3300013307 Unclassified 606
818 Ga0157372_12446361 3300013307 Bacteria 600
819 Ga0157375_10008788 3300013308 Bacteria 8853
820 Ga0157375_10021744 3300013308 Bacteria 5890
821 Ga0157375_10027347 3300013308 Bacteria 5331
822 Ga0157375_10053515 3300013308 Bacteria 3972
823 Ga0157375_10056342 3300013308 Bacteria 3880
824 Ga0157375_10615346 3300013308 Bacteria 1244
825 Ga0157375_10816115 3300013308 Bacteria 1081
826 Ga0157375_10980118 3300013308 Unclassified 986
827 Ga0163163_10000711 3300014325 Bacteria 28250
828 Ga0163163_10008173 3300014325 Bacteria 9281
829 Ga0163163_10017329 3300014325 Bacteria 6716
830 Ga0163163_10069005 3300014325 Bacteria 3519
831 Ga0163163_10276484 3300014325 Bacteria 1730
832 Ga0163163_10285024 3300014325 Unclassified 1704
833 Ga0163163_10426273 3300014325 Bacteria 1386
834 Ga0157380_10011555 3300014326 Bacteria 6381
835 Ga0157380_10023350 3300014326 Bacteria 4664
836 Ga0157380_10073132 3300014326 Bacteria 2778
837 Ga0157380_10078634 3300014326 Bacteria 2691
838 Ga0157380_10136617 3300014326 Unclassified 2099
839 Ga0157380_10157696 3300014326 Bacteria 1969
840 Ga0157380_10379053 3300014326 Bacteria 1334
841 Ga0157380_10578790 3300014326 Unclassified 1107
842 Ga0157380_10642519 3300014326 Unclassified 1057
843 Ga0157380_12344091 3300014326 Unclassified 599
844 Ga0157380_13461682 3300014326 Bacteria 505
845 Ga0182008_10186658 3300014497 Bacteria 1051
846 Ga0182008_10380842 3300014497 Unclassified 754
847 Ga0182008_10709129 3300014497 Bacteria 575
848 Ga0157377_10082207 3300014745 Unclassified 1885
849 Ga0157377_10110404 3300014745 Unclassified 1652
850 Ga0157377_10148780 3300014745 Bacteria 1446
851 Ga0157377_10161313 3300014745 Archaea 1394
852 Ga0157377_11462939 3300014745 Unclassified 541
853 Ga0157379_10000435 3300014968 Bacteria 33882
854 Ga0157379_10002996 3300014968 Bacteria 14245
855 Ga0157379_10008172 3300014968 Bacteria 9086
856 Ga0157379_10161586 3300014968 Unclassified 2022
857 Ga0157379_10162703 3300014968 Bacteria 2014
858 Ga0157379_10875159 3300014968 Bacteria 851
859 Ga0157376_10004673 3300014969 Bacteria 9547
860 Ga0157376_10028758 3300014969 Bacteria 4421
861 Ga0157376_10048570 3300014969 Bacteria 3510
862 Ga0157376_10069665 3300014969 Bacteria 2982
863 Ga0157376_10091393 3300014969 Bacteria 2637
864 Ga0157376_10165510 3300014969 Bacteria 2009
865 Ga0157376_10736273 3300014969 Unclassified 994
866 Ga0157376_11849580 3300014969 Unclassified 640
867 Ga0157376_11936351 3300014969 Bacteria 627
868 Ga0157376_13093663 3300014969 Unclassified 504
869 Ga0163161_10013817 3300017792 Bacteria 5624
870 Ga0163161_10015854 3300017792 Bacteria 5256
871 Ga0163161_10020209 3300017792 Bacteria 4672
872 Ga0163161_10091646 3300017792 Unclassified 2250
873 Ga0163161_10151770 3300017792 Bacteria 1761
874 Ga0163161_10203556 3300017792 Bacteria 1526
875 Ga0163161_10267989 3300017792 Bacteria 1336
876 Ga0163161_10398256 3300017792 Unclassified 1103
877 Ga0163161_11134578 3300017792 Bacteria 673
878 Ga0206356_11349820 3300020070 Unclassified 1901
879 Ga0207666_1021172 3300025271 Unclassified 957
880 Ga0207697_10015583 3300025315 Bacteria 3139
881 Ga0207697_10030581 3300025315 Unclassified 2204
882 Ga0207697_10033447 3300025315 Bacteria 2104
883 Ga0207656_10014591 3300025321 Unclassified 3031
884 Ga0207656_10039964 3300025321 Unclassified 1987
885 Ga0207656_10079589 3300025321 Unclassified 1470
886 Ga0207656_10081675 3300025321 Unclassified 1454
887 Ga0207656_10205203 3300025321 Bacteria 953
888 Ga0207656_10235326 3300025321 Unclassified 894
889 Ga0207653_10329735 3300025885 Unclassified 594
890 Ga0207682_10001165 3300025893 Bacteria 12192
891 Ga0207682_10027895 3300025893 Bacteria 2250
892 Ga0207682_10061317 3300025893 Unclassified 1574
893 Ga0207682_10066311 3300025893 Bacteria 1521
894 Ga0207682_10116073 3300025893 Unclassified 1183
895 Ga0207692_10019096 3300025898 Bacteria 3091
896 Ga0207692_10044673 3300025898 Unclassified 2212
897 Ga0207692_10297617 3300025898 Bacteria 981
898 Ga0207642_10003936 3300025899 Unclassified 4738
899 Ga0207642_10128602 3300025899 Unclassified 1318
900 Ga0207642_10131335 3300025899 Unclassified 1307
901 Ga0207642_10280273 3300025899 Bacteria 958
902 Ga0207642_10712692 3300025899 Bacteria 633
903 Ga0207710_10071241 3300025900 Unclassified 1594
904 Ga0207688_10001601 3300025901 Bacteria 11948
905 Ga0207688_10094936 3300025901 Unclassified 1716
906 Ga0207680_10013980 3300025903 Bacteria 4138
907 Ga0207680_10044551 3300025903 Unclassified 2610
908 Ga0207680_10099301 3300025903 Bacteria 1868
909 Ga0207680_10111354 3300025903 Bacteria 1776
910 Ga0207680_10198455 3300025903 Unclassified 1366
911 Ga0207680_10663097 3300025903 Unclassified 747
912 Ga0207685_10653651 3300025905 Bacteria 569
913 Ga0207699_10034540 3300025906 Unclassified 2870
914 Ga0207699_10045494 3300025906 Unclassified 2562
915 Ga0207699_10077587 3300025906 Bacteria 2050
916 Ga0207699_10146247 3300025906 Bacteria 1558
917 Ga0207699_10156992 3300025906 Bacteria 1511
918 Ga0207699_10164070 3300025906 Unclassified 1481
919 Ga0207699_10247232 3300025906 Bacteria 1228
920 Ga0207699_10613643 3300025906 Unclassified 793
921 Ga0207699_11330134 3300025906 Unclassified 532
922 Ga0207699_11463378 3300025906 Unclassified 505
923 Ga0207645_10000550 3300025907 Bacteria 31203
924 Ga0207645_10003083 3300025907 Bacteria 12792
925 Ga0207645_10022463 3300025907 Bacteria 4104
926 Ga0207645_10051618 3300025907 Bacteria 2627
927 Ga0207645_10059836 3300025907 Bacteria 2433
928 Ga0207645_10071387 3300025907 Bacteria 2222
929 Ga0207645_10264025 3300025907 Unclassified 1141
930 Ga0207645_10291645 3300025907 Bacteria 1085
931 Ga0207645_10453547 3300025907 Unclassified 866
932 Ga0207645_10540630 3300025907 Unclassified 790
933 Ga0207645_10562816 3300025907 Unclassified 773
934 Ga0207643_10002356 3300025908 Bacteria 10268
935 Ga0207643_10031260 3300025908 Bacteria 2967
936 Ga0207643_10066768 3300025908 Bacteria 2063
937 Ga0207643_10142696 3300025908 Unclassified 1431
938 Ga0207643_10394801 3300025908 Bacteria 874
939 Ga0207705_10021201 3300025909 Bacteria 4634
940 Ga0207705_10087765 3300025909 Unclassified 2275
941 Ga0207705_10200976 3300025909 Bacteria 1510
942 Ga0207705_11017988 3300025909 Unclassified 640
943 Ga0207705_11310724 3300025909 Bacteria 553
944 Ga0207684_10082815 3300025910 Unclassified 2732
945 Ga0207684_11713409 3300025910 Unclassified 506
946 Ga0207654_10077938 3300025911 Unclassified 1988
947 Ga0207654_10099007 3300025911 Bacteria 1793
948 Ga0207654_10123897 3300025911 Unclassified 1627
949 Ga0207654_10230407 3300025911 Bacteria 1233
950 Ga0207654_10280868 3300025911 Bacteria 1126
951 Ga0207707_10029586 3300025912 Bacteria 4790
952 Ga0207707_10079158 3300025912 Bacteria 2870
953 Ga0207707_10118532 3300025912 Bacteria 2313
954 Ga0207707_10125335 3300025912 Unclassified 2246
955 Ga0207707_10589942 3300025912 Bacteria 941
956 Ga0207707_10775887 3300025912 Unclassified 800
957 Ga0207707_11145707 3300025912 Bacteria 632
958 Ga0207695_10086838 3300025913 Bacteria 3153
959 Ga0207695_10185469 3300025913 Unclassified 2000
960 Ga0207695_10224060 3300025913 Bacteria 1787
961 Ga0207695_10345943 3300025913 Unclassified 1374
962 Ga0207671_10163888 3300025914 Unclassified 1723
963 Ga0207671_10244551 3300025914 Unclassified 1410
964 Ga0207693_10001152 3300025915 Bacteria 23588
965 Ga0207693_10049831 3300025915 Bacteria 3288
966 Ga0207693_10086503 3300025915 Bacteria 2456
967 Ga0207693_11390326 3300025915 Unclassified 521
968 Ga0207663_10065042 3300025916 Unclassified 2329
969 Ga0207663_10176964 3300025916 Bacteria 1520
970 Ga0207663_10280260 3300025916 Unclassified 1238
971 Ga0207663_10515164 3300025916 Unclassified 931
972 Ga0207663_10677917 3300025916 Bacteria 815
973 Ga0207663_10899092 3300025916 Unclassified 708
974 Ga0207660_10044479 3300025917 Bacteria 3124
975 Ga0207660_10198073 3300025917 Bacteria 1568
976 Ga0207660_10461290 3300025917 Bacteria 1028
977 Ga0207660_10587558 3300025917 Bacteria 907
978 Ga0207660_11120108 3300025917 Bacteria 641
979 Ga0207662_10049264 3300025918 Bacteria 2499
980 Ga0207662_10052420 3300025918 Bacteria 2428
981 Ga0207662_10081312 3300025918 Bacteria 1977
982 Ga0207662_10600643 3300025918 Unclassified 766
983 Ga0207657_10000657 3300025919 Bacteria 36802
984 Ga0207657_10001408 3300025919 Bacteria 25660
985 Ga0207657_10013958 3300025919 Bacteria 7859
986 Ga0207657_10020599 3300025919 Bacteria 6228
987 Ga0207657_10121179 3300025919 Bacteria 2152
988 Ga0207657_10149170 3300025919 Bacteria 1905
989 Ga0207657_10221545 3300025919 Bacteria 1515
990 Ga0207657_10489500 3300025919 Unclassified 964
991 Ga0207649_10024210 3300025920 Bacteria 3527
992 Ga0207649_10067313 3300025920 Unclassified 2273
993 Ga0207649_10148477 3300025920 Bacteria 1612
994 Ga0207649_10188319 3300025920 Unclassified 1449
995 Ga0207649_10264882 3300025920 Bacteria 1243
996 Ga0207649_10785988 3300025920 Unclassified 742
997 Ga0207649_11291461 3300025920 Unclassified 577
998 Ga0207649_11495038 3300025920 Unclassified 535
999 Ga0207652_10074087 3300025921 Bacteria 2964
1000 Ga0207652_10079820 3300025921 Unclassified 2859
1001 Ga0207652_10104887 3300025921 Bacteria 2501
1002 Ga0207652_10124051 3300025921 Bacteria 2300
1003 Ga0207652_10449195 3300025921 Bacteria 1162
1004 Ga0207652_10963275 3300025921 Bacteria 751
1005 Ga0207652_11070353 3300025921 Bacteria 706
1006 Ga0207652_11183430 3300025921 Bacteria 666
1007 Ga0207652_11252248 3300025921 Unclassified 644
1008 Ga0207646_10177965 3300025922 Bacteria 1921
1009 Ga0207646_10181019 3300025922 Unclassified 1904
1010 Ga0207646_11025643 3300025922 Unclassified 728
1011 Ga0207681_10024520 3300025923 Bacteria 3873
1012 Ga0207681_10030985 3300025923 Bacteria 3490
1013 Ga0207681_10067070 3300025923 Bacteria 2486
1014 Ga0207681_10143526 3300025923 Bacteria 1781
1015 Ga0207681_10237148 3300025923 Bacteria 1418
1016 Ga0207681_10322411 3300025923 Bacteria 1229
1017 Ga0207681_10734106 3300025923 Unclassified 822
1018 Ga0207681_10765370 3300025923 Bacteria 805
1019 Ga0207681_11230856 3300025923 Unclassified 629
1020 Ga0207681_11393076 3300025923 Unclassified 588
1021 Ga0207681_11477342 3300025923 Unclassified 570
1022 Ga0207681_11587658 3300025923 Bacteria 548
1023 Ga0207694_10076977 3300025924 Bacteria 2613
1024 Ga0207694_10101240 3300025924 Bacteria 2283
1025 Ga0207694_10225403 3300025924 Bacteria 1529
1026 Ga0207694_10359799 3300025924 Bacteria 1206
1027 Ga0207650_10003644 3300025925 Bacteria 10552
1028 Ga0207650_10021698 3300025925 Bacteria 4540
1029 Ga0207650_10035735 3300025925 Bacteria 3611
1030 Ga0207650_10070261 3300025925 Bacteria 2632
1031 Ga0207650_10081108 3300025925 Bacteria 2460
1032 Ga0207650_10148566 3300025925 Unclassified 1848
1033 Ga0207650_10149695 3300025925 Bacteria 1841
1034 Ga0207650_10378725 3300025925 Unclassified 1168
1035 Ga0207650_10495267 3300025925 Unclassified 1021
1036 Ga0207650_10545027 3300025925 Bacteria 972
1037 Ga0207650_10932194 3300025925 Bacteria 738
1038 Ga0207650_11683014 3300025925 Unclassified 538
1039 Ga0207659_10001433 3300025926 Bacteria 14213
1040 Ga0207659_10048208 3300025926 Bacteria 3017
1041 Ga0207659_10151305 3300025926 Unclassified 1812
1042 Ga0207659_10297135 3300025926 Unclassified 1325
1043 Ga0207659_10417070 3300025926 Unclassified 1125
1044 Ga0207659_10494310 3300025926 Bacteria 1035
1045 Ga0207659_10806855 3300025926 Unclassified 806
1046 Ga0207687_10000226 3300025927 Bacteria 38452
1047 Ga0207687_10002660 3300025927 Bacteria 12091
1048 Ga0207687_10046446 3300025927 Bacteria 3006
1049 Ga0207687_10055490 3300025927 Bacteria 2776
1050 Ga0207687_10265873 3300025927 Bacteria 1369
1051 Ga0207687_10387906 3300025927 Bacteria 1146
1052 Ga0207687_11436806 3300025927 Unclassified 593
1053 Ga0207700_10022679 3300025928 Bacteria 4311
1054 Ga0207700_10747477 3300025928 Unclassified 874
1055 Ga0207700_10752879 3300025928 Bacteria 871
1056 Ga0207664_10006209 3300025929 Bacteria 8205
1057 Ga0207664_10066211 3300025929 Bacteria 2895
1058 Ga0207664_10112380 3300025929 Bacteria 2267
1059 Ga0207664_10175051 3300025929 Bacteria 1839
1060 Ga0207664_11636971 3300025929 Unclassified 566
1061 Ga0207644_10004807 3300025931 Bacteria 8798
1062 Ga0207644_10011411 3300025931 Bacteria 5878
1063 Ga0207644_10012692 3300025931 Bacteria 5600
1064 Ga0207644_10093155 3300025931 Unclassified 2249
1065 Ga0207644_10095367 3300025931 Bacteria 2225
1066 Ga0207644_10095429 3300025931 Bacteria 2224
1067 Ga0207644_10230564 3300025931 Bacteria 1471
1068 Ga0207644_10259298 3300025931 Unclassified 1389
1069 Ga0207644_10296630 3300025931 Unclassified 1301
1070 Ga0207644_10438544 3300025931 Bacteria 1072
1071 Ga0207644_10525194 3300025931 Bacteria 978
1072 Ga0207644_10804128 3300025931 Bacteria 786
1073 Ga0207644_11188534 3300025931 Bacteria 641
1074 Ga0207644_11233433 3300025931 Unclassified 629
1075 Ga0207690_10000412 3300025932 Bacteria 28034
1076 Ga0207690_10093723 3300025932 Bacteria 2129
1077 Ga0207690_10133713 3300025932 Unclassified 1818
1078 Ga0207690_10463230 3300025932 Unclassified 1020
1079 Ga0207690_10488481 3300025932 Unclassified 995
1080 Ga0207706_10000164 3300025933 Bacteria 73885
1081 Ga0207706_10022175 3300025933 Bacteria 5700
1082 Ga0207706_10069635 3300025933 Bacteria 3094
1083 Ga0207706_10071211 3300025933 Unclassified 3058
1084 Ga0207706_10110613 3300025933 Bacteria 2417
1085 Ga0207706_10182126 3300025933 Bacteria 1845
1086 Ga0207706_10287749 3300025933 Unclassified 1433
1087 Ga0207706_10452135 3300025933 Bacteria 1111
1088 Ga0207706_10454499 3300025933 Bacteria 1108
1089 Ga0207706_10784095 3300025933 Bacteria 810
1090 Ga0207706_11380017 3300025933 Bacteria 579
1091 Ga0207706_11427130 3300025933 Bacteria 567
1092 Ga0207686_10000772 3300025934 Bacteria 19644
1093 Ga0207686_10005182 3300025934 Bacteria 7002
1094 Ga0207686_10010576 3300025934 Bacteria 5027
1095 Ga0207686_10369177 3300025934 Unclassified 1085
1096 Ga0207686_10985407 3300025934 Bacteria 683
1097 Ga0207709_10098944 3300025935 Bacteria 1924
1098 Ga0207709_10148098 3300025935 Unclassified 1622
1099 Ga0207709_10464819 3300025935 Unclassified 980
1100 Ga0207709_10476715 3300025935 Bacteria 969
1101 Ga0207709_10553114 3300025935 Unclassified 905
1102 Ga0207709_10911428 3300025935 Unclassified 715
1103 Ga0207670_10018114 3300025936 Bacteria 4272
1104 Ga0207670_10073017 3300025936 Bacteria 2378
1105 Ga0207670_10234333 3300025936 Archaea 1411
1106 Ga0207670_10238436 3300025936 Bacteria 1400
1107 Ga0207670_10317066 3300025936 Unclassified 1226
1108 Ga0207670_11174349 3300025936 Unclassified 649
1109 Ga0207669_10018341 3300025937 Bacteria 3615
1110 Ga0207669_10029546 3300025937 Unclassified 3033
1111 Ga0207669_10038203 3300025937 Bacteria 2762
1112 Ga0207669_10061440 3300025937 Bacteria 2309
1113 Ga0207669_10075368 3300025937 Unclassified 2137
1114 Ga0207669_10203060 3300025937 Unclassified 1440
1115 Ga0207669_10227215 3300025937 Unclassified 1374
1116 Ga0207669_10402917 3300025937 Unclassified 1072
1117 Ga0207669_10555561 3300025937 Archaea 927
1118 Ga0207704_10011623 3300025938 Unclassified 4342
1119 Ga0207704_10021214 3300025938 Bacteria 3454
1120 Ga0207704_10024812 3300025938 Bacteria 3260
1121 Ga0207704_10073355 3300025938 Unclassified 2179
1122 Ga0207704_10087160 3300025938 Unclassified 2038
1123 Ga0207704_10148307 3300025938 Bacteria 1651
1124 Ga0207704_10427864 3300025938 Bacteria 1051
1125 Ga0207704_11234078 3300025938 Unclassified 638
1126 Ga0207704_11370634 3300025938 Unclassified 606
1127 Ga0207665_10113032 3300025939 Bacteria 1910
1128 Ga0207665_10303197 3300025939 Bacteria 1195
1129 Ga0207665_10377800 3300025939 Bacteria 1075
1130 Ga0207691_10000216 3300025940 Bacteria 55947
1131 Ga0207691_10003506 3300025940 Bacteria 15269
1132 Ga0207691_10005875 3300025940 Bacteria 11857
1133 Ga0207691_10046551 3300025940 Unclassified 3984
1134 Ga0207691_10062989 3300025940 Unclassified 3364
1135 Ga0207691_10096519 3300025940 Bacteria 2643
1136 Ga0207691_10110624 3300025940 Bacteria 2443
1137 Ga0207691_10120512 3300025940 Bacteria 2326
1138 Ga0207691_10262579 3300025940 Unclassified 1488
1139 Ga0207691_10388926 3300025940 Bacteria 1190
1140 Ga0207711_10010807 3300025941 Bacteria 7588
1141 Ga0207711_10035949 3300025941 Bacteria 4201
1142 Ga0207711_10101744 3300025941 Unclassified 2543
1143 Ga0207711_10102578 3300025941 Bacteria 2532
1144 Ga0207711_10104574 3300025941 Bacteria 2509
1145 Ga0207711_10476463 3300025941 Bacteria 1163
1146 Ga0207711_10871441 3300025941 Unclassified 838
1147 Ga0207711_11043928 3300025941 Unclassified 757
1148 Ga0207711_11665840 3300025941 Unclassified 581
1149 Ga0207711_11748209 3300025941 Bacteria 565
1150 Ga0207689_10000536 3300025942 Bacteria 35988
1151 Ga0207689_10001319 3300025942 Bacteria 23906
1152 Ga0207689_10032951 3300025942 Bacteria 4306
1153 Ga0207689_10037059 3300025942 Bacteria 4047
1154 Ga0207689_10098649 3300025942 Unclassified 2400
1155 Ga0207689_10234587 3300025942 Bacteria 1516
1156 Ga0207689_10235565 3300025942 Unclassified 1513
1157 Ga0207689_10419166 3300025942 Unclassified 1117
1158 Ga0207661_10041056 3300025944 Bacteria 3641
1159 Ga0207661_10051650 3300025944 Unclassified 3281
1160 Ga0207661_10053018 3300025944 Bacteria 3243
1161 Ga0207661_10077346 3300025944 Bacteria 2736
1162 Ga0207679_10007699 3300025945 Bacteria 6842
1163 Ga0207679_10040246 3300025945 Bacteria 3344
1164 Ga0207679_10041373 3300025945 Bacteria 3304
1165 Ga0207679_10102374 3300025945 Unclassified 2242
1166 Ga0207679_10114172 3300025945 Bacteria 2138
1167 Ga0207679_10215097 3300025945 Unclassified 1614
1168 Ga0207679_10277105 3300025945 Bacteria 1437
1169 Ga0207679_10486581 3300025945 Unclassified 1099
1170 Ga0207679_10700473 3300025945 Bacteria 919
1171 Ga0207679_10782438 3300025945 Bacteria 869
1172 Ga0207679_10921450 3300025945 Bacteria 800
1173 Ga0207679_11010275 3300025945 Unclassified 762
1174 Ga0207679_11272558 3300025945 Unclassified 675
1175 Ga0207679_11697641 3300025945 Unclassified 578
1176 Ga0207667_10000695 3300025949 Bacteria 43623
1177 Ga0207667_10029282 3300025949 Bacteria 5973
1178 Ga0207667_10106398 3300025949 Bacteria 2894
1179 Ga0207667_10111015 3300025949 Bacteria 2828
1180 Ga0207667_10126412 3300025949 Bacteria 2633
1181 Ga0207667_10173389 3300025949 Bacteria 2217
1182 Ga0207667_11137941 3300025949 Unclassified 762
1183 Ga0207667_11257873 3300025949 Unclassified 718
1184 Ga0207667_11383274 3300025949 Unclassified 678
1185 Ga0207651_10008740 3300025960 Bacteria 5492
1186 Ga0207651_10012320 3300025960 Bacteria 4834
1187 Ga0207651_10047466 3300025960 Bacteria 2896
1188 Ga0207651_10225408 3300025960 Bacteria 1518
1189 Ga0207651_10308724 3300025960 Unclassified 1318
1190 Ga0207651_10357089 3300025960 Bacteria 1232
1191 Ga0207651_10378507 3300025960 Unclassified 1199
1192 Ga0207651_10383776 3300025960 Unclassified 1191
1193 Ga0207651_10409553 3300025960 Bacteria 1155
1194 Ga0207651_10471360 3300025960 Unclassified 1080
1195 Ga0207651_10602751 3300025960 Bacteria 960
1196 Ga0207651_11037820 3300025960 Bacteria 733
1197 Ga0207651_11326326 3300025960 Unclassified 647
1198 Ga0207651_11349356 3300025960 Unclassified 641
1199 Ga0207651_11752393 3300025960 Unclassified 559
1200 Ga0207712_10039802 3300025961 Bacteria 3222
1201 Ga0207712_10042639 3300025961 Bacteria 3126
1202 Ga0207712_10095842 3300025961 Bacteria 2195
1203 Ga0207712_10162078 3300025961 Unclassified 1739
1204 Ga0207712_10492329 3300025961 Bacteria 1047
1205 Ga0207712_11649250 3300025961 Unclassified 575
1206 Ga0207668_10005405 3300025972 Bacteria 7523
1207 Ga0207668_10037519 3300025972 Bacteria 3244
1208 Ga0207668_10044175 3300025972 Unclassified 3029
1209 Ga0207668_10051279 3300025972 Bacteria 2849
1210 Ga0207668_10503142 3300025972 Unclassified 1042
1211 Ga0207640_10023262 3300025981 Bacteria 3722
1212 Ga0207640_10032535 3300025981 Bacteria 3234
1213 Ga0207640_10083236 3300025981 Unclassified 2193
1214 Ga0207640_10180316 3300025981 Bacteria 1583
1215 Ga0207640_10318699 3300025981 Bacteria 1237
1216 Ga0207640_11107379 3300025981 Unclassified 701
1217 Ga0207640_11658406 3300025981 Unclassified 577
1218 Ga0207658_10000692 3300025986 Bacteria 29298
1219 Ga0207658_10003344 3300025986 Bacteria 11375
1220 Ga0207658_10006775 3300025986 Bacteria 7801
1221 Ga0207658_10018195 3300025986 Bacteria 4848
1222 Ga0207658_10082191 3300025986 Unclassified 2473
1223 Ga0207658_10174795 3300025986 Unclassified 1772
1224 Ga0207658_10232348 3300025986 Bacteria 1557
1225 Ga0207658_10252799 3300025986 Unclassified 1498
1226 Ga0207658_10484342 3300025986 Unclassified 1100
1227 Ga0207658_10851624 3300025986 Bacteria 829
1228 Ga0207658_11017055 3300025986 Unclassified 756
1229 Ga0207658_11046565 3300025986 Bacteria 745
1230 Ga0207677_10000162 3300026023 Bacteria 53309
1231 Ga0207677_10023617 3300026023 Bacteria 3802
1232 Ga0207677_10049738 3300026023 Bacteria 2831
1233 Ga0207677_10117628 3300026023 Unclassified 1993
1234 Ga0207677_10133832 3300026023 Bacteria 1887
1235 Ga0207677_10191676 3300026023 Bacteria 1617
1236 Ga0207677_10223810 3300026023 Bacteria 1511
1237 Ga0207677_10259133 3300026023 Bacteria 1417
1238 Ga0207677_10313095 3300026023 Unclassified 1302
1239 Ga0207677_10451458 3300026023 Unclassified 1102
1240 Ga0207677_11273719 3300026023 Unclassified 675
1241 Ga0207677_11602897 3300026023 Unclassified 603
1242 Ga0207703_10004137 3300026035 Bacteria 11966
1243 Ga0207703_10009361 3300026035 Bacteria 7699
1244 Ga0207703_10019363 3300026035 Bacteria 5317
1245 Ga0207703_10042385 3300026035 Bacteria 3651
1246 Ga0207703_10051228 3300026035 Unclassified 3344
1247 Ga0207703_10083537 3300026035 Unclassified 2669
1248 Ga0207703_10093797 3300026035 Bacteria 2529
1249 Ga0207703_10211815 3300026035 Bacteria 1728
1250 Ga0207639_10006505 3300026041 Bacteria 7948
1251 Ga0207639_10020340 3300026041 Bacteria 4750
1252 Ga0207639_10021561 3300026041 Bacteria 4628
1253 Ga0207639_10029627 3300026041 Bacteria 4009
1254 Ga0207639_10179953 3300026041 Unclassified 1798
1255 Ga0207639_10338061 3300026041 Unclassified 1342
1256 Ga0207639_10604894 3300026041 Bacteria 1011
1257 Ga0207639_10616947 3300026041 Bacteria 1001
1258 Ga0207639_10665618 3300026041 Archaea 964
1259 Ga0207639_10771989 3300026041 Bacteria 895
1260 Ga0207639_10971385 3300026041 Bacteria 795
1261 Ga0207639_11357012 3300026041 Unclassified 667
1262 Ga0207639_11712695 3300026041 Unclassified 589
1263 Ga0207678_10004516 3300026067 Bacteria 12512
1264 Ga0207678_10008037 3300026067 Bacteria 9299
1265 Ga0207678_10035843 3300026067 Bacteria 4319
1266 Ga0207678_10042402 3300026067 Bacteria 3942
1267 Ga0207678_10088022 3300026067 Unclassified 2654
1268 Ga0207678_10185846 3300026067 Bacteria 1775
1269 Ga0207678_10211262 3300026067 Unclassified 1660
1270 Ga0207678_10990148 3300026067 Bacteria 744
1271 Ga0207708_10013446 3300026075 Bacteria 6119
1272 Ga0207708_10031349 3300026075 Bacteria 4035
1273 Ga0207708_10077223 3300026075 Bacteria 2555
1274 Ga0207708_10154258 3300026075 Bacteria 1810
1275 Ga0207708_10376305 3300026075 Unclassified 1170
1276 Ga0207708_10501536 3300026075 Unclassified 1017
1277 Ga0207708_10907898 3300026075 Bacteria 762
1278 Ga0207708_12000849 3300026075 Unclassified 507
1279 Ga0207702_10004669 3300026078 Bacteria 12105
1280 Ga0207702_10032665 3300026078 Unclassified 4343
1281 Ga0207702_10070119 3300026078 Bacteria 3014
1282 Ga0207702_10095460 3300026078 Bacteria 2613
1283 Ga0207702_10169394 3300026078 Unclassified 2001
1284 Ga0207702_10483531 3300026078 Unclassified 1205
1285 Ga0207641_10001589 3300026088 Bacteria 22184
1286 Ga0207641_10004050 3300026088 Bacteria 12783
1287 Ga0207641_10015947 3300026088 Bacteria 6152
1288 Ga0207641_10057882 3300026088 Bacteria 3297
1289 Ga0207641_10071561 3300026088 Bacteria 2983
1290 Ga0207641_10101359 3300026088 Bacteria 2537
1291 Ga0207641_10116683 3300026088 Bacteria 2376
1292 Ga0207641_10470926 3300026088 Bacteria 1216
1293 Ga0207641_10594697 3300026088 Bacteria 1082
1294 Ga0207641_11276434 3300026088 Bacteria 735
1295 Ga0207641_11962124 3300026088 Bacteria 587
1296 Ga0207641_12050182 3300026088 Unclassified 573
1297 Ga0207648_10015995 3300026089 Bacteria 6875
1298 Ga0207648_10016602 3300026089 Bacteria 6721
1299 Ga0207648_10039156 3300026089 Bacteria 4168
1300 Ga0207648_10075921 3300026089 Bacteria 2929
1301 Ga0207648_10109392 3300026089 Unclassified 2426
1302 Ga0207648_10144806 3300026089 Unclassified 2096
1303 Ga0207648_10957785 3300026089 Bacteria 801
1304 Ga0207676_10005835 3300026095 Bacteria 8704
1305 Ga0207676_10016199 3300026095 Bacteria 5396
1306 Ga0207676_10019116 3300026095 Bacteria 4991
1307 Ga0207676_10033393 3300026095 Bacteria 3887
1308 Ga0207676_10045076 3300026095 Bacteria 3405
1309 Ga0207676_10216634 3300026095 Bacteria 1702
1310 Ga0207676_10240452 3300026095 Bacteria 1624
1311 Ga0207676_10293583 3300026095 Unclassified 1481
1312 Ga0207676_10305871 3300026095 Bacteria 1453
1313 Ga0207676_10410269 3300026095 Unclassified 1268
1314 Ga0207676_11051717 3300026095 Unclassified 803
1315 Ga0207676_11240883 3300026095 Bacteria 739
1316 Ga0207676_12048804 3300026095 Unclassified 571
1317 Ga0207676_12321817 3300026095 Unclassified 534
1318 Ga0207674_10006136 3300026116 Bacteria 14197
1319 Ga0207674_10008127 3300026116 Bacteria 12163
1320 Ga0207674_10086098 3300026116 Bacteria 3137
1321 Ga0207674_10111677 3300026116 Bacteria 2707
1322 Ga0207674_10173568 3300026116 Unclassified 2108
1323 Ga0207674_10190705 3300026116 Unclassified 1999
1324 Ga0207674_10325170 3300026116 Bacteria 1487
1325 Ga0207674_10365082 3300026116 Unclassified 1396
1326 Ga0207674_10778360 3300026116 Bacteria 923
1327 Ga0207675_100003963 3300026118 Bacteria 14369
1328 Ga0207675_100005623 3300026118 Bacteria 12001
1329 Ga0207675_100035859 3300026118 Bacteria 4626
1330 Ga0207675_100055833 3300026118 Bacteria 3685
1331 Ga0207675_100056573 3300026118 Bacteria 3658
1332 Ga0207675_100180437 3300026118 Bacteria 2021
1333 Ga0207675_100189963 3300026118 Unclassified 1970
1334 Ga0207675_100306499 3300026118 Bacteria 1548
1335 Ga0207675_100496898 3300026118 Bacteria 1214
1336 Ga0207675_100567180 3300026118 Unclassified 1136
1337 Ga0207675_100822131 3300026118 Unclassified 943
1338 Ga0207675_100856076 3300026118 Bacteria 924
1339 Ga0207675_101295043 3300026118 Bacteria 749
1340 Ga0207683_10000694 3300026121 Bacteria 30870
1341 Ga0207683_10007462 3300026121 Bacteria 9378
1342 Ga0207683_10010723 3300026121 Bacteria 7813
1343 Ga0207683_10019201 3300026121 Bacteria 5835
1344 Ga0207683_10041980 3300026121 Bacteria 3995
1345 Ga0207683_10048997 3300026121 Bacteria 3697
1346 Ga0207683_10517864 3300026121 Bacteria 1102
1347 Ga0207683_10764826 3300026121 Unclassified 896
1348 Ga0207683_11159927 3300026121 Unclassified 716
1349 Ga0207698_10002759 3300026142 Bacteria 10480
1350 Ga0207698_10112573 3300026142 Bacteria 2285
1351 Ga0207698_10143339 3300026142 Bacteria 2062
1352 Ga0207698_10207132 3300026142 Bacteria 1761
1353 Ga0207698_10317487 3300026142 Bacteria 1458
1354 Ga0207698_10538859 3300026142 Bacteria 1142
1355 Ga0207698_10878533 3300026142 Bacteria 903
1356 Ga0207698_11362903 3300026142 Unclassified 724
1357 Ga0207698_11704363 3300026142 Bacteria 646
1358 Ga0207698_11876939 3300026142 Unclassified 614
1359 Ga0209969_1038247 3300027360 Unclassified 742
1360 Ga0209996_1002790 3300027395 Bacteria 2172
1361 Ga0209984_1018017 3300027424 Unclassified 951
1362 Ga0209995_1006654 3300027471 Bacteria 1858
1363 Ga0209968_1000274 3300027526 Bacteria 8876
1364 Ga0209968_1034555 3300027526 Bacteria 852
1365 Ga0209999_1007826 3300027543 Unclassified 1921
1366 Ga0209970_1005190 3300027614 Unclassified 2151
1367 Ga0209970_1010001 3300027614 Unclassified 1549
1368 Ga0210002_1011686 3300027617 Bacteria 1359
1369 Ga0209983_1010224 3300027665 Unclassified 1917
1370 Ga0209983_1050583 3300027665 Unclassified 909
1371 Ga0209588_1003732 3300027671 Bacteria 4243
1372 Ga0209966_1000126 3300027695 Bacteria 33281
1373 Ga0209966_1017753 3300027695 Unclassified 1358
1374 Ga0209966_1018959 3300027695 Unclassified 1322
1375 Ga0209998_10023977 3300027717 Unclassified 1322
1376 Ga0209974_10004409 3300027876 Bacteria 5007
1377 Ga0209974_10011006 3300027876 Unclassified 3045
1378 Ga0209974_10053814 3300027876 Bacteria 1356
1379 Ga0207428_10006537 3300027907 Bacteria 10750
1380 Ga0207428_10240925 3300027907 Unclassified 1351
1381 Ga0207428_10395933 3300027907 Unclassified 1012
1382 Ga0268266_10012240 3300028379 Bacteria 7424
1383 Ga0268266_10039843 3300028379 Bacteria 4003
1384 Ga0268266_10049106 3300028379 Bacteria 3617
1385 Ga0268266_10223197 3300028379 Bacteria 1733
1386 Ga0268266_10838647 3300028379 Bacteria 888
1387 Ga0268266_11178485 3300028379 Unclassified 741
1388 Ga0268266_11685689 3300028379 Unclassified 609
1389 Ga0268265_10062610 3300028380 Unclassified 2859
1390 Ga0268265_10077462 3300028380 Bacteria 2611
1391 Ga0268265_10213767 3300028380 Unclassified 1682
1392 Ga0268265_10258418 3300028380 Unclassified 1547
1393 Ga0268265_10350676 3300028380 Bacteria 1347
1394 Ga0268265_10560751 3300028380 Bacteria 1086
1395 Ga0268265_10843506 3300028380 Bacteria 896
1396 Ga0268265_10944505 3300028380 Unclassified 849
1397 Ga0268264_10011844 3300028381 Bacteria 7186
1398 Ga0268264_10016872 3300028381 Bacteria 5977
1399 Ga0268264_10041785 3300028381 Bacteria 3793
1400 Ga0268264_10082345 3300028381 Bacteria 2753
1401 Ga0268264_10244997 3300028381 Bacteria 1662
1402 Ga0268264_10515414 3300028381 Bacteria 1168
1403 Ga0268264_10681926 3300028381 Unclassified 1019
1404 Ga0268264_11763545 3300028381 Unclassified 629
1405 Ga0268264_12007434 3300028381 Bacteria 588
1406 Ga0268264_12015362 3300028381 Unclassified 586
1407 Ga0307515_10202249 3300028794 Bacteria 1858
1408 Ga0265338_11006880 3300028800 Unclassified 564
1409 Ga0265330_10003496 3300031235 Bacteria 8194
1410 Ga0265332_10000783 3300031238 Bacteria 19357
1411 Ga0265328_10010176 3300031239 Bacteria 3797
1412 Ga0265325_10011353 3300031241 Bacteria 5119
1413 Ga0265329_10021291 3300031242 Bacteria 2178
1414 Ga0265339_10111097 3300031249 Unclassified 1418
1415 Ga0265331_10000936 3300031250 Bacteria 23357
1416 Ga0265327_10151959 3300031251 Unclassified 1074
1417 Ga0265316_10051554 3300031344 Unclassified 3232
1418 Ga0307513_10158609 3300031456 Bacteria 2158
1419 Ga0307408_100037707 3300031548 Bacteria 3405
1420 Ga0307408_100222988 3300031548 Unclassified 1539
1421 Ga0307408_100376762 3300031548 Bacteria 1212
1422 Ga0307408_100483368 3300031548 Unclassified 1081
1423 Ga0307408_101654098 3300031548 Unclassified 609
1424 Ga0316579_10292500 3300031691 Unclassified 787
1425 Ga0265314_10097220 3300031711 Bacteria 1902
1426 Ga0265314_10391721 3300031711 Unclassified 753
1427 Ga0265342_10035010 3300031712 Unclassified 3077
1428 Ga0316576_10013668 3300031727 Bacteria 5405
1429 Ga0316576_10290465 3300031727 Unclassified 1223
1430 Ga0316578_10080432 3300031728 Bacteria 1938
1431 Ga0307405_10037860 3300031731 Bacteria 2902
1432 Ga0307405_10137759 3300031731 Bacteria 1697
1433 Ga0307405_10210477 3300031731 Unclassified 1419
1434 Ga0316577_10123159 3300031733 Bacteria 1457
1435 Ga0307413_10009897 3300031824 Bacteria 4590
1436 Ga0307413_10052226 3300031824 Bacteria 2467
1437 Ga0307413_10144220 3300031824 Bacteria 1650
1438 Ga0307413_11249890 3300031824 Bacteria 648
1439 Ga0307413_12044662 3300031824 Unclassified 517
1440 Ga0307410_10010537 3300031852 Bacteria 5244
1441 Ga0307410_10020396 3300031852 Bacteria 4053
1442 Ga0307410_10320625 3300031852 Unclassified 1229
1443 Ga0307406_10188568 3300031901 Bacteria 1507
1444 Ga0307406_10352015 3300031901 Unclassified 1151
1445 Ga0307406_10633196 3300031901 Unclassified 886
1446 Ga0307407_10044585 3300031903 Bacteria 2501
1447 Ga0307407_10057278 3300031903 Bacteria 2260
1448 Ga0307407_10106984 3300031903 Bacteria 1748
1449 Ga0307412_10300113 3300031911 Unclassified 1269
1450 Ga0307412_10334165 3300031911 Unclassified 1210
1451 Ga0307412_10370350 3300031911 Bacteria 1156
1452 Ga0307412_10533490 3300031911 Bacteria 983
1453 Ga0307412_11172410 3300031911 Bacteria 687
1454 Ga0307409_100028493 3300031995 Bacteria 3980
1455 Ga0307409_100053410 3300031995 Bacteria 3104
1456 Ga0307409_100059634 3300031995 Bacteria 2971
1457 Ga0307409_100888002 3300031995 Unclassified 904
1458 Ga0307416_100044271 3300032002 Unclassified 3493
1459 Ga0307416_100079310 3300032002 Bacteria 2766
1460 Ga0307416_100118206 3300032002 Unclassified 2355
1461 Ga0307416_100197273 3300032002 Unclassified 1906
1462 Ga0307414_10309028 3300032004 Unclassified 1341
1463 Ga0307414_10485104 3300032004 Bacteria 1091
1464 Ga0307411_10017085 3300032005 Bacteria 4123
1465 Ga0307411_10149612 3300032005 Unclassified 1733
1466 Ga0307411_10182705 3300032005 Bacteria 1593
1467 Ga0307411_11381880 3300032005 Bacteria 644
1468 Ga0307415_100053151 3300032126 Unclassified 2758
1469 Ga0307415_100134728 3300032126 Bacteria 1876
1470 Ga0307415_101400790 3300032126 Unclassified 666
1471 Ga0373930_0019123 3300034816 Bacteria 1323
1472 Ga0373930_0105915 3300034816 Unclassified 673
1473 Ga0373948_0098159 3300034817 Bacteria 687
1474 Ga0373950_0052363 3300034818 Bacteria 804
1475 Ga0373926_0030098 3300035083 Unclassified 1910
1476 Ga0373926_0243892 3300035083 Unclassified 696
1477 Ga0373929_0088798 3300035085 Unclassified 764
1478 Ga0373934_0003186 3300035086 Bacteria 5999
1479 Ga0373940_0375481 3300035088 Unclassified 503
1480 Ga0373944_0053256 3300035089 Bacteria 1280
1481 Ga0373949_0108411 3300035090 Unclassified 768
1482 Ga0373923_0025085 3300035111 Unclassified 2359
1483 Ga0373932_0030013 3300035112 Bacteria 1504
1484 Ga0373932_0159201 3300035112 Unclassified 780
1485 Ga0373936_0076145 3300035113 Bacteria 1390
1486 Ga0373939_0116579 3300035114 Unclassified 937
1487 Ga0373939_0133521 3300035114 Bacteria 888
1488 Ga0373939_0156298 3300035114 Bacteria 834
1489 Ga0373939_0346719 3300035114 Bacteria 603
1490 Ga0373939_0439942 3300035114 Unclassified 547
1491 Ga0373945_0074690 3300035116 Bacteria 1289
1492 Ga0373945_0150702 3300035116 Bacteria 942
1493 Ga0373945_0150811 3300035116 Unclassified 942
1494 Ga0373953_0000655 3300035117 Bacteria 9598
1495 Ga0373953_0225732 3300035117 Bacteria 812
1496 Ga0373954_0003575 3300035118 Bacteria 6605
1497 Ga0373954_0168556 3300035118 Unclassified 1072
1498 Ga0373954_0300986 3300035118 Unclassified 791
1499 Ga0373956_0081443 3300035119 Unclassified 1485
1500 Ga0373956_0326039 3300035119 Unclassified 732
1501 Ga0373957_0035455 3300035120 Unclassified 1854
1502 Ga0373957_0229744 3300035120 Unclassified 778
1503 Ga0373957_0439139 3300035120 Bacteria 564
1504 Ga0373960_0173778 3300035121 Unclassified 748
1505 Ga0373943_0013050 3300035170 Bacteria 3748
1506 Ga0373943_0254744 3300035170 Archaea 987
1507 Ga0373943_0326615 3300035170 Unclassified 875
1508 Ga0373946_0084272 3300035171 Bacteria 1397
1509 Ga0373946_0170934 3300035171 Bacteria 1026
1510 Ga0373946_0221069 3300035171 Unclassified 914
1511 Ga0373955_0056096 3300035172 Unclassified 2160
1512 Ga0373955_0266855 3300035172 Unclassified 1028
1513 Ga0373955_1009388 3300035172 Unclassified 512
1514 Ga0373961_0436236 3300035241 Unclassified 508
1515 Ga0373924_0017224 3300035410 Bacteria 2768
1516 Ga0373924_0222181 3300035410 Unclassified 835
1517 Ga0373924_0230902 3300035410 Bacteria 818
1518 Ga0373924_0293870 3300035410 Bacteria 721
1519 Ga0373931_0004698 3300035691 Bacteria 6254
1520 Ga0373931_0112733 3300035691 Archaea 1545
1521 Ga0373931_0172625 3300035691 Bacteria 1275
1522 Ga0373931_0178826 3300035691 Unclassified 1255
1523 Ga0373931_0217075 3300035691 Bacteria 1150
1524 Ga0373935_0104203 3300035692 Unclassified 1874
1525 Ga0373935_0126252 3300035692 Bacteria 1714
1526 Ga0373935_0329390 3300035692 Bacteria 1085
1527 Ga0373935_0934069 3300035692 Unclassified 643
1528 Ga0373927_0059050 3300035695 Unclassified 2481
1529 Ga0373927_0060470 3300035695 Bacteria 2451
1530 Ga0373927_0061797 3300035695 Unclassified 2423
1531 Ga0373927_0086509 3300035695 Bacteria 2035
1532 Ga0373927_0572565 3300035695 Bacteria 746
1533 Ga0373927_0696317 3300035695 Unclassified 671
1534 Ga0373933_0020139 3300035724 Bacteria 3779
1535 Ga0373933_0034582 3300035724 Bacteria 2945
1536 Ga0373933_0657186 3300035724 Bacteria 689
1537 Ga0373933_1122284 3300035724 Unclassified 518
1538 Ga0373947_0028852 3300035725 Bacteria 3254
1539 Ga0373947_0114755 3300035725 Bacteria 1706
1540 Ga0373947_0468207 3300035725 Bacteria 854
1541 Ga0373947_0648824 3300035725 Bacteria 720
1542 Ga0373947_0973946 3300035725 Bacteria 579
1543 Ga0373937_0051948 3300036401 Bacteria 3757
1544 Ga0373937_0089848 3300036401 Unclassified 2844
1545 Ga0373937_0475831 3300036401 Bacteria 1186
1546 Ga0373937_0546452 3300036401 Unclassified 1100
1547 Ga0373937_0717845 3300036401 Unclassified 946
1548 Ga0373937_2047804 3300036401 Unclassified 518
1549 Ga0373937_2111260 3300036401 Unclassified 509
1550 Ga0316582_0071298 3300036647 Bacteria 2250
1551 Ga0316584_0008509 3300036712 Bacteria 7071
1552 Ga0316584_0533732 3300036712 Unclassified 821
1553 Ga0316584_0557427 3300036712 Bacteria 799
1554 Ga0316584_0927641 3300036712 Unclassified 585
1555 Ga0373925_0020187 3300037068 Bacteria 4849
1556 Ga0373925_0036448 3300037068 Bacteria 3630
1557 Ga0373925_0042297 3300037068 Bacteria 3380
1558 Ga0373925_0045226 3300037068 Bacteria 3270
1559 Ga0373925_0327531 3300037068 Bacteria 1240
1560 Ga0373925_0795893 3300037068 Bacteria 779
1561 Ga0395899_0030025 3300037312 Bacteria 4091
1562 Ga0395899_0064597 3300037312 Bacteria 2691
1563 Ga0395900_0692638 3300037418 Bacteria 953
1564 Ga0395900_1326321 3300037418 Bacteria 633
1565 Ga0395898_0008078 3300037466 Bacteria 11145
1566 Ga0395898_0042307 3300037466 Bacteria 4496
1567 Ga0395905_0055586 3300037471 Bacteria 3704
1568 Ga0395905_0063514 3300037471 Bacteria 3455
1569 Ga0395905_0104887 3300037471 Bacteria 2654
1570 Ga0395905_0171397 3300037471 Bacteria 2039
1571 Ga0395905_0472866 3300037471 Bacteria 1152
1572 Ga0395901_0008430 3300038443 Bacteria 10419
1573 Ga0395901_0011902 3300038443 Bacteria 8824
1574 Ga0395901_0016025 3300038443 Bacteria 7635
1575 Ga0242420_013427 3300038996 Unclassified 1396
1576 Ga0436360_0213181 3300039438 Unclassified 1101
1577 Ga0439436_0159961 3300041404 Bacteria 637
1578 Ga0451789_0884076 3300041443 Unclassified 515
1579 Ga0451793_0180856 3300041452 Unclassified 513
1580 Ga0451798_0266000 3300041458 Unclassified 622
1581 Ga0451800_1181577 3300041459 Bacteria 569
1582 Ga0451800_1385157 3300041459 Unclassified 531
1583 Ga0451804_0607212 3300041463 Bacteria 893
1584 Ga0451807_1793237 3300041486 Unclassified 1224
1585 Ga0451839_0451676 3300041496 Bacteria 958
1586 Ga0451839_0543072 3300041496 Unclassified 649
1587 Ga0451841_1032702 3300041498 Unclassified 760
1588 Ga0451847_0416076 3300041503 Bacteria 1121
1589 Ga0451851_0031062 3300041507 Unclassified 628
1590 Ga0451843_0662256 3300041509 Bacteria 831
1591 Ga0451853_3040296 3300041512 Unclassified 747
1592 Ga0451853_3541128 3300041512 Unclassified 634
1593 Ga0451853_3808615 3300041512 Bacteria 1676
1594 Ga0439441_043416 3300042001 Bacteria 907
1595 Ga0450890_035398 3300042127 Unclassified 724
1596 Ga0439435_0017179 3300042436 Bacteria 1825
1597 Ga0439444_0035329 3300042437 Unclassified 958
1598 Ga0439460_0146337 3300042461 Unclassified 786
1599 Ga0451577_0052351 3300042876 Bacteria 3645
1600 Ga0451577_0119022 3300042876 Bacteria 2365
1601 Ga0451577_0152667 3300042876 Bacteria 2078
1602 Ga0451577_0216225 3300042876 Unclassified 1732
1603 Ga0451577_0550180 3300042876 Bacteria 1048
1604 Ga0451577_0686446 3300042876 Unclassified 928
1605 Ga0451577_1065905 3300042876 Bacteria 724
1606 Ga0451577_1078961 3300042876 Bacteria 719
1607 Ga0453683_0399481 3300044673 Unclassified 886
1608 Ga0453683_0562954 3300044673 Unclassified 742
1609 Ga0466964_0056849 3300044706 Unclassified 1618
1610 Ga0451576_0036188 3300045051 Bacteria 5234
1611 Ga0451576_0136888 3300045051 Bacteria 2554
1612 Ga0451576_1134471 3300045051 Bacteria 817
1613 Ga0451576_1341854 3300045051 Bacteria 745
1614 Ga0451576_1983653 3300045051 Unclassified 600
1615 Ga0451576_2246404 3300045051 Unclassified 560
1616 Ga0466967_0137529 3300045976 Unclassified 2273
1617 Ga0495603_0812972 3300046455 Unclassified 533
1618 Ga0495629_0028114 3300046459 Bacteria 3992
1619 Ga0495580_0282303 3300046472 Unclassified 1133
1620 Ga0495580_0363989 3300046472 Bacteria 978
1621 Ga0495580_0476979 3300046472 Bacteria 835
1622 Ga0495582_0227203 3300046473 Bacteria 1068
1623 Ga0495582_0675761 3300046473 Unclassified 598
1624 Ga0495582_0703780 3300046473 Bacteria 585
1625 Ga0495639_0196717 3300046475 Bacteria 985
1626 Ga0495639_0487122 3300046475 Unclassified 629
1627 Ga0495662_0033097 3300046476 Bacteria 2498
1628 Ga0495664_0034904 3300046477 Bacteria 2960
1629 Ga0495664_0249959 3300046477 Unclassified 1072
1630 Ga0495628_0536606 3300046516 Bacteria 841
1631 Ga0495630_0112851 3300046517 Bacteria 2059
1632 Ga0495630_0207055 3300046517 Bacteria 1497
1633 Ga0495642_0558859 3300046528 Unclassified 508
1634 Ga0495665_0073632 3300046531 Bacteria 1798
1635 Ga0495665_0133633 3300046531 Bacteria 1298
1636 Ga0495640_0461711 3300046533 Bacteria 775
1637 Ga0495586_0366978 3300046535 Bacteria 827
1638 Ga0495586_0759251 3300046535 Unclassified 560
1639 Ga0495598_0167096 3300046537 Unclassified 778
1640 Ga0495621_0011015 3300046539 Bacteria 2784
1641 Ga0495621_0019935 3300046539 Unclassified 2195
1642 Ga0495621_0019942 3300046539 Unclassified 2195
1643 Ga0495621_0029552 3300046539 Bacteria 1869
1644 Ga0495645_0065936 3300046543 Bacteria 2619
1645 Ga0495667_0027889 3300046559 Bacteria 3802
1646 Ga0495635_0087208 3300046663 Bacteria 2135
1647 Ga0495659_0024886 3300046664 Unclassified 2045
1648 Ga0495588_0166706 3300046674 Unclassified 1165
1649 Ga0495588_0435756 3300046674 Bacteria 688
1650 Ga0495657_0196488 3300046675 Bacteria 1231
1651 Ga0495657_0346379 3300046675 Bacteria 880
1652 Ga0495599_0299042 3300046678 Bacteria 972
1653 Ga0495623_0041357 3300046679 Unclassified 2940
1654 Ga0495623_0506339 3300046679 Unclassified 637
1655 Ga0495647_0020297 3300046681 Bacteria 2383
1656 Ga0495647_0147218 3300046681 Bacteria 1008
1657 Ga0495658_0035187 3300046683 Bacteria 2753
1658 Ga0495658_0286601 3300046683 Archaea 1040
1659 Ga0495669_0228738 3300046684 Unclassified 892
1660 Ga0495624_0022146 3300046690 Bacteria 4205
1661 Ga0495671_0017060 3300046692 Bacteria 3867
1662 Ga0495600_0008024 3300046809 Bacteria 6472
1663 Ga0495581_0007883 3300047315 Bacteria 6165
1664 Ga0495581_0429078 3300047315 Bacteria 770
1665 Ga0495674_0644598 3300047319 Unclassified 836
1666 Ga0495680_0063418 3300047322 Bacteria 2838
1667 Ga0495675_0129642 3300047444 Unclassified 1568
1668 Ga0495684_0157880 3300047471 Bacteria 1693
1669 Ga0495593_0010677 3300047673 Bacteria 5294
1670 Ga0495593_0033524 3300047673 Bacteria 2796
1671 Ga0496100_0069382 3300048903 Unclassified 2347
1672 Ga0496100_0209035 3300048903 Unclassified 1426
1673 Ga0496100_1206179 3300048903 Unclassified 597
1674 Ga0496101_0062582 3300048904 Unclassified 2706
1675 Ga0496101_0226130 3300048904 Unclassified 1453
1676 Ga0496101_1030068 3300048904 Unclassified 647
1677 Ga0496102_0009107 3300048905 Bacteria 8520
1678 Ga0496102_0081349 3300048905 Unclassified 2986
1679 Ga0496102_0639766 3300048905 Bacteria 987
1680 Ga0496102_1551706 3300048905 Bacteria 581
1681 Ga0496103_0049084 3300048906 Bacteria 2610
1682 Ga0496103_0218147 3300048906 Unclassified 1227
1683 Ga0496103_0263702 3300048906 Unclassified 1108
1684 Ga0496104_0014530 3300048907 Bacteria 7112
1685 Ga0496104_1051518 3300048907 Unclassified 718
1686 Ga0496105_0081418 3300048908 Bacteria 2674
1687 Ga0496105_0086878 3300048908 Unclassified 2584
1688 Ga0496105_0098391 3300048908 Unclassified 2416
1689 Ga0496105_0757334 3300048908 Bacteria 741
1690 Ga0496106_0010554 3300048909 Bacteria 6822
1691 Ga0496106_0077277 3300048909 Bacteria 2553
1692 Ga0496106_0170244 3300048909 Bacteria 1726
1693 Ga0496106_0229090 3300048909 Unclassified 1483
1694 Ga0496106_1228659 3300048909 Unclassified 584
1695 Ga0496106_1343481 3300048909 Bacteria 554
1696 Ga0496107_0001319 3300048910 Bacteria 15218
1697 Ga0496107_0018674 3300048910 Bacteria 4886
1698 Ga0496107_0035618 3300048910 Unclassified 3568
1699 Ga0496107_0119343 3300048910 Unclassified 1942
1700 Ga0496107_0746977 3300048910 Bacteria 718
1701 Ga0496108_0030751 3300048911 Bacteria 4449
1702 Ga0496108_0087750 3300048911 Bacteria 2642
1703 Ga0496108_0146455 3300048911 Unclassified 2036
1704 Ga0496108_0243074 3300048911 Unclassified 1566
1705 Ga0496108_0750432 3300048911 Unclassified 844
1706 Ga0496108_0820538 3300048911 Unclassified 802
1707 Ga0496109_0015749 3300048912 Bacteria 6599
1708 Ga0496109_0015873 3300048912 Bacteria 6576
1709 Ga0496109_0087543 3300048912 Bacteria 2877
1710 Ga0496109_0356586 3300048912 Bacteria 1382
1711 Ga0496110_0304522 3300048913 Unclassified 1452
1712 Ga0496110_0386693 3300048913 Bacteria 1275
1713 Ga0496110_0678321 3300048913 Unclassified 931
1714 Ga0496110_1666343 3300048913 Unclassified 548
1715 Ga0496111_0115527 3300048914 Bacteria 1979
1716 Ga0496111_0253550 3300048914 Bacteria 1306
1717 Ga0496111_0264709 3300048914 Bacteria 1275
1718 Ga0496111_0454340 3300048914 Unclassified 945
1719 Ga0496111_0702636 3300048914 Bacteria 735
1720 Ga0496112_0145304 3300048915 Unclassified 2340
1721 Ga0496112_0209602 3300048915 Unclassified 1906
1722 Ga0496112_0220236 3300048915 Bacteria 1854
1723 Ga0496112_0732634 3300048915 Bacteria 915
1724 Ga0496112_0746100 3300048915 Unclassified 905
1725 Ga0496113_0088985 3300048916 Bacteria 2376
1726 Ga0496113_0272866 3300048916 Unclassified 1352
1727 Ga0496114_0022742 3300048917 Bacteria 5110
1728 Ga0496114_0035477 3300048917 Bacteria 4118
1729 Ga0496114_0061091 3300048917 Unclassified 3151
1730 Ga0496114_1316710 3300048917 Unclassified 609
1731 Ga0496114_1717539 3300048917 Bacteria 516
1732 Ga0496115_0566010 3300048918 Bacteria 907
1733 Ga0496115_0879482 3300048918 Bacteria 692
1734 Ga0501031_0799660 3300049568 Bacteria 605
1735 Ga0501033_0067307 3300049570 Bacteria 2634
1736 Ga0501039_0260747 3300049575 Bacteria 1362
1737 Ga0501039_0961702 3300049575 Bacteria 664
1738 Ga0501040_0790942 3300049576 Bacteria 686
1739 Ga0501041_0064270 3300049577 Bacteria 2247
1740 Ga0501041_0963412 3300049577 Bacteria 549
1741 Ga0501042_0046124 3300049578 Bacteria 3107
1742 Ga0501042_0054907 3300049578 Bacteria 2842
1743 Ga0501043_0257872 3300049579 Bacteria 1342
1744 Ga0501043_0422137 3300049579 Unclassified 1005
1745 Ga0501047_0243742 3300049581 Unclassified 1647
1746 Ga0501047_0512245 3300049581 Bacteria 1026
1747 Ga0501048_1318031 3300049582 Unclassified 519
1748 Ga0501067_0084497 3300049583 Bacteria 1760
1749 Ga0501067_0190948 3300049583 Unclassified 1141
1750 Ga0501069_0269848 3300049585 Bacteria 994
1751 Ga0501069_0359504 3300049585 Bacteria 859
1752 Ga0501070_0090624 3300049586 Bacteria 2530
1753 Ga0501072_0025913 3300049588 Bacteria 4569
1754 Ga0501072_0120213 3300049588 Bacteria 2093
1755 Ga0501073_0005691 3300049589 Bacteria 9323
1756 Ga0501074_0112904 3300049590 Bacteria 1944
1757 Ga0501075_1517166 3300049591 Unclassified 507
1758 Ga0501076_1668637 3300049592 Unclassified 523
1759 Ga0501077_0815941 3300049593 Archaea 600
1760 Ga0501079_0556292 3300049741 Bacteria 902
1761 Ga0501080_0226274 3300049742 Bacteria 1710
1762 Ga0501080_0332290 3300049742 Bacteria 1374
1763 Ga0501083_0028042 3300049744 Bacteria 3882
1764 Ga0501083_0038451 3300049744 Bacteria 3253
1765 Ga0501035_1352244 3300049822 Bacteria 547
1766 Ga0501045_0135268 3300049824 Bacteria 1833
1767 nmdc:mga05p37_1728116_c1 3300050507 Unclassified 608
1768 nmdc:mga05p37_172_c1 3300050507 Bacteria 63162
1769 nmdc:mga05p37_472022_c1 3300050507 Bacteria 1447
1770 nmdc:mga09592_191_c1 3300050508 Bacteria 41426
1771 nmdc:mga09592_47612_c1 3300050508 Bacteria 3237
1772 nmdc:mga0qj67_1354209_c1 3300050509 Bacteria 550
1773 nmdc:mga0qj67_981870_c1 3300050509 Bacteria 663
1774 nmdc:mga06r32_63340_c1 3300050510 Bacteria 3564
1775 nmdc:mga08y16_1844291_c1 3300050511 Unclassified 557
1776 nmdc:mga08y16_193468_c1 3300050511 Unclassified 2109
1777 nmdc:mga08y16_407116_c1 3300050511 Unclassified 1391
1778 nmdc:mga08y16_639735_c1 3300050511 Bacteria 1069
1779 nmdc:mga08y16_867_c1 3300050511 Bacteria 29137
1780 nmdc:mga0n895_136756_c1 3300050512 Unclassified 2477
1781 nmdc:mga0n895_142641_c1 3300050512 Unclassified 2424
1782 nmdc:mga0n895_1747798_c1 3300050512 Unclassified 584
1783 nmdc:mga0n895_1848439_c1 3300050512 Unclassified 564
1784 nmdc:mga0n895_32674_c1 3300050512 Bacteria 4996
1785 nmdc:mga0n895_701773_c1 3300050512 Unclassified 1008
1786 nmdc:mga0rr50_105016_c1 3300050513 Unclassified 2226
1787 nmdc:mga0rr50_1220065_c1 3300050513 Bacteria 639
1788 nmdc:mga0rr50_1256922_c1 3300050513 Unclassified 628
1789 nmdc:mga0rr50_276647_c1 3300050513 Bacteria 1400
1790 nmdc:mga0rr50_363390_c1 3300050513 Bacteria 1219
1791 nmdc:mga0rr50_468120_c1 3300050513 Bacteria 1070
1792 nmdc:mga0rr50_469293_c1 3300050513 Bacteria 1068
1793 nmdc:mga0rr50_67241_c1 3300050513 Unclassified 2721
1794 nmdc:mga0rr50_928027_c1 3300050513 Unclassified 742
1795 nmdc:mga08x19_157731_c1 3300050514 Bacteria 1540
1796 nmdc:mga08x19_313169_c1 3300050514 Bacteria 1091
1797 nmdc:mga08x19_393114_c1 3300050514 Bacteria 972
1798 nmdc:mga08x19_4190_c1 3300050514 Bacteria 8543
1799 nmdc:mga08x19_42273_c1 3300050514 Bacteria 2905
1800 nmdc:mga0a205_1007282_c1 3300050515 Unclassified 680
1801 nmdc:mga0a205_1491772_c1 3300050515 Unclassified 524
1802 nmdc:mga0a205_169132_c1 3300050515 Unclassified 2081
1803 nmdc:mga0a205_170036_c1 3300050515 Unclassified 2075
1804 nmdc:mga0a205_686188_c2 3300050515 Bacteria 580
1805 nmdc:mga0a205_92009_c1 3300050515 Unclassified 2931
1806 Ga0495601_0110802 3300053077 Bacteria 1778
1807 Ga0495601_0474001 3300053077 Unclassified 809
1808 Ga0495612_0026782 3300053078 Bacteria 2317
1809 Ga0495612_0040720 3300053078 Unclassified 1894
1810 Ga0495655_0289728 3300053083 Unclassified 560
1811 Ga0495619_0151735 3300053085 Bacteria 1598
1812 Ga0495619_0368513 3300053085 Archaea 993
1813 Ga0495619_0742190 3300053085 Unclassified 666
1814 Ga0495619_0938592 3300053085 Unclassified 581
1815 Ga0495619_1205129 3300053085 Unclassified 501
1816 Ga0501084_0079631 3300054114 Bacteria 2746
1817 Ga0501084_0482507 3300054114 Bacteria 1048
1818 Ga0501082_0132311 3300060353 Bacteria 2164
1819 Ga0530510_0360332 3300061734 Unclassified 1093

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007265 Ga0099794_10764129 Ga0099794_107641291 93
2 3300005444 Ga0070694_100049224 Ga0070694_1000492243 94
3 3300006881 Ga0068865_101488558 Ga0068865_1014885581 94
4 3300007076 Ga0075435_100146420 Ga0075435_1001464203 94
5 3300009177 Ga0105248_10713621 Ga0105248_107136213 94
6 3300011119 Ga0105246_12231043 Ga0105246_122310432 94
7 3300013306 Ga0163162_10173212 Ga0163162_101732123 94
8 3300013308 Ga0157375_10021744 Ga0157375_100217443 94
9 3300014326 Ga0157380_10073132 Ga0157380_100731324 94
10 3300025906 Ga0207699_10247232 Ga0207699_102472322 94
11 3300025938 Ga0207704_11370634 Ga0207704_113706341 94
12 3300034817 Ga0373948_0098159 Ga0373948_0098159_292_576 94
13 3300034818 Ga0373950_0052363 Ga0373950_0052363_202_486 94
14 3300035112 Ga0373932_0030013 Ga0373932_0030013_12_296 94
15 3300035691 Ga0373931_0004698 Ga0373931_0004698_3535_3819 94
16 3300037068 Ga0373925_0795893 Ga0373925_0795893_139_423 94
17 3300041496 Ga0451839_0451676 Ga0451839_0451676_219_503 94
18 3300048917 Ga0496114_1717539 Ga0496114_1717539_108_392 94
19 3300049585 Ga0501069_0359504 Ga0501069_0359504_185_469 94
20 3300005615 Ga0070702_100187184 Ga0070702_1001871842 95
21 3300032005 Ga0307411_11381880 Ga0307411_113818802 95
22 3300005336 Ga0070680_100470603 Ga0070680_1004706032 96
23 3300005343 Ga0070687_100082310 Ga0070687_1000823103 96
24 3300005345 Ga0070692_10684439 Ga0070692_106844392 96
25 3300005434 Ga0070709_10393048 Ga0070709_103930482 96
26 3300005440 Ga0070705_100868167 Ga0070705_1008681672 96
27 3300005440 Ga0070705_101619819 Ga0070705_1016198191 96
28 3300005444 Ga0070694_100014219 Ga0070694_1000142193 96
29 3300005444 Ga0070694_100176678 Ga0070694_1001766782 96
30 3300005444 Ga0070694_100949352 Ga0070694_1009493521 96
31 3300005456 Ga0070678_101318531 Ga0070678_1013185311 96
32 3300005545 Ga0070695_100023917 Ga0070695_1000239172 96
33 3300005546 Ga0070696_100227187 Ga0070696_1002271872 96
34 3300005549 Ga0070704_101044853 Ga0070704_1010448532 96
35 3300005615 Ga0070702_100856062 Ga0070702_1008560622 96
36 3300005615 Ga0070702_101553111 Ga0070702_1015531112 96
37 3300005617 Ga0068859_100789960 Ga0068859_1007899602 96
38 3300005618 Ga0068864_100200613 Ga0068864_1002006132 96
39 3300005840 Ga0068870_10898749 Ga0068870_108987492 96
40 3300005841 Ga0068863_100735119 Ga0068863_1007351192 96
41 3300006237 Ga0097621_102289254 Ga0097621_1022892541 96
42 3300006852 Ga0075433_10710338 Ga0075433_107103382 96
43 3300006914 Ga0075436_100387679 Ga0075436_1003876792 96
44 3300006931 Ga0097620_100789939 Ga0097620_1007899392 96
45 3300009098 Ga0105245_10745328 Ga0105245_107453281 96
46 3300012513 Ga0157326_1012603 Ga0157326_10126032 96
47 3300013100 Ga0157373_10765268 Ga0157373_107652682 96
48 3300013306 Ga0163162_10660065 Ga0163162_106600653 96
49 3300013307 Ga0157372_12446361 Ga0157372_124463612 96
50 3300014745 Ga0157377_11462939 Ga0157377_114629391 96
51 3300025906 Ga0207699_10156992 Ga0207699_101569922 96
52 3300025917 Ga0207660_10461290 Ga0207660_104612902 96
53 3300025918 Ga0207662_10052420 Ga0207662_100524202 96
54 3300025923 Ga0207681_11477342 Ga0207681_114773422 96
55 3300026075 Ga0207708_10154258 Ga0207708_101542582 96
56 3300026075 Ga0207708_12000849 Ga0207708_120008492 96
57 3300026095 Ga0207676_11240883 Ga0207676_112408831 96
58 3300026116 Ga0207674_10190705 Ga0207674_101907053 96
59 3300026118 Ga0207675_100180437 Ga0207675_1001804371 96
60 3300031691 Ga0316579_10292500 Ga0316579_102925002 96
61 3300031727 Ga0316576_10290465 Ga0316576_102904652 96
62 3300031728 Ga0316578_10080432 Ga0316578_100804323 96
63 3300031733 Ga0316577_10123159 Ga0316577_101231592 96
64 3300034816 Ga0373930_0105915 Ga0373930_0105915_263_553 96
65 3300035090 Ga0373949_0108411 Ga0373949_0108411_217_507 96
66 3300035114 Ga0373939_0156298 Ga0373939_0156298_359_649 96
67 3300035114 Ga0373939_0439942 Ga0373939_0439942_54_344 96
68 3300035241 Ga0373961_0436236 Ga0373961_0436236_67_357 96
69 3300035410 Ga0373924_0293870 Ga0373924_0293870_377_670 96
70 3300036401 Ga0373937_2111260 Ga0373937_2111260_21_314 96
71 3300036647 Ga0316582_0071298 Ga0316582_0071298_1296_1589 96
72 3300036712 Ga0316584_0008509 Ga0316584_0008509_3120_3413 96
73 3300036712 Ga0316584_0533732 Ga0316584_0533732_107_400 96
74 3300038996 Ga0242420_013427 Ga0242420_013427_457_747 96
75 3300041452 Ga0451793_0180856 Ga0451793_0180856_55_345 96
76 3300042436 Ga0439435_0017179 Ga0439435_0017179_1351_1641 96
77 3300042876 Ga0451577_0216225 Ga0451577_0216225_812_1102 96
78 3300042876 Ga0451577_1078961 Ga0451577_1078961_16_306 96
79 3300045051 Ga0451576_0136888 Ga0451576_0136888_1122_1412 96
80 3300046539 Ga0495621_0029552 Ga0495621_0029552_908_1198 96
81 3300046681 Ga0495647_0147218 Ga0495647_0147218_211_504 96
82 3300048909 Ga0496106_0077277 Ga0496106_0077277_216_506 96
83 3300048913 Ga0496110_0304522 Ga0496110_0304522_481_771 96
84 3300048914 Ga0496111_0702636 Ga0496111_0702636_394_684 96
85 3300049568 Ga0501031_0799660 Ga0501031_0799660_255_545 96
86 3300049570 Ga0501033_0067307 Ga0501033_0067307_673_963 96
87 3300049575 Ga0501039_0260747 Ga0501039_0260747_293_583 96
88 3300049576 Ga0501040_0790942 Ga0501040_0790942_356_646 96
89 3300049577 Ga0501041_0064270 Ga0501041_0064270_754_1044 96
90 3300049578 Ga0501042_0046124 Ga0501042_0046124_1673_1963 96
91 3300049579 Ga0501043_0422137 Ga0501043_0422137_310_600 96
92 3300049581 Ga0501047_0243742 Ga0501047_0243742_97_387 96
93 3300049582 Ga0501048_1318031 Ga0501048_1318031_97_387 96
94 3300049583 Ga0501067_0190948 Ga0501067_0190948_457_747 96
95 3300049593 Ga0501077_0815941 Ga0501077_0815941_134_424 96
96 3300050513 nmdc:mga0rr50_928027_c1 nmdc:mga0rr50_928027_c1_280_570 96
97 3300050514 nmdc:mga08x19_313169_c1 nmdc:mga08x19_313169_c1_249_539 96
98 3300050515 nmdc:mga0a205_686188_c2 nmdc:mga0a205_686188_c2_186_476 96
99 3300053085 Ga0495619_1205129 Ga0495619_1205129_155_448 96
100 2162886012 MBSR1b_contig_9864180 MBSR1b_0728.00002800 97
101 3300005290 Ga0065712_10542608 Ga0065712_105426081 97
102 3300005293 Ga0065715_10100272 Ga0065715_101002722 97
103 3300005295 Ga0065707_10145400 Ga0065707_101454002 97
104 3300005295 Ga0065707_10397702 Ga0065707_103977022 97
105 3300005327 Ga0070658_10094378 Ga0070658_100943783 97
106 3300005327 Ga0070658_10206452 Ga0070658_102064521 97
107 3300005327 Ga0070658_10822346 Ga0070658_108223462 97
108 3300005327 Ga0070658_11288025 Ga0070658_112880252 97
109 3300005327 Ga0070658_11493427 Ga0070658_114934272 97
110 3300005328 Ga0070676_10000211 Ga0070676_100002119 97
111 3300005328 Ga0070676_10025275 Ga0070676_100252751 97
112 3300005328 Ga0070676_10055500 Ga0070676_100555003 97
113 3300005328 Ga0070676_10114273 Ga0070676_101142731 97
114 3300005328 Ga0070676_10638306 Ga0070676_106383062 97
115 3300005328 Ga0070676_10807230 Ga0070676_108072302 97
116 3300005328 Ga0070676_10819939 Ga0070676_108199392 97
117 3300005328 Ga0070676_10832548 Ga0070676_108325482 97
118 3300005328 Ga0070676_11346053 Ga0070676_113460532 97
119 3300005329 Ga0070683_100090336 Ga0070683_1000903363 97
120 3300005329 Ga0070683_100125606 Ga0070683_1001256062 97
121 3300005329 Ga0070683_100140591 Ga0070683_1001405912 97
122 3300005329 Ga0070683_100196522 Ga0070683_1001965222 97
123 3300005330 Ga0070690_100005661 Ga0070690_1000056613 97
124 3300005330 Ga0070690_100102823 Ga0070690_1001028232 97
125 3300005330 Ga0070690_100488347 Ga0070690_1004883472 97
126 3300005330 Ga0070690_100851163 Ga0070690_1008511632 97
127 3300005330 Ga0070690_101760989 Ga0070690_1017609891 97
128 3300005331 Ga0070670_100003580 Ga0070670_1000035803 97
129 3300005331 Ga0070670_100087442 Ga0070670_1000874423 97
130 3300005331 Ga0070670_100112887 Ga0070670_1001128872 97
131 3300005331 Ga0070670_100196124 Ga0070670_1001961243 97
132 3300005331 Ga0070670_100208479 Ga0070670_1002084793 97
133 3300005331 Ga0070670_100381174 Ga0070670_1003811742 97
134 3300005331 Ga0070670_100476436 Ga0070670_1004764361 97
135 3300005331 Ga0070670_100528780 Ga0070670_1005287802 97
136 3300005331 Ga0070670_101437665 Ga0070670_1014376652 97
137 3300005331 Ga0070670_101586733 Ga0070670_1015867331 97
138 3300005333 Ga0070677_10042108 Ga0070677_100421083 97
139 3300005333 Ga0070677_10055555 Ga0070677_100555552 97
140 3300005333 Ga0070677_10101894 Ga0070677_101018943 97
141 3300005333 Ga0070677_10831166 Ga0070677_108311661 97
142 3300005334 Ga0068869_100001217 Ga0068869_1000012178 97
143 3300005334 Ga0068869_100004711 Ga0068869_1000047116 97
144 3300005334 Ga0068869_100018986 Ga0068869_1000189863 97
145 3300005334 Ga0068869_100098254 Ga0068869_1000982543 97
146 3300005334 Ga0068869_100133068 Ga0068869_1001330683 97
147 3300005334 Ga0068869_100226317 Ga0068869_1002263172 97
148 3300005334 Ga0068869_100253298 Ga0068869_1002532982 97
149 3300005334 Ga0068869_101190788 Ga0068869_1011907881 97
150 3300005334 Ga0068869_101930842 Ga0068869_1019308421 97
151 3300005335 Ga0070666_10011323 Ga0070666_100113233 97
152 3300005335 Ga0070666_10104249 Ga0070666_101042492 97
153 3300005335 Ga0070666_10116869 Ga0070666_101168692 97
154 3300005335 Ga0070666_10959008 Ga0070666_109590081 97
155 3300005336 Ga0070680_100179087 Ga0070680_1001790873 97
156 3300005336 Ga0070680_100179992 Ga0070680_1001799923 97
157 3300005336 Ga0070680_100479408 Ga0070680_1004794082 97
158 3300005336 Ga0070680_100644816 Ga0070680_1006448162 97
159 3300005336 Ga0070680_100939180 Ga0070680_1009391802 97
160 3300005336 Ga0070680_101027316 Ga0070680_1010273162 97
161 3300005336 Ga0070680_101133140 Ga0070680_1011331401 97
162 3300005336 Ga0070680_101259262 Ga0070680_1012592621 97
163 3300005336 Ga0070680_101642702 Ga0070680_1016427022 97
164 3300005337 Ga0070682_100079248 Ga0070682_1000792483 97
165 3300005337 Ga0070682_100141338 Ga0070682_1001413382 97
166 3300005337 Ga0070682_100153895 Ga0070682_1001538951 97
167 3300005337 Ga0070682_100677841 Ga0070682_1006778412 97
168 3300005338 Ga0068868_100004450 Ga0068868_1000044502 97
169 3300005338 Ga0068868_100045990 Ga0068868_1000459903 97
170 3300005338 Ga0068868_100076091 Ga0068868_1000760912 97
171 3300005338 Ga0068868_100139220 Ga0068868_1001392202 97
172 3300005338 Ga0068868_100236246 Ga0068868_1002362462 97
173 3300005338 Ga0068868_100425549 Ga0068868_1004255491 97
174 3300005338 Ga0068868_100805042 Ga0068868_1008050421 97
175 3300005338 Ga0068868_101494040 Ga0068868_1014940402 97
176 3300005338 Ga0068868_102047439 Ga0068868_1020474391 97
177 3300005339 Ga0070660_100003500 Ga0070660_1000035003 97
178 3300005339 Ga0070660_100005880 Ga0070660_1000058803 97
179 3300005339 Ga0070660_100093994 Ga0070660_1000939942 97
180 3300005339 Ga0070660_100113437 Ga0070660_1001134372 97
181 3300005339 Ga0070660_100241040 Ga0070660_1002410403 97
182 3300005339 Ga0070660_100514892 Ga0070660_1005148921 97
183 3300005339 Ga0070660_100713737 Ga0070660_1007137372 97
184 3300005339 Ga0070660_101239651 Ga0070660_1012396512 97
185 3300005339 Ga0070660_101777417 Ga0070660_1017774171 97
186 3300005340 Ga0070689_100025395 Ga0070689_1000253953 97
187 3300005340 Ga0070689_100061093 Ga0070689_1000610933 97
188 3300005340 Ga0070689_100117772 Ga0070689_1001177723 97
189 3300005340 Ga0070689_100127313 Ga0070689_1001273132 97
190 3300005340 Ga0070689_100162475 Ga0070689_1001624753 97
191 3300005340 Ga0070689_100417069 Ga0070689_1004170692 97
192 3300005341 Ga0070691_10061583 Ga0070691_100615833 97
193 3300005341 Ga0070691_10354306 Ga0070691_103543062 97
194 3300005341 Ga0070691_10866007 Ga0070691_108660071 97
195 3300005343 Ga0070687_100045775 Ga0070687_1000457752 97
196 3300005343 Ga0070687_100047605 Ga0070687_1000476053 97
197 3300005343 Ga0070687_100195423 Ga0070687_1001954231 97
198 3300005343 Ga0070687_100663317 Ga0070687_1006633172 97
199 3300005343 Ga0070687_100759345 Ga0070687_1007593452 97
200 3300005343 Ga0070687_100780189 Ga0070687_1007801891 97
201 3300005344 Ga0070661_100007884 Ga0070661_1000078843 97
202 3300005344 Ga0070661_100038383 Ga0070661_1000383834 97
203 3300005344 Ga0070661_100104277 Ga0070661_1001042773 97
204 3300005344 Ga0070661_100139938 Ga0070661_1001399383 97
205 3300005344 Ga0070661_100237909 Ga0070661_1002379091 97
206 3300005344 Ga0070661_100487460 Ga0070661_1004874602 97
207 3300005344 Ga0070661_100758277 Ga0070661_1007582772 97
208 3300005344 Ga0070661_101047619 Ga0070661_1010476192 97
209 3300005344 Ga0070661_101571147 Ga0070661_1015711471 97
210 3300005345 Ga0070692_10010072 Ga0070692_100100723 97
211 3300005345 Ga0070692_10030332 Ga0070692_100303322 97
212 3300005345 Ga0070692_10066134 Ga0070692_100661343 97
213 3300005345 Ga0070692_10136624 Ga0070692_101366242 97
214 3300005345 Ga0070692_10299887 Ga0070692_102998872 97
215 3300005345 Ga0070692_10446247 Ga0070692_104462472 97
216 3300005345 Ga0070692_10974427 Ga0070692_109744271 97
217 3300005347 Ga0070668_100002186 Ga0070668_1000021866 97
218 3300005347 Ga0070668_100007036 Ga0070668_1000070369 97
219 3300005347 Ga0070668_100033821 Ga0070668_1000338214 97
220 3300005347 Ga0070668_100046205 Ga0070668_1000462053 97
221 3300005347 Ga0070668_100082243 Ga0070668_1000822433 97
222 3300005347 Ga0070668_100102662 Ga0070668_1001026623 97
223 3300005353 Ga0070669_100036373 Ga0070669_1000363733 97
224 3300005353 Ga0070669_100045618 Ga0070669_1000456183 97
225 3300005353 Ga0070669_100050446 Ga0070669_1000504463 97
226 3300005353 Ga0070669_100090158 Ga0070669_1000901583 97
227 3300005353 Ga0070669_100107000 Ga0070669_1001070003 97
228 3300005353 Ga0070669_100128836 Ga0070669_1001288362 97
229 3300005353 Ga0070669_100290352 Ga0070669_1002903522 97
230 3300005353 Ga0070669_100403302 Ga0070669_1004033023 97
231 3300005353 Ga0070669_100924270 Ga0070669_1009242701 97
232 3300005354 Ga0070675_100006516 Ga0070675_1000065163 97
233 3300005354 Ga0070675_100046616 Ga0070675_1000466163 97
234 3300005354 Ga0070675_100063178 Ga0070675_1000631782 97
235 3300005354 Ga0070675_100100598 Ga0070675_1001005983 97
236 3300005354 Ga0070675_100113405 Ga0070675_1001134053 97
237 3300005354 Ga0070675_100167478 Ga0070675_1001674783 97
238 3300005354 Ga0070675_100309595 Ga0070675_1003095952 97
239 3300005354 Ga0070675_100354527 Ga0070675_1003545271 97
240 3300005354 Ga0070675_100458880 Ga0070675_1004588802 97
241 3300005354 Ga0070675_100637287 Ga0070675_1006372872 97
242 3300005354 Ga0070675_100780113 Ga0070675_1007801132 97
243 3300005354 Ga0070675_101139829 Ga0070675_1011398292 97
244 3300005355 Ga0070671_100004012 Ga0070671_10000401215 97
245 3300005355 Ga0070671_100011149 Ga0070671_1000111497 97
246 3300005355 Ga0070671_100031851 Ga0070671_1000318514 97
247 3300005355 Ga0070671_100073618 Ga0070671_1000736182 97
248 3300005355 Ga0070671_100101430 Ga0070671_1001014304 97
249 3300005355 Ga0070671_100249869 Ga0070671_1002498692 97
250 3300005355 Ga0070671_100314929 Ga0070671_1003149292 97
251 3300005355 Ga0070671_100624332 Ga0070671_1006243321 97
252 3300005355 Ga0070671_100835766 Ga0070671_1008357662 97
253 3300005356 Ga0070674_100040495 Ga0070674_1000404953 97
254 3300005356 Ga0070674_100081773 Ga0070674_1000817732 97
255 3300005356 Ga0070674_100096666 Ga0070674_1000966663 97
256 3300005356 Ga0070674_100097462 Ga0070674_1000974622 97
257 3300005356 Ga0070674_100108336 Ga0070674_1001083362 97
258 3300005356 Ga0070674_100671804 Ga0070674_1006718042 97
259 3300005356 Ga0070674_100745190 Ga0070674_1007451901 97
260 3300005356 Ga0070674_101999486 Ga0070674_1019994861 97
261 3300005364 Ga0070673_100003990 Ga0070673_1000039907 97
262 3300005364 Ga0070673_100004734 Ga0070673_1000047343 97
263 3300005364 Ga0070673_100005609 Ga0070673_1000056092 97
264 3300005364 Ga0070673_100085211 Ga0070673_1000852112 97
265 3300005364 Ga0070673_100112338 Ga0070673_1001123383 97
266 3300005364 Ga0070673_100290052 Ga0070673_1002900522 97
267 3300005364 Ga0070673_100318342 Ga0070673_1003183422 97
268 3300005364 Ga0070673_100390966 Ga0070673_1003909662 97
269 3300005364 Ga0070673_101877538 Ga0070673_1018775381 97
270 3300005365 Ga0070688_100000557 Ga0070688_1000005577 97
271 3300005365 Ga0070688_100009729 Ga0070688_1000097295 97
272 3300005365 Ga0070688_100037032 Ga0070688_1000370322 97
273 3300005365 Ga0070688_100703082 Ga0070688_1007030822 97
274 3300005366 Ga0070659_100027196 Ga0070659_1000271963 97
275 3300005366 Ga0070659_100027947 Ga0070659_1000279474 97
276 3300005366 Ga0070659_100097047 Ga0070659_1000970473 97
277 3300005366 Ga0070659_100097628 Ga0070659_1000976282 97
278 3300005366 Ga0070659_100123855 Ga0070659_1001238553 97
279 3300005366 Ga0070659_100399058 Ga0070659_1003990582 97
280 3300005366 Ga0070659_100420994 Ga0070659_1004209941 97
281 3300005366 Ga0070659_100767447 Ga0070659_1007674472 97
282 3300005367 Ga0070667_100011739 Ga0070667_1000117392 97
283 3300005367 Ga0070667_100065382 Ga0070667_1000653822 97
284 3300005367 Ga0070667_100133336 Ga0070667_1001333363 97
285 3300005367 Ga0070667_100155200 Ga0070667_1001552002 97
286 3300005367 Ga0070667_100232746 Ga0070667_1002327462 97
287 3300005367 Ga0070667_100238942 Ga0070667_1002389422 97
288 3300005367 Ga0070667_100333201 Ga0070667_1003332012 97
289 3300005367 Ga0070667_100372645 Ga0070667_1003726451 97
290 3300005367 Ga0070667_100519288 Ga0070667_1005192882 97
291 3300005434 Ga0070709_10011236 Ga0070709_100112363 97
292 3300005434 Ga0070709_10118659 Ga0070709_101186592 97
293 3300005434 Ga0070709_10194418 Ga0070709_101944182 97
294 3300005434 Ga0070709_10195015 Ga0070709_101950152 97
295 3300005434 Ga0070709_10272279 Ga0070709_102722792 97
296 3300005434 Ga0070709_10641698 Ga0070709_106416982 97
297 3300005435 Ga0070714_100005797 Ga0070714_1000057972 97
298 3300005435 Ga0070714_100024453 Ga0070714_1000244533 97
299 3300005435 Ga0070714_100994195 Ga0070714_1009941952 97
300 3300005436 Ga0070713_100002362 Ga0070713_10000236211 97
301 3300005436 Ga0070713_100007179 Ga0070713_1000071793 97
302 3300005436 Ga0070713_100554708 Ga0070713_1005547082 97
303 3300005436 Ga0070713_100728033 Ga0070713_1007280331 97
304 3300005436 Ga0070713_102315527 Ga0070713_1023155271 97
305 3300005437 Ga0070710_10003230 Ga0070710_100032301 97
306 3300005437 Ga0070710_10019099 Ga0070710_100190993 97
307 3300005437 Ga0070710_10049622 Ga0070710_100496222 97
308 3300005437 Ga0070710_10410569 Ga0070710_104105692 97
309 3300005438 Ga0070701_10041658 Ga0070701_100416582 97
310 3300005438 Ga0070701_10063235 Ga0070701_100632353 97
311 3300005438 Ga0070701_10082441 Ga0070701_100824412 97
312 3300005438 Ga0070701_10143470 Ga0070701_101434702 97
313 3300005438 Ga0070701_10449006 Ga0070701_104490062 97
314 3300005438 Ga0070701_10478610 Ga0070701_104786102 97
315 3300005438 Ga0070701_10728393 Ga0070701_107283932 97
316 3300005439 Ga0070711_100104268 Ga0070711_1001042682 97
317 3300005439 Ga0070711_100176774 Ga0070711_1001767743 97
318 3300005439 Ga0070711_100240399 Ga0070711_1002403992 97
319 3300005439 Ga0070711_100274116 Ga0070711_1002741162 97
320 3300005439 Ga0070711_100274333 Ga0070711_1002743332 97
321 3300005439 Ga0070711_100582609 Ga0070711_1005826092 97
322 3300005439 Ga0070711_101095740 Ga0070711_1010957402 97
323 3300005439 Ga0070711_101204176 Ga0070711_1012041762 97
324 3300005440 Ga0070705_100014396 Ga0070705_1000143962 97
325 3300005440 Ga0070705_100054471 Ga0070705_1000544712 97
326 3300005440 Ga0070705_100424623 Ga0070705_1004246232 97
327 3300005440 Ga0070705_100424741 Ga0070705_1004247412 97
328 3300005440 Ga0070705_101387406 Ga0070705_1013874062 97
329 3300005440 Ga0070705_101402566 Ga0070705_1014025661 97
330 3300005440 Ga0070705_101506925 Ga0070705_1015069252 97
331 3300005441 Ga0070700_100014520 Ga0070700_1000145203 97
332 3300005441 Ga0070700_100207922 Ga0070700_1002079222 97
333 3300005441 Ga0070700_100217420 Ga0070700_1002174202 97
334 3300005441 Ga0070700_100813629 Ga0070700_1008136292 97
335 3300005441 Ga0070700_101003806 Ga0070700_1010038062 97
336 3300005444 Ga0070694_100026011 Ga0070694_1000260113 97
337 3300005444 Ga0070694_100316088 Ga0070694_1003160881 97
338 3300005445 Ga0070708_100000683 Ga0070708_1000006833 97
339 3300005445 Ga0070708_100154259 Ga0070708_1001542593 97
340 3300005455 Ga0070663_100077453 Ga0070663_1000774533 97
341 3300005455 Ga0070663_100105931 Ga0070663_1001059312 97
342 3300005455 Ga0070663_100123078 Ga0070663_1001230782 97
343 3300005455 Ga0070663_100253026 Ga0070663_1002530262 97
344 3300005455 Ga0070663_100297822 Ga0070663_1002978222 97
345 3300005455 Ga0070663_100682265 Ga0070663_1006822652 97
346 3300005455 Ga0070663_101543572 Ga0070663_1015435721 97
347 3300005455 Ga0070663_101687593 Ga0070663_1016875931 97
348 3300005456 Ga0070678_100001883 Ga0070678_1000018832 97
349 3300005456 Ga0070678_100010302 Ga0070678_1000103023 97
350 3300005456 Ga0070678_100045591 Ga0070678_1000455913 97
351 3300005456 Ga0070678_100064189 Ga0070678_1000641893 97
352 3300005456 Ga0070678_100103735 Ga0070678_1001037353 97
353 3300005456 Ga0070678_100145022 Ga0070678_1001450223 97
354 3300005456 Ga0070678_100668698 Ga0070678_1006686982 97
355 3300005456 Ga0070678_101365960 Ga0070678_1013659601 97
356 3300005457 Ga0070662_100001043 Ga0070662_1000010433 97
357 3300005457 Ga0070662_100072452 Ga0070662_1000724522 97
358 3300005457 Ga0070662_100128156 Ga0070662_1001281562 97
359 3300005457 Ga0070662_100159878 Ga0070662_1001598782 97
360 3300005457 Ga0070662_100181545 Ga0070662_1001815451 97
361 3300005457 Ga0070662_100286648 Ga0070662_1002866482 97
362 3300005457 Ga0070662_100412010 Ga0070662_1004120102 97
363 3300005457 Ga0070662_100642241 Ga0070662_1006422411 97
364 3300005457 Ga0070662_100726440 Ga0070662_1007264401 97
365 3300005457 Ga0070662_101324469 Ga0070662_1013244691 97
366 3300005457 Ga0070662_101724008 Ga0070662_1017240081 97
367 3300005458 Ga0070681_10134071 Ga0070681_101340712 97
368 3300005458 Ga0070681_10139327 Ga0070681_101393273 97
369 3300005458 Ga0070681_10179397 Ga0070681_101793972 97
370 3300005458 Ga0070681_10556623 Ga0070681_105566232 97
371 3300005459 Ga0068867_100008824 Ga0068867_1000088248 97
372 3300005459 Ga0068867_100010852 Ga0068867_1000108527 97
373 3300005459 Ga0068867_100037549 Ga0068867_1000375493 97
374 3300005459 Ga0068867_100129200 Ga0068867_1001292003 97
375 3300005459 Ga0068867_100230853 Ga0068867_1002308532 97
376 3300005459 Ga0068867_100268657 Ga0068867_1002686572 97
377 3300005459 Ga0068867_100577481 Ga0068867_1005774812 97
378 3300005466 Ga0070685_10004731 Ga0070685_100047313 97
379 3300005466 Ga0070685_10080866 Ga0070685_100808663 97
380 3300005466 Ga0070685_10192066 Ga0070685_101920662 97
381 3300005466 Ga0070685_10375698 Ga0070685_103756982 97
382 3300005467 Ga0070706_100197408 Ga0070706_1001974082 97
383 3300005467 Ga0070706_100323888 Ga0070706_1003238881 97
384 3300005467 Ga0070706_101248701 Ga0070706_1012487012 97
385 3300005468 Ga0070707_100038066 Ga0070707_1000380664 97
386 3300005468 Ga0070707_100179302 Ga0070707_1001793023 97
387 3300005468 Ga0070707_100215895 Ga0070707_1002158952 97
388 3300005468 Ga0070707_101302103 Ga0070707_1013021031 97
389 3300005471 Ga0070698_100002731 Ga0070698_1000027314 97
390 3300005471 Ga0070698_100066623 Ga0070698_1000666233 97
391 3300005471 Ga0070698_100252024 Ga0070698_1002520241 97
392 3300005471 Ga0070698_100592664 Ga0070698_1005926642 97
393 3300005471 Ga0070698_101026283 Ga0070698_1010262832 97
394 3300005471 Ga0070698_101314976 Ga0070698_1013149762 97
395 3300005518 Ga0070699_100034559 Ga0070699_1000345593 97
396 3300005518 Ga0070699_100078559 Ga0070699_1000785592 97
397 3300005518 Ga0070699_100358771 Ga0070699_1003587712 97
398 3300005518 Ga0070699_100437578 Ga0070699_1004375782 97
399 3300005518 Ga0070699_100539103 Ga0070699_1005391032 97
400 3300005518 Ga0070699_100938050 Ga0070699_1009380502 97
401 3300005518 Ga0070699_101892382 Ga0070699_1018923821 97
402 3300005530 Ga0070679_100008441 Ga0070679_1000084414 97
403 3300005530 Ga0070679_100042847 Ga0070679_1000428474 97
404 3300005530 Ga0070679_100076461 Ga0070679_1000764614 97
405 3300005530 Ga0070679_100080173 Ga0070679_1000801734 97
406 3300005530 Ga0070679_100125474 Ga0070679_1001254744 97
407 3300005530 Ga0070679_100251947 Ga0070679_1002519472 97
408 3300005530 Ga0070679_100259128 Ga0070679_1002591282 97
409 3300005530 Ga0070679_100301444 Ga0070679_1003014441 97
410 3300005530 Ga0070679_100319813 Ga0070679_1003198132 97
411 3300005530 Ga0070679_100596183 Ga0070679_1005961832 97
412 3300005535 Ga0070684_100096875 Ga0070684_1000968753 97
413 3300005535 Ga0070684_100159725 Ga0070684_1001597252 97
414 3300005536 Ga0070697_101528259 Ga0070697_1015282592 97
415 3300005536 Ga0070697_102024739 Ga0070697_1020247391 97
416 3300005536 Ga0070697_102127823 Ga0070697_1021278232 97
417 3300005539 Ga0068853_100019451 Ga0068853_1000194512 97
418 3300005539 Ga0068853_100022517 Ga0068853_1000225173 97
419 3300005539 Ga0068853_100052514 Ga0068853_1000525143 97
420 3300005539 Ga0068853_100103359 Ga0068853_1001033592 97
421 3300005539 Ga0068853_100158080 Ga0068853_1001580802 97
422 3300005539 Ga0068853_100206402 Ga0068853_1002064023 97
423 3300005539 Ga0068853_100280532 Ga0068853_1002805322 97
424 3300005539 Ga0068853_100298682 Ga0068853_1002986821 97
425 3300005539 Ga0068853_100411231 Ga0068853_1004112311 97
426 3300005539 Ga0068853_100521878 Ga0068853_1005218781 97
427 3300005539 Ga0068853_100927427 Ga0068853_1009274272 97
428 3300005539 Ga0068853_102215221 Ga0068853_1022152211 97
429 3300005543 Ga0070672_100013833 Ga0070672_1000138333 97
430 3300005543 Ga0070672_100015091 Ga0070672_1000150913 97
431 3300005543 Ga0070672_100079583 Ga0070672_1000795832 97
432 3300005543 Ga0070672_100095050 Ga0070672_1000950502 97
433 3300005543 Ga0070672_100121800 Ga0070672_1001218002 97
434 3300005543 Ga0070672_100127589 Ga0070672_1001275892 97
435 3300005543 Ga0070672_100215099 Ga0070672_1002150993 97
436 3300005543 Ga0070672_102110348 Ga0070672_1021103482 97
437 3300005544 Ga0070686_100005635 Ga0070686_1000056357 97
438 3300005544 Ga0070686_100060398 Ga0070686_1000603982 97
439 3300005544 Ga0070686_100097759 Ga0070686_1000977592 97
440 3300005545 Ga0070695_100050540 Ga0070695_1000505402 97
441 3300005545 Ga0070695_100157197 Ga0070695_1001571972 97
442 3300005545 Ga0070695_100378936 Ga0070695_1003789362 97
443 3300005545 Ga0070695_100835014 Ga0070695_1008350142 97
444 3300005545 Ga0070695_101074094 Ga0070695_1010740942 97
445 3300005545 Ga0070695_101139591 Ga0070695_1011395912 97
446 3300005545 Ga0070695_101299476 Ga0070695_1012994762 97
447 3300005546 Ga0070696_100004634 Ga0070696_1000046348 97
448 3300005546 Ga0070696_100038973 Ga0070696_1000389732 97
449 3300005546 Ga0070696_100288623 Ga0070696_1002886232 97
450 3300005546 Ga0070696_100362629 Ga0070696_1003626291 97
451 3300005546 Ga0070696_100462227 Ga0070696_1004622272 97
452 3300005546 Ga0070696_100773568 Ga0070696_1007735682 97
453 3300005546 Ga0070696_100858165 Ga0070696_1008581652 97
454 3300005546 Ga0070696_101511106 Ga0070696_1015111062 97
455 3300005547 Ga0070693_100004817 Ga0070693_1000048176 97
456 3300005547 Ga0070693_100065501 Ga0070693_1000655013 97
457 3300005547 Ga0070693_100196826 Ga0070693_1001968262 97
458 3300005547 Ga0070693_100227622 Ga0070693_1002276222 97
459 3300005547 Ga0070693_100306885 Ga0070693_1003068852 97
460 3300005547 Ga0070693_100400481 Ga0070693_1004004812 97
461 3300005547 Ga0070693_100626973 Ga0070693_1006269731 97
462 3300005547 Ga0070693_100840614 Ga0070693_1008406142 97
463 3300005547 Ga0070693_100899669 Ga0070693_1008996692 97
464 3300005548 Ga0070665_100012865 Ga0070665_1000128653 97
465 3300005548 Ga0070665_100013219 Ga0070665_1000132199 97
466 3300005548 Ga0070665_100035715 Ga0070665_1000357153 97
467 3300005548 Ga0070665_100107758 Ga0070665_1001077582 97
468 3300005548 Ga0070665_100116962 Ga0070665_1001169623 97
469 3300005548 Ga0070665_100199146 Ga0070665_1001991462 97
470 3300005548 Ga0070665_100430312 Ga0070665_1004303122 97
471 3300005548 Ga0070665_100709487 Ga0070665_1007094872 97
472 3300005548 Ga0070665_101142108 Ga0070665_1011421082 97
473 3300005549 Ga0070704_100026286 Ga0070704_1000262863 97
474 3300005549 Ga0070704_100090377 Ga0070704_1000903772 97
475 3300005549 Ga0070704_100114743 Ga0070704_1001147433 97
476 3300005549 Ga0070704_100208655 Ga0070704_1002086553 97
477 3300005549 Ga0070704_100313604 Ga0070704_1003136042 97
478 3300005549 Ga0070704_100477121 Ga0070704_1004771212 97
479 3300005549 Ga0070704_100827580 Ga0070704_1008275802 97
480 3300005563 Ga0068855_100002546 Ga0068855_10000254626 97
481 3300005563 Ga0068855_100105240 Ga0068855_1001052403 97
482 3300005563 Ga0068855_100290198 Ga0068855_1002901983 97
483 3300005563 Ga0068855_100357242 Ga0068855_1003572422 97
484 3300005563 Ga0068855_100484186 Ga0068855_1004841862 97
485 3300005563 Ga0068855_100509770 Ga0068855_1005097702 97
486 3300005563 Ga0068855_100887707 Ga0068855_1008877072 97
487 3300005563 Ga0068855_101511400 Ga0068855_1015114002 97
488 3300005563 Ga0068855_102242162 Ga0068855_1022421621 97
489 3300005563 Ga0068855_102324797 Ga0068855_1023247971 97
490 3300005564 Ga0070664_100001257 Ga0070664_10000125724 97
491 3300005564 Ga0070664_100031737 Ga0070664_1000317374 97
492 3300005564 Ga0070664_100064284 Ga0070664_1000642843 97
493 3300005564 Ga0070664_100123104 Ga0070664_1001231042 97
494 3300005564 Ga0070664_100141352 Ga0070664_1001413523 97
495 3300005564 Ga0070664_100215992 Ga0070664_1002159922 97
496 3300005564 Ga0070664_100272223 Ga0070664_1002722231 97
497 3300005564 Ga0070664_100308626 Ga0070664_1003086261 97
498 3300005564 Ga0070664_100369237 Ga0070664_1003692372 97
499 3300005564 Ga0070664_100413530 Ga0070664_1004135302 97
500 3300005564 Ga0070664_100827069 Ga0070664_1008270692 97
501 3300005564 Ga0070664_100937555 Ga0070664_1009375552 97
502 3300005564 Ga0070664_101182474 Ga0070664_1011824742 97
503 3300005564 Ga0070664_101282059 Ga0070664_1012820592 97
504 3300005577 Ga0068857_100005948 Ga0068857_1000059483 97
505 3300005577 Ga0068857_100083566 Ga0068857_1000835663 97
506 3300005577 Ga0068857_100098329 Ga0068857_1000983293 97
507 3300005577 Ga0068857_100159206 Ga0068857_1001592062 97
508 3300005577 Ga0068857_100721645 Ga0068857_1007216452 97
509 3300005577 Ga0068857_100735486 Ga0068857_1007354862 97
510 3300005577 Ga0068857_100955879 Ga0068857_1009558792 97
511 3300005577 Ga0068857_101447389 Ga0068857_1014473892 97
512 3300005578 Ga0068854_100006199 Ga0068854_1000061993 97
513 3300005578 Ga0068854_100038550 Ga0068854_1000385503 97
514 3300005578 Ga0068854_100087867 Ga0068854_1000878672 97
515 3300005578 Ga0068854_100101714 Ga0068854_1001017143 97
516 3300005578 Ga0068854_100102421 Ga0068854_1001024213 97
517 3300005578 Ga0068854_100445694 Ga0068854_1004456942 97
518 3300005578 Ga0068854_100464339 Ga0068854_1004643392 97
519 3300005578 Ga0068854_100512922 Ga0068854_1005129222 97
520 3300005614 Ga0068856_100001602 Ga0068856_10000160228 97
521 3300005614 Ga0068856_100002156 Ga0068856_1000021563 97
522 3300005614 Ga0068856_100047408 Ga0068856_1000474083 97
523 3300005614 Ga0068856_100385278 Ga0068856_1003852782 97
524 3300005614 Ga0068856_100568860 Ga0068856_1005688602 97
525 3300005614 Ga0068856_100669447 Ga0068856_1006694472 97
526 3300005614 Ga0068856_100927148 Ga0068856_1009271482 97
527 3300005614 Ga0068856_101268313 Ga0068856_1012683132 97
528 3300005615 Ga0070702_100040186 Ga0070702_1000401863 97
529 3300005615 Ga0070702_100051126 Ga0070702_1000511262 97
530 3300005615 Ga0070702_100061823 Ga0070702_1000618233 97
531 3300005615 Ga0070702_100086126 Ga0070702_1000861262 97
532 3300005615 Ga0070702_101290026 Ga0070702_1012900262 97
533 3300005616 Ga0068852_100042663 Ga0068852_1000426633 97
534 3300005616 Ga0068852_100046641 Ga0068852_1000466412 97
535 3300005616 Ga0068852_100083858 Ga0068852_1000838582 97
536 3300005616 Ga0068852_100115314 Ga0068852_1001153142 97
537 3300005616 Ga0068852_100144376 Ga0068852_1001443763 97
538 3300005616 Ga0068852_100174862 Ga0068852_1001748623 97
539 3300005616 Ga0068852_100210494 Ga0068852_1002104941 97
540 3300005616 Ga0068852_100407373 Ga0068852_1004073732 97
541 3300005616 Ga0068852_100526494 Ga0068852_1005264942 97
542 3300005616 Ga0068852_100796811 Ga0068852_1007968112 97
543 3300005616 Ga0068852_101947952 Ga0068852_1019479521 97
544 3300005616 Ga0068852_102298120 Ga0068852_1022981202 97
545 3300005616 Ga0068852_102429556 Ga0068852_1024295561 97
546 3300005616 Ga0068852_102826679 Ga0068852_1028266792 97
547 3300005617 Ga0068859_100015827 Ga0068859_1000158275 97
548 3300005617 Ga0068859_100018029 Ga0068859_1000180299 97
549 3300005617 Ga0068859_100019812 Ga0068859_1000198123 97
550 3300005617 Ga0068859_100049072 Ga0068859_1000490723 97
551 3300005617 Ga0068859_100059335 Ga0068859_1000593353 97
552 3300005617 Ga0068859_100069544 Ga0068859_1000695445 97
553 3300005617 Ga0068859_100092241 Ga0068859_1000922412 97
554 3300005617 Ga0068859_100321720 Ga0068859_1003217202 97
555 3300005617 Ga0068859_100467999 Ga0068859_1004679991 97
556 3300005617 Ga0068859_101892456 Ga0068859_1018924562 97
557 3300005617 Ga0068859_102873878 Ga0068859_1028738782 97
558 3300005618 Ga0068864_100001539 Ga0068864_1000015393 97
559 3300005618 Ga0068864_100016527 Ga0068864_1000165275 97
560 3300005618 Ga0068864_100018763 Ga0068864_1000187635 97
561 3300005618 Ga0068864_100028441 Ga0068864_1000284413 97
562 3300005618 Ga0068864_100122680 Ga0068864_1001226802 97
563 3300005618 Ga0068864_100124920 Ga0068864_1001249203 97
564 3300005618 Ga0068864_100232640 Ga0068864_1002326402 97
565 3300005618 Ga0068864_100401042 Ga0068864_1004010422 97
566 3300005618 Ga0068864_100402929 Ga0068864_1004029292 97
567 3300005618 Ga0068864_100408947 Ga0068864_1004089473 97
568 3300005718 Ga0068866_10011830 Ga0068866_100118303 97
569 3300005718 Ga0068866_10036515 Ga0068866_100365153 97
570 3300005718 Ga0068866_10118687 Ga0068866_101186872 97
571 3300005719 Ga0068861_100048747 Ga0068861_1000487473 97
572 3300005719 Ga0068861_100061831 Ga0068861_1000618313 97
573 3300005719 Ga0068861_100065544 Ga0068861_1000655442 97
574 3300005719 Ga0068861_100135341 Ga0068861_1001353413 97
575 3300005719 Ga0068861_100158484 Ga0068861_1001584843 97
576 3300005719 Ga0068861_100203510 Ga0068861_1002035102 97
577 3300005719 Ga0068861_100918846 Ga0068861_1009188462 97
578 3300005719 Ga0068861_102214356 Ga0068861_1022143562 97
579 3300005834 Ga0068851_10001999 Ga0068851_100019994 97
580 3300005834 Ga0068851_10013816 Ga0068851_100138163 97
581 3300005834 Ga0068851_10057043 Ga0068851_100570432 97
582 3300005834 Ga0068851_10082535 Ga0068851_100825352 97
583 3300005834 Ga0068851_10084891 Ga0068851_100848913 97
584 3300005834 Ga0068851_10130056 Ga0068851_101300561 97
585 3300005834 Ga0068851_10625733 Ga0068851_106257331 97
586 3300005840 Ga0068870_10039515 Ga0068870_100395152 97
587 3300005840 Ga0068870_10051306 Ga0068870_100513063 97
588 3300005840 Ga0068870_10066628 Ga0068870_100666282 97
589 3300005840 Ga0068870_10213101 Ga0068870_102131013 97
590 3300005840 Ga0068870_10587058 Ga0068870_105870582 97
591 3300005841 Ga0068863_100001441 Ga0068863_1000014412 97
592 3300005841 Ga0068863_100017237 Ga0068863_1000172373 97
593 3300005841 Ga0068863_100087034 Ga0068863_1000870343 97
594 3300005841 Ga0068863_100156045 Ga0068863_1001560452 97
595 3300005841 Ga0068863_100194943 Ga0068863_1001949432 97
596 3300005841 Ga0068863_100200742 Ga0068863_1002007423 97
597 3300005841 Ga0068863_100374532 Ga0068863_1003745323 97
598 3300005841 Ga0068863_100379177 Ga0068863_1003791773 97
599 3300005841 Ga0068863_100488900 Ga0068863_1004889002 97
600 3300005841 Ga0068863_100791620 Ga0068863_1007916202 97
601 3300005841 Ga0068863_100813053 Ga0068863_1008130532 97
602 3300005841 Ga0068863_101544961 Ga0068863_1015449612 97
603 3300005841 Ga0068863_101785510 Ga0068863_1017855102 97
604 3300005841 Ga0068863_102273297 Ga0068863_1022732972 97
605 3300005841 Ga0068863_102414734 Ga0068863_1024147342 97
606 3300005842 Ga0068858_100000589 Ga0068858_10000058925 97
607 3300005842 Ga0068858_100004799 Ga0068858_1000047999 97
608 3300005842 Ga0068858_100012334 Ga0068858_1000123346 97
609 3300005842 Ga0068858_100014404 Ga0068858_1000144043 97
610 3300005842 Ga0068858_100022592 Ga0068858_1000225922 97
611 3300005842 Ga0068858_100118132 Ga0068858_1001181323 97
612 3300005842 Ga0068858_100129579 Ga0068858_1001295793 97
613 3300005842 Ga0068858_100256931 Ga0068858_1002569313 97
614 3300005842 Ga0068858_102134332 Ga0068858_1021343321 97
615 3300005843 Ga0068860_100010291 Ga0068860_1000102913 97
616 3300005843 Ga0068860_100017765 Ga0068860_1000177653 97
617 3300005843 Ga0068860_100074438 Ga0068860_1000744384 97
618 3300005843 Ga0068860_100095639 Ga0068860_1000956392 97
619 3300005843 Ga0068860_100118830 Ga0068860_1001188303 97
620 3300005843 Ga0068860_100153783 Ga0068860_1001537832 97
621 3300005843 Ga0068860_100267939 Ga0068860_1002679393 97
622 3300005843 Ga0068860_100290606 Ga0068860_1002906063 97
623 3300005843 Ga0068860_100310900 Ga0068860_1003109001 97
624 3300005843 Ga0068860_101464426 Ga0068860_1014644262 97
625 3300005843 Ga0068860_102643343 Ga0068860_1026433432 97
626 3300005844 Ga0068862_100016720 Ga0068862_1000167204 97
627 3300005844 Ga0068862_100059648 Ga0068862_1000596483 97
628 3300005844 Ga0068862_100067790 Ga0068862_1000677903 97
629 3300005844 Ga0068862_100117170 Ga0068862_1001171702 97
630 3300005844 Ga0068862_100189901 Ga0068862_1001899013 97
631 3300005844 Ga0068862_100498901 Ga0068862_1004989012 97
632 3300005844 Ga0068862_100728902 Ga0068862_1007289022 97
633 3300005937 Ga0081455_10310480 Ga0081455_103104802 97
634 3300006028 Ga0070717_11060748 Ga0070717_110607481 97
635 3300006163 Ga0070715_10164408 Ga0070715_101644082 97
636 3300006163 Ga0070715_10657133 Ga0070715_106571331 97
637 3300006173 Ga0070716_100330565 Ga0070716_1003305652 97
638 3300006173 Ga0070716_100385526 Ga0070716_1003855262 97
639 3300006173 Ga0070716_100681644 Ga0070716_1006816442 97
640 3300006173 Ga0070716_100886144 Ga0070716_1008861442 97
641 3300006173 Ga0070716_101040773 Ga0070716_1010407732 97
642 3300006173 Ga0070716_101486219 Ga0070716_1014862191 97
643 3300006175 Ga0070712_100033292 Ga0070712_1000332922 97
644 3300006175 Ga0070712_100225924 Ga0070712_1002259242 97
645 3300006237 Ga0097621_100004089 Ga0097621_1000040898 97
646 3300006237 Ga0097621_100014593 Ga0097621_1000145933 97
647 3300006237 Ga0097621_100041031 Ga0097621_1000410313 97
648 3300006237 Ga0097621_100128865 Ga0097621_1001288652 97
649 3300006237 Ga0097621_100232294 Ga0097621_1002322943 97
650 3300006237 Ga0097621_100297583 Ga0097621_1002975832 97
651 3300006237 Ga0097621_100487297 Ga0097621_1004872971 97
652 3300006237 Ga0097621_100487823 Ga0097621_1004878232 97
653 3300006237 Ga0097621_100825656 Ga0097621_1008256562 97
654 3300006237 Ga0097621_100997665 Ga0097621_1009976652 97
655 3300006237 Ga0097621_101306896 Ga0097621_1013068962 97
656 3300006237 Ga0097621_101391913 Ga0097621_1013919131 97
657 3300006237 Ga0097621_101708842 Ga0097621_1017088422 97
658 3300006358 Ga0068871_100003130 Ga0068871_1000031303 97
659 3300006358 Ga0068871_100007688 Ga0068871_1000076883 97
660 3300006358 Ga0068871_100015714 Ga0068871_1000157145 97
661 3300006358 Ga0068871_100078886 Ga0068871_1000788862 97
662 3300006358 Ga0068871_100141572 Ga0068871_1001415722 97
663 3300006358 Ga0068871_100215163 Ga0068871_1002151632 97
664 3300006358 Ga0068871_100409287 Ga0068871_1004092872 97
665 3300006358 Ga0068871_100533183 Ga0068871_1005331832 97
666 3300006358 Ga0068871_100909574 Ga0068871_1009095742 97
667 3300006358 Ga0068871_101269018 Ga0068871_1012690182 97
668 3300006844 Ga0075428_100007543 Ga0075428_1000075435 97
669 3300006844 Ga0075428_100144257 Ga0075428_1001442572 97
670 3300006846 Ga0075430_100532232 Ga0075430_1005322322 97
671 3300006847 Ga0075431_100011566 Ga0075431_1000115662 97
672 3300006852 Ga0075433_10135402 Ga0075433_101354023 97
673 3300006852 Ga0075433_10252791 Ga0075433_102527912 97
674 3300006852 Ga0075433_10583903 Ga0075433_105839032 97
675 3300006852 Ga0075433_10957242 Ga0075433_109572422 97
676 3300006871 Ga0075434_100078429 Ga0075434_1000784292 97
677 3300006871 Ga0075434_100332115 Ga0075434_1003321151 97
678 3300006871 Ga0075434_100370216 Ga0075434_1003702162 97
679 3300006871 Ga0075434_100462540 Ga0075434_1004625402 97
680 3300006871 Ga0075434_100996301 Ga0075434_1009963011 97
681 3300006871 Ga0075434_101746568 Ga0075434_1017465682 97
682 3300006880 Ga0075429_100000246 Ga0075429_10000024617 97
683 3300006880 Ga0075429_100127995 Ga0075429_1001279952 97
684 3300006880 Ga0075429_101377954 Ga0075429_1013779541 97
685 3300006880 Ga0075429_101458584 Ga0075429_1014585842 97
686 3300006880 Ga0075429_101983230 Ga0075429_1019832301 97
687 3300006881 Ga0068865_100009442 Ga0068865_1000094424 97
688 3300006881 Ga0068865_100037493 Ga0068865_1000374933 97
689 3300006881 Ga0068865_100060849 Ga0068865_1000608493 97
690 3300006881 Ga0068865_100084423 Ga0068865_1000844232 97
691 3300006881 Ga0068865_100254632 Ga0068865_1002546323 97
692 3300006881 Ga0068865_101965812 Ga0068865_1019658121 97
693 3300006914 Ga0075436_100012918 Ga0075436_1000129182 97
694 3300006914 Ga0075436_100014067 Ga0075436_1000140676 97
695 3300006914 Ga0075436_100129577 Ga0075436_1001295773 97
696 3300006914 Ga0075436_100214359 Ga0075436_1002143591 97
697 3300006914 Ga0075436_100235336 Ga0075436_1002353362 97
698 3300006931 Ga0097620_100015827 Ga0097620_1000158273 97
699 3300006931 Ga0097620_100018029 Ga0097620_1000180293 97
700 3300006931 Ga0097620_100019813 Ga0097620_1000198134 97
701 3300006931 Ga0097620_100049072 Ga0097620_1000490723 97
702 3300006931 Ga0097620_100059334 Ga0097620_1000593343 97
703 3300006931 Ga0097620_100069545 Ga0097620_1000695455 97
704 3300006931 Ga0097620_100092242 Ga0097620_1000922422 97
705 3300006931 Ga0097620_100321694 Ga0097620_1003216942 97
706 3300006931 Ga0097620_100468034 Ga0097620_1004680341 97
707 3300006931 Ga0097620_101892484 Ga0097620_1018924842 97
708 3300006931 Ga0097620_102873951 Ga0097620_1028739511 97
709 3300007076 Ga0075435_100042533 Ga0075435_1000425333 97
710 3300007076 Ga0075435_100062154 Ga0075435_1000621542 97
711 3300007076 Ga0075435_100143977 Ga0075435_1001439772 97
712 3300007076 Ga0075435_100204015 Ga0075435_1002040152 97
713 3300007076 Ga0075435_100595083 Ga0075435_1005950832 97
714 3300007265 Ga0099794_10016305 Ga0099794_100163052 97
715 3300009011 Ga0105251_10265511 Ga0105251_102655112 97
716 3300009011 Ga0105251_10443538 Ga0105251_104435381 97
717 3300009093 Ga0105240_10031680 Ga0105240_100316806 97
718 3300009093 Ga0105240_10101076 Ga0105240_101010763 97
719 3300009093 Ga0105240_10198538 Ga0105240_101985382 97
720 3300009093 Ga0105240_10233150 Ga0105240_102331502 97
721 3300009093 Ga0105240_10796005 Ga0105240_107960052 97
722 3300009093 Ga0105240_11688454 Ga0105240_116884542 97
723 3300009094 Ga0111539_10000195 Ga0111539_1000019540 97
724 3300009094 Ga0111539_10023013 Ga0111539_100230133 97
725 3300009094 Ga0111539_10164278 Ga0111539_101642782 97
726 3300009094 Ga0111539_10399830 Ga0111539_103998302 97
727 3300009094 Ga0111539_10452577 Ga0111539_104525773 97
728 3300009098 Ga0105245_10077347 Ga0105245_100773472 97
729 3300009098 Ga0105245_10114911 Ga0105245_101149112 97
730 3300009098 Ga0105245_10214936 Ga0105245_102149362 97
731 3300009098 Ga0105245_10325837 Ga0105245_103258373 97
732 3300009098 Ga0105245_10397794 Ga0105245_103977942 97
733 3300009098 Ga0105245_11222456 Ga0105245_112224562 97
734 3300009098 Ga0105245_11447549 Ga0105245_114475492 97
735 3300009098 Ga0105245_11829198 Ga0105245_118291982 97
736 3300009098 Ga0105245_12056515 Ga0105245_120565151 97
737 3300009101 Ga0105247_10076918 Ga0105247_100769182 97
738 3300009101 Ga0105247_10123240 Ga0105247_101232402 97
739 3300009101 Ga0105247_10536275 Ga0105247_105362752 97
740 3300009147 Ga0114129_10183138 Ga0114129_101831382 97
741 3300009147 Ga0114129_10694310 Ga0114129_106943102 97
742 3300009147 Ga0114129_10703512 Ga0114129_107035122 97
743 3300009147 Ga0114129_11277426 Ga0114129_112774262 97
744 3300009148 Ga0105243_10082290 Ga0105243_100822902 97
745 3300009148 Ga0105243_10308179 Ga0105243_103081791 97
746 3300009148 Ga0105243_10899719 Ga0105243_108997192 97
747 3300009148 Ga0105243_12275536 Ga0105243_122755362 97
748 3300009148 Ga0105243_12516822 Ga0105243_125168222 97
749 3300009174 Ga0105241_10043591 Ga0105241_100435913 97
750 3300009174 Ga0105241_10115898 Ga0105241_101158982 97
751 3300009174 Ga0105241_10336854 Ga0105241_103368542 97
752 3300009174 Ga0105241_10635409 Ga0105241_106354092 97
753 3300009174 Ga0105241_10863777 Ga0105241_108637772 97
754 3300009174 Ga0105241_11347129 Ga0105241_113471292 97
755 3300009176 Ga0105242_10002633 Ga0105242_100026337 97
756 3300009176 Ga0105242_10010752 Ga0105242_100107523 97
757 3300009176 Ga0105242_10017032 Ga0105242_100170323 97
758 3300009176 Ga0105242_10260704 Ga0105242_102607042 97
759 3300009176 Ga0105242_10261351 Ga0105242_102613513 97
760 3300009176 Ga0105242_10867696 Ga0105242_108676962 97
761 3300009176 Ga0105242_11629262 Ga0105242_116292621 97
762 3300009177 Ga0105248_10003518 Ga0105248_1000351816 97
763 3300009177 Ga0105248_10010942 Ga0105248_100109423 97
764 3300009177 Ga0105248_10017598 Ga0105248_100175987 97
765 3300009177 Ga0105248_10019421 Ga0105248_100194217 97
766 3300009177 Ga0105248_10051863 Ga0105248_100518631 97
767 3300009177 Ga0105248_10293213 Ga0105248_102932132 97
768 3300009177 Ga0105248_10304481 Ga0105248_103044813 97
769 3300009177 Ga0105248_10343616 Ga0105248_103436162 97
770 3300009177 Ga0105248_11684961 Ga0105248_116849612 97
771 3300009177 Ga0105248_12471720 Ga0105248_124717202 97
772 3300009545 Ga0105237_10203754 Ga0105237_102037543 97
773 3300009545 Ga0105237_10487301 Ga0105237_104873013 97
774 3300009545 Ga0105237_11633417 Ga0105237_116334171 97
775 3300009551 Ga0105238_10024374 Ga0105238_100243742 97
776 3300009551 Ga0105238_10156061 Ga0105238_101560613 97
777 3300009551 Ga0105238_10667544 Ga0105238_106675442 97
778 3300009553 Ga0105249_10014175 Ga0105249_100141755 97
779 3300009553 Ga0105249_10092230 Ga0105249_100922302 97
780 3300009553 Ga0105249_10255081 Ga0105249_102550813 97
781 3300009553 Ga0105249_10332451 Ga0105249_103324511 97
782 3300009553 Ga0105249_10418227 Ga0105249_104182272 97
783 3300009553 Ga0105249_10509027 Ga0105249_105090272 97
784 3300010375 Ga0105239_10117283 Ga0105239_101172833 97
785 3300010375 Ga0105239_10422625 Ga0105239_104226252 97
786 3300010375 Ga0105239_10521632 Ga0105239_105216323 97
787 3300010375 Ga0105239_10859399 Ga0105239_108593992 97
788 3300010375 Ga0105239_10866022 Ga0105239_108660222 97
789 3300010375 Ga0105239_10935396 Ga0105239_109353962 97
790 3300010375 Ga0105239_11115700 Ga0105239_111157002 97
791 3300010375 Ga0105239_11462060 Ga0105239_114620601 97
792 3300010375 Ga0105239_11482063 Ga0105239_114820632 97
793 3300011119 Ga0105246_10112024 Ga0105246_101120243 97
794 3300011119 Ga0105246_10205189 Ga0105246_102051892 97
795 3300011119 Ga0105246_11199352 Ga0105246_111993522 97
796 3300011119 Ga0105246_11337520 Ga0105246_113375202 97
797 3300012480 Ga0157346_1024513 Ga0157346_10245131 97
798 3300012502 Ga0157347_1071702 Ga0157347_10717021 97
799 3300012508 Ga0157315_1055998 Ga0157315_10559981 97
800 3300012512 Ga0157327_1002323 Ga0157327_10023232 97
801 3300012512 Ga0157327_1028783 Ga0157327_10287831 97
802 3300013100 Ga0157373_10000924 Ga0157373_1000092426 97
803 3300013100 Ga0157373_10004866 Ga0157373_100048664 97
804 3300013100 Ga0157373_10010017 Ga0157373_100100176 97
805 3300013100 Ga0157373_10087676 Ga0157373_100876763 97
806 3300013100 Ga0157373_10097260 Ga0157373_100972603 97
807 3300013100 Ga0157373_10315923 Ga0157373_103159232 97
808 3300013100 Ga0157373_10366929 Ga0157373_103669292 97
809 3300013100 Ga0157373_11112349 Ga0157373_111123491 97
810 3300013102 Ga0157371_10000522 Ga0157371_1000052243 97
811 3300013102 Ga0157371_10095066 Ga0157371_100950662 97
812 3300013102 Ga0157371_10106920 Ga0157371_101069202 97
813 3300013102 Ga0157371_10207796 Ga0157371_102077962 97
814 3300013102 Ga0157371_10275225 Ga0157371_102752252 97
815 3300013104 Ga0157370_10008483 Ga0157370_1000848310 97
816 3300013104 Ga0157370_10017692 Ga0157370_100176923 97
817 3300013104 Ga0157370_10025706 Ga0157370_100257066 97
818 3300013104 Ga0157370_10040137 Ga0157370_100401373 97
819 3300013104 Ga0157370_10058192 Ga0157370_100581923 97
820 3300013104 Ga0157370_10086348 Ga0157370_100863483 97
821 3300013104 Ga0157370_10192649 Ga0157370_101926492 97
822 3300013104 Ga0157370_10216045 Ga0157370_102160452 97
823 3300013104 Ga0157370_10234210 Ga0157370_102342102 97
824 3300013104 Ga0157370_10828646 Ga0157370_108286462 97
825 3300013104 Ga0157370_10843052 Ga0157370_108430522 97
826 3300013104 Ga0157370_10859511 Ga0157370_108595112 97
827 3300013104 Ga0157370_11188711 Ga0157370_111887112 97
828 3300013104 Ga0157370_11954372 Ga0157370_119543721 97
829 3300013105 Ga0157369_10008534 Ga0157369_100085344 97
830 3300013105 Ga0157369_10028175 Ga0157369_100281755 97
831 3300013105 Ga0157369_10210740 Ga0157369_102107403 97
832 3300013105 Ga0157369_10537086 Ga0157369_105370862 97
833 3300013105 Ga0157369_10591334 Ga0157369_105913342 97
834 3300013105 Ga0157369_10969805 Ga0157369_109698052 97
835 3300013105 Ga0157369_12606799 Ga0157369_126067991 97
836 3300013296 Ga0157374_10014172 Ga0157374_100141724 97
837 3300013296 Ga0157374_10015548 Ga0157374_100155485 97
838 3300013296 Ga0157374_10159910 Ga0157374_101599103 97
839 3300013296 Ga0157374_10216117 Ga0157374_102161172 97
840 3300013296 Ga0157374_10449387 Ga0157374_104493872 97
841 3300013296 Ga0157374_10750388 Ga0157374_107503882 97
842 3300013297 Ga0157378_10022416 Ga0157378_100224162 97
843 3300013297 Ga0157378_10030813 Ga0157378_100308133 97
844 3300013297 Ga0157378_10063819 Ga0157378_100638193 97
845 3300013297 Ga0157378_10093932 Ga0157378_100939323 97
846 3300013297 Ga0157378_10137664 Ga0157378_101376643 97
847 3300013297 Ga0157378_10193198 Ga0157378_101931982 97
848 3300013297 Ga0157378_10258969 Ga0157378_102589693 97
849 3300013297 Ga0157378_10562485 Ga0157378_105624852 97
850 3300013297 Ga0157378_10848758 Ga0157378_108487581 97
851 3300013297 Ga0157378_11579720 Ga0157378_115797202 97
852 3300013297 Ga0157378_11682060 Ga0157378_116820602 97
853 3300013297 Ga0157378_12837149 Ga0157378_128371492 97
854 3300013306 Ga0163162_10003693 Ga0163162_1000369312 97
855 3300013306 Ga0163162_10015795 Ga0163162_100157957 97
856 3300013306 Ga0163162_10016299 Ga0163162_100162997 97
857 3300013306 Ga0163162_10047059 Ga0163162_100470592 97
858 3300013306 Ga0163162_10247203 Ga0163162_102472032 97
859 3300013306 Ga0163162_10301193 Ga0163162_103011931 97
860 3300013306 Ga0163162_10317641 Ga0163162_103176411 97
861 3300013306 Ga0163162_10333030 Ga0163162_103330302 97
862 3300013306 Ga0163162_10366269 Ga0163162_103662692 97
863 3300013306 Ga0163162_10400164 Ga0163162_104001642 97
864 3300013306 Ga0163162_10438274 Ga0163162_104382743 97
865 3300013306 Ga0163162_10581640 Ga0163162_105816402 97
866 3300013307 Ga0157372_10000791 Ga0157372_1000079130 97
867 3300013307 Ga0157372_10037987 Ga0157372_100379875 97
868 3300013307 Ga0157372_10067738 Ga0157372_100677383 97
869 3300013307 Ga0157372_10091093 Ga0157372_100910933 97
870 3300013307 Ga0157372_10155687 Ga0157372_101556872 97
871 3300013307 Ga0157372_10208264 Ga0157372_102082642 97
872 3300013307 Ga0157372_10228524 Ga0157372_102285243 97
873 3300013307 Ga0157372_10327178 Ga0157372_103271782 97
874 3300013307 Ga0157372_10361317 Ga0157372_103613172 97
875 3300013307 Ga0157372_10484782 Ga0157372_104847822 97
876 3300013307 Ga0157372_10546423 Ga0157372_105464232 97
877 3300013307 Ga0157372_10667312 Ga0157372_106673122 97
878 3300013307 Ga0157372_10903519 Ga0157372_109035192 97
879 3300013307 Ga0157372_11291431 Ga0157372_112914312 97
880 3300013307 Ga0157372_11512751 Ga0157372_115127512 97
881 3300013307 Ga0157372_12393826 Ga0157372_123938262 97
882 3300013308 Ga0157375_10008788 Ga0157375_100087884 97
883 3300013308 Ga0157375_10027347 Ga0157375_100273473 97
884 3300013308 Ga0157375_10053515 Ga0157375_100535154 97
885 3300013308 Ga0157375_10056342 Ga0157375_100563424 97
886 3300013308 Ga0157375_10615346 Ga0157375_106153462 97
887 3300013308 Ga0157375_10816115 Ga0157375_108161151 97
888 3300013308 Ga0157375_10980118 Ga0157375_109801182 97
889 3300014325 Ga0163163_10000711 Ga0163163_1000071127 97
890 3300014325 Ga0163163_10008173 Ga0163163_100081734 97
891 3300014325 Ga0163163_10017329 Ga0163163_100173295 97
892 3300014325 Ga0163163_10069005 Ga0163163_100690053 97
893 3300014325 Ga0163163_10276484 Ga0163163_102764843 97
894 3300014325 Ga0163163_10285024 Ga0163163_102850243 97
895 3300014325 Ga0163163_10426273 Ga0163163_104262732 97
896 3300014326 Ga0157380_10011555 Ga0157380_100115554 97
897 3300014326 Ga0157380_10023350 Ga0157380_100233503 97
898 3300014326 Ga0157380_10078634 Ga0157380_100786342 97
899 3300014326 Ga0157380_10136617 Ga0157380_101366172 97
900 3300014326 Ga0157380_10157696 Ga0157380_101576963 97
901 3300014326 Ga0157380_10379053 Ga0157380_103790533 97
902 3300014326 Ga0157380_10578790 Ga0157380_105787902 97
903 3300014326 Ga0157380_10642519 Ga0157380_106425192 97
904 3300014326 Ga0157380_12344091 Ga0157380_123440912 97
905 3300014326 Ga0157380_13461682 Ga0157380_134616822 97
906 3300014497 Ga0182008_10186658 Ga0182008_101866581 97
907 3300014497 Ga0182008_10380842 Ga0182008_103808422 97
908 3300014497 Ga0182008_10709129 Ga0182008_107091291 97
909 3300014745 Ga0157377_10082207 Ga0157377_100822072 97
910 3300014745 Ga0157377_10110404 Ga0157377_101104043 97
911 3300014745 Ga0157377_10148780 Ga0157377_101487801 97
912 3300014745 Ga0157377_10161313 Ga0157377_101613133 97
913 3300014968 Ga0157379_10000435 Ga0157379_1000043527 97
914 3300014968 Ga0157379_10002996 Ga0157379_100029963 97
915 3300014968 Ga0157379_10008172 Ga0157379_100081727 97
916 3300014968 Ga0157379_10161586 Ga0157379_101615862 97
917 3300014968 Ga0157379_10162703 Ga0157379_101627033 97
918 3300014968 Ga0157379_10875159 Ga0157379_108751592 97
919 3300014969 Ga0157376_10004673 Ga0157376_100046737 97
920 3300014969 Ga0157376_10028758 Ga0157376_100287583 97
921 3300014969 Ga0157376_10048570 Ga0157376_100485703 97
922 3300014969 Ga0157376_10069665 Ga0157376_100696653 97
923 3300014969 Ga0157376_10091393 Ga0157376_100913932 97
924 3300014969 Ga0157376_10165510 Ga0157376_101655103 97
925 3300014969 Ga0157376_10736273 Ga0157376_107362732 97
926 3300014969 Ga0157376_11849580 Ga0157376_118495802 97
927 3300014969 Ga0157376_11936351 Ga0157376_119363512 97
928 3300014969 Ga0157376_13093663 Ga0157376_130936632 97
929 3300017792 Ga0163161_10013817 Ga0163161_100138173 97
930 3300017792 Ga0163161_10015854 Ga0163161_100158542 97
931 3300017792 Ga0163161_10020209 Ga0163161_100202095 97
932 3300017792 Ga0163161_10091646 Ga0163161_100916462 97
933 3300017792 Ga0163161_10151770 Ga0163161_101517702 97
934 3300017792 Ga0163161_10203556 Ga0163161_102035562 97
935 3300017792 Ga0163161_10267989 Ga0163161_102679892 97
936 3300017792 Ga0163161_10398256 Ga0163161_103982562 97
937 3300017792 Ga0163161_11134578 Ga0163161_111345782 97
938 3300020070 Ga0206356_11349820 Ga0206356_113498203 97
939 3300025271 Ga0207666_1021172 Ga0207666_10211722 97
940 3300025315 Ga0207697_10015583 Ga0207697_100155834 97
941 3300025315 Ga0207697_10030581 Ga0207697_100305813 97
942 3300025315 Ga0207697_10033447 Ga0207697_100334472 97
943 3300025321 Ga0207656_10014591 Ga0207656_100145913 97
944 3300025321 Ga0207656_10039964 Ga0207656_100399643 97
945 3300025321 Ga0207656_10079589 Ga0207656_100795892 97
946 3300025321 Ga0207656_10081675 Ga0207656_100816753 97
947 3300025321 Ga0207656_10205203 Ga0207656_102052032 97
948 3300025321 Ga0207656_10235326 Ga0207656_102353262 97
949 3300025885 Ga0207653_10329735 Ga0207653_103297352 97
950 3300025893 Ga0207682_10001165 Ga0207682_100011653 97
951 3300025893 Ga0207682_10027895 Ga0207682_100278952 97
952 3300025893 Ga0207682_10061317 Ga0207682_100613172 97
953 3300025893 Ga0207682_10066311 Ga0207682_100663112 97
954 3300025893 Ga0207682_10116073 Ga0207682_101160733 97
955 3300025898 Ga0207692_10019096 Ga0207692_100190963 97
956 3300025898 Ga0207692_10044673 Ga0207692_100446732 97
957 3300025898 Ga0207692_10297617 Ga0207692_102976172 97
958 3300025899 Ga0207642_10003936 Ga0207642_100039363 97
959 3300025899 Ga0207642_10128602 Ga0207642_101286022 97
960 3300025899 Ga0207642_10131335 Ga0207642_101313353 97
961 3300025899 Ga0207642_10280273 Ga0207642_102802732 97
962 3300025899 Ga0207642_10712692 Ga0207642_107126922 97
963 3300025900 Ga0207710_10071241 Ga0207710_100712411 97
964 3300025901 Ga0207688_10001601 Ga0207688_1000160112 97
965 3300025901 Ga0207688_10094936 Ga0207688_100949363 97
966 3300025903 Ga0207680_10013980 Ga0207680_100139803 97
967 3300025903 Ga0207680_10044551 Ga0207680_100445513 97
968 3300025903 Ga0207680_10099301 Ga0207680_100993012 97
969 3300025903 Ga0207680_10111354 Ga0207680_101113543 97
970 3300025903 Ga0207680_10198455 Ga0207680_101984552 97
971 3300025903 Ga0207680_10663097 Ga0207680_106630972 97
972 3300025905 Ga0207685_10653651 Ga0207685_106536512 97
973 3300025906 Ga0207699_10034540 Ga0207699_100345402 97
974 3300025906 Ga0207699_10045494 Ga0207699_100454942 97
975 3300025906 Ga0207699_10077587 Ga0207699_100775874 97
976 3300025906 Ga0207699_10146247 Ga0207699_101462472 97
977 3300025906 Ga0207699_10164070 Ga0207699_101640702 97
978 3300025906 Ga0207699_10613643 Ga0207699_106136432 97
979 3300025906 Ga0207699_11330134 Ga0207699_113301342 97
980 3300025906 Ga0207699_11463378 Ga0207699_114633782 97
981 3300025907 Ga0207645_10000550 Ga0207645_100005505 97
982 3300025907 Ga0207645_10003083 Ga0207645_100030833 97
983 3300025907 Ga0207645_10022463 Ga0207645_100224632 97
984 3300025907 Ga0207645_10051618 Ga0207645_100516183 97
985 3300025907 Ga0207645_10059836 Ga0207645_100598362 97
986 3300025907 Ga0207645_10071387 Ga0207645_100713873 97
987 3300025907 Ga0207645_10264025 Ga0207645_102640252 97
988 3300025907 Ga0207645_10291645 Ga0207645_102916452 97
989 3300025907 Ga0207645_10453547 Ga0207645_104535472 97
990 3300025907 Ga0207645_10540630 Ga0207645_105406302 97
991 3300025907 Ga0207645_10562816 Ga0207645_105628162 97
992 3300025908 Ga0207643_10002356 Ga0207643_100023563 97
993 3300025908 Ga0207643_10031260 Ga0207643_100312603 97
994 3300025908 Ga0207643_10066768 Ga0207643_100667682 97
995 3300025908 Ga0207643_10142696 Ga0207643_101426962 97
996 3300025908 Ga0207643_10394801 Ga0207643_103948012 97
997 3300025909 Ga0207705_10021201 Ga0207705_100212013 97
998 3300025909 Ga0207705_10087765 Ga0207705_100877653 97
999 3300025909 Ga0207705_10200976 Ga0207705_102009762 97
1000 3300025909 Ga0207705_11017988 Ga0207705_110179882 97
1001 3300025909 Ga0207705_11310724 Ga0207705_113107241 97
1002 3300025910 Ga0207684_10082815 Ga0207684_100828152 97
1003 3300025910 Ga0207684_11713409 Ga0207684_117134091 97
1004 3300025911 Ga0207654_10077938 Ga0207654_100779383 97
1005 3300025911 Ga0207654_10099007 Ga0207654_100990073 97
1006 3300025911 Ga0207654_10123897 Ga0207654_101238972 97
1007 3300025911 Ga0207654_10230407 Ga0207654_102304072 97
1008 3300025911 Ga0207654_10280868 Ga0207654_102808682 97
1009 3300025912 Ga0207707_10029586 Ga0207707_100295863 97
1010 3300025912 Ga0207707_10079158 Ga0207707_100791583 97
1011 3300025912 Ga0207707_10118532 Ga0207707_101185323 97
1012 3300025912 Ga0207707_10125335 Ga0207707_101253352 97
1013 3300025912 Ga0207707_10589942 Ga0207707_105899422 97
1014 3300025912 Ga0207707_10775887 Ga0207707_107758872 97
1015 3300025912 Ga0207707_11145707 Ga0207707_111457072 97
1016 3300025913 Ga0207695_10086838 Ga0207695_100868383 97
1017 3300025913 Ga0207695_10185469 Ga0207695_101854693 97
1018 3300025913 Ga0207695_10224060 Ga0207695_102240603 97
1019 3300025913 Ga0207695_10345943 Ga0207695_103459432 97
1020 3300025914 Ga0207671_10163888 Ga0207671_101638883 97
1021 3300025914 Ga0207671_10244551 Ga0207671_102445512 97
1022 3300025915 Ga0207693_10001152 Ga0207693_100011522 97
1023 3300025915 Ga0207693_10049831 Ga0207693_100498312 97
1024 3300025915 Ga0207693_10086503 Ga0207693_100865033 97
1025 3300025915 Ga0207693_11390326 Ga0207693_113903262 97
1026 3300025916 Ga0207663_10065042 Ga0207663_100650422 97
1027 3300025916 Ga0207663_10176964 Ga0207663_101769642 97
1028 3300025916 Ga0207663_10280260 Ga0207663_102802602 97
1029 3300025916 Ga0207663_10515164 Ga0207663_105151642 97
1030 3300025916 Ga0207663_10677917 Ga0207663_106779172 97
1031 3300025916 Ga0207663_10899092 Ga0207663_108990922 97
1032 3300025917 Ga0207660_10044479 Ga0207660_100444792 97
1033 3300025917 Ga0207660_10198073 Ga0207660_101980733 97
1034 3300025917 Ga0207660_10587558 Ga0207660_105875582 97
1035 3300025917 Ga0207660_11120108 Ga0207660_111201082 97
1036 3300025918 Ga0207662_10049264 Ga0207662_100492643 97
1037 3300025918 Ga0207662_10081312 Ga0207662_100813122 97
1038 3300025918 Ga0207662_10600643 Ga0207662_106006432 97
1039 3300025919 Ga0207657_10000657 Ga0207657_100006577 97
1040 3300025919 Ga0207657_10001408 Ga0207657_100014083 97
1041 3300025919 Ga0207657_10013958 Ga0207657_100139587 97
1042 3300025919 Ga0207657_10020599 Ga0207657_100205995 97
1043 3300025919 Ga0207657_10121179 Ga0207657_101211792 97
1044 3300025919 Ga0207657_10149170 Ga0207657_101491703 97
1045 3300025919 Ga0207657_10221545 Ga0207657_102215451 97
1046 3300025919 Ga0207657_10489500 Ga0207657_104895002 97
1047 3300025920 Ga0207649_10024210 Ga0207649_100242102 97
1048 3300025920 Ga0207649_10067313 Ga0207649_100673132 97
1049 3300025920 Ga0207649_10148477 Ga0207649_101484772 97
1050 3300025920 Ga0207649_10188319 Ga0207649_101883193 97
1051 3300025920 Ga0207649_10264882 Ga0207649_102648822 97
1052 3300025920 Ga0207649_10785988 Ga0207649_107859881 97
1053 3300025920 Ga0207649_11291461 Ga0207649_112914612 97
1054 3300025920 Ga0207649_11495038 Ga0207649_114950381 97
1055 3300025921 Ga0207652_10074087 Ga0207652_100740872 97
1056 3300025921 Ga0207652_10079820 Ga0207652_100798203 97
1057 3300025921 Ga0207652_10104887 Ga0207652_101048872 97
1058 3300025921 Ga0207652_10124051 Ga0207652_101240513 97
1059 3300025921 Ga0207652_10449195 Ga0207652_104491952 97
1060 3300025921 Ga0207652_10963275 Ga0207652_109632752 97
1061 3300025921 Ga0207652_11070353 Ga0207652_110703532 97
1062 3300025921 Ga0207652_11183430 Ga0207652_111834302 97
1063 3300025921 Ga0207652_11252248 Ga0207652_112522482 97
1064 3300025922 Ga0207646_10177965 Ga0207646_101779653 97
1065 3300025922 Ga0207646_10181019 Ga0207646_101810192 97
1066 3300025922 Ga0207646_11025643 Ga0207646_110256432 97
1067 3300025923 Ga0207681_10024520 Ga0207681_100245204 97
1068 3300025923 Ga0207681_10030985 Ga0207681_100309852 97
1069 3300025923 Ga0207681_10067070 Ga0207681_100670702 97
1070 3300025923 Ga0207681_10143526 Ga0207681_101435262 97
1071 3300025923 Ga0207681_10237148 Ga0207681_102371482 97
1072 3300025923 Ga0207681_10322411 Ga0207681_103224112 97
1073 3300025923 Ga0207681_10734106 Ga0207681_107341062 97
1074 3300025923 Ga0207681_10765370 Ga0207681_107653702 97
1075 3300025923 Ga0207681_11230856 Ga0207681_112308561 97
1076 3300025923 Ga0207681_11393076 Ga0207681_113930762 97
1077 3300025923 Ga0207681_11587658 Ga0207681_115876581 97
1078 3300025924 Ga0207694_10076977 Ga0207694_100769772 97
1079 3300025924 Ga0207694_10101240 Ga0207694_101012403 97
1080 3300025924 Ga0207694_10225403 Ga0207694_102254033 97
1081 3300025924 Ga0207694_10359799 Ga0207694_103597992 97
1082 3300025925 Ga0207650_10003644 Ga0207650_1000364410 97
1083 3300025925 Ga0207650_10021698 Ga0207650_100216984 97
1084 3300025925 Ga0207650_10035735 Ga0207650_100357354 97
1085 3300025925 Ga0207650_10070261 Ga0207650_100702613 97
1086 3300025925 Ga0207650_10081108 Ga0207650_100811083 97
1087 3300025925 Ga0207650_10148566 Ga0207650_101485662 97
1088 3300025925 Ga0207650_10149695 Ga0207650_101496952 97
1089 3300025925 Ga0207650_10378725 Ga0207650_103787252 97
1090 3300025925 Ga0207650_10495267 Ga0207650_104952672 97
1091 3300025925 Ga0207650_10545027 Ga0207650_105450272 97
1092 3300025925 Ga0207650_10932194 Ga0207650_109321942 97
1093 3300025925 Ga0207650_11683014 Ga0207650_116830142 97
1094 3300025926 Ga0207659_10001433 Ga0207659_100014339 97
1095 3300025926 Ga0207659_10048208 Ga0207659_100482083 97
1096 3300025926 Ga0207659_10151305 Ga0207659_101513053 97
1097 3300025926 Ga0207659_10297135 Ga0207659_102971352 97
1098 3300025926 Ga0207659_10417070 Ga0207659_104170703 97
1099 3300025926 Ga0207659_10494310 Ga0207659_104943102 97
1100 3300025926 Ga0207659_10806855 Ga0207659_108068551 97
1101 3300025927 Ga0207687_10000226 Ga0207687_1000022643 97
1102 3300025927 Ga0207687_10002660 Ga0207687_1000266011 97
1103 3300025927 Ga0207687_10046446 Ga0207687_100464463 97
1104 3300025927 Ga0207687_10055490 Ga0207687_100554902 97
1105 3300025927 Ga0207687_10265873 Ga0207687_102658731 97
1106 3300025927 Ga0207687_10387906 Ga0207687_103879062 97
1107 3300025927 Ga0207687_11436806 Ga0207687_114368062 97
1108 3300025928 Ga0207700_10022679 Ga0207700_100226793 97
1109 3300025928 Ga0207700_10747477 Ga0207700_107474772 97
1110 3300025928 Ga0207700_10752879 Ga0207700_107528792 97
1111 3300025929 Ga0207664_10006209 Ga0207664_100062095 97
1112 3300025929 Ga0207664_10066211 Ga0207664_100662112 97
1113 3300025929 Ga0207664_10112380 Ga0207664_101123802 97
1114 3300025929 Ga0207664_10175051 Ga0207664_101750511 97
1115 3300025929 Ga0207664_11636971 Ga0207664_116369712 97
1116 3300025931 Ga0207644_10004807 Ga0207644_1000480711 97
1117 3300025931 Ga0207644_10011411 Ga0207644_100114115 97
1118 3300025931 Ga0207644_10012692 Ga0207644_100126924 97
1119 3300025931 Ga0207644_10093155 Ga0207644_100931553 97
1120 3300025931 Ga0207644_10095367 Ga0207644_100953672 97
1121 3300025931 Ga0207644_10095429 Ga0207644_100954292 97
1122 3300025931 Ga0207644_10230564 Ga0207644_102305641 97
1123 3300025931 Ga0207644_10259298 Ga0207644_102592982 97
1124 3300025931 Ga0207644_10296630 Ga0207644_102966302 97
1125 3300025931 Ga0207644_10438544 Ga0207644_104385442 97
1126 3300025931 Ga0207644_10525194 Ga0207644_105251942 97
1127 3300025931 Ga0207644_10804128 Ga0207644_108041281 97
1128 3300025931 Ga0207644_11188534 Ga0207644_111885341 97
1129 3300025931 Ga0207644_11233433 Ga0207644_112334332 97
1130 3300025932 Ga0207690_10000412 Ga0207690_100004123 97
1131 3300025932 Ga0207690_10093723 Ga0207690_100937232 97
1132 3300025932 Ga0207690_10133713 Ga0207690_101337133 97
1133 3300025932 Ga0207690_10463230 Ga0207690_104632302 97
1134 3300025932 Ga0207690_10488481 Ga0207690_104884812 97
1135 3300025933 Ga0207706_10000164 Ga0207706_100001647 97
1136 3300025933 Ga0207706_10022175 Ga0207706_100221753 97
1137 3300025933 Ga0207706_10069635 Ga0207706_100696352 97
1138 3300025933 Ga0207706_10071211 Ga0207706_100712113 97
1139 3300025933 Ga0207706_10110613 Ga0207706_101106132 97
1140 3300025933 Ga0207706_10182126 Ga0207706_101821262 97
1141 3300025933 Ga0207706_10287749 Ga0207706_102877492 97
1142 3300025933 Ga0207706_10452135 Ga0207706_104521351 97
1143 3300025933 Ga0207706_10454499 Ga0207706_104544993 97
1144 3300025933 Ga0207706_10784095 Ga0207706_107840952 97
1145 3300025933 Ga0207706_11380017 Ga0207706_113800172 97
1146 3300025933 Ga0207706_11427130 Ga0207706_114271301 97
1147 3300025934 Ga0207686_10000772 Ga0207686_100007723 97
1148 3300025934 Ga0207686_10005182 Ga0207686_100051824 97
1149 3300025934 Ga0207686_10010576 Ga0207686_100105763 97
1150 3300025934 Ga0207686_10369177 Ga0207686_103691773 97
1151 3300025934 Ga0207686_10985407 Ga0207686_109854072 97
1152 3300025935 Ga0207709_10098944 Ga0207709_100989443 97
1153 3300025935 Ga0207709_10148098 Ga0207709_101480982 97
1154 3300025935 Ga0207709_10464819 Ga0207709_104648192 97
1155 3300025935 Ga0207709_10476715 Ga0207709_104767151 97
1156 3300025935 Ga0207709_10553114 Ga0207709_105531142 97
1157 3300025935 Ga0207709_10911428 Ga0207709_109114282 97
1158 3300025936 Ga0207670_10018114 Ga0207670_100181143 97
1159 3300025936 Ga0207670_10073017 Ga0207670_100730173 97
1160 3300025936 Ga0207670_10234333 Ga0207670_102343332 97
1161 3300025936 Ga0207670_10238436 Ga0207670_102384361 97
1162 3300025936 Ga0207670_10317066 Ga0207670_103170662 97
1163 3300025936 Ga0207670_11174349 Ga0207670_111743491 97
1164 3300025937 Ga0207669_10018341 Ga0207669_100183413 97
1165 3300025937 Ga0207669_10029546 Ga0207669_100295462 97
1166 3300025937 Ga0207669_10038203 Ga0207669_100382033 97
1167 3300025937 Ga0207669_10061440 Ga0207669_100614402 97
1168 3300025937 Ga0207669_10075368 Ga0207669_100753683 97
1169 3300025937 Ga0207669_10203060 Ga0207669_102030602 97
1170 3300025937 Ga0207669_10227215 Ga0207669_102272152 97
1171 3300025937 Ga0207669_10402917 Ga0207669_104029172 97
1172 3300025937 Ga0207669_10555561 Ga0207669_105555612 97
1173 3300025938 Ga0207704_10011623 Ga0207704_100116233 97
1174 3300025938 Ga0207704_10021214 Ga0207704_100212143 97
1175 3300025938 Ga0207704_10024812 Ga0207704_100248123 97
1176 3300025938 Ga0207704_10073355 Ga0207704_100733553 97
1177 3300025938 Ga0207704_10087160 Ga0207704_100871601 97
1178 3300025938 Ga0207704_10148307 Ga0207704_101483072 97
1179 3300025938 Ga0207704_10427864 Ga0207704_104278643 97
1180 3300025938 Ga0207704_11234078 Ga0207704_112340782 97
1181 3300025939 Ga0207665_10113032 Ga0207665_101130322 97
1182 3300025939 Ga0207665_10303197 Ga0207665_103031972 97
1183 3300025939 Ga0207665_10377800 Ga0207665_103778002 97
1184 3300025940 Ga0207691_10000216 Ga0207691_1000021652 97
1185 3300025940 Ga0207691_10003506 Ga0207691_1000350616 97
1186 3300025940 Ga0207691_10005875 Ga0207691_100058753 97
1187 3300025940 Ga0207691_10046551 Ga0207691_100465513 97
1188 3300025940 Ga0207691_10062989 Ga0207691_100629893 97
1189 3300025940 Ga0207691_10096519 Ga0207691_100965192 97
1190 3300025940 Ga0207691_10110624 Ga0207691_101106244 97
1191 3300025940 Ga0207691_10120512 Ga0207691_101205122 97
1192 3300025940 Ga0207691_10262579 Ga0207691_102625793 97
1193 3300025940 Ga0207691_10388926 Ga0207691_103889262 97
1194 3300025941 Ga0207711_10010807 Ga0207711_100108075 97
1195 3300025941 Ga0207711_10035949 Ga0207711_100359493 97
1196 3300025941 Ga0207711_10101744 Ga0207711_101017443 97
1197 3300025941 Ga0207711_10102578 Ga0207711_101025782 97
1198 3300025941 Ga0207711_10104574 Ga0207711_101045743 97
1199 3300025941 Ga0207711_10476463 Ga0207711_104764633 97
1200 3300025941 Ga0207711_10871441 Ga0207711_108714411 97
1201 3300025941 Ga0207711_11043928 Ga0207711_110439282 97
1202 3300025941 Ga0207711_11665840 Ga0207711_116658402 97
1203 3300025941 Ga0207711_11748209 Ga0207711_117482092 97
1204 3300025942 Ga0207689_10000536 Ga0207689_1000053629 97
1205 3300025942 Ga0207689_10001319 Ga0207689_100013193 97
1206 3300025942 Ga0207689_10032951 Ga0207689_100329513 97
1207 3300025942 Ga0207689_10037059 Ga0207689_100370593 97
1208 3300025942 Ga0207689_10098649 Ga0207689_100986493 97
1209 3300025942 Ga0207689_10234587 Ga0207689_102345872 97
1210 3300025942 Ga0207689_10235565 Ga0207689_102355652 97
1211 3300025942 Ga0207689_10419166 Ga0207689_104191661 97
1212 3300025944 Ga0207661_10041056 Ga0207661_100410562 97
1213 3300025944 Ga0207661_10051650 Ga0207661_100516503 97
1214 3300025944 Ga0207661_10053018 Ga0207661_100530183 97
1215 3300025944 Ga0207661_10077346 Ga0207661_100773462 97
1216 3300025945 Ga0207679_10007699 Ga0207679_100076993 97
1217 3300025945 Ga0207679_10040246 Ga0207679_100402461 97
1218 3300025945 Ga0207679_10041373 Ga0207679_100413733 97
1219 3300025945 Ga0207679_10102374 Ga0207679_101023742 97
1220 3300025945 Ga0207679_10114172 Ga0207679_101141722 97
1221 3300025945 Ga0207679_10215097 Ga0207679_102150972 97
1222 3300025945 Ga0207679_10277105 Ga0207679_102771053 97
1223 3300025945 Ga0207679_10486581 Ga0207679_104865812 97
1224 3300025945 Ga0207679_10700473 Ga0207679_107004732 97
1225 3300025945 Ga0207679_10782438 Ga0207679_107824381 97
1226 3300025945 Ga0207679_10921450 Ga0207679_109214502 97
1227 3300025945 Ga0207679_11010275 Ga0207679_110102752 97
1228 3300025945 Ga0207679_11272558 Ga0207679_112725582 97
1229 3300025945 Ga0207679_11697641 Ga0207679_116976412 97
1230 3300025949 Ga0207667_10000695 Ga0207667_100006955 97
1231 3300025949 Ga0207667_10029282 Ga0207667_100292822 97
1232 3300025949 Ga0207667_10106398 Ga0207667_101063982 97
1233 3300025949 Ga0207667_10111015 Ga0207667_101110152 97
1234 3300025949 Ga0207667_10126412 Ga0207667_101264123 97
1235 3300025949 Ga0207667_10173389 Ga0207667_101733892 97
1236 3300025949 Ga0207667_11137941 Ga0207667_111379412 97
1237 3300025949 Ga0207667_11257873 Ga0207667_112578732 97
1238 3300025949 Ga0207667_11383274 Ga0207667_113832742 97
1239 3300025960 Ga0207651_10008740 Ga0207651_100087402 97
1240 3300025960 Ga0207651_10012320 Ga0207651_100123203 97
1241 3300025960 Ga0207651_10047466 Ga0207651_100474664 97
1242 3300025960 Ga0207651_10225408 Ga0207651_102254082 97
1243 3300025960 Ga0207651_10308724 Ga0207651_103087242 97
1244 3300025960 Ga0207651_10357089 Ga0207651_103570892 97
1245 3300025960 Ga0207651_10378507 Ga0207651_103785073 97
1246 3300025960 Ga0207651_10383776 Ga0207651_103837762 97
1247 3300025960 Ga0207651_10409553 Ga0207651_104095533 97
1248 3300025960 Ga0207651_10471360 Ga0207651_104713602 97
1249 3300025960 Ga0207651_10602751 Ga0207651_106027512 97
1250 3300025960 Ga0207651_11037820 Ga0207651_110378202 97
1251 3300025960 Ga0207651_11326326 Ga0207651_113263261 97
1252 3300025960 Ga0207651_11349356 Ga0207651_113493562 97
1253 3300025960 Ga0207651_11752393 Ga0207651_117523932 97
1254 3300025961 Ga0207712_10039802 Ga0207712_100398023 97
1255 3300025961 Ga0207712_10042639 Ga0207712_100426393 97
1256 3300025961 Ga0207712_10095842 Ga0207712_100958423 97
1257 3300025961 Ga0207712_10162078 Ga0207712_101620783 97
1258 3300025961 Ga0207712_10492329 Ga0207712_104923292 97
1259 3300025961 Ga0207712_11649250 Ga0207712_116492502 97
1260 3300025972 Ga0207668_10005405 Ga0207668_100054052 97
1261 3300025972 Ga0207668_10037519 Ga0207668_100375192 97
1262 3300025972 Ga0207668_10044175 Ga0207668_100441754 97
1263 3300025972 Ga0207668_10051279 Ga0207668_100512792 97
1264 3300025972 Ga0207668_10503142 Ga0207668_105031422 97
1265 3300025981 Ga0207640_10023262 Ga0207640_100232623 97
1266 3300025981 Ga0207640_10032535 Ga0207640_100325352 97
1267 3300025981 Ga0207640_10083236 Ga0207640_100832362 97
1268 3300025981 Ga0207640_10180316 Ga0207640_101803162 97
1269 3300025981 Ga0207640_10318699 Ga0207640_103186991 97
1270 3300025981 Ga0207640_11107379 Ga0207640_111073792 97
1271 3300025981 Ga0207640_11658406 Ga0207640_116584062 97
1272 3300025986 Ga0207658_10000692 Ga0207658_1000069220 97
1273 3300025986 Ga0207658_10003344 Ga0207658_1000334410 97
1274 3300025986 Ga0207658_10006775 Ga0207658_100067759 97
1275 3300025986 Ga0207658_10018195 Ga0207658_100181953 97
1276 3300025986 Ga0207658_10082191 Ga0207658_100821912 97
1277 3300025986 Ga0207658_10174795 Ga0207658_101747952 97
1278 3300025986 Ga0207658_10232348 Ga0207658_102323482 97
1279 3300025986 Ga0207658_10252799 Ga0207658_102527993 97
1280 3300025986 Ga0207658_10484342 Ga0207658_104843422 97
1281 3300025986 Ga0207658_10851624 Ga0207658_108516242 97
1282 3300025986 Ga0207658_11017055 Ga0207658_110170551 97
1283 3300025986 Ga0207658_11046565 Ga0207658_110465651 97
1284 3300026023 Ga0207677_10000162 Ga0207677_100001624 97
1285 3300026023 Ga0207677_10023617 Ga0207677_100236175 97
1286 3300026023 Ga0207677_10049738 Ga0207677_100497382 97
1287 3300026023 Ga0207677_10117628 Ga0207677_101176282 97
1288 3300026023 Ga0207677_10133832 Ga0207677_101338323 97
1289 3300026023 Ga0207677_10191676 Ga0207677_101916762 97
1290 3300026023 Ga0207677_10223810 Ga0207677_102238102 97
1291 3300026023 Ga0207677_10259133 Ga0207677_102591333 97
1292 3300026023 Ga0207677_10313095 Ga0207677_103130952 97
1293 3300026023 Ga0207677_10451458 Ga0207677_104514581 97
1294 3300026023 Ga0207677_11273719 Ga0207677_112737191 97
1295 3300026023 Ga0207677_11602897 Ga0207677_116028972 97
1296 3300026035 Ga0207703_10004137 Ga0207703_100041374 97
1297 3300026035 Ga0207703_10009361 Ga0207703_100093615 97
1298 3300026035 Ga0207703_10019363 Ga0207703_100193636 97
1299 3300026035 Ga0207703_10042385 Ga0207703_100423852 97
1300 3300026035 Ga0207703_10051228 Ga0207703_100512283 97
1301 3300026035 Ga0207703_10083537 Ga0207703_100835373 97
1302 3300026035 Ga0207703_10093797 Ga0207703_100937973 97
1303 3300026035 Ga0207703_10211815 Ga0207703_102118152 97
1304 3300026041 Ga0207639_10006505 Ga0207639_1000650511 97
1305 3300026041 Ga0207639_10020340 Ga0207639_100203401 97
1306 3300026041 Ga0207639_10021561 Ga0207639_100215613 97
1307 3300026041 Ga0207639_10029627 Ga0207639_100296274 97
1308 3300026041 Ga0207639_10179953 Ga0207639_101799532 97
1309 3300026041 Ga0207639_10338061 Ga0207639_103380612 97
1310 3300026041 Ga0207639_10604894 Ga0207639_106048942 97
1311 3300026041 Ga0207639_10616947 Ga0207639_106169472 97
1312 3300026041 Ga0207639_10665618 Ga0207639_106656181 97
1313 3300026041 Ga0207639_10771989 Ga0207639_107719892 97
1314 3300026041 Ga0207639_10971385 Ga0207639_109713852 97
1315 3300026041 Ga0207639_11357012 Ga0207639_113570121 97
1316 3300026041 Ga0207639_11712695 Ga0207639_117126952 97
1317 3300026067 Ga0207678_10004516 Ga0207678_100045163 97
1318 3300026067 Ga0207678_10008037 Ga0207678_100080373 97
1319 3300026067 Ga0207678_10035843 Ga0207678_100358432 97
1320 3300026067 Ga0207678_10042402 Ga0207678_100424023 97
1321 3300026067 Ga0207678_10088022 Ga0207678_100880224 97
1322 3300026067 Ga0207678_10185846 Ga0207678_101858462 97
1323 3300026067 Ga0207678_10211262 Ga0207678_102112622 97
1324 3300026067 Ga0207678_10990148 Ga0207678_109901482 97
1325 3300026075 Ga0207708_10013446 Ga0207708_100134463 97
1326 3300026075 Ga0207708_10031349 Ga0207708_100313493 97
1327 3300026075 Ga0207708_10077223 Ga0207708_100772232 97
1328 3300026075 Ga0207708_10376305 Ga0207708_103763053 97
1329 3300026075 Ga0207708_10501536 Ga0207708_105015362 97
1330 3300026075 Ga0207708_10907898 Ga0207708_109078982 97
1331 3300026078 Ga0207702_10004669 Ga0207702_100046693 97
1332 3300026078 Ga0207702_10032665 Ga0207702_100326654 97
1333 3300026078 Ga0207702_10070119 Ga0207702_100701194 97
1334 3300026078 Ga0207702_10095460 Ga0207702_100954603 97
1335 3300026078 Ga0207702_10169394 Ga0207702_101693943 97
1336 3300026078 Ga0207702_10483531 Ga0207702_104835312 97
1337 3300026088 Ga0207641_10001589 Ga0207641_100015893 97
1338 3300026088 Ga0207641_10004050 Ga0207641_1000405012 97
1339 3300026088 Ga0207641_10015947 Ga0207641_100159474 97
1340 3300026088 Ga0207641_10057882 Ga0207641_100578822 97
1341 3300026088 Ga0207641_10071561 Ga0207641_100715612 97
1342 3300026088 Ga0207641_10101359 Ga0207641_101013591 97
1343 3300026088 Ga0207641_10116683 Ga0207641_101166833 97
1344 3300026088 Ga0207641_10470926 Ga0207641_104709263 97
1345 3300026088 Ga0207641_10594697 Ga0207641_105946972 97
1346 3300026088 Ga0207641_11276434 Ga0207641_112764342 97
1347 3300026088 Ga0207641_11962124 Ga0207641_119621242 97
1348 3300026088 Ga0207641_12050182 Ga0207641_120501821 97
1349 3300026089 Ga0207648_10015995 Ga0207648_100159956 97
1350 3300026089 Ga0207648_10016602 Ga0207648_100166023 97
1351 3300026089 Ga0207648_10039156 Ga0207648_100391562 97
1352 3300026089 Ga0207648_10075921 Ga0207648_100759212 97
1353 3300026089 Ga0207648_10109392 Ga0207648_101093923 97
1354 3300026089 Ga0207648_10144806 Ga0207648_101448062 97
1355 3300026089 Ga0207648_10957785 Ga0207648_109577851 97
1356 3300026095 Ga0207676_10005835 Ga0207676_1000583510 97
1357 3300026095 Ga0207676_10016199 Ga0207676_100161993 97
1358 3300026095 Ga0207676_10019116 Ga0207676_100191163 97
1359 3300026095 Ga0207676_10033393 Ga0207676_100333932 97
1360 3300026095 Ga0207676_10045076 Ga0207676_100450764 97
1361 3300026095 Ga0207676_10216634 Ga0207676_102166343 97
1362 3300026095 Ga0207676_10240452 Ga0207676_102404522 97
1363 3300026095 Ga0207676_10293583 Ga0207676_102935833 97
1364 3300026095 Ga0207676_10305871 Ga0207676_103058712 97
1365 3300026095 Ga0207676_10410269 Ga0207676_104102692 97
1366 3300026095 Ga0207676_11051717 Ga0207676_110517171 97
1367 3300026095 Ga0207676_12048804 Ga0207676_120488042 97
1368 3300026095 Ga0207676_12321817 Ga0207676_123218171 97
1369 3300026116 Ga0207674_10006136 Ga0207674_1000613614 97
1370 3300026116 Ga0207674_10008127 Ga0207674_100081273 97
1371 3300026116 Ga0207674_10086098 Ga0207674_100860983 97
1372 3300026116 Ga0207674_10111677 Ga0207674_101116773 97
1373 3300026116 Ga0207674_10173568 Ga0207674_101735683 97
1374 3300026116 Ga0207674_10325170 Ga0207674_103251702 97
1375 3300026116 Ga0207674_10365082 Ga0207674_103650823 97
1376 3300026116 Ga0207674_10778360 Ga0207674_107783602 97
1377 3300026118 Ga0207675_100003963 Ga0207675_10000396313 97
1378 3300026118 Ga0207675_100005623 Ga0207675_1000056233 97
1379 3300026118 Ga0207675_100035859 Ga0207675_1000358591 97
1380 3300026118 Ga0207675_100055833 Ga0207675_1000558333 97
1381 3300026118 Ga0207675_100056573 Ga0207675_1000565733 97
1382 3300026118 Ga0207675_100189963 Ga0207675_1001899632 97
1383 3300026118 Ga0207675_100306499 Ga0207675_1003064993 97
1384 3300026118 Ga0207675_100496898 Ga0207675_1004968983 97
1385 3300026118 Ga0207675_100567180 Ga0207675_1005671802 97
1386 3300026118 Ga0207675_100822131 Ga0207675_1008221312 97
1387 3300026118 Ga0207675_100856076 Ga0207675_1008560763 97
1388 3300026118 Ga0207675_101295043 Ga0207675_1012950431 97
1389 3300026121 Ga0207683_10000694 Ga0207683_1000069429 97
1390 3300026121 Ga0207683_10007462 Ga0207683_100074625 97
1391 3300026121 Ga0207683_10010723 Ga0207683_100107233 97
1392 3300026121 Ga0207683_10019201 Ga0207683_100192016 97
1393 3300026121 Ga0207683_10041980 Ga0207683_100419802 97
1394 3300026121 Ga0207683_10048997 Ga0207683_100489974 97
1395 3300026121 Ga0207683_10517864 Ga0207683_105178643 97
1396 3300026121 Ga0207683_10764826 Ga0207683_107648262 97
1397 3300026121 Ga0207683_11159927 Ga0207683_111599272 97
1398 3300026142 Ga0207698_10002759 Ga0207698_1000275910 97
1399 3300026142 Ga0207698_10112573 Ga0207698_101125733 97
1400 3300026142 Ga0207698_10143339 Ga0207698_101433392 97
1401 3300026142 Ga0207698_10207132 Ga0207698_102071323 97
1402 3300026142 Ga0207698_10317487 Ga0207698_103174872 97
1403 3300026142 Ga0207698_10538859 Ga0207698_105388592 97
1404 3300026142 Ga0207698_10878533 Ga0207698_108785332 97
1405 3300026142 Ga0207698_11362903 Ga0207698_113629032 97
1406 3300026142 Ga0207698_11704363 Ga0207698_117043632 97
1407 3300026142 Ga0207698_11876939 Ga0207698_118769391 97
1408 3300027360 Ga0209969_1038247 Ga0209969_10382472 97
1409 3300027395 Ga0209996_1002790 Ga0209996_10027903 97
1410 3300027424 Ga0209984_1018017 Ga0209984_10180172 97
1411 3300027471 Ga0209995_1006654 Ga0209995_10066543 97
1412 3300027526 Ga0209968_1000274 Ga0209968_10002743 97
1413 3300027526 Ga0209968_1034555 Ga0209968_10345552 97
1414 3300027543 Ga0209999_1007826 Ga0209999_10078262 97
1415 3300027614 Ga0209970_1005190 Ga0209970_10051903 97
1416 3300027614 Ga0209970_1010001 Ga0209970_10100013 97
1417 3300027617 Ga0210002_1011686 Ga0210002_10116863 97
1418 3300027665 Ga0209983_1010224 Ga0209983_10102243 97
1419 3300027665 Ga0209983_1050583 Ga0209983_10505832 97
1420 3300027671 Ga0209588_1003732 Ga0209588_10037322 97
1421 3300027695 Ga0209966_1000126 Ga0209966_10001269 97
1422 3300027695 Ga0209966_1017753 Ga0209966_10177533 97
1423 3300027695 Ga0209966_1018959 Ga0209966_10189592 97
1424 3300027717 Ga0209998_10023977 Ga0209998_100239772 97
1425 3300027876 Ga0209974_10004409 Ga0209974_100044094 97
1426 3300027876 Ga0209974_10011006 Ga0209974_100110063 97
1427 3300027876 Ga0209974_10053814 Ga0209974_100538142 97
1428 3300027907 Ga0207428_10006537 Ga0207428_100065377 97
1429 3300027907 Ga0207428_10240925 Ga0207428_102409253 97
1430 3300027907 Ga0207428_10395933 Ga0207428_103959332 97
1431 3300028379 Ga0268266_10012240 Ga0268266_100122404 97
1432 3300028379 Ga0268266_10039843 Ga0268266_100398432 97
1433 3300028379 Ga0268266_10049106 Ga0268266_100491062 97
1434 3300028379 Ga0268266_10223197 Ga0268266_102231972 97
1435 3300028379 Ga0268266_10838647 Ga0268266_108386472 97
1436 3300028379 Ga0268266_11178485 Ga0268266_111784852 97
1437 3300028379 Ga0268266_11685689 Ga0268266_116856892 97
1438 3300028380 Ga0268265_10062610 Ga0268265_100626102 97
1439 3300028380 Ga0268265_10077462 Ga0268265_100774623 97
1440 3300028380 Ga0268265_10213767 Ga0268265_102137673 97
1441 3300028380 Ga0268265_10258418 Ga0268265_102584182 97
1442 3300028380 Ga0268265_10350676 Ga0268265_103506763 97
1443 3300028380 Ga0268265_10560751 Ga0268265_105607513 97
1444 3300028380 Ga0268265_10843506 Ga0268265_108435061 97
1445 3300028380 Ga0268265_10944505 Ga0268265_109445052 97
1446 3300028381 Ga0268264_10011844 Ga0268264_100118442 97
1447 3300028381 Ga0268264_10016872 Ga0268264_100168722 97
1448 3300028381 Ga0268264_10041785 Ga0268264_100417852 97
1449 3300028381 Ga0268264_10082345 Ga0268264_100823453 97
1450 3300028381 Ga0268264_10244997 Ga0268264_102449972 97
1451 3300028381 Ga0268264_10515414 Ga0268264_105154142 97
1452 3300028381 Ga0268264_10681926 Ga0268264_106819262 97
1453 3300028381 Ga0268264_11763545 Ga0268264_117635452 97
1454 3300028381 Ga0268264_12007434 Ga0268264_120074341 97
1455 3300028381 Ga0268264_12015362 Ga0268264_120153622 97
1456 3300028794 Ga0307515_10202249 Ga0307515_102022492 97
1457 3300028800 Ga0265338_11006880 Ga0265338_110068802 97
1458 3300031235 Ga0265330_10003496 Ga0265330_100034968 97
1459 3300031238 Ga0265332_10000783 Ga0265332_1000078310 97
1460 3300031239 Ga0265328_10010176 Ga0265328_100101763 97
1461 3300031241 Ga0265325_10011353 Ga0265325_100113532 97
1462 3300031242 Ga0265329_10021291 Ga0265329_100212913 97
1463 3300031249 Ga0265339_10111097 Ga0265339_101110972 97
1464 3300031250 Ga0265331_10000936 Ga0265331_100009364 97
1465 3300031251 Ga0265327_10151959 Ga0265327_101519592 97
1466 3300031344 Ga0265316_10051554 Ga0265316_100515543 97
1467 3300031456 Ga0307513_10158609 Ga0307513_101586092 97
1468 3300031548 Ga0307408_100037707 Ga0307408_1000377072 97
1469 3300031548 Ga0307408_100222988 Ga0307408_1002229883 97
1470 3300031548 Ga0307408_100376762 Ga0307408_1003767622 97
1471 3300031548 Ga0307408_100483368 Ga0307408_1004833682 97
1472 3300031548 Ga0307408_101654098 Ga0307408_1016540982 97
1473 3300031711 Ga0265314_10097220 Ga0265314_100972202 97
1474 3300031711 Ga0265314_10391721 Ga0265314_103917212 97
1475 3300031712 Ga0265342_10035010 Ga0265342_100350104 97
1476 3300031727 Ga0316576_10013668 Ga0316576_100136683 97
1477 3300031731 Ga0307405_10037860 Ga0307405_100378603 97
1478 3300031731 Ga0307405_10137759 Ga0307405_101377593 97
1479 3300031731 Ga0307405_10210477 Ga0307405_102104772 97
1480 3300031824 Ga0307413_10009897 Ga0307413_100098974 97
1481 3300031824 Ga0307413_10052226 Ga0307413_100522262 97
1482 3300031824 Ga0307413_10144220 Ga0307413_101442203 97
1483 3300031824 Ga0307413_11249890 Ga0307413_112498901 97
1484 3300031824 Ga0307413_12044662 Ga0307413_120446622 97
1485 3300031852 Ga0307410_10010537 Ga0307410_100105373 97
1486 3300031852 Ga0307410_10020396 Ga0307410_100203964 97
1487 3300031852 Ga0307410_10320625 Ga0307410_103206251 97
1488 3300031901 Ga0307406_10188568 Ga0307406_101885682 97
1489 3300031901 Ga0307406_10352015 Ga0307406_103520153 97
1490 3300031901 Ga0307406_10633196 Ga0307406_106331962 97
1491 3300031903 Ga0307407_10044585 Ga0307407_100445852 97
1492 3300031903 Ga0307407_10057278 Ga0307407_100572783 97
1493 3300031903 Ga0307407_10106984 Ga0307407_101069842 97
1494 3300031911 Ga0307412_10300113 Ga0307412_103001132 97
1495 3300031911 Ga0307412_10334165 Ga0307412_103341652 97
1496 3300031911 Ga0307412_10370350 Ga0307412_103703503 97
1497 3300031911 Ga0307412_10533490 Ga0307412_105334902 97
1498 3300031911 Ga0307412_11172410 Ga0307412_111724102 97
1499 3300031995 Ga0307409_100028493 Ga0307409_1000284934 97
1500 3300031995 Ga0307409_100053410 Ga0307409_1000534102 97
1501 3300031995 Ga0307409_100059634 Ga0307409_1000596343 97
1502 3300031995 Ga0307409_100888002 Ga0307409_1008880022 97
1503 3300032002 Ga0307416_100044271 Ga0307416_1000442713 97
1504 3300032002 Ga0307416_100079310 Ga0307416_1000793103 97
1505 3300032002 Ga0307416_100118206 Ga0307416_1001182063 97
1506 3300032002 Ga0307416_100197273 Ga0307416_1001972733 97
1507 3300032004 Ga0307414_10309028 Ga0307414_103090282 97
1508 3300032004 Ga0307414_10485104 Ga0307414_104851043 97
1509 3300032005 Ga0307411_10017085 Ga0307411_100170856 97
1510 3300032005 Ga0307411_10149612 Ga0307411_101496122 97
1511 3300032005 Ga0307411_10182705 Ga0307411_101827052 97
1512 3300032126 Ga0307415_100053151 Ga0307415_1000531513 97
1513 3300032126 Ga0307415_100134728 Ga0307415_1001347282 97
1514 3300032126 Ga0307415_101400790 Ga0307415_1014007901 97
1515 3300034816 Ga0373930_0019123 Ga0373930_0019123_42_335 97
1516 3300035083 Ga0373926_0030098 Ga0373926_0030098_296_589 97
1517 3300035083 Ga0373926_0243892 Ga0373926_0243892_348_641 97
1518 3300035085 Ga0373929_0088798 Ga0373929_0088798_192_485 97
1519 3300035086 Ga0373934_0003186 Ga0373934_0003186_4632_4925 97
1520 3300035088 Ga0373940_0375481 Ga0373940_0375481_53_346 97
1521 3300035089 Ga0373944_0053256 Ga0373944_0053256_372_665 97
1522 3300035111 Ga0373923_0025085 Ga0373923_0025085_1276_1569 97
1523 3300035112 Ga0373932_0159201 Ga0373932_0159201_43_339 97
1524 3300035113 Ga0373936_0076145 Ga0373936_0076145_466_759 97
1525 3300035114 Ga0373939_0116579 Ga0373939_0116579_477_770 97
1526 3300035114 Ga0373939_0133521 Ga0373939_0133521_117_410 97
1527 3300035114 Ga0373939_0346719 Ga0373939_0346719_91_384 97
1528 3300035116 Ga0373945_0074690 Ga0373945_0074690_556_849 97
1529 3300035116 Ga0373945_0150702 Ga0373945_0150702_305_598 97
1530 3300035116 Ga0373945_0150811 Ga0373945_0150811_583_876 97
1531 3300035117 Ga0373953_0000655 Ga0373953_0000655_8198_8491 97
1532 3300035117 Ga0373953_0225732 Ga0373953_0225732_122_415 97
1533 3300035118 Ga0373954_0003575 Ga0373954_0003575_4628_4921 97
1534 3300035118 Ga0373954_0168556 Ga0373954_0168556_282_575 97
1535 3300035118 Ga0373954_0300986 Ga0373954_0300986_314_607 97
1536 3300035119 Ga0373956_0081443 Ga0373956_0081443_246_539 97
1537 3300035119 Ga0373956_0326039 Ga0373956_0326039_267_560 97
1538 3300035120 Ga0373957_0035455 Ga0373957_0035455_1169_1462 97
1539 3300035120 Ga0373957_0229744 Ga0373957_0229744_286_579 97
1540 3300035120 Ga0373957_0439139 Ga0373957_0439139_35_328 97
1541 3300035121 Ga0373960_0173778 Ga0373960_0173778_96_389 97
1542 3300035170 Ga0373943_0013050 Ga0373943_0013050_3286_3579 97
1543 3300035170 Ga0373943_0254744 Ga0373943_0254744_375_668 97
1544 3300035170 Ga0373943_0326615 Ga0373943_0326615_381_674 97
1545 3300035171 Ga0373946_0084272 Ga0373946_0084272_484_777 97
1546 3300035171 Ga0373946_0170934 Ga0373946_0170934_574_867 97
1547 3300035171 Ga0373946_0221069 Ga0373946_0221069_329_622 97
1548 3300035172 Ga0373955_0056096 Ga0373955_0056096_1178_1471 97
1549 3300035172 Ga0373955_0266855 Ga0373955_0266855_123_416 97
1550 3300035172 Ga0373955_1009388 Ga0373955_1009388_10_303 97
1551 3300035410 Ga0373924_0017224 Ga0373924_0017224_2318_2611 97
1552 3300035410 Ga0373924_0222181 Ga0373924_0222181_368_661 97
1553 3300035410 Ga0373924_0230902 Ga0373924_0230902_346_639 97
1554 3300035691 Ga0373931_0112733 Ga0373931_0112733_822_1118 97
1555 3300035691 Ga0373931_0172625 Ga0373931_0172625_691_984 97
1556 3300035691 Ga0373931_0178826 Ga0373931_0178826_293_586 97
1557 3300035691 Ga0373931_0217075 Ga0373931_0217075_243_536 97
1558 3300035692 Ga0373935_0104203 Ga0373935_0104203_1230_1523 97
1559 3300035692 Ga0373935_0126252 Ga0373935_0126252_375_668 97
1560 3300035692 Ga0373935_0329390 Ga0373935_0329390_657_950 97
1561 3300035692 Ga0373935_0934069 Ga0373935_0934069_201_494 97
1562 3300035695 Ga0373927_0059050 Ga0373927_0059050_1068_1361 97
1563 3300035695 Ga0373927_0060470 Ga0373927_0060470_1608_1901 97
1564 3300035695 Ga0373927_0061797 Ga0373927_0061797_1262_1555 97
1565 3300035695 Ga0373927_0086509 Ga0373927_0086509_1453_1746 97
1566 3300035695 Ga0373927_0572565 Ga0373927_0572565_203_496 97
1567 3300035695 Ga0373927_0696317 Ga0373927_0696317_241_534 97
1568 3300035724 Ga0373933_0020139 Ga0373933_0020139_1198_1491 97
1569 3300035724 Ga0373933_0034582 Ga0373933_0034582_2414_2707 97
1570 3300035724 Ga0373933_0657186 Ga0373933_0657186_316_609 97
1571 3300035724 Ga0373933_1122284 Ga0373933_1122284_189_482 97
1572 3300035725 Ga0373947_0028852 Ga0373947_0028852_522_815 97
1573 3300035725 Ga0373947_0114755 Ga0373947_0114755_926_1219 97
1574 3300035725 Ga0373947_0468207 Ga0373947_0468207_192_485 97
1575 3300035725 Ga0373947_0648824 Ga0373947_0648824_158_451 97
1576 3300035725 Ga0373947_0973946 Ga0373947_0973946_80_373 97
1577 3300036401 Ga0373937_0051948 Ga0373937_0051948_1526_1819 97
1578 3300036401 Ga0373937_0089848 Ga0373937_0089848_1119_1412 97
1579 3300036401 Ga0373937_0475831 Ga0373937_0475831_650_943 97
1580 3300036401 Ga0373937_0546452 Ga0373937_0546452_178_483 97
1581 3300036401 Ga0373937_0717845 Ga0373937_0717845_414_707 97
1582 3300036401 Ga0373937_2047804 Ga0373937_2047804_209_502 97
1583 3300036712 Ga0316584_0557427 Ga0316584_0557427_445_744 97
1584 3300036712 Ga0316584_0927641 Ga0316584_0927641_244_537 97
1585 3300037068 Ga0373925_0020187 Ga0373925_0020187_1648_1941 97
1586 3300037068 Ga0373925_0036448 Ga0373925_0036448_3321_3614 97
1587 3300037068 Ga0373925_0042297 Ga0373925_0042297_1298_1591 97
1588 3300037068 Ga0373925_0045226 Ga0373925_0045226_235_528 97
1589 3300037068 Ga0373925_0327531 Ga0373925_0327531_323_616 97
1590 3300037312 Ga0395899_0030025 Ga0395899_0030025_712_1005 97
1591 3300037312 Ga0395899_0064597 Ga0395899_0064597_1287_1583 97
1592 3300037418 Ga0395900_0692638 Ga0395900_0692638_289_582 97
1593 3300037418 Ga0395900_1326321 Ga0395900_1326321_189_482 97
1594 3300037466 Ga0395898_0008078 Ga0395898_0008078_8816_9112 97
1595 3300037466 Ga0395898_0042307 Ga0395898_0042307_1353_1646 97
1596 3300037471 Ga0395905_0055586 Ga0395905_0055586_3175_3468 97
1597 3300037471 Ga0395905_0063514 Ga0395905_0063514_1502_1795 97
1598 3300037471 Ga0395905_0104887 Ga0395905_0104887_1069_1362 97
1599 3300037471 Ga0395905_0171397 Ga0395905_0171397_499_795 97
1600 3300037471 Ga0395905_0472866 Ga0395905_0472866_300_593 97
1601 3300038443 Ga0395901_0008430 Ga0395901_0008430_5298_5591 97
1602 3300038443 Ga0395901_0011902 Ga0395901_0011902_5082_5378 97
1603 3300038443 Ga0395901_0016025 Ga0395901_0016025_6487_6780 97
1604 3300039438 Ga0436360_0213181 Ga0436360_0213181_495_788 97
1605 3300041404 Ga0439436_0159961 Ga0439436_0159961_265_564 97
1606 3300041443 Ga0451789_0884076 Ga0451789_0884076_141_434 97
1607 3300041458 Ga0451798_0266000 Ga0451798_0266000_112_405 97
1608 3300041459 Ga0451800_1181577 Ga0451800_1181577_249_542 97
1609 3300041459 Ga0451800_1385157 Ga0451800_1385157_74_367 97
1610 3300041463 Ga0451804_0607212 Ga0451804_0607212_435_728 97
1611 3300041486 Ga0451807_1793237 Ga0451807_1793237_784_1077 97
1612 3300041496 Ga0451839_0543072 Ga0451839_0543072_109_402 97
1613 3300041498 Ga0451841_1032702 Ga0451841_1032702_324_617 97
1614 3300041503 Ga0451847_0416076 Ga0451847_0416076_251_544 97
1615 3300041507 Ga0451851_0031062 Ga0451851_0031062_153_446 97
1616 3300041509 Ga0451843_0662256 Ga0451843_0662256_405_698 97
1617 3300041512 Ga0451853_3040296 Ga0451853_3040296_25_330 97
1618 3300041512 Ga0451853_3541128 Ga0451853_3541128_270_566 97
1619 3300041512 Ga0451853_3808615 Ga0451853_3808615_535_828 97
1620 3300042001 Ga0439441_043416 Ga0439441_043416_251_544 97
1621 3300042127 Ga0450890_035398 Ga0450890_035398_367_660 97
1622 3300042437 Ga0439444_0035329 Ga0439444_0035329_45_344 97
1623 3300042461 Ga0439460_0146337 Ga0439460_0146337_266_559 97
1624 3300042876 Ga0451577_0052351 Ga0451577_0052351_339_632 97
1625 3300042876 Ga0451577_0119022 Ga0451577_0119022_642_935 97
1626 3300042876 Ga0451577_0152667 Ga0451577_0152667_193_486 97
1627 3300042876 Ga0451577_0550180 Ga0451577_0550180_443_736 97
1628 3300042876 Ga0451577_0686446 Ga0451577_0686446_122_415 97
1629 3300042876 Ga0451577_1065905 Ga0451577_1065905_41_334 97
1630 3300044673 Ga0453683_0399481 Ga0453683_0399481_125_421 97
1631 3300044673 Ga0453683_0562954 Ga0453683_0562954_203_496 97
1632 3300044706 Ga0466964_0056849 Ga0466964_0056849_865_1158 97
1633 3300045051 Ga0451576_0036188 Ga0451576_0036188_3760_4056 97
1634 3300045051 Ga0451576_1134471 Ga0451576_1134471_277_570 97
1635 3300045051 Ga0451576_1341854 Ga0451576_1341854_272_565 97
1636 3300045051 Ga0451576_1983653 Ga0451576_1983653_184_477 97
1637 3300045051 Ga0451576_2246404 Ga0451576_2246404_62_355 97
1638 3300045976 Ga0466967_0137529 Ga0466967_0137529_602_895 97
1639 3300046455 Ga0495603_0812972 Ga0495603_0812972_23_316 97
1640 3300046459 Ga0495629_0028114 Ga0495629_0028114_1316_1609 97
1641 3300046472 Ga0495580_0282303 Ga0495580_0282303_632_925 97
1642 3300046472 Ga0495580_0363989 Ga0495580_0363989_46_339 97
1643 3300046472 Ga0495580_0476979 Ga0495580_0476979_167_460 97
1644 3300046473 Ga0495582_0227203 Ga0495582_0227203_598_891 97
1645 3300046473 Ga0495582_0675761 Ga0495582_0675761_248_541 97
1646 3300046473 Ga0495582_0703780 Ga0495582_0703780_139_432 97
1647 3300046475 Ga0495639_0196717 Ga0495639_0196717_316_609 97
1648 3300046475 Ga0495639_0487122 Ga0495639_0487122_175_468 97
1649 3300046476 Ga0495662_0033097 Ga0495662_0033097_393_686 97
1650 3300046477 Ga0495664_0034904 Ga0495664_0034904_1293_1586 97
1651 3300046477 Ga0495664_0249959 Ga0495664_0249959_524_817 97
1652 3300046516 Ga0495628_0536606 Ga0495628_0536606_185_478 97
1653 3300046517 Ga0495630_0112851 Ga0495630_0112851_1401_1694 97
1654 3300046517 Ga0495630_0207055 Ga0495630_0207055_734_1027 97
1655 3300046528 Ga0495642_0558859 Ga0495642_0558859_94_387 97
1656 3300046531 Ga0495665_0073632 Ga0495665_0073632_1339_1632 97
1657 3300046531 Ga0495665_0133633 Ga0495665_0133633_686_979 97
1658 3300046533 Ga0495640_0461711 Ga0495640_0461711_16_309 97
1659 3300046535 Ga0495586_0366978 Ga0495586_0366978_506_799 97
1660 3300046535 Ga0495586_0759251 Ga0495586_0759251_26_319 97
1661 3300046537 Ga0495598_0167096 Ga0495598_0167096_55_348 97
1662 3300046539 Ga0495621_0011015 Ga0495621_0011015_283_576 97
1663 3300046539 Ga0495621_0019935 Ga0495621_0019935_1889_2182 97
1664 3300046539 Ga0495621_0019942 Ga0495621_0019942_1381_1674 97
1665 3300046543 Ga0495645_0065936 Ga0495645_0065936_311_604 97
1666 3300046559 Ga0495667_0027889 Ga0495667_0027889_3495_3791 97
1667 3300046663 Ga0495635_0087208 Ga0495635_0087208_1307_1600 97
1668 3300046664 Ga0495659_0024886 Ga0495659_0024886_967_1260 97
1669 3300046674 Ga0495588_0166706 Ga0495588_0166706_750_1043 97
1670 3300046674 Ga0495588_0435756 Ga0495588_0435756_14_307 97
1671 3300046675 Ga0495657_0196488 Ga0495657_0196488_706_999 97
1672 3300046675 Ga0495657_0346379 Ga0495657_0346379_367_660 97
1673 3300046678 Ga0495599_0299042 Ga0495599_0299042_256_549 97
1674 3300046679 Ga0495623_0041357 Ga0495623_0041357_708_1001 97
1675 3300046679 Ga0495623_0506339 Ga0495623_0506339_213_506 97
1676 3300046681 Ga0495647_0020297 Ga0495647_0020297_1448_1741 97
1677 3300046683 Ga0495658_0035187 Ga0495658_0035187_1341_1634 97
1678 3300046683 Ga0495658_0286601 Ga0495658_0286601_152_448 97
1679 3300046684 Ga0495669_0228738 Ga0495669_0228738_417_710 97
1680 3300046690 Ga0495624_0022146 Ga0495624_0022146_2407_2700 97
1681 3300046692 Ga0495671_0017060 Ga0495671_0017060_469_762 97
1682 3300046809 Ga0495600_0008024 Ga0495600_0008024_5291_5584 97
1683 3300047315 Ga0495581_0007883 Ga0495581_0007883_202_495 97
1684 3300047315 Ga0495581_0429078 Ga0495581_0429078_234_527 97
1685 3300047319 Ga0495674_0644598 Ga0495674_0644598_167_460 97
1686 3300047322 Ga0495680_0063418 Ga0495680_0063418_2425_2718 97
1687 3300047444 Ga0495675_0129642 Ga0495675_0129642_65_358 97
1688 3300047471 Ga0495684_0157880 Ga0495684_0157880_1120_1413 97
1689 3300047673 Ga0495593_0010677 Ga0495593_0010677_3126_3419 97
1690 3300047673 Ga0495593_0033524 Ga0495593_0033524_1247_1540 97
1691 3300048903 Ga0496100_0069382 Ga0496100_0069382_1245_1538 97
1692 3300048903 Ga0496100_0209035 Ga0496100_0209035_795_1088 97
1693 3300048903 Ga0496100_1206179 Ga0496100_1206179_224_517 97
1694 3300048904 Ga0496101_0062582 Ga0496101_0062582_895_1188 97
1695 3300048904 Ga0496101_0226130 Ga0496101_0226130_234_527 97
1696 3300048904 Ga0496101_1030068 Ga0496101_1030068_129_422 97
1697 3300048905 Ga0496102_0009107 Ga0496102_0009107_6892_7185 97
1698 3300048905 Ga0496102_0081349 Ga0496102_0081349_1732_2025 97
1699 3300048905 Ga0496102_0639766 Ga0496102_0639766_631_924 97
1700 3300048905 Ga0496102_1551706 Ga0496102_1551706_185_478 97
1701 3300048906 Ga0496103_0049084 Ga0496103_0049084_300_593 97
1702 3300048906 Ga0496103_0218147 Ga0496103_0218147_15_308 97
1703 3300048906 Ga0496103_0263702 Ga0496103_0263702_266_559 97
1704 3300048907 Ga0496104_0014530 Ga0496104_0014530_1343_1636 97
1705 3300048907 Ga0496104_1051518 Ga0496104_1051518_43_336 97
1706 3300048908 Ga0496105_0081418 Ga0496105_0081418_1012_1305 97
1707 3300048908 Ga0496105_0086878 Ga0496105_0086878_1289_1582 97
1708 3300048908 Ga0496105_0098391 Ga0496105_0098391_221_514 97
1709 3300048908 Ga0496105_0757334 Ga0496105_0757334_409_702 97
1710 3300048909 Ga0496106_0010554 Ga0496106_0010554_1593_1886 97
1711 3300048909 Ga0496106_0170244 Ga0496106_0170244_555_848 97
1712 3300048909 Ga0496106_0229090 Ga0496106_0229090_717_1010 97
1713 3300048909 Ga0496106_1228659 Ga0496106_1228659_97_390 97
1714 3300048909 Ga0496106_1343481 Ga0496106_1343481_102_395 97
1715 3300048910 Ga0496107_0001319 Ga0496107_0001319_1469_1762 97
1716 3300048910 Ga0496107_0018674 Ga0496107_0018674_3251_3544 97
1717 3300048910 Ga0496107_0035618 Ga0496107_0035618_1901_2194 97
1718 3300048910 Ga0496107_0119343 Ga0496107_0119343_666_959 97
1719 3300048910 Ga0496107_0746977 Ga0496107_0746977_185_478 97
1720 3300048911 Ga0496108_0030751 Ga0496108_0030751_1301_1594 97
1721 3300048911 Ga0496108_0087750 Ga0496108_0087750_1461_1754 97
1722 3300048911 Ga0496108_0146455 Ga0496108_0146455_1707_2000 97
1723 3300048911 Ga0496108_0243074 Ga0496108_0243074_805_1098 97
1724 3300048911 Ga0496108_0750432 Ga0496108_0750432_207_500 97
1725 3300048911 Ga0496108_0820538 Ga0496108_0820538_468_761 97
1726 3300048912 Ga0496109_0015749 Ga0496109_0015749_4894_5187 97
1727 3300048912 Ga0496109_0015873 Ga0496109_0015873_4695_4988 97
1728 3300048912 Ga0496109_0087543 Ga0496109_0087543_896_1189 97
1729 3300048912 Ga0496109_0356586 Ga0496109_0356586_479_772 97
1730 3300048913 Ga0496110_0386693 Ga0496110_0386693_226_519 97
1731 3300048913 Ga0496110_0678321 Ga0496110_0678321_35_328 97
1732 3300048913 Ga0496110_1666343 Ga0496110_1666343_189_482 97
1733 3300048914 Ga0496111_0115527 Ga0496111_0115527_149_442 97
1734 3300048914 Ga0496111_0253550 Ga0496111_0253550_229_522 97
1735 3300048914 Ga0496111_0264709 Ga0496111_0264709_951_1244 97
1736 3300048914 Ga0496111_0454340 Ga0496111_0454340_270_563 97
1737 3300048915 Ga0496112_0145304 Ga0496112_0145304_388_681 97
1738 3300048915 Ga0496112_0209602 Ga0496112_0209602_672_965 97
1739 3300048915 Ga0496112_0220236 Ga0496112_0220236_1146_1439 97
1740 3300048915 Ga0496112_0732634 Ga0496112_0732634_98_391 97
1741 3300048915 Ga0496112_0746100 Ga0496112_0746100_111_404 97
1742 3300048916 Ga0496113_0088985 Ga0496113_0088985_216_509 97
1743 3300048916 Ga0496113_0272866 Ga0496113_0272866_624_917 97
1744 3300048917 Ga0496114_0022742 Ga0496114_0022742_386_679 97
1745 3300048917 Ga0496114_0035477 Ga0496114_0035477_1339_1632 97
1746 3300048917 Ga0496114_0061091 Ga0496114_0061091_2011_2304 97
1747 3300048917 Ga0496114_1316710 Ga0496114_1316710_34_327 97
1748 3300048918 Ga0496115_0566010 Ga0496115_0566010_86_379 97
1749 3300048918 Ga0496115_0879482 Ga0496115_0879482_94_387 97
1750 3300049575 Ga0501039_0961702 Ga0501039_0961702_77_370 97
1751 3300049577 Ga0501041_0963412 Ga0501041_0963412_238_531 97
1752 3300049578 Ga0501042_0054907 Ga0501042_0054907_2443_2736 97
1753 3300049579 Ga0501043_0257872 Ga0501043_0257872_62_367 97
1754 3300049581 Ga0501047_0512245 Ga0501047_0512245_408_713 97
1755 3300049583 Ga0501067_0084497 Ga0501067_0084497_534_827 97
1756 3300049585 Ga0501069_0269848 Ga0501069_0269848_555_848 97
1757 3300049586 Ga0501070_0090624 Ga0501070_0090624_1680_1973 97
1758 3300049588 Ga0501072_0025913 Ga0501072_0025913_1320_1625 97
1759 3300049588 Ga0501072_0120213 Ga0501072_0120213_645_938 97
1760 3300049589 Ga0501073_0005691 Ga0501073_0005691_1456_1761 97
1761 3300049590 Ga0501074_0112904 Ga0501074_0112904_955_1260 97
1762 3300049591 Ga0501075_1517166 Ga0501075_1517166_22_315 97
1763 3300049592 Ga0501076_1668637 Ga0501076_1668637_158_463 97
1764 3300049741 Ga0501079_0556292 Ga0501079_0556292_142_435 97
1765 3300049742 Ga0501080_0226274 Ga0501080_0226274_743_1036 97
1766 3300049742 Ga0501080_0332290 Ga0501080_0332290_793_1086 97
1767 3300049744 Ga0501083_0028042 Ga0501083_0028042_595_900 97
1768 3300049744 Ga0501083_0038451 Ga0501083_0038451_1713_2006 97
1769 3300049822 Ga0501035_1352244 Ga0501035_1352244_218_523 97
1770 3300049824 Ga0501045_0135268 Ga0501045_0135268_92_385 97
1771 3300050507 nmdc:mga05p37_1728116_c1 nmdc:mga05p37_1728116_c1_207_500 97
1772 3300050507 nmdc:mga05p37_172_c1 nmdc:mga05p37_172_c1_46778_47071 97
1773 3300050507 nmdc:mga05p37_472022_c1 nmdc:mga05p37_472022_c1_680_976 97
1774 3300050508 nmdc:mga09592_191_c1 nmdc:mga09592_191_c1_13190_13483 97
1775 3300050508 nmdc:mga09592_47612_c1 nmdc:mga09592_47612_c1_2503_2802 97
1776 3300050509 nmdc:mga0qj67_1354209_c1 nmdc:mga0qj67_1354209_c1_85_378 97
1777 3300050509 nmdc:mga0qj67_981870_c1 nmdc:mga0qj67_981870_c1_354_653 97
1778 3300050510 nmdc:mga06r32_63340_c1 nmdc:mga06r32_63340_c1_1293_1586 97
1779 3300050511 nmdc:mga08y16_1844291_c1 nmdc:mga08y16_1844291_c1_74_367 97
1780 3300050511 nmdc:mga08y16_193468_c1 nmdc:mga08y16_193468_c1_1309_1602 97
1781 3300050511 nmdc:mga08y16_407116_c1 nmdc:mga08y16_407116_c1_411_704 97
1782 3300050511 nmdc:mga08y16_639735_c1 nmdc:mga08y16_639735_c1_666_959 97
1783 3300050511 nmdc:mga08y16_867_c1 nmdc:mga08y16_867_c1_13811_14110 97
1784 3300050512 nmdc:mga0n895_136756_c1 nmdc:mga0n895_136756_c1_938_1231 97
1785 3300050512 nmdc:mga0n895_142641_c1 nmdc:mga0n895_142641_c1_1648_1941 97
1786 3300050512 nmdc:mga0n895_1747798_c1 nmdc:mga0n895_1747798_c1_280_573 97
1787 3300050512 nmdc:mga0n895_1848439_c1 nmdc:mga0n895_1848439_c1_182_475 97
1788 3300050512 nmdc:mga0n895_32674_c1 nmdc:mga0n895_32674_c1_4606_4899 97
1789 3300050512 nmdc:mga0n895_701773_c1 nmdc:mga0n895_701773_c1_444_740 97
1790 3300050513 nmdc:mga0rr50_105016_c1 nmdc:mga0rr50_105016_c1_132_428 97
1791 3300050513 nmdc:mga0rr50_1220065_c1 nmdc:mga0rr50_1220065_c1_94_387 97
1792 3300050513 nmdc:mga0rr50_1256922_c1 nmdc:mga0rr50_1256922_c1_69_362 97
1793 3300050513 nmdc:mga0rr50_276647_c1 nmdc:mga0rr50_276647_c1_226_519 97
1794 3300050513 nmdc:mga0rr50_363390_c1 nmdc:mga0rr50_363390_c1_76_369 97
1795 3300050513 nmdc:mga0rr50_468120_c1 nmdc:mga0rr50_468120_c1_570_863 97
1796 3300050513 nmdc:mga0rr50_469293_c1 nmdc:mga0rr50_469293_c1_235_528 97
1797 3300050513 nmdc:mga0rr50_67241_c1 nmdc:mga0rr50_67241_c1_1499_1792 97
1798 3300050514 nmdc:mga08x19_157731_c1 nmdc:mga08x19_157731_c1_853_1146 97
1799 3300050514 nmdc:mga08x19_393114_c1 nmdc:mga08x19_393114_c1_537_830 97
1800 3300050514 nmdc:mga08x19_4190_c1 nmdc:mga08x19_4190_c1_5038_5334 97
1801 3300050514 nmdc:mga08x19_42273_c1 nmdc:mga08x19_42273_c1_1882_2178 97
1802 3300050515 nmdc:mga0a205_1007282_c1 nmdc:mga0a205_1007282_c1_344_637 97
1803 3300050515 nmdc:mga0a205_1491772_c1 nmdc:mga0a205_1491772_c1_39_332 97
1804 3300050515 nmdc:mga0a205_169132_c1 nmdc:mga0a205_169132_c1_1386_1682 97
1805 3300050515 nmdc:mga0a205_170036_c1 nmdc:mga0a205_170036_c1_1154_1447 97
1806 3300050515 nmdc:mga0a205_92009_c1 nmdc:mga0a205_92009_c1_732_1025 97
1807 3300053077 Ga0495601_0110802 Ga0495601_0110802_539_832 97
1808 3300053077 Ga0495601_0474001 Ga0495601_0474001_352_645 97
1809 3300053078 Ga0495612_0026782 Ga0495612_0026782_1399_1692 97
1810 3300053078 Ga0495612_0040720 Ga0495612_0040720_538_831 97
1811 3300053083 Ga0495655_0289728 Ga0495655_0289728_224_517 97
1812 3300053085 Ga0495619_0151735 Ga0495619_0151735_504_797 97
1813 3300053085 Ga0495619_0368513 Ga0495619_0368513_434_727 97
1814 3300053085 Ga0495619_0742190 Ga0495619_0742190_173_466 97
1815 3300053085 Ga0495619_0938592 Ga0495619_0938592_104_397 97
1816 3300054114 Ga0501084_0079631 Ga0501084_0079631_1462_1755 97
1817 3300054114 Ga0501084_0482507 Ga0501084_0482507_745_1038 97
1818 3300060353 Ga0501082_0132311 Ga0501082_0132311_449_742 97
1819 3300061734 Ga0530510_0360332 Ga0530510_0360332_309_602 97

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13466

STAS_2

STAS domain

12

88

0.97

PF01740

STAS

STAS domain

10

98

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m36-assembly1.cif.gz_F the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9243 1 92
7s9d-assembly1.cif.gz_B cryo-em structure of dolphin prestin: intermediate state 0.9226 35 73
6m36-assembly1.cif.gz_H the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.897 1 94
6m36-assembly1.cif.gz_F the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.887 1 92
4hyl-assembly1.cif.gz_A the crystal structure of an anti-sigma-factor antagonist from haliangium ochraceum dsm 14365 0.8635 1 93
ID Description Score Start End Superfamily
af_P60070_1_106_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8944 1 93 3.30.750.24
af_Q55FJ8_836_995_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8862 11 94 3.30.750.24
af_G5EC30_461_581_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8836 11 92 3.30.750.24
af_O33206_378_486_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8638 2 84 3.30.750.24
af_Q8LR58_519_649_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8591 5 94 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A0Q7AXH0-F1-model_v4 Anti-sigma factor antagonist 1.002 13 97 GO:0043856
AF-A0A536XZW8-F1-model_v4 Anti-sigma factor antagonist 0.9975 1 97 GO:0043856
AF-A0A536WJR9-F1-model_v4 Anti-sigma factor antagonist 0.9967 1 97 GO:0043856
AF-A0A7Y2G1M8-F1-model_v4 STAS domain-containing protein 0.9903 1 94 GO:0043856
AF-A0A7Y2CRB5-F1-model_v4 STAS domain-containing protein 0.9902 1 93 GO:0043856

Feature Viewer

pLDDT pTM Quality
96.67 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map