F495724

General Info

Members Datasets Scaffolds Average Seq Length
1794 619 3588 121

Family's Representative Sequence

Representative Sequence 3300035111|Ga0373923_0066378|Ga0373923_0066378_607_1035
Length 142
Sequence LPTPTSAEFATAEFENAEEFVMTTLYTADHEWLRIEGDVATIGVTDYAQSQLGDVVFVELPKVGRSLKKAEAAAVVESVKAASDVYAPISGEVLEVNDAVTAEPALVNSDAAGKAWFFKMKIADKGELGGLMDEAAYAKHTA

Samples

Sample ID Description Type Environment
1 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
89 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
110 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
111 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
114 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
115 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
116 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
145 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
148 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
149 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
150 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
151 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
152 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
153 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
154 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
158 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
161 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
225 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
226 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
227 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
230 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
231 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
235 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
236 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
237 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
238 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
239 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
241 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
242 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
243 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
244 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
245 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
246 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
247 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
248 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
249 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
250 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
251 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
252 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
253 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
254 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
255 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
256 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
257 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
258 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
259 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
260 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
261 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
262 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
263 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
264 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
265 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
266 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
267 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
268 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
269 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
270 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
271 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
272 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
273 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
274 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
275 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
276 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
277 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
278 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
279 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
280 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
281 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
282 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
283 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
284 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
285 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
286 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
287 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
288 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
289 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
290 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
291 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
292 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
293 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
294 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
295 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
296 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
297 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
298 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
299 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
300 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
301 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
302 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
303 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
304 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
305 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
306 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
307 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
308 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
309 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
310 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
311 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
312 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
313 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
314 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
315 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
316 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
317 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
318 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
319 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
320 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
321 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
322 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
323 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
324 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
325 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
326 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
327 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
328 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
329 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
330 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
331 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
332 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
333 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
334 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
335 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
336 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
337 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
338 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
339 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
340 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
341 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
342 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
343 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
344 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
345 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
346 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
347 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
348 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
349 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
350 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
351 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
352 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
353 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
354 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
355 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
356 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
357 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
358 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
359 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
360 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
361 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
362 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
363 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
364 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
365 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
366 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
367 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
368 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
369 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
370 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
371 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
372 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
373 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
374 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
375 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
376 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
377 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
378 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
379 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
380 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
381 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
382 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
383 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
384 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
385 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
386 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
387 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
388 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
389 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
390 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
391 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
392 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
393 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
394 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
395 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
396 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
397 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
398 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
399 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
400 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
401 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
402 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
403 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
404 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
405 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
406 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
407 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
408 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
409 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
410 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
411 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
412 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
413 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
414 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
415 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
416 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
417 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
418 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
419 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
420 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
421 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
422 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
423 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
424 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
425 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
426 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
427 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
428 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
429 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
430 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
431 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
432 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
433 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
434 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
435 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
436 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
437 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
438 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
439 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
440 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
441 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
442 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
443 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
444 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
445 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
446 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
451 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
454 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
456 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
461 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
462 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
463 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
464 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
465 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
466 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
467 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
468 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
469 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
470 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
471 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
472 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
473 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
474 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
475 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
476 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
477 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
478 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
479 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
480 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
481 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
482 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
483 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
484 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
485 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
486 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
487 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
488 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
489 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
490 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
491 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
492 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
493 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
494 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
495 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
496 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
497 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
498 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
499 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
500 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
501 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
502 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
503 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
504 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
505 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
506 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
507 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
508 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
509 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
510 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
511 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
512 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
513 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
514 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
515 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
516 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
517 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
518 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
519 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
520 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
521 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
522 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
523 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
524 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
525 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
526 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
527 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
528 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
529 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
530 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
531 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
532 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
533 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
534 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
535 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
536 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
537 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
538 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
539 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
540 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
541 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
542 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
543 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
544 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
545 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
546 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
547 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
548 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
549 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
550 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
551 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
553 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
554 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
555 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
556 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
557 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
558 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
559 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
560 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
561 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
562 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
563 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
564 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
565 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
566 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
567 2791355199
568 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
569 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
570 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
571 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
572 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
573 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
574 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
575 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
576 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
577 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
578 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
579 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
580 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
581 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
582 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
583 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
584 2906610324
585 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
586 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
587 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
588 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
589 2922425934
590 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
591 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
592 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
593 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
594 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
595 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
596 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
597 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
598 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
599 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
600 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
601 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
602 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
603 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
604 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
605 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
606 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
607 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
608 3004167301 Mesorhizobium loti 582 Isolate Unclassified
609 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
610 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
611 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
612 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
613 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
614 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
615 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
616 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
617 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
618 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
619 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.09
Metatranscriptomes 0.39
Isolates 3.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.08
Nodule 3.23
Rhizoplane 6.52
Rhizosphere 75.08
Stem 0
Stem Tuber 0
Unclassified 0.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373923_0066378 3300035111 Bacteria 1542
2 LJQas_1024377 3300000549 Bacteria 704
3 JGI24740J21852_10053397 3300001979 Bacteria 1146
4 JGI24737J22298_10048933 3300001990 Bacteria 1286
5 JGI24738J21930_10155461 3300002075 Bacteria 510
6 JGI25406J46586_10000108 3300003203 Bacteria 36424
7 JGI25406J46586_10001646 3300003203 Bacteria 10551
8 JGI25165J46597_1024394 3300003214 Bacteria 785
9 JGI25153J46596_10050604 3300003215 Bacteria 1196
10 JGI25404J52841_10000644 3300003659 Bacteria 5303
11 JGI25404J52841_10005197 3300003659 Bacteria 2683
12 JGI25404J52841_10008083 3300003659 Bacteria 2233
13 Ga0055539_1003154 3300003752 Bacteria 2348
14 Ga0055529_1032799 3300003763 Bacteria 635
15 Ga0065712_10488784 3300005290 Bacteria 657
16 Ga0065715_10670048 3300005293 Bacteria 668
17 Ga0065707_10999634 3300005295 Bacteria 539
18 Ga0070658_10260390 3300005327 Bacteria 1473
19 Ga0070658_10295838 3300005327 Bacteria 1380
20 Ga0070676_10487858 3300005328 Bacteria 873
21 Ga0070676_10583999 3300005328 Bacteria 804
22 Ga0070676_11263007 3300005328 Bacteria 563
23 Ga0070683_100014355 3300005329 Bacteria 6928
24 Ga0070683_100088077 3300005329 Bacteria 2912
25 Ga0070683_100242484 3300005329 Bacteria 1714
26 Ga0070683_101817851 3300005329 Bacteria 586
27 Ga0070690_100151047 3300005330 Bacteria 1585
28 Ga0070670_100248435 3300005331 Bacteria 1550
29 Ga0068869_100121997 3300005334 Bacteria 1994
30 Ga0068869_100360168 3300005334 Bacteria 1187
31 Ga0068869_101139702 3300005334 Bacteria 683
32 Ga0068869_101456381 3300005334 Bacteria 607
33 Ga0068869_101752895 3300005334 Bacteria 555
34 Ga0070666_10866789 3300005335 Bacteria 667
35 Ga0070680_100089144 3300005336 Bacteria 2552
36 Ga0070682_100022647 3300005337 Bacteria 3723
37 Ga0070682_100208447 3300005337 Bacteria 1384
38 Ga0070682_100746269 3300005337 Bacteria 790
39 Ga0068868_100050475 3300005338 Bacteria 3267
40 Ga0068868_100289018 3300005338 Bacteria 1390
41 Ga0068868_101210858 3300005338 Bacteria 698
42 Ga0070660_100483094 3300005339 Bacteria 1029
43 Ga0070660_100707145 3300005339 Bacteria 845
44 Ga0070689_100245267 3300005340 Bacteria 1477
45 Ga0070689_100259560 3300005340 Bacteria 1436
46 Ga0070689_100370655 3300005340 Bacteria 1205
47 Ga0070691_10222532 3300005341 Bacteria 1001
48 Ga0070661_100497286 3300005344 Bacteria 976
49 Ga0070661_101060465 3300005344 Bacteria 674
50 Ga0070668_100088077 3300005347 Bacteria 2443
51 Ga0070668_100166340 3300005347 Bacteria 1792
52 Ga0070668_100539036 3300005347 Bacteria 1014
53 Ga0070668_100551290 3300005347 Bacteria 1003
54 Ga0070675_100722419 3300005354 Bacteria 908
55 Ga0070675_102211501 3300005354 Bacteria 507
56 Ga0070671_100648685 3300005355 Bacteria 914
57 Ga0070671_101294720 3300005355 Bacteria 643
58 Ga0070674_100037998 3300005356 Bacteria 3241
59 Ga0070674_100122461 3300005356 Bacteria 1927
60 Ga0070674_100186876 3300005356 Bacteria 1591
61 Ga0070674_100361464 3300005356 Bacteria 1175
62 Ga0070674_100798353 3300005356 Bacteria 815
63 Ga0070673_100261600 3300005364 Bacteria 1512
64 Ga0070673_100534165 3300005364 Bacteria 1064
65 Ga0070673_100818164 3300005364 Bacteria 861
66 Ga0070688_100679056 3300005365 Bacteria 796
67 Ga0070659_100070899 3300005366 Bacteria 2770
68 Ga0070659_100222247 3300005366 Bacteria 1559
69 Ga0070667_100523251 3300005367 Bacteria 1088
70 Ga0070667_100629517 3300005367 Bacteria 990
71 Ga0070667_100968351 3300005367 Bacteria 793
72 Ga0070667_101621456 3300005367 Bacteria 608
73 Ga0070703_10455391 3300005406 Bacteria 568
74 Ga0070709_10000711 3300005434 Bacteria 18912
75 Ga0070709_10005923 3300005434 Bacteria 6633
76 Ga0070709_10010651 3300005434 Bacteria 5099
77 Ga0070709_10034579 3300005434 Bacteria 3064
78 Ga0070709_10050656 3300005434 Bacteria 2603
79 Ga0070709_10337566 3300005434 Bacteria 1110
80 Ga0070709_10564081 3300005434 Bacteria 873
81 Ga0070714_100122613 3300005435 Bacteria 2313
82 Ga0070714_100147745 3300005435 Bacteria 2115
83 Ga0070714_100160171 3300005435 Bacteria 2035
84 Ga0070714_100172101 3300005435 Bacteria 1966
85 Ga0070714_100187955 3300005435 Bacteria 1883
86 Ga0070714_101001809 3300005435 Bacteria 813
87 Ga0070714_101046724 3300005435 Bacteria 795
88 Ga0070713_100009795 3300005436 Bacteria 6887
89 Ga0070713_100013303 3300005436 Bacteria 6071
90 Ga0070713_100016454 3300005436 Bacteria 5560
91 Ga0070713_100099847 3300005436 Bacteria 2512
92 Ga0070713_100931011 3300005436 Bacteria 836
93 Ga0070713_101446220 3300005436 Bacteria 667
94 Ga0070710_10006260 3300005437 Bacteria 5703
95 Ga0070710_10015382 3300005437 Bacteria 3871
96 Ga0070710_10043936 3300005437 Bacteria 2477
97 Ga0070710_10230229 3300005437 Bacteria 1183
98 Ga0070710_10455702 3300005437 Bacteria 868
99 Ga0070710_10598786 3300005437 Bacteria 767
100 Ga0070710_10648406 3300005437 Bacteria 740
101 Ga0070710_10850946 3300005437 Bacteria 655
102 Ga0070711_100019819 3300005439 Bacteria 4323
103 Ga0070711_100038598 3300005439 Bacteria 3212
104 Ga0070711_100045927 3300005439 Bacteria 2974
105 Ga0070711_100083601 3300005439 Bacteria 2281
106 Ga0070711_100117258 3300005439 Bacteria 1963
107 Ga0070711_100179878 3300005439 Bacteria 1619
108 Ga0070711_100579577 3300005439 Bacteria 934
109 Ga0070711_101712159 3300005439 Bacteria 551
110 Ga0070705_101006793 3300005440 Bacteria 677
111 Ga0070700_100056764 3300005441 Bacteria 2455
112 Ga0070700_101946535 3300005441 Bacteria 509
113 Ga0070694_100651404 3300005444 Bacteria 852
114 Ga0070663_100053735 3300005455 Bacteria 2876
115 Ga0070663_100057596 3300005455 Bacteria 2788
116 Ga0070663_100297974 3300005455 Bacteria 1290
117 Ga0070663_100486186 3300005455 Bacteria 1023
118 Ga0070663_100732786 3300005455 Bacteria 843
119 Ga0070663_102062773 3300005455 Bacteria 514
120 Ga0070678_100172355 3300005456 Bacteria 1764
121 Ga0070678_100388036 3300005456 Bacteria 1210
122 Ga0070678_100499506 3300005456 Bacteria 1073
123 Ga0070678_100856078 3300005456 Bacteria 829
124 Ga0070662_100184538 3300005457 Bacteria 1646
125 Ga0070662_100307962 3300005457 Bacteria 1289
126 Ga0070662_101069398 3300005457 Bacteria 692
127 Ga0070662_101287692 3300005457 Bacteria 629
128 Ga0070681_10015887 3300005458 Bacteria 7506
129 Ga0070681_10024393 3300005458 Bacteria 6088
130 Ga0070681_10108764 3300005458 Bacteria 2712
131 Ga0070681_10406727 3300005458 Bacteria 1273
132 Ga0070681_11250672 3300005458 Bacteria 665
133 Ga0070685_10235074 3300005466 Bacteria 1207
134 Ga0070685_10625187 3300005466 Bacteria 777
135 Ga0070685_10908482 3300005466 Bacteria 656
136 Ga0070706_100559633 3300005467 Bacteria 1063
137 Ga0070706_100714804 3300005467 Bacteria 929
138 Ga0070706_100782188 3300005467 Bacteria 884
139 Ga0070707_100066943 3300005468 Bacteria 3454
140 Ga0070707_101487963 3300005468 Bacteria 644
141 Ga0070698_100078989 3300005471 Bacteria 3287
142 Ga0070698_100337454 3300005471 Bacteria 1439
143 Ga0070698_100504663 3300005471 Bacteria 1148
144 Ga0070698_101128762 3300005471 Bacteria 733
145 Ga0070699_100912368 3300005518 Bacteria 805
146 Ga0070699_101106803 3300005518 Bacteria 727
147 Ga0070679_100047533 3300005530 Bacteria 4276
148 Ga0070679_100088927 3300005530 Bacteria 3075
149 Ga0070679_100091402 3300005530 Bacteria 3032
150 Ga0070679_100496444 3300005530 Bacteria 1164
151 Ga0070679_100716012 3300005530 Bacteria 944
152 Ga0070684_100018307 3300005535 Bacteria 5769
153 Ga0070684_100019711 3300005535 Bacteria 5582
154 Ga0070684_100070933 3300005535 Bacteria 3066
155 Ga0070697_100665161 3300005536 Bacteria 918
156 Ga0068853_100015002 3300005539 Bacteria 6365
157 Ga0068853_100114236 3300005539 Bacteria 2402
158 Ga0068853_100167477 3300005539 Bacteria 1986
159 Ga0070672_100365276 3300005543 Bacteria 1232
160 Ga0070672_101119556 3300005543 Bacteria 700
161 Ga0070686_100332212 3300005544 Bacteria 1137
162 Ga0070686_100981667 3300005544 Bacteria 692
163 Ga0070695_101196752 3300005545 Bacteria 625
164 Ga0070696_101037466 3300005546 Bacteria 687
165 Ga0070696_101091012 3300005546 Bacteria 671
166 Ga0070693_100130062 3300005547 Bacteria 1572
167 Ga0070665_100473791 3300005548 Bacteria 1263
168 Ga0070665_100619516 3300005548 Bacteria 1095
169 Ga0070665_100643163 3300005548 Bacteria 1073
170 Ga0070665_100689684 3300005548 Bacteria 1034
171 Ga0070665_101353326 3300005548 Bacteria 721
172 Ga0070704_100074071 3300005549 Bacteria 2482
173 Ga0070704_100723180 3300005549 Bacteria 885
174 Ga0070704_102180459 3300005549 Bacteria 515
175 Ga0068855_100115160 3300005563 Bacteria 3082
176 Ga0068855_100172088 3300005563 Bacteria 2452
177 Ga0068855_100287225 3300005563 Bacteria 1825
178 Ga0068855_100303265 3300005563 Bacteria 1768
179 Ga0068855_100443398 3300005563 Bacteria 1417
180 Ga0068855_100471582 3300005563 Bacteria 1367
181 Ga0068855_100543251 3300005563 Bacteria 1259
182 Ga0068855_102056495 3300005563 Bacteria 576
183 Ga0070664_100256517 3300005564 Bacteria 1573
184 Ga0070664_100330475 3300005564 Bacteria 1383
185 Ga0068857_100050842 3300005577 Bacteria 3676
186 Ga0068857_100137022 3300005577 Bacteria 2210
187 Ga0068857_100262384 3300005577 Bacteria 1586
188 Ga0068857_100458566 3300005577 Bacteria 1192
189 Ga0068854_100044784 3300005578 Bacteria 3143
190 Ga0068854_100205677 3300005578 Bacteria 1550
191 Ga0068854_100376562 3300005578 Bacteria 1169
192 Ga0068854_100785867 3300005578 Bacteria 829
193 Ga0068854_100821247 3300005578 Bacteria 812
194 Ga0068854_100990579 3300005578 Bacteria 744
195 Ga0068854_101065639 3300005578 Bacteria 719
196 Ga0068854_101071515 3300005578 Bacteria 717
197 Ga0068856_100012484 3300005614 Bacteria 8223
198 Ga0068856_100068789 3300005614 Bacteria 3500
199 Ga0068856_100277470 3300005614 Bacteria 1692
200 Ga0068856_100356049 3300005614 Bacteria 1482
201 Ga0068856_100425581 3300005614 Bacteria 1348
202 Ga0068856_100732744 3300005614 Bacteria 1009
203 Ga0068856_102309127 3300005614 Bacteria 546
204 Ga0070702_100798160 3300005615 Bacteria 730
205 Ga0068852_100090179 3300005616 Bacteria 2741
206 Ga0068852_100100343 3300005616 Bacteria 2611
207 Ga0068852_100106181 3300005616 Bacteria 2545
208 Ga0068852_100173219 3300005616 Bacteria 2024
209 Ga0068852_100817382 3300005616 Bacteria 947
210 Ga0068859_100385816 3300005617 Bacteria 1496
211 Ga0068859_101222746 3300005617 Bacteria 827
212 Ga0068864_100133909 3300005618 Bacteria 2230
213 Ga0068864_100524318 3300005618 Bacteria 1142
214 Ga0068864_100761187 3300005618 Bacteria 950
215 Ga0068866_10220054 3300005718 Bacteria 1145
216 Ga0068866_11081523 3300005718 Bacteria 574
217 Ga0068861_100160363 3300005719 Bacteria 1854
218 Ga0068861_100168456 3300005719 Bacteria 1813
219 Ga0068861_100297953 3300005719 Bacteria 1395
220 Ga0068861_100365240 3300005719 Bacteria 1271
221 Ga0068851_10005108 3300005834 Bacteria 5950
222 Ga0068851_10257272 3300005834 Bacteria 992
223 Ga0068870_10275921 3300005840 Bacteria 1052
224 Ga0068870_10290969 3300005840 Bacteria 1027
225 Ga0068870_10516662 3300005840 Bacteria 798
226 Ga0068863_100176845 3300005841 Bacteria 2048
227 Ga0068863_100247083 3300005841 Bacteria 1723
228 Ga0068863_100699159 3300005841 Bacteria 1008
229 Ga0068863_100975027 3300005841 Bacteria 850
230 Ga0068858_100033733 3300005842 Bacteria 4747
231 Ga0068858_100193136 3300005842 Bacteria 1924
232 Ga0068858_100210555 3300005842 Bacteria 1840
233 Ga0068858_100255666 3300005842 Bacteria 1664
234 Ga0068858_100391269 3300005842 Bacteria 1335
235 Ga0068858_100521331 3300005842 Bacteria 1149
236 Ga0068858_100749239 3300005842 Bacteria 952
237 Ga0068860_100000161 3300005843 Bacteria 110123
238 Ga0068860_100238519 3300005843 Bacteria 1768
239 Ga0068860_100428901 3300005843 Bacteria 1311
240 Ga0068860_100672045 3300005843 Bacteria 1044
241 Ga0068860_100789017 3300005843 Bacteria 963
242 Ga0068862_100118043 3300005844 Bacteria 2335
243 Ga0068862_100167431 3300005844 Bacteria 1965
244 Ga0068862_100367413 3300005844 Bacteria 1338
245 Ga0068862_100833940 3300005844 Bacteria 902
246 Ga0068862_100978952 3300005844 Bacteria 835
247 Ga0068862_102590875 3300005844 Bacteria 519
248 Ga0081455_10011653 3300005937 Bacteria 8819
249 Ga0081455_10025146 3300005937 Bacteria 5501
250 Ga0081455_10033819 3300005937 Bacteria 4588
251 Ga0081455_10124483 3300005937 Bacteria 2026
252 Ga0081540_1000533 3300005983 Bacteria 37025
253 Ga0081540_1008405 3300005983 Bacteria 7215
254 Ga0081540_1008486 3300005983 Bacteria 7172
255 Ga0081540_1014919 3300005983 Bacteria 4943
256 Ga0081540_1018724 3300005983 Bacteria 4237
257 Ga0081540_1021152 3300005983 Bacteria 3885
258 Ga0081540_1024938 3300005983 Bacteria 3456
259 Ga0081540_1097380 3300005983 Bacteria 1277
260 Ga0081540_1108410 3300005983 Bacteria 1180
261 Ga0081540_1109766 3300005983 Bacteria 1169
262 Ga0081540_1158287 3300005983 Bacteria 883
263 Ga0081540_1193830 3300005983 Bacteria 746
264 Ga0081539_10000008 3300005985 Bacteria 525071
265 Ga0081539_10000319 3300005985 Bacteria 106944
266 Ga0081539_10051298 3300005985 Bacteria 2326
267 Ga0070717_10010806 3300006028 Bacteria 6906
268 Ga0070717_10011078 3300006028 Bacteria 6833
269 Ga0070717_10093601 3300006028 Bacteria 2541
270 Ga0070717_10146777 3300006028 Bacteria 2038
271 Ga0070717_10732411 3300006028 Bacteria 899
272 Ga0070717_10936103 3300006028 Bacteria 789
273 Ga0070717_10987235 3300006028 Bacteria 767
274 Ga0070717_11385236 3300006028 Bacteria 639
275 Ga0075365_10170429 3300006038 Bacteria 1519
276 Ga0075365_10266966 3300006038 Bacteria 1203
277 Ga0075365_10275562 3300006038 Bacteria 1183
278 Ga0075365_10745657 3300006038 Bacteria 691
279 Ga0075368_10057566 3300006042 Bacteria 1552
280 Ga0075368_10126101 3300006042 Bacteria 1062
281 Ga0075363_100434923 3300006048 Bacteria 774
282 Ga0075364_10498452 3300006051 Bacteria 832
283 Ga0075432_10154891 3300006058 Bacteria 883
284 Ga0070715_10054998 3300006163 Bacteria 1726
285 Ga0070715_11093669 3300006163 Bacteria 502
286 Ga0070716_100005426 3300006173 Bacteria 6177
287 Ga0070716_100036012 3300006173 Bacteria 2726
288 Ga0070716_100073640 3300006173 Bacteria 2015
289 Ga0070716_100397944 3300006173 Bacteria 990
290 Ga0070716_100654825 3300006173 Bacteria 797
291 Ga0070716_100844024 3300006173 Bacteria 713
292 Ga0070716_100918555 3300006173 Bacteria 687
293 Ga0070716_101763030 3300006173 Bacteria 512
294 Ga0070712_100031648 3300006175 Bacteria 3566
295 Ga0070712_100149458 3300006175 Bacteria 1792
296 Ga0070712_100249535 3300006175 Bacteria 1417
297 Ga0070712_100319096 3300006175 Bacteria 1263
298 Ga0070712_100401046 3300006175 Bacteria 1133
299 Ga0070712_100782561 3300006175 Bacteria 818
300 Ga0075362_10044251 3300006177 Bacteria 1974
301 Ga0075362_10475899 3300006177 Bacteria 637
302 Ga0075367_10179634 3300006178 Bacteria 1319
303 Ga0075367_10359999 3300006178 Bacteria 919
304 Ga0075367_10678756 3300006178 Bacteria 655
305 Ga0075369_10028743 3300006186 Bacteria 2332
306 Ga0075369_10145108 3300006186 Bacteria 1083
307 Ga0075369_10360163 3300006186 Bacteria 683
308 Ga0075366_10496499 3300006195 Bacteria 754
309 Ga0097621_100540451 3300006237 Bacteria 1060
310 Ga0097621_100576082 3300006237 Bacteria 1027
311 Ga0097621_100806756 3300006237 Bacteria 870
312 Ga0097621_101336351 3300006237 Bacteria 677
313 Ga0075370_10095230 3300006353 Bacteria 1720
314 Ga0075370_10103519 3300006353 Bacteria 1649
315 Ga0075370_10537320 3300006353 Bacteria 707
316 Ga0068871_100170257 3300006358 Bacteria 1866
317 Ga0068871_100204319 3300006358 Bacteria 1707
318 Ga0068871_100369542 3300006358 Bacteria 1272
319 Ga0068871_101128277 3300006358 Bacteria 734
320 Ga0068871_101422156 3300006358 Bacteria 654
321 Ga0068871_102088589 3300006358 Bacteria 539
322 Ga0068871_102156303 3300006358 Bacteria 531
323 Ga0075428_101045257 3300006844 Bacteria 864
324 Ga0075430_100647269 3300006846 Bacteria 872
325 Ga0075431_101726346 3300006847 Bacteria 583
326 Ga0075434_100207420 3300006871 Bacteria 1980
327 Ga0075434_100342945 3300006871 Bacteria 1515
328 Ga0068865_100686583 3300006881 Bacteria 873
329 Ga0068865_100902238 3300006881 Bacteria 769
330 Ga0075436_100074879 3300006914 Bacteria 2344
331 Ga0075436_101390907 3300006914 Bacteria 532
332 Ga0097620_100385840 3300006931 Bacteria 1496
333 Ga0097620_101222756 3300006931 Bacteria 827
334 Ga0099825_1025798 3300006941 Bacteria 3220
335 Ga0099824_1002235 3300006942 Bacteria 28253
336 Ga0099822_1006882 3300006943 Bacteria 14762
337 Ga0075435_100575742 3300007076 Bacteria 976
338 Ga0075435_101201063 3300007076 Bacteria 664
339 Ga0075435_101333737 3300007076 Bacteria 628
340 Ga0099794_10026969 3300007265 Bacteria 2660
341 Ga0099794_10110647 3300007265 Bacteria 1376
342 Ga0099794_10227749 3300007265 Bacteria 958
343 Ga0099794_10775838 3300007265 Bacteria 512
344 Ga0099795_10055193 3300007788 Bacteria 1458
345 Ga0099795_10096048 3300007788 Bacteria 1156
346 Ga0099795_10152514 3300007788 Bacteria 947
347 Ga0099795_10328200 3300007788 Bacteria 679
348 Ga0099795_10357315 3300007788 Bacteria 655
349 Ga0105251_10539554 3300009011 Bacteria 548
350 Ga0105250_10469832 3300009092 Bacteria 567
351 Ga0105240_10074299 3300009093 Bacteria 4197
352 Ga0105240_10108370 3300009093 Bacteria 3365
353 Ga0105240_10132523 3300009093 Bacteria 2988
354 Ga0105240_10174911 3300009093 Bacteria 2539
355 Ga0105240_10273738 3300009093 Bacteria 1943
356 Ga0105240_10276477 3300009093 Bacteria 1931
357 Ga0105240_10750917 3300009093 Bacteria 1061
358 Ga0105240_10906311 3300009093 Bacteria 948
359 Ga0105240_11406332 3300009093 Unclassified 733
360 Ga0105240_11517282 3300009093 Bacteria 702
361 Ga0105240_11563359 3300009093 Bacteria 691
362 Ga0111539_12268288 3300009094 Bacteria 630
363 Ga0111539_12432873 3300009094 Bacteria 607
364 Ga0105245_10113770 3300009098 Bacteria 2520
365 Ga0105245_10165372 3300009098 Bacteria 2103
366 Ga0105245_10550704 3300009098 Bacteria 1175
367 Ga0105245_10860058 3300009098 Bacteria 947
368 Ga0105245_10932570 3300009098 Bacteria 911
369 Ga0105245_11067005 3300009098 Bacteria 853
370 Ga0105247_10033343 3300009101 Bacteria 3132
371 Ga0105247_10079482 3300009101 Bacteria 2064
372 Ga0105247_10127166 3300009101 Bacteria 1657
373 Ga0105247_10144790 3300009101 Bacteria 1560
374 Ga0105247_10152058 3300009101 Bacteria 1526
375 Ga0105247_10366853 3300009101 Bacteria 1017
376 Ga0105247_10711033 3300009101 Bacteria 757
377 Ga0114129_10226285 3300009147 Bacteria 2521
378 Ga0105243_10389767 3300009148 Bacteria 1291
379 Ga0105243_10815473 3300009148 Bacteria 921
380 Ga0105243_10901638 3300009148 Bacteria 879
381 Ga0105243_11013930 3300009148 Bacteria 833
382 Ga0105241_10001465 3300009174 Bacteria 18092
383 Ga0105241_10049278 3300009174 Bacteria 3207
384 Ga0105241_10132093 3300009174 Bacteria 2023
385 Ga0105241_11148235 3300009174 Bacteria 733
386 Ga0105241_12638700 3300009174 Bacteria 505
387 Ga0105242_10298121 3300009176 Bacteria 1470
388 Ga0105242_10780212 3300009176 Bacteria 944
389 Ga0105242_10958571 3300009176 Bacteria 860
390 Ga0105242_12479757 3300009176 Bacteria 567
391 Ga0105242_12737101 3300009176 Bacteria 543
392 Ga0105248_10079208 3300009177 Bacteria 3692
393 Ga0105248_10180846 3300009177 Bacteria 2376
394 Ga0105248_10443094 3300009177 Bacteria 1463
395 Ga0105248_11481593 3300009177 Bacteria 768
396 Ga0105248_13041081 3300009177 Bacteria 534
397 Ga0105237_10082775 3300009545 Bacteria 3200
398 Ga0105237_10160602 3300009545 Bacteria 2246
399 Ga0105237_10162256 3300009545 Bacteria 2234
400 Ga0105237_10233768 3300009545 Bacteria 1839
401 Ga0105237_10509940 3300009545 Bacteria 1209
402 Ga0105237_10609634 3300009545 Bacteria 1098
403 Ga0105237_10614061 3300009545 Bacteria 1094
404 Ga0105237_11183166 3300009545 Bacteria 771
405 Ga0105237_11443767 3300009545 Bacteria 694
406 Ga0105238_10061520 3300009551 Bacteria 3757
407 Ga0105238_10082122 3300009551 Bacteria 3212
408 Ga0105238_10267973 3300009551 Bacteria 1688
409 Ga0105238_10291187 3300009551 Bacteria 1615
410 Ga0105238_10483474 3300009551 Bacteria 1238
411 Ga0105238_10602130 3300009551 Bacteria 1107
412 Ga0105238_11838552 3300009551 Bacteria 638
413 Ga0105238_12020289 3300009551 Bacteria 610
414 Ga0105238_13059924 3300009551 Bacteria 502
415 Ga0105249_10068182 3300009553 Bacteria 3280
416 Ga0105249_10410318 3300009553 Bacteria 1386
417 Ga0105249_10577193 3300009553 Bacteria 1177
418 Ga0105249_12026154 3300009553 Bacteria 648
419 Ga0105249_12991147 3300009553 Bacteria 543
420 Ga0099796_10115466 3300010159 Bacteria 1026
421 Ga0099796_10296990 3300010159 Bacteria 683
422 Ga0099796_10320592 3300010159 Bacteria 661
423 Ga0105239_10088062 3300010375 Bacteria 3423
424 Ga0105239_10101265 3300010375 Bacteria 3187
425 Ga0105239_10131659 3300010375 Bacteria 2782
426 Ga0105239_10220159 3300010375 Bacteria 2129
427 Ga0105239_10226651 3300010375 Bacteria 2097
428 Ga0105239_10260778 3300010375 Bacteria 1948
429 Ga0105239_10339626 3300010375 Bacteria 1695
430 Ga0105239_10597532 3300010375 Bacteria 1258
431 Ga0105239_10700420 3300010375 Bacteria 1158
432 Ga0105239_11293569 3300010375 Bacteria 841
433 Ga0105239_12007311 3300010375 Bacteria 671
434 Ga0105239_12450229 3300010375 Bacteria 608
435 Ga0105246_10241362 3300011119 Bacteria 1428
436 Ga0105246_10371949 3300011119 Bacteria 1178
437 Ga0105246_10760957 3300011119 Bacteria 855
438 Ga0105246_11145659 3300011119 Bacteria 713
439 Ga0157371_10284552 3300013102 Bacteria 1195
440 Ga0157370_10160379 3300013104 Bacteria 2092
441 Ga0157370_10173993 3300013104 Bacteria 2001
442 Ga0157369_10008049 3300013105 Bacteria 12091
443 Ga0157369_10213310 3300013105 Bacteria 2023
444 Ga0157369_10247375 3300013105 Bacteria 1862
445 Ga0157369_10778389 3300013105 Bacteria 984
446 Ga0157369_12451210 3300013105 Bacteria 528
447 Ga0157374_10096142 3300013296 Bacteria 2833
448 Ga0157374_11022102 3300013296 Bacteria 846
449 Ga0157374_11298936 3300013296 Bacteria 750
450 Ga0157378_10269866 3300013297 Bacteria 1636
451 Ga0157378_10414848 3300013297 Bacteria 1330
452 Ga0157378_11454845 3300013297 Bacteria 729
453 Ga0157378_11577077 3300013297 Bacteria 702
454 Ga0163162_10058369 3300013306 Bacteria 3888
455 Ga0163162_10309215 3300013306 Bacteria 1713
456 Ga0163162_10321723 3300013306 Bacteria 1679
457 Ga0163162_10367943 3300013306 Bacteria 1571
458 Ga0163162_10398679 3300013306 Bacteria 1508
459 Ga0163162_11222532 3300013306 Bacteria 853
460 Ga0157372_10319813 3300013307 Bacteria 1807
461 Ga0157372_10579081 3300013307 Bacteria 1308
462 Ga0157372_10759731 3300013307 Bacteria 1127
463 Ga0157372_11165745 3300013307 Bacteria 891
464 Ga0157372_12136808 3300013307 Bacteria 643
465 Ga0157375_10150857 3300013308 Bacteria 2460
466 Ga0157375_10250632 3300013308 Bacteria 1931
467 Ga0157375_10678966 3300013308 Bacteria 1185
468 Ga0157375_13474794 3300013308 Bacteria 524
469 Ga0163163_10041903 3300014325 Bacteria 4480
470 Ga0163163_10162927 3300014325 Bacteria 2276
471 Ga0163163_10216026 3300014325 Bacteria 1966
472 Ga0163163_11372685 3300014325 Bacteria 768
473 Ga0163163_11520999 3300014325 Bacteria 730
474 Ga0163163_11618380 3300014325 Bacteria 708
475 Ga0157380_10380529 3300014326 Bacteria 1332
476 Ga0157380_10725191 3300014326 Bacteria 1002
477 Ga0157380_11824342 3300014326 Bacteria 668
478 Ga0157380_11953605 3300014326 Bacteria 648
479 Ga0182008_10196178 3300014497 Bacteria 1026
480 Ga0157379_10144727 3300014968 Bacteria 2143
481 Ga0157379_10248801 3300014968 Bacteria 1613
482 Ga0157379_10329119 3300014968 Bacteria 1396
483 Ga0157379_10398734 3300014968 Bacteria 1264
484 Ga0157379_11027200 3300014968 Bacteria 787
485 Ga0157379_11241282 3300014968 Bacteria 718
486 Ga0157379_11784923 3300014968 Bacteria 604
487 Ga0157376_10046774 3300014969 Bacteria 3570
488 Ga0157376_10267297 3300014969 Bacteria 1605
489 Ga0157376_12623663 3300014969 Bacteria 544
490 Ga0182007_10073559 3300015262 Bacteria 1120
491 Ga0163161_10149277 3300017792 Bacteria 1775
492 Ga0163161_10348488 3300017792 Bacteria 1177
493 Ga0163161_11194055 3300017792 Bacteria 657
494 Ga0163161_11272012 3300017792 Bacteria 639
495 Ga0213873_10008342 3300021358 Bacteria 2112
496 Ga0213872_10147300 3300021361 Bacteria 1030
497 Ga0213872_10247740 3300021361 Bacteria 751
498 Ga0213872_10338979 3300021361 Bacteria 618
499 Ga0213874_10027137 3300021377 Bacteria 1627
500 Ga0213876_10001294 3300021384 Bacteria 15771
501 Ga0213876_10190064 3300021384 Bacteria 1092
502 Ga0213876_10712441 3300021384 Bacteria 534
503 Ga0213875_10014183 3300021388 Bacteria 3894
504 Ga0213871_10027908 3300021441 Bacteria 1453
505 Ga0224570_105443 3300022730 Bacteria 774
506 Ga0209563_104166 3300025230 Bacteria 2814
507 Ga0209677_101183 3300025253 Bacteria 11970
508 Ga0209677_126603 3300025253 Bacteria 616
509 Ga0209148_1014592 3300025254 Bacteria 1386
510 Ga0209148_1035414 3300025254 Bacteria 718
511 Ga0209233_1002172 3300025261 Bacteria 7348
512 Ga0209233_1014836 3300025261 Bacteria 2184
513 Ga0207666_1076584 3300025271 Bacteria 540
514 Ga0209455_1005408 3300025272 Bacteria 3951
515 Ga0209758_1002105 3300025297 Bacteria 21114
516 Ga0209758_1011397 3300025297 Bacteria 5155
517 Ga0209758_1011463 3300025297 Bacteria 5131
518 Ga0207697_10095122 3300025315 Bacteria 1265
519 Ga0207697_10383970 3300025315 Bacteria 624
520 Ga0207656_10012398 3300025321 Bacteria 3239
521 Ga0207692_10002007 3300025898 Bacteria 7770
522 Ga0207692_10062420 3300025898 Bacteria 1934
523 Ga0207692_10129499 3300025898 Bacteria 1423
524 Ga0207692_10214961 3300025898 Bacteria 1137
525 Ga0207692_10269141 3300025898 Bacteria 1027
526 Ga0207692_10292578 3300025898 Bacteria 989
527 Ga0207692_10874660 3300025898 Bacteria 590
528 Ga0207642_10250547 3300025899 Bacteria 1005
529 Ga0207710_10011777 3300025900 Bacteria 3678
530 Ga0207710_10137033 3300025900 Bacteria 1179
531 Ga0207710_10192100 3300025900 Bacteria 1005
532 Ga0207688_10393371 3300025901 Bacteria 859
533 Ga0207688_10599482 3300025901 Bacteria 694
534 Ga0207680_11050146 3300025903 Bacteria 583
535 Ga0207647_10087783 3300025904 Bacteria 1857
536 Ga0207685_10069066 3300025905 Bacteria 1426
537 Ga0207685_10092936 3300025905 Bacteria 1274
538 Ga0207699_10002233 3300025906 Bacteria 9138
539 Ga0207699_10024823 3300025906 Bacteria 3283
540 Ga0207699_10107078 3300025906 Bacteria 1785
541 Ga0207699_10125076 3300025906 Bacteria 1668
542 Ga0207699_10264414 3300025906 Bacteria 1190
543 Ga0207699_10543321 3300025906 Bacteria 842
544 Ga0207699_10691817 3300025906 Bacteria 746
545 Ga0207645_10075012 3300025907 Bacteria 2165
546 Ga0207645_10727170 3300025907 Bacteria 675
547 Ga0207643_10101240 3300025908 Bacteria 1690
548 Ga0207643_10135766 3300025908 Bacteria 1466
549 Ga0207705_10127476 3300025909 Bacteria 1892
550 Ga0207705_10215223 3300025909 Bacteria 1458
551 Ga0207684_10128732 3300025910 Bacteria 2173
552 Ga0207684_10740532 3300025910 Bacteria 833
553 Ga0207684_10948995 3300025910 Bacteria 721
554 Ga0207654_10090759 3300025911 Bacteria 1862
555 Ga0207654_10721163 3300025911 Bacteria 717
556 Ga0207654_11421404 3300025911 Bacteria 506
557 Ga0207707_10006493 3300025912 Bacteria 10212
558 Ga0207707_10116161 3300025912 Bacteria 2338
559 Ga0207707_10158160 3300025912 Bacteria 1981
560 Ga0207707_10336641 3300025912 Bacteria 1301
561 Ga0207695_10001299 3300025913 Bacteria 42408
562 Ga0207695_10086044 3300025913 Bacteria 3171
563 Ga0207695_10090236 3300025913 Bacteria 3080
564 Ga0207695_10161353 3300025913 Bacteria 2173
565 Ga0207695_10228138 3300025913 Bacteria 1768
566 Ga0207695_10596445 3300025913 Bacteria 986
567 Ga0207695_10853344 3300025913 Bacteria 791
568 Ga0207695_11147792 3300025913 Bacteria 657
569 Ga0207695_11172626 3300025913 Bacteria 648
570 Ga0207671_10044178 3300025914 Bacteria 3295
571 Ga0207671_10083902 3300025914 Bacteria 2392
572 Ga0207671_10154578 3300025914 Bacteria 1774
573 Ga0207671_10217149 3300025914 Bacteria 1497
574 Ga0207671_10503011 3300025914 Bacteria 966
575 Ga0207671_10642607 3300025914 Bacteria 845
576 Ga0207671_11053644 3300025914 Bacteria 640
577 Ga0207693_10005604 3300025915 Bacteria 10440
578 Ga0207693_10042357 3300025915 Bacteria 3584
579 Ga0207693_10085535 3300025915 Bacteria 2470
580 Ga0207693_10127830 3300025915 Bacteria 1998
581 Ga0207693_10185023 3300025915 Bacteria 1640
582 Ga0207693_10801212 3300025915 Bacteria 726
583 Ga0207663_10000136 3300025916 Bacteria 34085
584 Ga0207663_10041045 3300025916 Bacteria 2817
585 Ga0207663_10286479 3300025916 Bacteria 1226
586 Ga0207663_10341782 3300025916 Bacteria 1131
587 Ga0207663_10430954 3300025916 Bacteria 1014
588 Ga0207663_11707686 3300025916 Bacteria 506
589 Ga0207660_10115735 3300025917 Bacteria 2024
590 Ga0207660_10134207 3300025917 Bacteria 1887
591 Ga0207660_10203717 3300025917 Bacteria 1546
592 Ga0207660_10208403 3300025917 Bacteria 1530
593 Ga0207660_10607039 3300025917 Bacteria 891
594 Ga0207662_10786502 3300025918 Bacteria 670
595 Ga0207657_10016940 3300025919 Bacteria 7011
596 Ga0207657_10105232 3300025919 Bacteria 2336
597 Ga0207657_10218778 3300025919 Bacteria 1526
598 Ga0207652_10017419 3300025921 Bacteria 5879
599 Ga0207652_10222982 3300025921 Bacteria 1699
600 Ga0207652_10229710 3300025921 Bacteria 1672
601 Ga0207652_10992972 3300025921 Bacteria 738
602 Ga0207652_11281640 3300025921 Bacteria 635
603 Ga0207681_10413143 3300025923 Bacteria 1092
604 Ga0207681_10512593 3300025923 Bacteria 983
605 Ga0207694_10000131 3300025924 Bacteria 76343
606 Ga0207694_10056928 3300025924 Bacteria 3038
607 Ga0207694_10089914 3300025924 Bacteria 2422
608 Ga0207694_10127899 3300025924 Bacteria 2034
609 Ga0207694_11271848 3300025924 Bacteria 622
610 Ga0207650_10376305 3300025925 Bacteria 1172
611 Ga0207659_10966195 3300025926 Bacteria 733
612 Ga0207659_11080948 3300025926 Bacteria 690
613 Ga0207659_11082834 3300025926 Bacteria 690
614 Ga0207687_10170480 3300025927 Bacteria 1678
615 Ga0207687_10572476 3300025927 Bacteria 949
616 Ga0207687_10738762 3300025927 Bacteria 837
617 Ga0207687_11682122 3300025927 Bacteria 544
618 Ga0207687_11814114 3300025927 Bacteria 522
619 Ga0207700_10019504 3300025928 Bacteria 4580
620 Ga0207700_10044976 3300025928 Bacteria 3254
621 Ga0207700_10064226 3300025928 Bacteria 2795
622 Ga0207700_10244234 3300025928 Bacteria 1531
623 Ga0207700_10308406 3300025928 Bacteria 1368
624 Ga0207700_10536989 3300025928 Bacteria 1037
625 Ga0207700_10646838 3300025928 Bacteria 942
626 Ga0207664_10040605 3300025929 Bacteria 3620
627 Ga0207664_10161604 3300025929 Bacteria 1911
628 Ga0207664_10163572 3300025929 Bacteria 1900
629 Ga0207664_10179136 3300025929 Bacteria 1819
630 Ga0207664_10240143 3300025929 Bacteria 1577
631 Ga0207664_10413338 3300025929 Bacteria 1201
632 Ga0207664_11259880 3300025929 Bacteria 658
633 Ga0207644_10544116 3300025931 Bacteria 961
634 Ga0207644_10597653 3300025931 Bacteria 916
635 Ga0207690_10341449 3300025932 Bacteria 1182
636 Ga0207690_10344356 3300025932 Bacteria 1177
637 Ga0207706_10191515 3300025933 Bacteria 1795
638 Ga0207706_10260895 3300025933 Bacteria 1513
639 Ga0207706_10384613 3300025933 Bacteria 1217
640 Ga0207706_11135438 3300025933 Bacteria 652
641 Ga0207706_11262928 3300025933 Bacteria 611
642 Ga0207709_10285175 3300025935 Bacteria 1221
643 Ga0207709_10545443 3300025935 Bacteria 911
644 Ga0207709_10646333 3300025935 Bacteria 842
645 Ga0207709_10923212 3300025935 Bacteria 710
646 Ga0207709_11104650 3300025935 Bacteria 651
647 Ga0207709_11686995 3300025935 Bacteria 527
648 Ga0207670_10369137 3300025936 Bacteria 1140
649 Ga0207669_10029295 3300025937 Bacteria 3042
650 Ga0207669_10557795 3300025937 Bacteria 925
651 Ga0207704_11166233 3300025938 Bacteria 656
652 Ga0207665_10003171 3300025939 Bacteria 11017
653 Ga0207665_10082081 3300025939 Bacteria 2221
654 Ga0207665_10435712 3300025939 Bacteria 1003
655 Ga0207665_10483197 3300025939 Bacteria 955
656 Ga0207665_10725983 3300025939 Bacteria 782
657 Ga0207665_10911030 3300025939 Bacteria 698
658 Ga0207665_11467003 3300025939 Bacteria 542
659 Ga0207691_10131807 3300025940 Bacteria 2207
660 Ga0207691_10241472 3300025940 Bacteria 1561
661 Ga0207691_10756432 3300025940 Bacteria 818
662 Ga0207691_11292630 3300025940 Bacteria 603
663 Ga0207711_10290933 3300025941 Bacteria 1506
664 Ga0207711_10309354 3300025941 Bacteria 1459
665 Ga0207711_10384237 3300025941 Bacteria 1303
666 Ga0207711_11619265 3300025941 Bacteria 591
667 Ga0207689_10118294 3300025942 Bacteria 2179
668 Ga0207689_11713111 3300025942 Bacteria 521
669 Ga0207661_10003939 3300025944 Bacteria 10368
670 Ga0207661_10131723 3300025944 Bacteria 2142
671 Ga0207661_10157752 3300025944 Bacteria 1967
672 Ga0207661_10257895 3300025944 Bacteria 1552
673 Ga0207679_10087005 3300025945 Bacteria 2405
674 Ga0207679_11252738 3300025945 Bacteria 681
675 Ga0207679_11613808 3300025945 Bacteria 594
676 Ga0207667_10077674 3300025949 Bacteria 3442
677 Ga0207667_10091938 3300025949 Bacteria 3134
678 Ga0207667_10134297 3300025949 Bacteria 2548
679 Ga0207667_10154984 3300025949 Bacteria 2357
680 Ga0207667_10225581 3300025949 Bacteria 1919
681 Ga0207667_10272462 3300025949 Bacteria 1730
682 Ga0207667_11074115 3300025949 Bacteria 789
683 Ga0207667_11894950 3300025949 Bacteria 558
684 Ga0207651_10125168 3300025960 Bacteria 1957
685 Ga0207651_11109452 3300025960 Bacteria 709
686 Ga0207651_11166438 3300025960 Bacteria 691
687 Ga0207712_10057243 3300025961 Bacteria 2750
688 Ga0207712_10388714 3300025961 Bacteria 1170
689 Ga0207712_10884699 3300025961 Bacteria 789
690 Ga0207712_11914681 3300025961 Bacteria 531
691 Ga0207668_10013333 3300025972 Bacteria 5057
692 Ga0207668_10047708 3300025972 Bacteria 2934
693 Ga0207668_10085181 3300025972 Bacteria 2305
694 Ga0207668_10374965 3300025972 Bacteria 1196
695 Ga0207668_10528439 3300025972 Bacteria 1019
696 Ga0207668_10636147 3300025972 Bacteria 932
697 Ga0207668_10927951 3300025972 Bacteria 776
698 Ga0207668_11147218 3300025972 Bacteria 697
699 Ga0207668_11497823 3300025972 Bacteria 609
700 Ga0207640_10298194 3300025981 Bacteria 1274
701 Ga0207640_10465812 3300025981 Bacteria 1045
702 Ga0207640_10531339 3300025981 Bacteria 985
703 Ga0207640_10545035 3300025981 Bacteria 974
704 Ga0207640_11227400 3300025981 Bacteria 667
705 Ga0207640_11274829 3300025981 Bacteria 655
706 Ga0207658_10193212 3300025986 Bacteria 1694
707 Ga0207658_10304636 3300025986 Bacteria 1374
708 Ga0207658_10981278 3300025986 Bacteria 770
709 Ga0207658_11079085 3300025986 Bacteria 733
710 Ga0207677_10015130 3300026023 Bacteria 4527
711 Ga0207677_10063701 3300026023 Bacteria 2564
712 Ga0207703_10097777 3300026035 Bacteria 2481
713 Ga0207703_10209413 3300026035 Bacteria 1737
714 Ga0207703_10251105 3300026035 Bacteria 1594
715 Ga0207703_10775852 3300026035 Bacteria 914
716 Ga0207703_11406455 3300026035 Bacteria 671
717 Ga0207639_10022677 3300026041 Bacteria 4524
718 Ga0207639_10071933 3300026041 Bacteria 2707
719 Ga0207639_10084661 3300026041 Bacteria 2519
720 Ga0207639_10581839 3300026041 Bacteria 1031
721 Ga0207639_10694494 3300026041 Bacteria 944
722 Ga0207639_12187392 3300026041 Bacteria 514
723 Ga0207678_10155088 3300026067 Bacteria 1955
724 Ga0207678_10162209 3300026067 Bacteria 1909
725 Ga0207678_10253588 3300026067 Bacteria 1507
726 Ga0207678_10674527 3300026067 Bacteria 909
727 Ga0207678_11362880 3300026067 Bacteria 627
728 Ga0207678_11861889 3300026067 Bacteria 526
729 Ga0207708_10052763 3300026075 Bacteria 3097
730 Ga0207708_11470586 3300026075 Bacteria 598
731 Ga0207702_10000005 3300026078 Bacteria 420296
732 Ga0207702_10018516 3300026078 Bacteria 5762
733 Ga0207702_10205301 3300026078 Bacteria 1829
734 Ga0207702_10360799 3300026078 Bacteria 1393
735 Ga0207702_11188008 3300026078 Bacteria 757
736 Ga0207702_12203316 3300026078 Bacteria 540
737 Ga0207641_10437414 3300026088 Bacteria 1262
738 Ga0207641_10638346 3300026088 Bacteria 1045
739 Ga0207641_10733058 3300026088 Bacteria 975
740 Ga0207648_10164176 3300026089 Bacteria 1962
741 Ga0207648_11033849 3300026089 Bacteria 770
742 Ga0207648_11041264 3300026089 Bacteria 767
743 Ga0207648_11795369 3300026089 Bacteria 575
744 Ga0207676_10466374 3300026095 Bacteria 1193
745 Ga0207676_10788454 3300026095 Bacteria 926
746 Ga0207676_12228019 3300026095 Bacteria 546
747 Ga0207674_10028556 3300026116 Bacteria 5886
748 Ga0207674_10090864 3300026116 Bacteria 3044
749 Ga0207674_10170416 3300026116 Bacteria 2130
750 Ga0207674_10348816 3300026116 Bacteria 1431
751 Ga0207675_100096830 3300026118 Bacteria 2778
752 Ga0207675_100174781 3300026118 Bacteria 2054
753 Ga0207675_100195761 3300026118 Bacteria 1940
754 Ga0207683_10095129 3300026121 Bacteria 2656
755 Ga0207683_10099596 3300026121 Bacteria 2594
756 Ga0207683_10124581 3300026121 Bacteria 2315
757 Ga0207683_10406819 3300026121 Bacteria 1252
758 Ga0207683_10833926 3300026121 Bacteria 856
759 Ga0207683_11229216 3300026121 Bacteria 694
760 Ga0207698_10055219 3300026142 Bacteria 3059
761 Ga0207698_11153787 3300026142 Bacteria 788
762 Ga0207698_11299061 3300026142 Bacteria 742
763 Ga0207698_11767886 3300026142 Bacteria 633
764 Ga0207698_11875379 3300026142 Bacteria 614
765 Ga0209589_1000018 3300027357 Bacteria 192614
766 Ga0209489_100026 3300027361 Bacteria 192614
767 Ga0209700_100035 3300027363 Bacteria 192614
768 Ga0209179_1059022 3300027512 Bacteria 831
769 Ga0209179_1127771 3300027512 Bacteria 568
770 Ga0209588_1018157 3300027671 Bacteria 2189
771 Ga0209588_1150638 3300027671 Bacteria 737
772 Ga0209813_10242785 3300027866 Bacteria 682
773 Ga0207428_10545785 3300027907 Bacteria 839
774 Ga0268266_10061797 3300028379 Bacteria 3230
775 Ga0268266_10073425 3300028379 Bacteria 2968
776 Ga0268266_10074719 3300028379 Bacteria 2943
777 Ga0268266_10129418 3300028379 Bacteria 2256
778 Ga0268266_10432944 3300028379 Bacteria 1248
779 Ga0268266_10512564 3300028379 Bacteria 1146
780 Ga0268265_10218062 3300028380 Bacteria 1667
781 Ga0268265_10319468 3300028380 Bacteria 1405
782 Ga0268265_10709541 3300028380 Bacteria 972
783 Ga0268265_11389090 3300028380 Bacteria 704
784 Ga0268265_11437857 3300028380 Bacteria 692
785 Ga0268265_12565431 3300028380 Bacteria 515
786 Ga0268264_10000096 3300028381 Bacteria 230188
787 Ga0268264_10654995 3300028381 Bacteria 1040
788 Ga0268264_10666017 3300028381 Bacteria 1031
789 Ga0268264_10785903 3300028381 Bacteria 950
790 Ga0265334_10011607 3300028573 Bacteria 3706
791 Ga0307517_10000049 3300028786 Bacteria 160368
792 Ga0307517_10497589 3300028786 Bacteria 621
793 Ga0307515_10389190 3300028794 Bacteria 1024
794 Ga0307515_10414782 3300028794 Bacteria 968
795 Ga0307515_10583891 3300028794 Bacteria 727
796 Ga0307515_10779836 3300028794 Bacteria 577
797 Ga0265338_10774896 3300028800 Bacteria 658
798 Ga0307511_10198086 3300030521 Bacteria 1048
799 Ga0265763_1030814 3300030763 Bacteria 609
800 Ga0265330_10003983 3300031235 Bacteria 7578
801 Ga0265330_10076540 3300031235 Bacteria 1444
802 Ga0265330_10104976 3300031235 Bacteria 1208
803 Ga0265330_10128906 3300031235 Bacteria 1077
804 Ga0265332_10093032 3300031238 Bacteria 1274
805 Ga0265325_10265263 3300031241 Bacteria 774
806 Ga0265340_10012561 3300031247 Bacteria 4471
807 Ga0265340_10017348 3300031247 Bacteria 3723
808 Ga0265339_10008611 3300031249 Bacteria 6478
809 Ga0265339_10070095 3300031249 Bacteria 1870
810 Ga0265339_10517743 3300031249 Bacteria 550
811 Ga0265331_10162904 3300031250 Bacteria 1011
812 Ga0265316_10537539 3300031344 Bacteria 833
813 Ga0265316_10826260 3300031344 Bacteria 649
814 Ga0265316_11009934 3300031344 Bacteria 579
815 Ga0307513_10088523 3300031456 Bacteria 3164
816 Ga0307513_10155863 3300031456 Bacteria 2184
817 Ga0307513_10841173 3300031456 Bacteria 624
818 Ga0307513_10882819 3300031456 Bacteria 601
819 Ga0307509_10587857 3300031507 Bacteria 787
820 Ga0307509_10613045 3300031507 Bacteria 760
821 Ga0307509_10679025 3300031507 Bacteria 697
822 Ga0307408_100199014 3300031548 Bacteria 1620
823 Ga0307408_100940495 3300031548 Bacteria 793
824 Ga0307508_10000731 3300031616 Bacteria 38975
825 Ga0307508_10054710 3300031616 Bacteria 3537
826 Ga0307508_10072072 3300031616 Bacteria 3028
827 Ga0307508_10151659 3300031616 Bacteria 1922
828 Ga0307514_10307685 3300031649 Bacteria 882
829 Ga0265314_10013390 3300031711 Bacteria 6627
830 Ga0265314_10408282 3300031711 Bacteria 733
831 Ga0265342_10292805 3300031712 Bacteria 859
832 Ga0265342_10450628 3300031712 Bacteria 660
833 Ga0307516_10018018 3300031730 Bacteria 7347
834 Ga0307516_10118652 3300031730 Bacteria 2439
835 Ga0307516_10269504 3300031730 Bacteria 1389
836 Ga0307516_10280878 3300031730 Bacteria 1347
837 Ga0307516_10501689 3300031730 Bacteria 868
838 Ga0307516_10501846 3300031730 Bacteria 868
839 Ga0307405_10815430 3300031731 Bacteria 783
840 Ga0307413_10547331 3300031824 Bacteria 938
841 Ga0307410_11193499 3300031852 Bacteria 663
842 Ga0307406_10974300 3300031901 Bacteria 726
843 Ga0307406_11215635 3300031901 Bacteria 655
844 Ga0307412_10424043 3300031911 Bacteria 1089
845 Ga0307412_10761035 3300031911 Bacteria 837
846 Ga0307411_10043403 3300032005 Bacteria 2876
847 Ga0307411_11526294 3300032005 Bacteria 614
848 Ga0307415_100233697 3300032126 Bacteria 1482
849 Ga0307415_101409146 3300032126 Bacteria 664
850 Ga0307510_10024603 3300033180 Bacteria 6955
851 Ga0307510_10029438 3300033180 Bacteria 6251
852 Ga0307510_10059937 3300033180 Bacteria 3923
853 Ga0307510_10205350 3300033180 Bacteria 1499
854 Ga0315911_1000011 3300033442 Bacteria 264678
855 Ga0316214_1029407 3300033545 Bacteria 779
856 Ga0316212_1031585 3300033547 Bacteria 745
857 Ga0373950_0116448 3300034818 Bacteria 588
858 Ga0373926_0005959 3300035083 Bacteria 4034
859 Ga0373926_0380901 3300035083 Bacteria 556
860 Ga0373929_0006593 3300035085 Bacteria 2101
861 Ga0373934_0010297 3300035086 Bacteria 3510
862 Ga0373934_0029548 3300035086 Bacteria 2141
863 Ga0373940_0156661 3300035088 Bacteria 729
864 Ga0373944_0040097 3300035089 Bacteria 1444
865 Ga0373944_0199167 3300035089 Bacteria 724
866 Ga0373949_0132794 3300035090 Bacteria 708
867 Ga0373951_0104252 3300035091 Bacteria 757
868 Ga0373923_0020587 3300035111 Bacteria 2564
869 Ga0373923_0051471 3300035111 Bacteria 1728
870 Ga0373932_0007201 3300035112 Bacteria 2644
871 Ga0373932_0203447 3300035112 Bacteria 705
872 Ga0373936_0004101 3300035113 Bacteria 5486
873 Ga0373936_0013140 3300035113 Bacteria 3158
874 Ga0373936_0032185 3300035113 Bacteria 2073
875 Ga0373936_0087161 3300035113 Bacteria 1305
876 Ga0373936_0104690 3300035113 Bacteria 1197
877 Ga0373939_0027867 3300035114 Bacteria 1604
878 Ga0373941_0271671 3300035115 Bacteria 668
879 Ga0373941_0298140 3300035115 Bacteria 643
880 Ga0373945_0021976 3300035116 Bacteria 2195
881 Ga0373945_0106499 3300035116 Bacteria 1103
882 Ga0373945_0325368 3300035116 Bacteria 663
883 Ga0373953_0002102 3300035117 Bacteria 5944
884 Ga0373953_0032224 3300035117 Bacteria 2043
885 Ga0373953_0049200 3300035117 Bacteria 1700
886 Ga0373954_0003682 3300035118 Bacteria 6528
887 Ga0373954_0003903 3300035118 Bacteria 6380
888 Ga0373954_0064964 3300035118 Bacteria 1726
889 Ga0373954_0179576 3300035118 Bacteria 1038
890 Ga0373956_0087005 3300035119 Bacteria 1438
891 Ga0373956_0192506 3300035119 Bacteria 966
892 Ga0373957_0050529 3300035120 Bacteria 1589
893 Ga0373957_0270436 3300035120 Bacteria 717
894 Ga0373960_0140826 3300035121 Bacteria 817
895 Ga0373943_0013515 3300035170 Bacteria 3688
896 Ga0373943_0019155 3300035170 Bacteria 3147
897 Ga0373943_0159136 3300035170 Bacteria 1228
898 Ga0373946_0007469 3300035171 Bacteria 3996
899 Ga0373946_0019231 3300035171 Bacteria 2631
900 Ga0373946_0033987 3300035171 Bacteria 2056
901 Ga0373946_0237641 3300035171 Bacteria 885
902 Ga0373946_0500378 3300035171 Bacteria 623
903 Ga0373955_0002813 3300035172 Bacteria 7643
904 Ga0373955_0004594 3300035172 Bacteria 6118
905 Ga0373955_0031043 3300035172 Bacteria 2796
906 Ga0373955_0066668 3300035172 Bacteria 2001
907 Ga0373955_0401979 3300035172 Bacteria 832
908 Ga0373942_0383683 3300035207 Bacteria 502
909 Ga0373962_0059436 3300035242 Bacteria 1120
910 Ga0373962_0115549 3300035242 Bacteria 851
911 Ga0373924_0008710 3300035410 Bacteria 3697
912 Ga0373924_0038459 3300035410 Bacteria 1952
913 Ga0373924_0102591 3300035410 Bacteria 1231
914 Ga0373924_0116917 3300035410 Bacteria 1155
915 Ga0373931_0010082 3300035691 Bacteria 4531
916 Ga0373931_0107836 3300035691 Bacteria 1576
917 Ga0373931_0125247 3300035691 Bacteria 1473
918 Ga0373931_0210435 3300035691 Bacteria 1166
919 Ga0373931_0570184 3300035691 Bacteria 737
920 Ga0373935_0033366 3300035692 Bacteria 3202
921 Ga0373935_0070809 3300035692 Bacteria 2248
922 Ga0373935_0095773 3300035692 Bacteria 1950
923 Ga0373935_0174430 3300035692 Bacteria 1472
924 Ga0373935_0261731 3300035692 Bacteria 1213
925 Ga0373927_0002864 3300035695 Bacteria 12558
926 Ga0373927_0003673 3300035695 Bacteria 10929
927 Ga0373927_0010232 3300035695 Bacteria 6265
928 Ga0373927_0010787 3300035695 Bacteria 6087
929 Ga0373927_0027325 3300035695 Bacteria 3726
930 Ga0373927_0065850 3300035695 Bacteria 2343
931 Ga0373927_0115311 3300035695 Bacteria 1751
932 Ga0373927_1007703 3300035695 Bacteria 549
933 Ga0373933_0000466 3300035724 Bacteria 25296
934 Ga0373933_0216019 3300035724 Bacteria 1229
935 Ga0373933_0339166 3300035724 Bacteria 975
936 Ga0373933_0354758 3300035724 Bacteria 953
937 Ga0373933_0631550 3300035724 Bacteria 704
938 Ga0373947_0014032 3300035725 Bacteria 4593
939 Ga0373947_0021300 3300035725 Bacteria 3751
940 Ga0373947_0066819 3300035725 Bacteria 2195
941 Ga0373947_0889459 3300035725 Bacteria 608
942 Ga0373937_0158941 3300036401 Bacteria 2118
943 Ga0373937_0851548 3300036401 Bacteria 860
944 Ga0373937_1025702 3300036401 Bacteria 774
945 Ga0373937_1376277 3300036401 Bacteria 653
946 Ga0373937_1798487 3300036401 Bacteria 559
947 Ga0373925_0012681 3300037068 Bacteria 6104
948 Ga0373925_0021354 3300037068 Bacteria 4716
949 Ga0373925_0027352 3300037068 Bacteria 4175
950 Ga0373925_0066476 3300037068 Bacteria 2718
951 Ga0373925_0077878 3300037068 Bacteria 2517
952 Ga0373925_0232102 3300037068 Bacteria 1476
953 Ga0373925_0271728 3300037068 Bacteria 1364
954 Ga0373925_0411782 3300037068 Bacteria 1103
955 Ga0373925_0520156 3300037068 Bacteria 978
956 Ga0395899_0502013 3300037312 Bacteria 787
957 Ga0395900_0092192 3300037418 Bacteria 3113
958 Ga0395900_0398077 3300037418 Bacteria 1342
959 Ga0395900_0865802 3300037418 Bacteria 828
960 Ga0395900_0955183 3300037418 Bacteria 778
961 Ga0395898_0174963 3300037466 Bacteria 2052
962 Ga0395905_0135856 3300037471 Bacteria 2313
963 Ga0395905_0384353 3300037471 Bacteria 1298
964 Ga0395905_0622403 3300037471 Bacteria 981
965 Ga0395905_1322460 3300037471 Bacteria 625
966 Ga0436364_0367164 3300037853 Bacteria 1285
967 Ga0436364_0570855 3300037853 Bacteria 5958
968 Ga0436364_0710321 3300037853 Bacteria 510
969 Ga0395901_0282898 3300038443 Bacteria 1723
970 Ga0395901_0310793 3300038443 Bacteria 1632
971 Ga0395901_0400732 3300038443 Bacteria 1410
972 Ga0436365_0063216 3300039437 Bacteria 2823
973 Ga0436365_0341884 3300039437 Bacteria 1264
974 Ga0436365_0521739 3300039437 Bacteria 1444
975 Ga0436365_0986223 3300039437 Bacteria 1324
976 Ga0436365_1184573 3300039437 Bacteria 1055
977 Ga0436365_1331614 3300039437 Bacteria 11360
978 Ga0436365_1546547 3300039437 Bacteria 4902
979 Ga0436365_1592603 3300039437 Bacteria 982
980 Ga0436365_1707337 3300039437 Bacteria 2912
981 Ga0436360_0142267 3300039438 Bacteria 1069
982 Ga0436360_0745328 3300039438 Bacteria 2378
983 Ga0436360_1338677 3300039438 Bacteria 1229
984 Ga0436361_0236119 3300039447 Bacteria 1245
985 Ga0436361_0437201 3300039447 Bacteria 2404
986 Ga0436361_0889836 3300039447 Bacteria 2600
987 Ga0436361_0906525 3300039447 Bacteria 859
988 Ga0436361_0993311 3300039447 Bacteria 2334
989 Ga0436363_0239993 3300039450 Bacteria 1088
990 Ga0436363_0564280 3300039450 Bacteria 3272
991 Ga0436363_1076737 3300039450 Bacteria 637
992 Ga0436363_1285406 3300039450 Bacteria 943
993 Ga0436363_1431327 3300039450 Bacteria 838
994 Ga0436363_1567451 3300039450 Bacteria 553
995 Ga0436363_1586010 3300039450 Bacteria 796
996 Ga0436363_1718188 3300039450 Bacteria 2982
997 Ga0436362_0127034 3300039453 Bacteria 3918
998 Ga0436362_0635133 3300039453 Bacteria 611
999 Ga0436362_1052023 3300039453 Bacteria 1086
1000 Ga0439461_0126632 3300041410 Bacteria 643
1001 Ga0439465_0292946 3300041413 Bacteria 608
1002 Ga0451787_685306 3300041441 Bacteria 679
1003 Ga0451791_0302238 3300041451 Bacteria 586
1004 Ga0451793_1902718 3300041452 Bacteria 546
1005 Ga0451797_0178116 3300041453 Bacteria 636
1006 Ga0451798_0525704 3300041458 Bacteria 714
1007 Ga0451798_0766331 3300041458 Bacteria 632
1008 Ga0451806_573896 3300041462 Bacteria 651
1009 Ga0451804_0932924 3300041463 Bacteria 591
1010 Ga0451837_0039678 3300041494 Bacteria 659
1011 Ga0451839_0744572 3300041496 Bacteria 891
1012 Ga0451849_0110876 3300041505 Bacteria 722
1013 Ga0451853_1409169 3300041512 Bacteria 528
1014 Ga0439442_161171 3300042002 Bacteria 502
1015 Ga0439455_0066730 3300042012 Bacteria 962
1016 Ga0439440_0036338 3300042993 Bacteria 1185
1017 Ga0466969_0203686 3300044656 Bacteria 902
1018 Ga0466969_0493348 3300044656 Bacteria 559
1019 Ga0466965_0209519 3300044683 Bacteria 1036
1020 Ga0466966_0355105 3300044684 Bacteria 881
1021 Ga0466966_0947857 3300044684 Bacteria 519
1022 Ga0466961_0050554 3300044693 Bacteria 2655
1023 Ga0466963_0066871 3300044694 Bacteria 2411
1024 Ga0466963_0192978 3300044694 Bacteria 1423
1025 Ga0466963_0460604 3300044694 Bacteria 897
1026 Ga0466964_0177002 3300044706 Bacteria 1009
1027 Ga0466964_0184585 3300044706 Bacteria 991
1028 Ga0466964_0473245 3300044706 Bacteria 668
1029 Ga0466971_0096053 3300044719 Bacteria 1359
1030 Ga0466968_0249357 3300044735 Bacteria 843
1031 Ga0466968_0302093 3300044735 Bacteria 770
1032 Ga0466968_0517622 3300044735 Bacteria 596
1033 Ga0466970_0212186 3300044765 Bacteria 1079
1034 Ga0466957_0100830 3300044842 Bacteria 1820
1035 Ga0466957_0100932 3300044842 Bacteria 1819
1036 Ga0466957_0135927 3300044842 Bacteria 1580
1037 Ga0466957_1002090 3300044842 Bacteria 600
1038 Ga0466959_0077576 3300045049 Bacteria 2397
1039 Ga0466959_0122873 3300045049 Bacteria 1844
1040 Ga0466959_0368600 3300045049 Bacteria 978
1041 Ga0466959_0374067 3300045049 Bacteria 970
1042 Ga0466959_0615049 3300045049 Bacteria 730
1043 Ga0466958_0497578 3300045836 Bacteria 791
1044 Ga0466967_0058260 3300045976 Bacteria 3414
1045 Ga0466967_0518670 3300045976 Bacteria 1171
1046 Ga0466967_0895125 3300045976 Bacteria 882
1047 Ga0466967_1121943 3300045976 Bacteria 784
1048 Ga0466967_1221002 3300045976 Bacteria 749
1049 Ga0495617_014228 3300046452 Bacteria 2705
1050 Ga0495592_0014958 3300046454 Bacteria 5892
1051 Ga0495592_0043583 3300046454 Bacteria 3356
1052 Ga0495592_0065311 3300046454 Bacteria 2664
1053 Ga0495592_0091605 3300046454 Bacteria 2180
1054 Ga0495592_0368385 3300046454 Bacteria 917
1055 Ga0495603_0009404 3300046455 Bacteria 5906
1056 Ga0495603_0014373 3300046455 Bacteria 4788
1057 Ga0495603_0014979 3300046455 Bacteria 4688
1058 Ga0495603_0016796 3300046455 Bacteria 4428
1059 Ga0495603_0042944 3300046455 Bacteria 2701
1060 Ga0495603_0113512 3300046455 Bacteria 1580
1061 Ga0495603_0189645 3300046455 Bacteria 1189
1062 Ga0495603_0269844 3300046455 Bacteria 979
1063 Ga0495590_0091217 3300046457 Bacteria 1078
1064 Ga0495590_0242746 3300046457 Bacteria 669
1065 Ga0495629_0000613 3300046459 Bacteria 29030
1066 Ga0495629_0017830 3300046459 Bacteria 5089
1067 Ga0495629_0040867 3300046459 Bacteria 3263
1068 Ga0495629_0111404 3300046459 Bacteria 1908
1069 Ga0495629_0111418 3300046459 Bacteria 1908
1070 Ga0495629_0532630 3300046459 Bacteria 790
1071 Ga0495629_0771007 3300046459 Bacteria 636
1072 Ga0495638_0042575 3300046460 Bacteria 2867
1073 Ga0495638_0289831 3300046460 Bacteria 886
1074 Ga0495638_0328574 3300046460 Bacteria 815
1075 Ga0495641_0003482 3300046461 Bacteria 11741
1076 Ga0495641_0169821 3300046461 Bacteria 976
1077 Ga0495651_0032896 3300046462 Bacteria 4044
1078 Ga0495651_0162003 3300046462 Bacteria 1601
1079 Ga0495651_0173806 3300046462 Bacteria 1531
1080 Ga0495651_0339993 3300046462 Bacteria 995
1081 Ga0495651_0368488 3300046462 Bacteria 945
1082 Ga0495653_0018693 3300046463 Bacteria 5626
1083 Ga0495653_0101477 3300046463 Bacteria 2084
1084 Ga0495650_0192206 3300046471 Bacteria 713
1085 Ga0495580_0015760 3300046472 Bacteria 5693
1086 Ga0495580_0037287 3300046472 Bacteria 3490
1087 Ga0495580_0423702 3300046472 Bacteria 895
1088 Ga0495582_0000354 3300046473 Bacteria 25130
1089 Ga0495582_0029563 3300046473 Bacteria 3008
1090 Ga0495582_0049634 3300046473 Bacteria 2311
1091 Ga0495582_0057451 3300046473 Bacteria 2145
1092 Ga0495582_0216545 3300046473 Bacteria 1095
1093 Ga0495582_0774766 3300046473 Bacteria 555
1094 Ga0495605_0105093 3300046474 Bacteria 1293
1095 Ga0495605_0227067 3300046474 Bacteria 805
1096 Ga0495639_0000140 3300046475 Bacteria 37499
1097 Ga0495639_0049373 3300046475 Bacteria 1910
1098 Ga0495639_0244899 3300046475 Bacteria 885
1099 Ga0495639_0468958 3300046475 Bacteria 641
1100 Ga0495639_0604451 3300046475 Bacteria 564
1101 Ga0495662_0010658 3300046476 Bacteria 4496
1102 Ga0495662_0077201 3300046476 Bacteria 1618
1103 Ga0495662_0108703 3300046476 Bacteria 1358
1104 Ga0495664_0045438 3300046477 Bacteria 2605
1105 Ga0495664_0192392 3300046477 Bacteria 1236
1106 Ga0495664_0200726 3300046477 Bacteria 1208
1107 Ga0495664_0628833 3300046477 Bacteria 637
1108 Ga0495664_0955557 3300046477 Bacteria 500
1109 Ga0495584_0082641 3300046491 Bacteria 1617
1110 Ga0495584_0414117 3300046491 Bacteria 685
1111 Ga0495585_0098194 3300046492 Bacteria 1569
1112 Ga0495585_0137054 3300046492 Bacteria 1284
1113 Ga0495594_0000198 3300046499 Bacteria 29459
1114 Ga0495594_0174150 3300046499 Bacteria 1224
1115 Ga0495596_0178342 3300046500 Bacteria 826
1116 Ga0495606_0002687 3300046507 Bacteria 20107
1117 Ga0495606_0136669 3300046507 Bacteria 1451
1118 Ga0495606_0355431 3300046507 Bacteria 776
1119 Ga0495608_0105818 3300046511 Bacteria 1811
1120 Ga0495608_0151351 3300046511 Bacteria 1478
1121 Ga0495608_0580030 3300046511 Bacteria 674
1122 Ga0495610_0062565 3300046512 Bacteria 1765
1123 Ga0495610_0131844 3300046512 Bacteria 1084
1124 Ga0495610_0213145 3300046512 Bacteria 784
1125 Ga0495610_0222809 3300046512 Bacteria 761
1126 Ga0495616_0117900 3300046513 Bacteria 1228
1127 Ga0495616_0176797 3300046513 Bacteria 951
1128 Ga0495616_0203889 3300046513 Bacteria 868
1129 Ga0495618_0065533 3300046514 Bacteria 2309
1130 Ga0495618_0102863 3300046514 Bacteria 1828
1131 Ga0495618_0138628 3300046514 Bacteria 1556
1132 Ga0495618_0183687 3300046514 Bacteria 1328
1133 Ga0495618_0323491 3300046514 Bacteria 955
1134 Ga0495620_0140670 3300046515 Bacteria 944
1135 Ga0495628_0018107 3300046516 Bacteria 5842
1136 Ga0495628_0022236 3300046516 Bacteria 5211
1137 Ga0495628_0041672 3300046516 Bacteria 3665
1138 Ga0495628_0065353 3300046516 Bacteria 2846
1139 Ga0495630_0020468 3300046517 Bacteria 4879
1140 Ga0495630_0052250 3300046517 Bacteria 3059
1141 Ga0495630_0186619 3300046517 Bacteria 1582
1142 Ga0495631_0050891 3300046518 Bacteria 1811
1143 Ga0495631_0068928 3300046518 Bacteria 1530
1144 Ga0495631_0518398 3300046518 Bacteria 508
1145 Ga0495632_0166879 3300046519 Bacteria 1012
1146 Ga0495632_0241351 3300046519 Bacteria 812
1147 Ga0495643_0504646 3300046522 Bacteria 520
1148 Ga0495644_0421631 3300046523 Bacteria 529
1149 Ga0495648_0078089 3300046524 Bacteria 1894
1150 Ga0495648_0186538 3300046524 Bacteria 1050
1151 Ga0495663_0190439 3300046525 Bacteria 713
1152 Ga0495666_0018838 3300046526 Bacteria 3429
1153 Ga0495666_0112865 3300046526 Bacteria 1276
1154 Ga0495666_0115885 3300046526 Bacteria 1257
1155 Ga0495652_0032645 3300046529 Bacteria 4552
1156 Ga0495652_0049225 3300046529 Bacteria 3608
1157 Ga0495652_0203923 3300046529 Bacteria 1499
1158 Ga0495652_0208934 3300046529 Bacteria 1475
1159 Ga0495652_0708619 3300046529 Bacteria 677
1160 Ga0495665_0021456 3300046531 Bacteria 3469
1161 Ga0495665_0112957 3300046531 Bacteria 1424
1162 Ga0495640_0024235 3300046533 Bacteria 4415
1163 Ga0495640_0025557 3300046533 Bacteria 4281
1164 Ga0495640_0025627 3300046533 Bacteria 4273
1165 Ga0495640_0118037 3300046533 Bacteria 1727
1166 Ga0495640_0255291 3300046533 Bacteria 1097
1167 Ga0495640_0289683 3300046533 Bacteria 1018
1168 Ga0495586_0037796 3300046535 Bacteria 2592
1169 Ga0495586_0317554 3300046535 Bacteria 893
1170 Ga0495587_0035917 3300046536 Bacteria 2983
1171 Ga0495587_0059128 3300046536 Bacteria 2250
1172 Ga0495587_0200679 3300046536 Bacteria 1128
1173 Ga0495598_0113678 3300046537 Bacteria 910
1174 Ga0495609_0035099 3300046538 Bacteria 2271
1175 Ga0495597_0166257 3300046542 Bacteria 898
1176 Ga0495645_0163967 3300046543 Bacteria 1534
1177 Ga0495645_0264314 3300046543 Bacteria 1138
1178 Ga0495645_0689287 3300046543 Bacteria 621
1179 Ga0495645_0808773 3300046543 Bacteria 562
1180 Ga0495622_0016759 3300046557 Bacteria 3413
1181 Ga0495622_0163687 3300046557 Bacteria 1002
1182 Ga0495622_0224576 3300046557 Bacteria 831
1183 Ga0495667_0003356 3300046559 Bacteria 10715
1184 Ga0495667_0019293 3300046559 Bacteria 4601
1185 Ga0495667_0052675 3300046559 Bacteria 2680
1186 Ga0495667_0176474 3300046559 Bacteria 1372
1187 Ga0495667_0280803 3300046559 Bacteria 1057
1188 Ga0495656_0005814 3300046615 Bacteria 4285
1189 Ga0495656_0171849 3300046615 Bacteria 1060
1190 Ga0495668_0078445 3300046616 Bacteria 1813
1191 Ga0495668_0530980 3300046616 Bacteria 649
1192 Ga0495634_0004959 3300046642 Bacteria 10289
1193 Ga0495634_0011642 3300046642 Bacteria 6399
1194 Ga0495634_0042389 3300046642 Bacteria 3087
1195 Ga0495634_0246183 3300046642 Bacteria 1095
1196 Ga0495611_0200268 3300046648 Bacteria 931
1197 Ga0495625_0728227 3300046660 Bacteria 583
1198 Ga0495635_0003204 3300046663 Bacteria 11282
1199 Ga0495635_0123500 3300046663 Bacteria 1765
1200 Ga0495635_0124409 3300046663 Bacteria 1758
1201 Ga0495661_0183860 3300046665 Bacteria 1106
1202 Ga0495661_0422600 3300046665 Bacteria 645
1203 Ga0495588_0005521 3300046674 Bacteria 5631
1204 Ga0495588_0240579 3300046674 Bacteria 955
1205 Ga0495588_0290350 3300046674 Bacteria 862
1206 Ga0495657_0016048 3300046675 Bacteria 5463
1207 Ga0495657_0063091 3300046675 Bacteria 2445
1208 Ga0495599_0004470 3300046678 Bacteria 8285
1209 Ga0495599_0038853 3300046678 Bacteria 2991
1210 Ga0495599_0052626 3300046678 Bacteria 2551
1211 Ga0495599_0236615 3300046678 Bacteria 1114
1212 Ga0495623_0101004 3300046679 Bacteria 1757
1213 Ga0495623_0116121 3300046679 Bacteria 1617
1214 Ga0495623_0142086 3300046679 Bacteria 1426
1215 Ga0495646_0012855 3300046680 Bacteria 5322
1216 Ga0495646_0018662 3300046680 Bacteria 4393
1217 Ga0495646_0023205 3300046680 Bacteria 3906
1218 Ga0495647_0024985 3300046681 Bacteria 2179
1219 Ga0495647_0035229 3300046681 Bacteria 1878
1220 Ga0495647_0106711 3300046681 Bacteria 1165
1221 Ga0495658_0000888 3300046683 Bacteria 16070
1222 Ga0495658_0024311 3300046683 Bacteria 3225
1223 Ga0495658_0242565 3300046683 Bacteria 1132
1224 Ga0495658_0259464 3300046683 Bacteria 1094
1225 Ga0495669_0011937 3300046684 Bacteria 3695
1226 Ga0495669_0016724 3300046684 Bacteria 3145
1227 Ga0495669_0516119 3300046684 Bacteria 581
1228 Ga0495669_0591347 3300046684 Bacteria 540
1229 Ga0495669_0626707 3300046684 Bacteria 523
1230 Ga0495613_0004930 3300046689 Bacteria 10028
1231 Ga0495613_0026647 3300046689 Bacteria 4306
1232 Ga0495613_0049642 3300046689 Bacteria 3096
1233 Ga0495613_0228106 3300046689 Bacteria 1305
1234 Ga0495624_0014296 3300046690 Bacteria 5389
1235 Ga0495624_0031976 3300046690 Bacteria 3415
1236 Ga0495624_0514485 3300046690 Bacteria 716
1237 Ga0495670_0289113 3300046691 Bacteria 877
1238 Ga0495670_0705379 3300046691 Bacteria 550
1239 Ga0495670_0816391 3300046691 Bacteria 509
1240 Ga0495671_0069276 3300046692 Bacteria 1734
1241 Ga0495671_0258088 3300046692 Bacteria 841
1242 Ga0495649_0183835 3300046694 Bacteria 1090
1243 Ga0495589_0198788 3300046794 Bacteria 947
1244 Ga0495589_0258357 3300046794 Bacteria 813
1245 Ga0495600_0010040 3300046809 Bacteria 5869
1246 Ga0495600_0014804 3300046809 Bacteria 4920
1247 Ga0495600_0134365 3300046809 Bacteria 1607
1248 Ga0495600_0383849 3300046809 Bacteria 876
1249 Ga0495600_0548353 3300046809 Bacteria 707
1250 Ga0495600_0619142 3300046809 Bacteria 657
1251 Ga0495600_0636127 3300046809 Bacteria 646
1252 Ga0495581_0000600 3300047315 Bacteria 18833
1253 Ga0495581_0180415 3300047315 Bacteria 1235
1254 Ga0495581_0227293 3300047315 Bacteria 1092
1255 Ga0495581_0478735 3300047315 Bacteria 724
1256 Ga0495581_0494080 3300047315 Bacteria 712
1257 Ga0495581_0722645 3300047315 Bacteria 574
1258 Ga0495604_0032194 3300047317 Bacteria 4157
1259 Ga0495604_0293465 3300047317 Bacteria 1094
1260 Ga0495604_0449014 3300047317 Bacteria 843
1261 Ga0495604_0731819 3300047317 Bacteria 627
1262 Ga0495674_0000559 3300047319 Bacteria 34585
1263 Ga0495674_0027226 3300047319 Bacteria 5225
1264 Ga0495674_0036979 3300047319 Bacteria 4388
1265 Ga0495674_0307235 3300047319 Bacteria 1294
1266 Ga0495674_0720517 3300047319 Bacteria 781
1267 Ga0495674_0736584 3300047319 Bacteria 771
1268 Ga0495674_0935523 3300047319 Bacteria 667
1269 Ga0495672_0006823 3300047320 Bacteria 8724
1270 Ga0495672_0185064 3300047320 Bacteria 1052
1271 Ga0495672_0189842 3300047320 Bacteria 1034
1272 Ga0495676_0063084 3300047321 Bacteria 2890
1273 Ga0495676_0077323 3300047321 Bacteria 2538
1274 Ga0495676_1115302 3300047321 Bacteria 501
1275 Ga0495680_0023759 3300047322 Bacteria 5094
1276 Ga0495680_0216291 3300047322 Bacteria 1370
1277 Ga0495675_0200553 3300047444 Bacteria 1214
1278 Ga0495675_0225460 3300047444 Bacteria 1132
1279 Ga0495685_065541 3300047447 Bacteria 1221
1280 Ga0495673_0022015 3300047469 Bacteria 3132
1281 Ga0495673_0169106 3300047469 Bacteria 834
1282 Ga0495684_0004169 3300047471 Bacteria 11285
1283 Ga0495684_0018085 3300047471 Bacteria 5432
1284 Ga0495684_0025746 3300047471 Bacteria 4520
1285 Ga0495684_0136491 3300047471 Bacteria 1840
1286 Ga0495686_0201235 3300047472 Bacteria 1143
1287 Ga0495686_0474691 3300047472 Bacteria 662
1288 Ga0495593_0010511 3300047673 Bacteria 5341
1289 Ga0495593_0015108 3300047673 Bacteria 4384
1290 Ga0495593_0112655 3300047673 Bacteria 1388
1291 Ga0495593_0118269 3300047673 Bacteria 1350
1292 Ga0495602_0048612 3300048088 Bacteria 3809
1293 Ga0495602_0119490 3300048088 Bacteria 2123
1294 Ga0495602_0121856 3300048088 Bacteria 2097
1295 Ga0495614_0120054 3300048089 Bacteria 1159
1296 Ga0495614_0482762 3300048089 Bacteria 589
1297 Ga0496100_0046021 3300048903 Bacteria 2803
1298 Ga0496100_0050707 3300048903 Bacteria 2690
1299 Ga0496100_0052796 3300048903 Bacteria 2644
1300 Ga0496100_0071267 3300048903 Bacteria 2320
1301 Ga0496100_0316437 3300048903 Bacteria 1171
1302 Ga0496100_0557560 3300048903 Bacteria 887
1303 Ga0496100_0615096 3300048903 Bacteria 844
1304 Ga0496100_0621164 3300048903 Bacteria 840
1305 Ga0496101_0031805 3300048904 Bacteria 3712
1306 Ga0496101_0038658 3300048904 Bacteria 3389
1307 Ga0496101_0081744 3300048904 Bacteria 2390
1308 Ga0496101_0087255 3300048904 Bacteria 2316
1309 Ga0496101_0115840 3300048904 Bacteria 2022
1310 Ga0496101_0205977 3300048904 Bacteria 1522
1311 Ga0496101_0297279 3300048904 Bacteria 1264
1312 Ga0496101_0335861 3300048904 Bacteria 1186
1313 Ga0496102_0040369 3300048905 Bacteria 4221
1314 Ga0496102_0235381 3300048905 Bacteria 1727
1315 Ga0496102_0261400 3300048905 Bacteria 1632
1316 Ga0496102_0711138 3300048905 Bacteria 927
1317 Ga0496103_0045684 3300048906 Bacteria 2702
1318 Ga0496103_0375969 3300048906 Bacteria 913
1319 Ga0496103_0483396 3300048906 Bacteria 793
1320 Ga0496103_0498542 3300048906 Bacteria 779
1321 Ga0496103_0663955 3300048906 Bacteria 662
1322 Ga0496104_0028279 3300048907 Bacteria 5196
1323 Ga0496104_0034259 3300048907 Bacteria 4733
1324 Ga0496104_0051847 3300048907 Bacteria 3874
1325 Ga0496104_0515383 3300048907 Bacteria 1107
1326 Ga0496104_0790186 3300048907 Bacteria 855
1327 Ga0496104_0824417 3300048907 Bacteria 833
1328 Ga0496105_0008852 3300048908 Bacteria 7843
1329 Ga0496105_0025832 3300048908 Bacteria 4784
1330 Ga0496105_0036011 3300048908 Bacteria 4075
1331 Ga0496105_0522331 3300048908 Bacteria 930
1332 Ga0496106_0034402 3300048909 Bacteria 3783
1333 Ga0496106_0035026 3300048909 Bacteria 3752
1334 Ga0496106_0047123 3300048909 Bacteria 3243
1335 Ga0496106_0055110 3300048909 Bacteria 3004
1336 Ga0496106_0059950 3300048909 Bacteria 2884
1337 Ga0496106_0288994 3300048909 Bacteria 1314
1338 Ga0496106_0311545 3300048909 Bacteria 1263
1339 Ga0496106_0526078 3300048909 Bacteria 950
1340 Ga0496106_0565297 3300048909 Bacteria 912
1341 Ga0496106_0626290 3300048909 Bacteria 861
1342 Ga0496107_0098614 3300048910 Bacteria 2140
1343 Ga0496107_0283617 3300048910 Bacteria 1233
1344 Ga0496108_0003043 3300048911 Bacteria 13477
1345 Ga0496108_0197454 3300048911 Bacteria 1745
1346 Ga0496108_0198549 3300048911 Bacteria 1740
1347 Ga0496108_0332468 3300048911 Bacteria 1325
1348 Ga0496108_0533638 3300048911 Bacteria 1024
1349 Ga0496108_0778245 3300048911 Bacteria 826
1350 Ga0496108_0831821 3300048911 Bacteria 795
1351 Ga0496109_0009711 3300048912 Bacteria 8213
1352 Ga0496109_0149407 3300048912 Bacteria 2187
1353 Ga0496109_0191019 3300048912 Bacteria 1924
1354 Ga0496109_0198648 3300048912 Bacteria 1885
1355 Ga0496109_0581071 3300048912 Bacteria 1056
1356 Ga0496109_1662183 3300048912 Bacteria 573
1357 Ga0496109_1919558 3300048912 Bacteria 524
1358 Ga0496110_0004491 3300048913 Bacteria 10821
1359 Ga0496110_0005229 3300048913 Bacteria 10154
1360 Ga0496110_0088768 3300048913 Bacteria 2762
1361 Ga0496110_0339977 3300048913 Bacteria 1367
1362 Ga0496110_0367549 3300048913 Bacteria 1311
1363 Ga0496110_0411415 3300048913 Bacteria 1233
1364 Ga0496110_1314802 3300048913 Bacteria 632
1365 Ga0496110_1709304 3300048913 Bacteria 539
1366 Ga0496111_0009814 3300048914 Bacteria 6399
1367 Ga0496111_0031327 3300048914 Bacteria 3788
1368 Ga0496111_0172410 3300048914 Bacteria 1607
1369 Ga0496111_0267541 3300048914 Bacteria 1268
1370 Ga0496111_0551614 3300048914 Bacteria 846
1371 Ga0496111_0632185 3300048914 Bacteria 782
1372 Ga0496112_0000046 3300048915 Bacteria 85631
1373 Ga0496112_0012428 3300048915 Bacteria 7827
1374 Ga0496112_0023031 3300048915 Bacteria 5943
1375 Ga0496112_0071634 3300048915 Bacteria 3425
1376 Ga0496112_0099111 3300048915 Bacteria 2884
1377 Ga0496112_0112577 3300048915 Bacteria 2692
1378 Ga0496112_0163689 3300048915 Bacteria 2190
1379 Ga0496112_0312861 3300048915 Bacteria 1515
1380 Ga0496112_0387308 3300048915 Bacteria 1338
1381 Ga0496112_0556686 3300048915 Bacteria 1080
1382 Ga0496112_1241505 3300048915 Bacteria 661
1383 Ga0496113_0044643 3300048916 Bacteria 3284
1384 Ga0496113_0048018 3300048916 Bacteria 3175
1385 Ga0496113_0131622 3300048916 Bacteria 1963
1386 Ga0496113_0147516 3300048916 Bacteria 1854
1387 Ga0496113_0267909 3300048916 Bacteria 1365
1388 Ga0496113_1370963 3300048916 Bacteria 548
1389 Ga0496114_0099620 3300048917 Bacteria 2479
1390 Ga0496114_0196415 3300048917 Bacteria 1766
1391 Ga0496114_0205692 3300048917 Bacteria 1725
1392 Ga0496114_0368535 3300048917 Bacteria 1271
1393 Ga0496114_0586261 3300048917 Bacteria 984
1394 Ga0496114_0596970 3300048917 Bacteria 974
1395 Ga0496114_0965475 3300048917 Bacteria 735
1396 Ga0496114_1470854 3300048917 Bacteria 569
1397 Ga0496115_0002909 3300048918 Bacteria 12354
1398 Ga0496115_0066846 3300048918 Bacteria 2906
1399 Ga0496115_0066985 3300048918 Bacteria 2903
1400 Ga0496115_0069623 3300048918 Bacteria 2850
1401 Ga0496115_0098350 3300048918 Bacteria 2396
1402 Ga0496115_0212681 3300048918 Bacteria 1597
1403 Ga0496115_0540473 3300048918 Bacteria 932
1404 Ga0496115_0665980 3300048918 Bacteria 821
1405 Ga0496117_0070896 3300048920 Bacteria 2338
1406 Ga0496117_0138996 3300048920 Bacteria 1458
1407 Ga0496117_0373243 3300048920 Bacteria 729
1408 Ga0496118_0006802 3300048921 Bacteria 12416
1409 Ga0496118_0011822 3300048921 Bacteria 8470
1410 Ga0496118_0066857 3300048921 Bacteria 2622
1411 Ga0496118_0128508 3300048921 Bacteria 1633
1412 Ga0496118_0251502 3300048921 Bacteria 1004
1413 Ga0496119_0034242 3300048922 Bacteria 3351
1414 Ga0496119_0111350 3300048922 Bacteria 1519
1415 Ga0496120_0155353 3300048923 Bacteria 1146
1416 Ga0496121_0001986 3300048924 Bacteria 32509
1417 Ga0496121_0018240 3300048924 Bacteria 7092
1418 Ga0496121_0018643 3300048924 Bacteria 6985
1419 Ga0496121_0036041 3300048924 Bacteria 4417
1420 Ga0496121_0166631 3300048924 Bacteria 1605
1421 Ga0496121_0201014 3300048924 Bacteria 1420
1422 Ga0496121_0462043 3300048924 Bacteria 815
1423 Ga0496121_0521909 3300048924 Bacteria 749
1424 Ga0496121_0554476 3300048924 Bacteria 718
1425 Ga0496122_0226298 3300048925 Bacteria 1068
1426 Ga0496122_0306329 3300048925 Bacteria 853
1427 Ga0496123_0254621 3300048926 Bacteria 864
1428 Ga0496124_0006608 3300048927 Bacteria 12593
1429 Ga0496124_0080396 3300048927 Bacteria 2682
1430 Ga0496124_0123368 3300048927 Bacteria 2067
1431 Ga0496124_0144217 3300048927 Bacteria 1876
1432 Ga0496124_0303222 3300048927 Bacteria 1152
1433 Ga0496124_0358801 3300048927 Bacteria 1028
1434 Ga0496124_0667052 3300048927 Bacteria 665
1435 Ga0496125_0000063 3300048928 Bacteria 250260
1436 Ga0496125_0006261 3300048928 Bacteria 12936
1437 Ga0496125_0019586 3300048928 Bacteria 6376
1438 Ga0496125_0061100 3300048928 Bacteria 3024
1439 Ga0496125_0077973 3300048928 Bacteria 2550
1440 Ga0496125_0252591 3300048928 Bacteria 1111
1441 Ga0496125_0412207 3300048928 Bacteria 786
1442 Ga0496126_0010555 3300048929 Bacteria 9662
1443 Ga0496126_0066644 3300048929 Bacteria 3219
1444 Ga0496126_0106374 3300048929 Bacteria 2448
1445 Ga0496126_0109200 3300048929 Bacteria 2411
1446 Ga0496126_0135669 3300048929 Bacteria 2123
1447 Ga0496126_0180108 3300048929 Bacteria 1796
1448 Ga0496126_0212877 3300048929 Bacteria 1626
1449 Ga0496126_0232991 3300048929 Bacteria 1542
1450 Ga0496126_0342455 3300048929 Bacteria 1224
1451 Ga0496126_0397278 3300048929 Bacteria 1119
1452 Ga0496126_0502674 3300048929 Bacteria 968
1453 Ga0496126_0612854 3300048929 Bacteria 856
1454 Ga0496126_0682209 3300048929 Bacteria 800
1455 Ga0496126_0872275 3300048929 Bacteria 685
1456 Ga0496126_0884853 3300048929 Bacteria 678
1457 Ga0496126_1008170 3300048929 Bacteria 624
1458 Ga0495682_0160041 3300049460 Bacteria 802
1459 Ga0495682_0204573 3300049460 Bacteria 700
1460 Ga0495682_0340248 3300049460 Bacteria 529
1461 Ga0501031_0006400 3300049568 Bacteria 7678
1462 Ga0501031_0012001 3300049568 Bacteria 5650
1463 Ga0501031_0028674 3300049568 Bacteria 3629
1464 Ga0501031_0116400 3300049568 Bacteria 1746
1465 Ga0501032_0001803 3300049569 Bacteria 16905
1466 Ga0501032_0004911 3300049569 Bacteria 10005
1467 Ga0501032_0239594 3300049569 Bacteria 1179
1468 Ga0501033_0000523 3300049570 Bacteria 35975
1469 Ga0501033_0001240 3300049570 Bacteria 22917
1470 Ga0501033_0004826 3300049570 Bacteria 10758
1471 Ga0501033_0024599 3300049570 Bacteria 4542
1472 Ga0501033_0289234 3300049570 Bacteria 1156
1473 Ga0501033_0880398 3300049570 Bacteria 602
1474 Ga0501034_0000717 3300049571 Bacteria 50424
1475 Ga0501034_0051314 3300049571 Bacteria 4159
1476 Ga0501034_0082701 3300049571 Bacteria 3212
1477 Ga0501034_0088722 3300049571 Bacteria 3090
1478 Ga0501034_0231883 3300049571 Bacteria 1795
1479 Ga0501034_0809119 3300049571 Bacteria 829
1480 Ga0501036_0000027 3300049572 Bacteria 99799
1481 Ga0501036_0022965 3300049572 Bacteria 5251
1482 Ga0501036_0253831 3300049572 Bacteria 1473
1483 Ga0501036_0418554 3300049572 Bacteria 1117
1484 Ga0501036_0487067 3300049572 Bacteria 1026
1485 Ga0501036_1523264 3300049572 Bacteria 541
1486 Ga0501037_0000104 3300049573 Bacteria 80204
1487 Ga0501037_0001986 3300049573 Bacteria 14819
1488 Ga0501037_0026399 3300049573 Bacteria 4293
1489 Ga0501037_0029042 3300049573 Bacteria 4084
1490 Ga0501037_0067887 3300049573 Bacteria 2596
1491 Ga0501038_0000477 3300049574 Bacteria 35252
1492 Ga0501038_0011478 3300049574 Bacteria 8081
1493 Ga0501038_0019478 3300049574 Bacteria 6115
1494 Ga0501038_0100633 3300049574 Bacteria 2407
1495 Ga0501038_0361996 3300049574 Bacteria 1128
1496 Ga0501039_0001050 3300049575 Bacteria 20238
1497 Ga0501039_0036741 3300049575 Bacteria 3780
1498 Ga0501039_0325226 3300049575 Bacteria 1208
1499 Ga0501039_0334264 3300049575 Bacteria 1190
1500 Ga0501039_0833716 3300049575 Bacteria 719
1501 Ga0501040_0006915 3300049576 Bacteria 7345
1502 Ga0501040_0123072 3300049576 Bacteria 1821
1503 Ga0501042_0026182 3300049578 Bacteria 4100
1504 Ga0501042_0042559 3300049578 Bacteria 3233
1505 Ga0501042_0249237 3300049578 Bacteria 1281
1506 Ga0501043_0000076 3300049579 Bacteria 86074
1507 Ga0501043_0005019 3300049579 Bacteria 10713
1508 Ga0501043_0012465 3300049579 Bacteria 6651
1509 Ga0501043_0085138 3300049579 Bacteria 2484
1510 Ga0501043_0186687 3300049579 Bacteria 1614
1511 Ga0501043_0192722 3300049579 Bacteria 1584
1512 Ga0501046_0001785 3300049580 Bacteria 20526
1513 Ga0501046_0008324 3300049580 Bacteria 9048
1514 Ga0501046_0213911 3300049580 Bacteria 1430
1515 Ga0501047_0000123 3300049581 Bacteria 95016
1516 Ga0501047_0027982 3300049581 Bacteria 5432
1517 Ga0501047_0063198 3300049581 Bacteria 3571
1518 Ga0501047_0105537 3300049581 Bacteria 2698
1519 Ga0501047_0527750 3300049581 Bacteria 1006
1520 Ga0501047_1134197 3300049581 Bacteria 595
1521 Ga0501048_0001197 3300049582 Bacteria 19639
1522 Ga0501048_0009900 3300049582 Bacteria 7145
1523 Ga0501067_0003629 3300049583 Bacteria 8499
1524 Ga0501067_0012611 3300049583 Bacteria 4690
1525 Ga0501068_0005455 3300049584 Bacteria 6961
1526 Ga0501068_0198448 3300049584 Bacteria 1272
1527 Ga0501069_0029662 3300049585 Bacteria 3002
1528 Ga0501070_0003948 3300049586 Bacteria 12769
1529 Ga0501070_0019003 3300049586 Bacteria 5764
1530 Ga0501070_0029926 3300049586 Bacteria 4562
1531 Ga0501070_0411142 3300049586 Bacteria 1093
1532 Ga0501070_0713467 3300049586 Bacteria 792
1533 Ga0501071_0016328 3300049587 Bacteria 5106
1534 Ga0501071_0036287 3300049587 Bacteria 3515
1535 Ga0501071_0300531 3300049587 Bacteria 1217
1536 Ga0501072_0009992 3300049588 Bacteria 7216
1537 Ga0501072_0011011 3300049588 Bacteria 6900
1538 Ga0501072_0051068 3300049588 Bacteria 3256
1539 Ga0501073_0000014 3300049589 Bacteria 159719
1540 Ga0501073_0048823 3300049589 Bacteria 2969
1541 Ga0501073_0050698 3300049589 Bacteria 2908
1542 Ga0501073_0172707 3300049589 Bacteria 1496
1543 Ga0501074_0000615 3300049590 Bacteria 22190
1544 Ga0501074_0019020 3300049590 Bacteria 4988
1545 Ga0501075_0117688 3300049591 Bacteria 2020
1546 Ga0501075_1396422 3300049591 Bacteria 530
1547 Ga0501076_0470144 3300049592 Bacteria 1036
1548 Ga0501079_0000830 3300049741 Bacteria 20998
1549 Ga0501079_0009379 3300049741 Bacteria 7416
1550 Ga0501079_1049956 3300049741 Bacteria 642
1551 Ga0501079_1348852 3300049741 Bacteria 561
1552 Ga0501080_0000547 3300049742 Bacteria 29661
1553 Ga0501080_0080707 3300049742 Bacteria 3023
1554 Ga0501080_0291576 3300049742 Bacteria 1481
1555 Ga0501081_0306248 3300049743 Bacteria 1166
1556 Ga0501081_1221894 3300049743 Bacteria 569
1557 Ga0501083_0000174 3300049744 Bacteria 41662
1558 Ga0501083_0043137 3300049744 Bacteria 3056
1559 Ga0501035_0001320 3300049822 Bacteria 25596
1560 Ga0501035_0001597 3300049822 Bacteria 22938
1561 Ga0501035_0024312 3300049822 Bacteria 5556
1562 Ga0501035_0034283 3300049822 Bacteria 4614
1563 Ga0501035_0061445 3300049822 Bacteria 3343
1564 Ga0501035_0110858 3300049822 Bacteria 2405
1565 Ga0501035_0255463 3300049822 Bacteria 1487
1566 Ga0501035_0336441 3300049822 Bacteria 1266
1567 Ga0501044_0012380 3300049823 Bacteria 9235
1568 Ga0501044_0013936 3300049823 Bacteria 8685
1569 Ga0501044_0034011 3300049823 Bacteria 5349
1570 Ga0501044_0055534 3300049823 Bacteria 4067
1571 Ga0501044_0070448 3300049823 Bacteria 3556
1572 Ga0501044_0086977 3300049823 Bacteria 3157
1573 Ga0501044_0201252 3300049823 Bacteria 1950
1574 Ga0501044_0408151 3300049823 Bacteria 1270
1575 Ga0501045_0013305 3300049824 Bacteria 5809
1576 Ga0501045_0174546 3300049824 Bacteria 1601
1577 Ga0501045_0426907 3300049824 Bacteria 986
1578 nmdc:mga03683_161160_c1 3300050489 Bacteria 1016
1579 nmdc:mga03683_31811_c1 3300050489 Bacteria 2119
1580 nmdc:mga03n38_298928_c1 3300050490 Bacteria 864
1581 nmdc:mga03n38_450763_c1 3300050490 Bacteria 716
1582 nmdc:mga00v17_392786_c1 3300050491 Bacteria 902
1583 nmdc:mga00v17_47772_c1 3300050491 Bacteria 2593
1584 nmdc:mga0yw44_189421_c1 3300050492 Bacteria 1356
1585 nmdc:mga0yw44_37742_c1 3300050492 Bacteria 2854
1586 nmdc:mga0yw44_481599_c1 3300050492 Bacteria 842
1587 nmdc:mga0yw44_610969_c1 3300050492 Bacteria 741
1588 nmdc:mga0k408_174724_c1 3300050493 Bacteria 1281
1589 nmdc:mga0k408_341720_c1 3300050493 Bacteria 892
1590 nmdc:mga06z11_158583_c1 3300050494 Bacteria 1292
1591 nmdc:mga06z11_478689_c1 3300050494 Bacteria 753
1592 nmdc:mga06z11_552963_c1 3300050494 Bacteria 699
1593 nmdc:mga06z11_692515_c1 3300050494 Bacteria 621
1594 nmdc:mga04h51_313894_c1 3300050495 Bacteria 641
1595 nmdc:mga07m45_128548_c1 3300050496 Bacteria 1465
1596 nmdc:mga07m45_222870_c1 3300050496 Bacteria 1097
1597 nmdc:mga05p37_671762_c1 3300050507 Bacteria 1156
1598 nmdc:mga05p37_75721_c1 3300050507 Bacteria 4142
1599 nmdc:mga08y16_1139274_c1 3300050511 Bacteria 753
1600 nmdc:mga08y16_549393_c1 3300050511 Bacteria 1169
1601 nmdc:mga0n895_211449_c1 3300050512 Bacteria 1970
1602 nmdc:mga0rr50_1057741_c1 3300050513 Bacteria 691
1603 nmdc:mga0rr50_505013_c1 3300050513 Bacteria 1028
1604 nmdc:mga08x19_113391_c1 3300050514 Bacteria 1810
1605 nmdc:mga08x19_1230309_c1 3300050514 Bacteria 531
1606 nmdc:mga08x19_837281_c1 3300050514 Bacteria 653
1607 nmdc:mga0a205_723618_c1 3300050515 Bacteria 844
1608 nmdc:mga0sz30_46403_c1 3300050516 Bacteria 1834
1609 Ga0495601_0032181 3300053077 Bacteria 3264
1610 Ga0495601_0126922 3300053077 Bacteria 1660
1611 Ga0495601_0133917 3300053077 Bacteria 1615
1612 Ga0495601_0198588 3300053077 Bacteria 1311
1613 Ga0495601_0284115 3300053077 Bacteria 1079
1614 Ga0495612_0043479 3300053078 Bacteria 1836
1615 Ga0495612_0050233 3300053078 Bacteria 1712
1616 Ga0495612_0222109 3300053078 Bacteria 837
1617 Ga0495612_0233479 3300053078 Bacteria 816
1618 Ga0495612_0255290 3300053078 Bacteria 780
1619 Ga0500635_0058336 3300053080 Bacteria 1340
1620 Ga0500635_0059408 3300053080 Bacteria 1330
1621 Ga0495655_0211203 3300053083 Bacteria 639
1622 Ga0495595_0009446 3300053084 Bacteria 4035
1623 Ga0495595_0148261 3300053084 Bacteria 1153
1624 Ga0495595_0404740 3300053084 Bacteria 692
1625 Ga0495619_0014450 3300053085 Bacteria 4986
1626 Ga0495619_0080719 3300053085 Bacteria 2189
1627 Ga0495619_0393790 3300053085 Bacteria 957
1628 Ga0495619_0673392 3300053085 Bacteria 704
1629 Ga0500643_089644 3300053087 Bacteria 839
1630 Ga0500644_0136437 3300053088 Bacteria 971
1631 Ga0500647_0178692 3300053091 Bacteria 975
1632 Ga0500647_0266953 3300053091 Bacteria 745
1633 Ga0500651_0070589 3300053093 Bacteria 2174
1634 Ga0500566_0000254 3300053094 Bacteria 28717
1635 Ga0500566_0003600 3300053094 Bacteria 9237
1636 Ga0500566_0211549 3300053094 Bacteria 971
1637 Ga0500566_0303082 3300053094 Bacteria 751
1638 Ga0500640_051642 3300053095 Bacteria 1797
1639 Ga0500641_0021282 3300053096 Bacteria 2470
1640 Ga0500641_0165216 3300053096 Bacteria 954
1641 Ga0500641_0369353 3300053096 Bacteria 572
1642 Ga0500554_004284 3300053102 Bacteria 3010
1643 Ga0500554_006809 3300053102 Bacteria 2590
1644 Ga0500555_171278 3300053103 Bacteria 527
1645 Ga0500556_0042140 3300053104 Bacteria 1613
1646 Ga0500562_120112 3300053108 Bacteria 716
1647 Ga0500569_158403 3300053109 Bacteria 766
1648 Ga0500572_000178 3300053111 Bacteria 22343
1649 Ga0500572_005818 3300053111 Bacteria 2806
1650 Ga0500591_073827 3300053115 Bacteria 1538
1651 Ga0500594_0258797 3300053118 Bacteria 580
1652 Ga0500595_002259 3300053119 Bacteria 9742
1653 Ga0500595_003316 3300053119 Bacteria 7570
1654 Ga0500595_008308 3300053119 Bacteria 4248
1655 Ga0500595_023364 3300053119 Bacteria 2174
1656 Ga0500595_025393 3300053119 Bacteria 2054
1657 Ga0500607_258411 3300053121 Bacteria 685
1658 Ga0500608_045172 3300053122 Bacteria 2116
1659 Ga0500614_015435 3300053123 Bacteria 1703
1660 Ga0500614_111579 3300053123 Bacteria 798
1661 Ga0500617_219617 3300053124 Bacteria 677
1662 Ga0500621_214738 3300053126 Bacteria 671
1663 Ga0500642_0067899 3300053130 Bacteria 1617
1664 Ga0500658_0529480 3300053134 Bacteria 532
1665 Ga0500658_0573983 3300053134 Bacteria 506
1666 Ga0500559_0002150 3300053136 Bacteria 10482
1667 Ga0500559_0002386 3300053136 Bacteria 9764
1668 Ga0500559_0103041 3300053136 Bacteria 1316
1669 Ga0500561_0285191 3300053137 Bacteria 526
1670 Ga0500568_0010703 3300053139 Bacteria 4285
1671 Ga0500568_0020007 3300053139 Bacteria 2903
1672 Ga0500568_0150436 3300053139 Bacteria 861
1673 Ga0500573_0083630 3300053140 Bacteria 1811
1674 Ga0500577_0365448 3300053142 Bacteria 631
1675 Ga0500588_0234075 3300053146 Bacteria 687
1676 Ga0500588_0386986 3300053146 Bacteria 532
1677 Ga0500590_059871 3300053148 Bacteria 1916
1678 Ga0500590_182781 3300053148 Bacteria 908
1679 Ga0500590_200691 3300053148 Bacteria 844
1680 Ga0500603_000282 3300053150 Bacteria 13460
1681 Ga0500603_001384 3300053150 Bacteria 5530
1682 Ga0500603_011894 3300053150 Bacteria 1990
1683 Ga0500603_182662 3300053150 Bacteria 660
1684 Ga0500604_0236855 3300053151 Bacteria 631
1685 Ga0500616_0000084 3300053153 Bacteria 195562
1686 Ga0500616_0076717 3300053153 Bacteria 1689
1687 Ga0500622_0006086 3300053156 Bacteria 7086
1688 Ga0500627_0137977 3300053158 Bacteria 1102
1689 Ga0500630_001999 3300053159 Bacteria 9797
1690 Ga0500638_019089 3300053162 Bacteria 3209
1691 Ga0500638_051677 3300053162 Bacteria 1986
1692 Ga0500638_186828 3300053162 Bacteria 889
1693 Ga0500638_193729 3300053162 Bacteria 866
1694 Ga0500639_000025 3300053163 Bacteria 84839
1695 Ga0500639_169843 3300053163 Bacteria 979
1696 Ga0500639_197028 3300053163 Bacteria 870
1697 Ga0500636_0017152 3300053177 Bacteria 4272
1698 Ga0500636_0033663 3300053177 Bacteria 3033
1699 Ga0500636_0078103 3300053177 Bacteria 1911
1700 Ga0500636_0096663 3300053177 Bacteria 1685
1701 Ga0500636_0539956 3300053177 Bacteria 506
1702 Ga0500637_0000520 3300053178 Bacteria 15017
1703 Ga0500637_0005157 3300053178 Bacteria 6298
1704 Ga0500637_0060228 3300053178 Bacteria 2174
1705 Ga0500637_0110048 3300053178 Bacteria 1597
1706 Ga0500576_010807 3300053725 Bacteria 4039
1707 Ga0500611_135833 3300053727 Bacteria 666
1708 Ga0500656_015674 3300053732 Bacteria 891
1709 Ga0500552_004980 3300053733 Bacteria 1426
1710 Ga0500596_001469 3300053735 Bacteria 4761
1711 Ga0500596_002457 3300053735 Bacteria 3651
1712 Ga0500596_003890 3300053735 Bacteria 2793
1713 Ga0500601_044126 3300053737 Bacteria 546
1714 Ga0501084_0003729 3300054114 Bacteria 12367
1715 Ga0501084_0034764 3300054114 Bacteria 4214
1716 Ga0501084_0524440 3300054114 Bacteria 1001
1717 Ga0500661_004207 3300055283 Bacteria 2693
1718 Ga0500661_095768 3300055283 Bacteria 560
1719 Ga0587073_0218694 3300059492 Bacteria 581
1720 Ga0587090_024678 3300059510 Bacteria 966
1721 Ga0587091_202700 3300059511 Bacteria 534
1722 Ga0587129_014690 3300059608 Bacteria 646
1723 Ga0587128_033317 3300059630 Bacteria 866
1724 Ga0587078_054878 3300059646 Bacteria 592
1725 Ga0501082_0002368 3300060353 Bacteria 16508
1726 Ga0501082_0043704 3300060353 Bacteria 3864
1727 Ga0501082_0575236 3300060353 Bacteria 986
1728 Ga0466962_0135371 3300061719 Bacteria 1192
1729 2513661279 2513237096 Bacteria 8722461
1730 2513673107 2513237098 Bacteria 9902361
1731 2513697034 2513237101 Bacteria 7952346
1732 2513723768 2513237104 Bacteria 10034502
1733 2513858172 2513237137 Bacteria 9558895
1734 2513891991 2513237141 Bacteria 8496279
1735 2513923000 2513237145 Bacteria 8979722
1736 2517893937 2517572143 Bacteria 9484767
1737 2524540707 2524023228 Bacteria 10118060
1738 2671122927 2667528175 Bacteria 7532676
1739 2723846475 2721755755 Bacteria 8322773
1740 2728748055 2728368998 Bacteria 8720350
1741 2793072820 2791355197 Bacteria 8420563
1742 2793076856
1743 2856325746 2856320880 Bacteria 7263508
1744 2869279364 2869278585 Bacteria 7077053
1745 2874145111 2874139085 Bacteria 7021506
1746 2874610557 2874604998 Bacteria 7834745
1747 2876810242 2876808645 Bacteria 8824342
1748 2878743310 2878738818 Bacteria 7136951
1749 2879111751 2879110137 Bacteria 8907982
1750 2885379964 2885374607 Bacteria 8927485
1751 2885389021 2885383462 Bacteria 9473874
1752 2888340039 2888337043 Bacteria 6629336
1753 2888388333 2888388044 Bacteria 7304136
1754 2889039006 2889033259 Bacteria 9099371
1755 2903451935 2903448605 Bacteria 7357801
1756 2903749544 2903748898 Bacteria 9972761
1757 2903774649 2903768456 Bacteria 9749579
1758 2904693415 2904690495 Bacteria 9412302
1759 2906610830
1760 2906636018 2906635258 Bacteria 8601019
1761 2906663914 2906660503 Bacteria 8595048
1762 2908744340 2908739725 Bacteria 8628932
1763 2908761932 2908756301 Bacteria 8864324
1764 2922428499
1765 2924723301 2924718760 Bacteria 6331356
1766 2924739515 2924733363 Bacteria 7574837
1767 2924781121 2924776078 Bacteria 7492003
1768 2935634483 2935630451 Bacteria 8169952
1769 2937877545 2937877337 Bacteria 7246526
1770 2937975372 2937972304 Bacteria 7532020
1771 2941508969 2941507105 Bacteria 8166816
1772 2941516798 2941515067 Bacteria 8166720
1773 2941525107 2941523033 Bacteria 8169134
1774 2958035504 2958034702 Bacteria 6989922
1775 2958043691 2958041894 Bacteria 13082850
1776 2958084652 2958084443 Bacteria 7312792
1777 2958152120 2958144490 Bacteria 6677056
1778 2968017948 2968016561 Bacteria 7022047
1779 2968087635 2968083720 Bacteria 7351627
1780 2970471877 2970469710 Bacteria 6969209
1781 2970593960 2970593180 Bacteria 7073582
1782 2996350805 2996348954 Bacteria 7239054
1783 3004169468 3004167301 Bacteria 8330599
1784 3004277503 3004275668 Bacteria 7114440
1785 3004295265 3004289098 Bacteria 6135450
1786 3005478624 3005474847 Bacteria 9259049
1787 8006942737 8006933436 Bacteria 10410654
1788 8006964874 8006964411 Bacteria 8966052
1789 8006982460 8006973647 Bacteria 10679141
1790 8006995599 8006994254 Bacteria 8309700
1791 8019558502 8019555841 Bacteria 9642137
1792 8019566796 8019565922 Bacteria 9639779
1793 8056685029 8056681323 Bacteria 8472857
1794 8056691815 8056689827 Bacteria 6712655
1795 Ga0373923_0066378
1796 LJQas_1024377
1797 JGI24740J21852_10053397
1798 JGI24737J22298_10048933
1799 JGI24738J21930_10155461
1800 JGI25406J46586_10000108
1801 JGI25406J46586_10001646
1802 JGI25165J46597_1024394
1803 JGI25153J46596_10050604
1804 JGI25404J52841_10000644
1805 JGI25404J52841_10005197
1806 JGI25404J52841_10008083
1807 Ga0055539_1003154
1808 Ga0055529_1032799
1809 Ga0065712_10488784
1810 Ga0065715_10670048
1811 Ga0065707_10999634
1812 Ga0070658_10260390
1813 Ga0070658_10295838
1814 Ga0070676_10487858
1815 Ga0070676_10583999
1816 Ga0070676_11263007
1817 Ga0070683_100014355
1818 Ga0070683_100088077
1819 Ga0070683_100242484
1820 Ga0070683_101817851
1821 Ga0070690_100151047
1822 Ga0070670_100248435
1823 Ga0068869_100121997
1824 Ga0068869_100360168
1825 Ga0068869_101139702
1826 Ga0068869_101456381
1827 Ga0068869_101752895
1828 Ga0070666_10866789
1829 Ga0070680_100089144
1830 Ga0070682_100022647
1831 Ga0070682_100208447
1832 Ga0070682_100746269
1833 Ga0068868_100050475
1834 Ga0068868_100289018
1835 Ga0068868_101210858
1836 Ga0070660_100483094
1837 Ga0070660_100707145
1838 Ga0070689_100245267
1839 Ga0070689_100259560
1840 Ga0070689_100370655
1841 Ga0070691_10222532
1842 Ga0070661_100497286
1843 Ga0070661_101060465
1844 Ga0070668_100088077
1845 Ga0070668_100166340
1846 Ga0070668_100539036
1847 Ga0070668_100551290
1848 Ga0070675_100722419
1849 Ga0070675_102211501
1850 Ga0070671_100648685
1851 Ga0070671_101294720
1852 Ga0070674_100037998
1853 Ga0070674_100122461
1854 Ga0070674_100186876
1855 Ga0070674_100361464
1856 Ga0070674_100798353
1857 Ga0070673_100261600
1858 Ga0070673_100534165
1859 Ga0070673_100818164
1860 Ga0070688_100679056
1861 Ga0070659_100070899
1862 Ga0070659_100222247
1863 Ga0070667_100523251
1864 Ga0070667_100629517
1865 Ga0070667_100968351
1866 Ga0070667_101621456
1867 Ga0070703_10455391
1868 Ga0070709_10000711
1869 Ga0070709_10005923
1870 Ga0070709_10010651
1871 Ga0070709_10034579
1872 Ga0070709_10050656
1873 Ga0070709_10337566
1874 Ga0070709_10564081
1875 Ga0070714_100122613
1876 Ga0070714_100147745
1877 Ga0070714_100160171
1878 Ga0070714_100172101
1879 Ga0070714_100187955
1880 Ga0070714_101001809
1881 Ga0070714_101046724
1882 Ga0070713_100009795
1883 Ga0070713_100013303
1884 Ga0070713_100016454
1885 Ga0070713_100099847
1886 Ga0070713_100931011
1887 Ga0070713_101446220
1888 Ga0070710_10006260
1889 Ga0070710_10015382
1890 Ga0070710_10043936
1891 Ga0070710_10230229
1892 Ga0070710_10455702
1893 Ga0070710_10598786
1894 Ga0070710_10648406
1895 Ga0070710_10850946
1896 Ga0070711_100019819
1897 Ga0070711_100038598
1898 Ga0070711_100045927
1899 Ga0070711_100083601
1900 Ga0070711_100117258
1901 Ga0070711_100179878
1902 Ga0070711_100579577
1903 Ga0070711_101712159
1904 Ga0070705_101006793
1905 Ga0070700_100056764
1906 Ga0070700_101946535
1907 Ga0070694_100651404
1908 Ga0070663_100053735
1909 Ga0070663_100057596
1910 Ga0070663_100297974
1911 Ga0070663_100486186
1912 Ga0070663_100732786
1913 Ga0070663_102062773
1914 Ga0070678_100172355
1915 Ga0070678_100388036
1916 Ga0070678_100499506
1917 Ga0070678_100856078
1918 Ga0070662_100184538
1919 Ga0070662_100307962
1920 Ga0070662_101069398
1921 Ga0070662_101287692
1922 Ga0070681_10015887
1923 Ga0070681_10024393
1924 Ga0070681_10108764
1925 Ga0070681_10406727
1926 Ga0070681_11250672
1927 Ga0070685_10235074
1928 Ga0070685_10625187
1929 Ga0070685_10908482
1930 Ga0070706_100559633
1931 Ga0070706_100714804
1932 Ga0070706_100782188
1933 Ga0070707_100066943
1934 Ga0070707_101487963
1935 Ga0070698_100078989
1936 Ga0070698_100337454
1937 Ga0070698_100504663
1938 Ga0070698_101128762
1939 Ga0070699_100912368
1940 Ga0070699_101106803
1941 Ga0070679_100047533
1942 Ga0070679_100088927
1943 Ga0070679_100091402
1944 Ga0070679_100496444
1945 Ga0070679_100716012
1946 Ga0070684_100018307
1947 Ga0070684_100019711
1948 Ga0070684_100070933
1949 Ga0070697_100665161
1950 Ga0068853_100015002
1951 Ga0068853_100114236
1952 Ga0068853_100167477
1953 Ga0070672_100365276
1954 Ga0070672_101119556
1955 Ga0070686_100332212
1956 Ga0070686_100981667
1957 Ga0070695_101196752
1958 Ga0070696_101037466
1959 Ga0070696_101091012
1960 Ga0070693_100130062
1961 Ga0070665_100473791
1962 Ga0070665_100619516
1963 Ga0070665_100643163
1964 Ga0070665_100689684
1965 Ga0070665_101353326
1966 Ga0070704_100074071
1967 Ga0070704_100723180
1968 Ga0070704_102180459
1969 Ga0068855_100115160
1970 Ga0068855_100172088
1971 Ga0068855_100287225
1972 Ga0068855_100303265
1973 Ga0068855_100443398
1974 Ga0068855_100471582
1975 Ga0068855_100543251
1976 Ga0068855_102056495
1977 Ga0070664_100256517
1978 Ga0070664_100330475
1979 Ga0068857_100050842
1980 Ga0068857_100137022
1981 Ga0068857_100262384
1982 Ga0068857_100458566
1983 Ga0068854_100044784
1984 Ga0068854_100205677
1985 Ga0068854_100376562
1986 Ga0068854_100785867
1987 Ga0068854_100821247
1988 Ga0068854_100990579
1989 Ga0068854_101065639
1990 Ga0068854_101071515
1991 Ga0068856_100012484
1992 Ga0068856_100068789
1993 Ga0068856_100277470
1994 Ga0068856_100356049
1995 Ga0068856_100425581
1996 Ga0068856_100732744
1997 Ga0068856_102309127
1998 Ga0070702_100798160
1999 Ga0068852_100090179
2000 Ga0068852_100100343
2001 Ga0068852_100106181
2002 Ga0068852_100173219
2003 Ga0068852_100817382
2004 Ga0068859_100385816
2005 Ga0068859_101222746
2006 Ga0068864_100133909
2007 Ga0068864_100524318
2008 Ga0068864_100761187
2009 Ga0068866_10220054
2010 Ga0068866_11081523
2011 Ga0068861_100160363
2012 Ga0068861_100168456
2013 Ga0068861_100297953
2014 Ga0068861_100365240
2015 Ga0068851_10005108
2016 Ga0068851_10257272
2017 Ga0068870_10275921
2018 Ga0068870_10290969
2019 Ga0068870_10516662
2020 Ga0068863_100176845
2021 Ga0068863_100247083
2022 Ga0068863_100699159
2023 Ga0068863_100975027
2024 Ga0068858_100033733
2025 Ga0068858_100193136
2026 Ga0068858_100210555
2027 Ga0068858_100255666
2028 Ga0068858_100391269
2029 Ga0068858_100521331
2030 Ga0068858_100749239
2031 Ga0068860_100000161
2032 Ga0068860_100238519
2033 Ga0068860_100428901
2034 Ga0068860_100672045
2035 Ga0068860_100789017
2036 Ga0068862_100118043
2037 Ga0068862_100167431
2038 Ga0068862_100367413
2039 Ga0068862_100833940
2040 Ga0068862_100978952
2041 Ga0068862_102590875
2042 Ga0081455_10011653
2043 Ga0081455_10025146
2044 Ga0081455_10033819
2045 Ga0081455_10124483
2046 Ga0081540_1000533
2047 Ga0081540_1008405
2048 Ga0081540_1008486
2049 Ga0081540_1014919
2050 Ga0081540_1018724
2051 Ga0081540_1021152
2052 Ga0081540_1024938
2053 Ga0081540_1097380
2054 Ga0081540_1108410
2055 Ga0081540_1109766
2056 Ga0081540_1158287
2057 Ga0081540_1193830
2058 Ga0081539_10000008
2059 Ga0081539_10000319
2060 Ga0081539_10051298
2061 Ga0070717_10010806
2062 Ga0070717_10011078
2063 Ga0070717_10093601
2064 Ga0070717_10146777
2065 Ga0070717_10732411
2066 Ga0070717_10936103
2067 Ga0070717_10987235
2068 Ga0070717_11385236
2069 Ga0075365_10170429
2070 Ga0075365_10266966
2071 Ga0075365_10275562
2072 Ga0075365_10745657
2073 Ga0075368_10057566
2074 Ga0075368_10126101
2075 Ga0075363_100434923
2076 Ga0075364_10498452
2077 Ga0075432_10154891
2078 Ga0070715_10054998
2079 Ga0070715_11093669
2080 Ga0070716_100005426
2081 Ga0070716_100036012
2082 Ga0070716_100073640
2083 Ga0070716_100397944
2084 Ga0070716_100654825
2085 Ga0070716_100844024
2086 Ga0070716_100918555
2087 Ga0070716_101763030
2088 Ga0070712_100031648
2089 Ga0070712_100149458
2090 Ga0070712_100249535
2091 Ga0070712_100319096
2092 Ga0070712_100401046
2093 Ga0070712_100782561
2094 Ga0075362_10044251
2095 Ga0075362_10475899
2096 Ga0075367_10179634
2097 Ga0075367_10359999
2098 Ga0075367_10678756
2099 Ga0075369_10028743
2100 Ga0075369_10145108
2101 Ga0075369_10360163
2102 Ga0075366_10496499
2103 Ga0097621_100540451
2104 Ga0097621_100576082
2105 Ga0097621_100806756
2106 Ga0097621_101336351
2107 Ga0075370_10095230
2108 Ga0075370_10103519
2109 Ga0075370_10537320
2110 Ga0068871_100170257
2111 Ga0068871_100204319
2112 Ga0068871_100369542
2113 Ga0068871_101128277
2114 Ga0068871_101422156
2115 Ga0068871_102088589
2116 Ga0068871_102156303
2117 Ga0075428_101045257
2118 Ga0075430_100647269
2119 Ga0075431_101726346
2120 Ga0075434_100207420
2121 Ga0075434_100342945
2122 Ga0068865_100686583
2123 Ga0068865_100902238
2124 Ga0075436_100074879
2125 Ga0075436_101390907
2126 Ga0097620_100385840
2127 Ga0097620_101222756
2128 Ga0099825_1025798
2129 Ga0099824_1002235
2130 Ga0099822_1006882
2131 Ga0075435_100575742
2132 Ga0075435_101201063
2133 Ga0075435_101333737
2134 Ga0099794_10026969
2135 Ga0099794_10110647
2136 Ga0099794_10227749
2137 Ga0099794_10775838
2138 Ga0099795_10055193
2139 Ga0099795_10096048
2140 Ga0099795_10152514
2141 Ga0099795_10328200
2142 Ga0099795_10357315
2143 Ga0105251_10539554
2144 Ga0105250_10469832
2145 Ga0105240_10074299
2146 Ga0105240_10108370
2147 Ga0105240_10132523
2148 Ga0105240_10174911
2149 Ga0105240_10273738
2150 Ga0105240_10276477
2151 Ga0105240_10750917
2152 Ga0105240_10906311
2153 Ga0105240_11406332
2154 Ga0105240_11517282
2155 Ga0105240_11563359
2156 Ga0111539_12268288
2157 Ga0111539_12432873
2158 Ga0105245_10113770
2159 Ga0105245_10165372
2160 Ga0105245_10550704
2161 Ga0105245_10860058
2162 Ga0105245_10932570
2163 Ga0105245_11067005
2164 Ga0105247_10033343
2165 Ga0105247_10079482
2166 Ga0105247_10127166
2167 Ga0105247_10144790
2168 Ga0105247_10152058
2169 Ga0105247_10366853
2170 Ga0105247_10711033
2171 Ga0114129_10226285
2172 Ga0105243_10389767
2173 Ga0105243_10815473
2174 Ga0105243_10901638
2175 Ga0105243_11013930
2176 Ga0105241_10001465
2177 Ga0105241_10049278
2178 Ga0105241_10132093
2179 Ga0105241_11148235
2180 Ga0105241_12638700
2181 Ga0105242_10298121
2182 Ga0105242_10780212
2183 Ga0105242_10958571
2184 Ga0105242_12479757
2185 Ga0105242_12737101
2186 Ga0105248_10079208
2187 Ga0105248_10180846
2188 Ga0105248_10443094
2189 Ga0105248_11481593
2190 Ga0105248_13041081
2191 Ga0105237_10082775
2192 Ga0105237_10160602
2193 Ga0105237_10162256
2194 Ga0105237_10233768
2195 Ga0105237_10509940
2196 Ga0105237_10609634
2197 Ga0105237_10614061
2198 Ga0105237_11183166
2199 Ga0105237_11443767
2200 Ga0105238_10061520
2201 Ga0105238_10082122
2202 Ga0105238_10267973
2203 Ga0105238_10291187
2204 Ga0105238_10483474
2205 Ga0105238_10602130
2206 Ga0105238_11838552
2207 Ga0105238_12020289
2208 Ga0105238_13059924
2209 Ga0105249_10068182
2210 Ga0105249_10410318
2211 Ga0105249_10577193
2212 Ga0105249_12026154
2213 Ga0105249_12991147
2214 Ga0099796_10115466
2215 Ga0099796_10296990
2216 Ga0099796_10320592
2217 Ga0105239_10088062
2218 Ga0105239_10101265
2219 Ga0105239_10131659
2220 Ga0105239_10220159
2221 Ga0105239_10226651
2222 Ga0105239_10260778
2223 Ga0105239_10339626
2224 Ga0105239_10597532
2225 Ga0105239_10700420
2226 Ga0105239_11293569
2227 Ga0105239_12007311
2228 Ga0105239_12450229
2229 Ga0105246_10241362
2230 Ga0105246_10371949
2231 Ga0105246_10760957
2232 Ga0105246_11145659
2233 Ga0157371_10284552
2234 Ga0157370_10160379
2235 Ga0157370_10173993
2236 Ga0157369_10008049
2237 Ga0157369_10213310
2238 Ga0157369_10247375
2239 Ga0157369_10778389
2240 Ga0157369_12451210
2241 Ga0157374_10096142
2242 Ga0157374_11022102
2243 Ga0157374_11298936
2244 Ga0157378_10269866
2245 Ga0157378_10414848
2246 Ga0157378_11454845
2247 Ga0157378_11577077
2248 Ga0163162_10058369
2249 Ga0163162_10309215
2250 Ga0163162_10321723
2251 Ga0163162_10367943
2252 Ga0163162_10398679
2253 Ga0163162_11222532
2254 Ga0157372_10319813
2255 Ga0157372_10579081
2256 Ga0157372_10759731
2257 Ga0157372_11165745
2258 Ga0157372_12136808
2259 Ga0157375_10150857
2260 Ga0157375_10250632
2261 Ga0157375_10678966
2262 Ga0157375_13474794
2263 Ga0163163_10041903
2264 Ga0163163_10162927
2265 Ga0163163_10216026
2266 Ga0163163_11372685
2267 Ga0163163_11520999
2268 Ga0163163_11618380
2269 Ga0157380_10380529
2270 Ga0157380_10725191
2271 Ga0157380_11824342
2272 Ga0157380_11953605
2273 Ga0182008_10196178
2274 Ga0157379_10144727
2275 Ga0157379_10248801
2276 Ga0157379_10329119
2277 Ga0157379_10398734
2278 Ga0157379_11027200
2279 Ga0157379_11241282
2280 Ga0157379_11784923
2281 Ga0157376_10046774
2282 Ga0157376_10267297
2283 Ga0157376_12623663
2284 Ga0182007_10073559
2285 Ga0163161_10149277
2286 Ga0163161_10348488
2287 Ga0163161_11194055
2288 Ga0163161_11272012
2289 Ga0213873_10008342
2290 Ga0213872_10147300
2291 Ga0213872_10247740
2292 Ga0213872_10338979
2293 Ga0213874_10027137
2294 Ga0213876_10001294
2295 Ga0213876_10190064
2296 Ga0213876_10712441
2297 Ga0213875_10014183
2298 Ga0213871_10027908
2299 Ga0224570_105443
2300 Ga0209563_104166
2301 Ga0209677_101183
2302 Ga0209677_126603
2303 Ga0209148_1014592
2304 Ga0209148_1035414
2305 Ga0209233_1002172
2306 Ga0209233_1014836
2307 Ga0207666_1076584
2308 Ga0209455_1005408
2309 Ga0209758_1002105
2310 Ga0209758_1011397
2311 Ga0209758_1011463
2312 Ga0207697_10095122
2313 Ga0207697_10383970
2314 Ga0207656_10012398
2315 Ga0207692_10002007
2316 Ga0207692_10062420
2317 Ga0207692_10129499
2318 Ga0207692_10214961
2319 Ga0207692_10269141
2320 Ga0207692_10292578
2321 Ga0207692_10874660
2322 Ga0207642_10250547
2323 Ga0207710_10011777
2324 Ga0207710_10137033
2325 Ga0207710_10192100
2326 Ga0207688_10393371
2327 Ga0207688_10599482
2328 Ga0207680_11050146
2329 Ga0207647_10087783
2330 Ga0207685_10069066
2331 Ga0207685_10092936
2332 Ga0207699_10002233
2333 Ga0207699_10024823
2334 Ga0207699_10107078
2335 Ga0207699_10125076
2336 Ga0207699_10264414
2337 Ga0207699_10543321
2338 Ga0207699_10691817
2339 Ga0207645_10075012
2340 Ga0207645_10727170
2341 Ga0207643_10101240
2342 Ga0207643_10135766
2343 Ga0207705_10127476
2344 Ga0207705_10215223
2345 Ga0207684_10128732
2346 Ga0207684_10740532
2347 Ga0207684_10948995
2348 Ga0207654_10090759
2349 Ga0207654_10721163
2350 Ga0207654_11421404
2351 Ga0207707_10006493
2352 Ga0207707_10116161
2353 Ga0207707_10158160
2354 Ga0207707_10336641
2355 Ga0207695_10001299
2356 Ga0207695_10086044
2357 Ga0207695_10090236
2358 Ga0207695_10161353
2359 Ga0207695_10228138
2360 Ga0207695_10596445
2361 Ga0207695_10853344
2362 Ga0207695_11147792
2363 Ga0207695_11172626
2364 Ga0207671_10044178
2365 Ga0207671_10083902
2366 Ga0207671_10154578
2367 Ga0207671_10217149
2368 Ga0207671_10503011
2369 Ga0207671_10642607
2370 Ga0207671_11053644
2371 Ga0207693_10005604
2372 Ga0207693_10042357
2373 Ga0207693_10085535
2374 Ga0207693_10127830
2375 Ga0207693_10185023
2376 Ga0207693_10801212
2377 Ga0207663_10000136
2378 Ga0207663_10041045
2379 Ga0207663_10286479
2380 Ga0207663_10341782
2381 Ga0207663_10430954
2382 Ga0207663_11707686
2383 Ga0207660_10115735
2384 Ga0207660_10134207
2385 Ga0207660_10203717
2386 Ga0207660_10208403
2387 Ga0207660_10607039
2388 Ga0207662_10786502
2389 Ga0207657_10016940
2390 Ga0207657_10105232
2391 Ga0207657_10218778
2392 Ga0207652_10017419
2393 Ga0207652_10222982
2394 Ga0207652_10229710
2395 Ga0207652_10992972
2396 Ga0207652_11281640
2397 Ga0207681_10413143
2398 Ga0207681_10512593
2399 Ga0207694_10000131
2400 Ga0207694_10056928
2401 Ga0207694_10089914
2402 Ga0207694_10127899
2403 Ga0207694_11271848
2404 Ga0207650_10376305
2405 Ga0207659_10966195
2406 Ga0207659_11080948
2407 Ga0207659_11082834
2408 Ga0207687_10170480
2409 Ga0207687_10572476
2410 Ga0207687_10738762
2411 Ga0207687_11682122
2412 Ga0207687_11814114
2413 Ga0207700_10019504
2414 Ga0207700_10044976
2415 Ga0207700_10064226
2416 Ga0207700_10244234
2417 Ga0207700_10308406
2418 Ga0207700_10536989
2419 Ga0207700_10646838
2420 Ga0207664_10040605
2421 Ga0207664_10161604
2422 Ga0207664_10163572
2423 Ga0207664_10179136
2424 Ga0207664_10240143
2425 Ga0207664_10413338
2426 Ga0207664_11259880
2427 Ga0207644_10544116
2428 Ga0207644_10597653
2429 Ga0207690_10341449
2430 Ga0207690_10344356
2431 Ga0207706_10191515
2432 Ga0207706_10260895
2433 Ga0207706_10384613
2434 Ga0207706_11135438
2435 Ga0207706_11262928
2436 Ga0207709_10285175
2437 Ga0207709_10545443
2438 Ga0207709_10646333
2439 Ga0207709_10923212
2440 Ga0207709_11104650
2441 Ga0207709_11686995
2442 Ga0207670_10369137
2443 Ga0207669_10029295
2444 Ga0207669_10557795
2445 Ga0207704_11166233
2446 Ga0207665_10003171
2447 Ga0207665_10082081
2448 Ga0207665_10435712
2449 Ga0207665_10483197
2450 Ga0207665_10725983
2451 Ga0207665_10911030
2452 Ga0207665_11467003
2453 Ga0207691_10131807
2454 Ga0207691_10241472
2455 Ga0207691_10756432
2456 Ga0207691_11292630
2457 Ga0207711_10290933
2458 Ga0207711_10309354
2459 Ga0207711_10384237
2460 Ga0207711_11619265
2461 Ga0207689_10118294
2462 Ga0207689_11713111
2463 Ga0207661_10003939
2464 Ga0207661_10131723
2465 Ga0207661_10157752
2466 Ga0207661_10257895
2467 Ga0207679_10087005
2468 Ga0207679_11252738
2469 Ga0207679_11613808
2470 Ga0207667_10077674
2471 Ga0207667_10091938
2472 Ga0207667_10134297
2473 Ga0207667_10154984
2474 Ga0207667_10225581
2475 Ga0207667_10272462
2476 Ga0207667_11074115
2477 Ga0207667_11894950
2478 Ga0207651_10125168
2479 Ga0207651_11109452
2480 Ga0207651_11166438
2481 Ga0207712_10057243
2482 Ga0207712_10388714
2483 Ga0207712_10884699
2484 Ga0207712_11914681
2485 Ga0207668_10013333
2486 Ga0207668_10047708
2487 Ga0207668_10085181
2488 Ga0207668_10374965
2489 Ga0207668_10528439
2490 Ga0207668_10636147
2491 Ga0207668_10927951
2492 Ga0207668_11147218
2493 Ga0207668_11497823
2494 Ga0207640_10298194
2495 Ga0207640_10465812
2496 Ga0207640_10531339
2497 Ga0207640_10545035
2498 Ga0207640_11227400
2499 Ga0207640_11274829
2500 Ga0207658_10193212
2501 Ga0207658_10304636
2502 Ga0207658_10981278
2503 Ga0207658_11079085
2504 Ga0207677_10015130
2505 Ga0207677_10063701
2506 Ga0207703_10097777
2507 Ga0207703_10209413
2508 Ga0207703_10251105
2509 Ga0207703_10775852
2510 Ga0207703_11406455
2511 Ga0207639_10022677
2512 Ga0207639_10071933
2513 Ga0207639_10084661
2514 Ga0207639_10581839
2515 Ga0207639_10694494
2516 Ga0207639_12187392
2517 Ga0207678_10155088
2518 Ga0207678_10162209
2519 Ga0207678_10253588
2520 Ga0207678_10674527
2521 Ga0207678_11362880
2522 Ga0207678_11861889
2523 Ga0207708_10052763
2524 Ga0207708_11470586
2525 Ga0207702_10000005
2526 Ga0207702_10018516
2527 Ga0207702_10205301
2528 Ga0207702_10360799
2529 Ga0207702_11188008
2530 Ga0207702_12203316
2531 Ga0207641_10437414
2532 Ga0207641_10638346
2533 Ga0207641_10733058
2534 Ga0207648_10164176
2535 Ga0207648_11033849
2536 Ga0207648_11041264
2537 Ga0207648_11795369
2538 Ga0207676_10466374
2539 Ga0207676_10788454
2540 Ga0207676_12228019
2541 Ga0207674_10028556
2542 Ga0207674_10090864
2543 Ga0207674_10170416
2544 Ga0207674_10348816
2545 Ga0207675_100096830
2546 Ga0207675_100174781
2547 Ga0207675_100195761
2548 Ga0207683_10095129
2549 Ga0207683_10099596
2550 Ga0207683_10124581
2551 Ga0207683_10406819
2552 Ga0207683_10833926
2553 Ga0207683_11229216
2554 Ga0207698_10055219
2555 Ga0207698_11153787
2556 Ga0207698_11299061
2557 Ga0207698_11767886
2558 Ga0207698_11875379
2559 Ga0209589_1000018
2560 Ga0209489_100026
2561 Ga0209700_100035
2562 Ga0209179_1059022
2563 Ga0209179_1127771
2564 Ga0209588_1018157
2565 Ga0209588_1150638
2566 Ga0209813_10242785
2567 Ga0207428_10545785
2568 Ga0268266_10061797
2569 Ga0268266_10073425
2570 Ga0268266_10074719
2571 Ga0268266_10129418
2572 Ga0268266_10432944
2573 Ga0268266_10512564
2574 Ga0268265_10218062
2575 Ga0268265_10319468
2576 Ga0268265_10709541
2577 Ga0268265_11389090
2578 Ga0268265_11437857
2579 Ga0268265_12565431
2580 Ga0268264_10000096
2581 Ga0268264_10654995
2582 Ga0268264_10666017
2583 Ga0268264_10785903
2584 Ga0265334_10011607
2585 Ga0307517_10000049
2586 Ga0307517_10497589
2587 Ga0307515_10389190
2588 Ga0307515_10414782
2589 Ga0307515_10583891
2590 Ga0307515_10779836
2591 Ga0265338_10774896
2592 Ga0307511_10198086
2593 Ga0265763_1030814
2594 Ga0265330_10003983
2595 Ga0265330_10076540
2596 Ga0265330_10104976
2597 Ga0265330_10128906
2598 Ga0265332_10093032
2599 Ga0265325_10265263
2600 Ga0265340_10012561
2601 Ga0265340_10017348
2602 Ga0265339_10008611
2603 Ga0265339_10070095
2604 Ga0265339_10517743
2605 Ga0265331_10162904
2606 Ga0265316_10537539
2607 Ga0265316_10826260
2608 Ga0265316_11009934
2609 Ga0307513_10088523
2610 Ga0307513_10155863
2611 Ga0307513_10841173
2612 Ga0307513_10882819
2613 Ga0307509_10587857
2614 Ga0307509_10613045
2615 Ga0307509_10679025
2616 Ga0307408_100199014
2617 Ga0307408_100940495
2618 Ga0307508_10000731
2619 Ga0307508_10054710
2620 Ga0307508_10072072
2621 Ga0307508_10151659
2622 Ga0307514_10307685
2623 Ga0265314_10013390
2624 Ga0265314_10408282
2625 Ga0265342_10292805
2626 Ga0265342_10450628
2627 Ga0307516_10018018
2628 Ga0307516_10118652
2629 Ga0307516_10269504
2630 Ga0307516_10280878
2631 Ga0307516_10501689
2632 Ga0307516_10501846
2633 Ga0307405_10815430
2634 Ga0307413_10547331
2635 Ga0307410_11193499
2636 Ga0307406_10974300
2637 Ga0307406_11215635
2638 Ga0307412_10424043
2639 Ga0307412_10761035
2640 Ga0307411_10043403
2641 Ga0307411_11526294
2642 Ga0307415_100233697
2643 Ga0307415_101409146
2644 Ga0307510_10024603
2645 Ga0307510_10029438
2646 Ga0307510_10059937
2647 Ga0307510_10205350
2648 Ga0315911_1000011
2649 Ga0316214_1029407
2650 Ga0316212_1031585
2651 Ga0373950_0116448
2652 Ga0373926_0005959
2653 Ga0373926_0380901
2654 Ga0373929_0006593
2655 Ga0373934_0010297
2656 Ga0373934_0029548
2657 Ga0373940_0156661
2658 Ga0373944_0040097
2659 Ga0373944_0199167
2660 Ga0373949_0132794
2661 Ga0373951_0104252
2662 Ga0373923_0020587
2663 Ga0373923_0051471
2664 Ga0373932_0007201
2665 Ga0373932_0203447
2666 Ga0373936_0004101
2667 Ga0373936_0013140
2668 Ga0373936_0032185
2669 Ga0373936_0087161
2670 Ga0373936_0104690
2671 Ga0373939_0027867
2672 Ga0373941_0271671
2673 Ga0373941_0298140
2674 Ga0373945_0021976
2675 Ga0373945_0106499
2676 Ga0373945_0325368
2677 Ga0373953_0002102
2678 Ga0373953_0032224
2679 Ga0373953_0049200
2680 Ga0373954_0003682
2681 Ga0373954_0003903
2682 Ga0373954_0064964
2683 Ga0373954_0179576
2684 Ga0373956_0087005
2685 Ga0373956_0192506
2686 Ga0373957_0050529
2687 Ga0373957_0270436
2688 Ga0373960_0140826
2689 Ga0373943_0013515
2690 Ga0373943_0019155
2691 Ga0373943_0159136
2692 Ga0373946_0007469
2693 Ga0373946_0019231
2694 Ga0373946_0033987
2695 Ga0373946_0237641
2696 Ga0373946_0500378
2697 Ga0373955_0002813
2698 Ga0373955_0004594
2699 Ga0373955_0031043
2700 Ga0373955_0066668
2701 Ga0373955_0401979
2702 Ga0373942_0383683
2703 Ga0373962_0059436
2704 Ga0373962_0115549
2705 Ga0373924_0008710
2706 Ga0373924_0038459
2707 Ga0373924_0102591
2708 Ga0373924_0116917
2709 Ga0373931_0010082
2710 Ga0373931_0107836
2711 Ga0373931_0125247
2712 Ga0373931_0210435
2713 Ga0373931_0570184
2714 Ga0373935_0033366
2715 Ga0373935_0070809
2716 Ga0373935_0095773
2717 Ga0373935_0174430
2718 Ga0373935_0261731
2719 Ga0373927_0002864
2720 Ga0373927_0003673
2721 Ga0373927_0010232
2722 Ga0373927_0010787
2723 Ga0373927_0027325
2724 Ga0373927_0065850
2725 Ga0373927_0115311
2726 Ga0373927_1007703
2727 Ga0373933_0000466
2728 Ga0373933_0216019
2729 Ga0373933_0339166
2730 Ga0373933_0354758
2731 Ga0373933_0631550
2732 Ga0373947_0014032
2733 Ga0373947_0021300
2734 Ga0373947_0066819
2735 Ga0373947_0889459
2736 Ga0373937_0158941
2737 Ga0373937_0851548
2738 Ga0373937_1025702
2739 Ga0373937_1376277
2740 Ga0373937_1798487
2741 Ga0373925_0012681
2742 Ga0373925_0021354
2743 Ga0373925_0027352
2744 Ga0373925_0066476
2745 Ga0373925_0077878
2746 Ga0373925_0232102
2747 Ga0373925_0271728
2748 Ga0373925_0411782
2749 Ga0373925_0520156
2750 Ga0395899_0502013
2751 Ga0395900_0092192
2752 Ga0395900_0398077
2753 Ga0395900_0865802
2754 Ga0395900_0955183
2755 Ga0395898_0174963
2756 Ga0395905_0135856
2757 Ga0395905_0384353
2758 Ga0395905_0622403
2759 Ga0395905_1322460
2760 Ga0436364_0367164
2761 Ga0436364_0570855
2762 Ga0436364_0710321
2763 Ga0395901_0282898
2764 Ga0395901_0310793
2765 Ga0395901_0400732
2766 Ga0436365_0063216
2767 Ga0436365_0341884
2768 Ga0436365_0521739
2769 Ga0436365_0986223
2770 Ga0436365_1184573
2771 Ga0436365_1331614
2772 Ga0436365_1546547
2773 Ga0436365_1592603
2774 Ga0436365_1707337
2775 Ga0436360_0142267
2776 Ga0436360_0745328
2777 Ga0436360_1338677
2778 Ga0436361_0236119
2779 Ga0436361_0437201
2780 Ga0436361_0889836
2781 Ga0436361_0906525
2782 Ga0436361_0993311
2783 Ga0436363_0239993
2784 Ga0436363_0564280
2785 Ga0436363_1076737
2786 Ga0436363_1285406
2787 Ga0436363_1431327
2788 Ga0436363_1567451
2789 Ga0436363_1586010
2790 Ga0436363_1718188
2791 Ga0436362_0127034
2792 Ga0436362_0635133
2793 Ga0436362_1052023
2794 Ga0439461_0126632
2795 Ga0439465_0292946
2796 Ga0451787_685306
2797 Ga0451791_0302238
2798 Ga0451793_1902718
2799 Ga0451797_0178116
2800 Ga0451798_0525704
2801 Ga0451798_0766331
2802 Ga0451806_573896
2803 Ga0451804_0932924
2804 Ga0451837_0039678
2805 Ga0451839_0744572
2806 Ga0451849_0110876
2807 Ga0451853_1409169
2808 Ga0439442_161171
2809 Ga0439455_0066730
2810 Ga0439440_0036338
2811 Ga0466969_0203686
2812 Ga0466969_0493348
2813 Ga0466965_0209519
2814 Ga0466966_0355105
2815 Ga0466966_0947857
2816 Ga0466961_0050554
2817 Ga0466963_0066871
2818 Ga0466963_0192978
2819 Ga0466963_0460604
2820 Ga0466964_0177002
2821 Ga0466964_0184585
2822 Ga0466964_0473245
2823 Ga0466971_0096053
2824 Ga0466968_0249357
2825 Ga0466968_0302093
2826 Ga0466968_0517622
2827 Ga0466970_0212186
2828 Ga0466957_0100830
2829 Ga0466957_0100932
2830 Ga0466957_0135927
2831 Ga0466957_1002090
2832 Ga0466959_0077576
2833 Ga0466959_0122873
2834 Ga0466959_0368600
2835 Ga0466959_0374067
2836 Ga0466959_0615049
2837 Ga0466958_0497578
2838 Ga0466967_0058260
2839 Ga0466967_0518670
2840 Ga0466967_0895125
2841 Ga0466967_1121943
2842 Ga0466967_1221002
2843 Ga0495617_014228
2844 Ga0495592_0014958
2845 Ga0495592_0043583
2846 Ga0495592_0065311
2847 Ga0495592_0091605
2848 Ga0495592_0368385
2849 Ga0495603_0009404
2850 Ga0495603_0014373
2851 Ga0495603_0014979
2852 Ga0495603_0016796
2853 Ga0495603_0042944
2854 Ga0495603_0113512
2855 Ga0495603_0189645
2856 Ga0495603_0269844
2857 Ga0495590_0091217
2858 Ga0495590_0242746
2859 Ga0495629_0000613
2860 Ga0495629_0017830
2861 Ga0495629_0040867
2862 Ga0495629_0111404
2863 Ga0495629_0111418
2864 Ga0495629_0532630
2865 Ga0495629_0771007
2866 Ga0495638_0042575
2867 Ga0495638_0289831
2868 Ga0495638_0328574
2869 Ga0495641_0003482
2870 Ga0495641_0169821
2871 Ga0495651_0032896
2872 Ga0495651_0162003
2873 Ga0495651_0173806
2874 Ga0495651_0339993
2875 Ga0495651_0368488
2876 Ga0495653_0018693
2877 Ga0495653_0101477
2878 Ga0495650_0192206
2879 Ga0495580_0015760
2880 Ga0495580_0037287
2881 Ga0495580_0423702
2882 Ga0495582_0000354
2883 Ga0495582_0029563
2884 Ga0495582_0049634
2885 Ga0495582_0057451
2886 Ga0495582_0216545
2887 Ga0495582_0774766
2888 Ga0495605_0105093
2889 Ga0495605_0227067
2890 Ga0495639_0000140
2891 Ga0495639_0049373
2892 Ga0495639_0244899
2893 Ga0495639_0468958
2894 Ga0495639_0604451
2895 Ga0495662_0010658
2896 Ga0495662_0077201
2897 Ga0495662_0108703
2898 Ga0495664_0045438
2899 Ga0495664_0192392
2900 Ga0495664_0200726
2901 Ga0495664_0628833
2902 Ga0495664_0955557
2903 Ga0495584_0082641
2904 Ga0495584_0414117
2905 Ga0495585_0098194
2906 Ga0495585_0137054
2907 Ga0495594_0000198
2908 Ga0495594_0174150
2909 Ga0495596_0178342
2910 Ga0495606_0002687
2911 Ga0495606_0136669
2912 Ga0495606_0355431
2913 Ga0495608_0105818
2914 Ga0495608_0151351
2915 Ga0495608_0580030
2916 Ga0495610_0062565
2917 Ga0495610_0131844
2918 Ga0495610_0213145
2919 Ga0495610_0222809
2920 Ga0495616_0117900
2921 Ga0495616_0176797
2922 Ga0495616_0203889
2923 Ga0495618_0065533
2924 Ga0495618_0102863
2925 Ga0495618_0138628
2926 Ga0495618_0183687
2927 Ga0495618_0323491
2928 Ga0495620_0140670
2929 Ga0495628_0018107
2930 Ga0495628_0022236
2931 Ga0495628_0041672
2932 Ga0495628_0065353
2933 Ga0495630_0020468
2934 Ga0495630_0052250
2935 Ga0495630_0186619
2936 Ga0495631_0050891
2937 Ga0495631_0068928
2938 Ga0495631_0518398
2939 Ga0495632_0166879
2940 Ga0495632_0241351
2941 Ga0495643_0504646
2942 Ga0495644_0421631
2943 Ga0495648_0078089
2944 Ga0495648_0186538
2945 Ga0495663_0190439
2946 Ga0495666_0018838
2947 Ga0495666_0112865
2948 Ga0495666_0115885
2949 Ga0495652_0032645
2950 Ga0495652_0049225
2951 Ga0495652_0203923
2952 Ga0495652_0208934
2953 Ga0495652_0708619
2954 Ga0495665_0021456
2955 Ga0495665_0112957
2956 Ga0495640_0024235
2957 Ga0495640_0025557
2958 Ga0495640_0025627
2959 Ga0495640_0118037
2960 Ga0495640_0255291
2961 Ga0495640_0289683
2962 Ga0495586_0037796
2963 Ga0495586_0317554
2964 Ga0495587_0035917
2965 Ga0495587_0059128
2966 Ga0495587_0200679
2967 Ga0495598_0113678
2968 Ga0495609_0035099
2969 Ga0495597_0166257
2970 Ga0495645_0163967
2971 Ga0495645_0264314
2972 Ga0495645_0689287
2973 Ga0495645_0808773
2974 Ga0495622_0016759
2975 Ga0495622_0163687
2976 Ga0495622_0224576
2977 Ga0495667_0003356
2978 Ga0495667_0019293
2979 Ga0495667_0052675
2980 Ga0495667_0176474
2981 Ga0495667_0280803
2982 Ga0495656_0005814
2983 Ga0495656_0171849
2984 Ga0495668_0078445
2985 Ga0495668_0530980
2986 Ga0495634_0004959
2987 Ga0495634_0011642
2988 Ga0495634_0042389
2989 Ga0495634_0246183
2990 Ga0495611_0200268
2991 Ga0495625_0728227
2992 Ga0495635_0003204
2993 Ga0495635_0123500
2994 Ga0495635_0124409
2995 Ga0495661_0183860
2996 Ga0495661_0422600
2997 Ga0495588_0005521
2998 Ga0495588_0240579
2999 Ga0495588_0290350
3000 Ga0495657_0016048
3001 Ga0495657_0063091
3002 Ga0495599_0004470
3003 Ga0495599_0038853
3004 Ga0495599_0052626
3005 Ga0495599_0236615
3006 Ga0495623_0101004
3007 Ga0495623_0116121
3008 Ga0495623_0142086
3009 Ga0495646_0012855
3010 Ga0495646_0018662
3011 Ga0495646_0023205
3012 Ga0495647_0024985
3013 Ga0495647_0035229
3014 Ga0495647_0106711
3015 Ga0495658_0000888
3016 Ga0495658_0024311
3017 Ga0495658_0242565
3018 Ga0495658_0259464
3019 Ga0495669_0011937
3020 Ga0495669_0016724
3021 Ga0495669_0516119
3022 Ga0495669_0591347
3023 Ga0495669_0626707
3024 Ga0495613_0004930
3025 Ga0495613_0026647
3026 Ga0495613_0049642
3027 Ga0495613_0228106
3028 Ga0495624_0014296
3029 Ga0495624_0031976
3030 Ga0495624_0514485
3031 Ga0495670_0289113
3032 Ga0495670_0705379
3033 Ga0495670_0816391
3034 Ga0495671_0069276
3035 Ga0495671_0258088
3036 Ga0495649_0183835
3037 Ga0495589_0198788
3038 Ga0495589_0258357
3039 Ga0495600_0010040
3040 Ga0495600_0014804
3041 Ga0495600_0134365
3042 Ga0495600_0383849
3043 Ga0495600_0548353
3044 Ga0495600_0619142
3045 Ga0495600_0636127
3046 Ga0495581_0000600
3047 Ga0495581_0180415
3048 Ga0495581_0227293
3049 Ga0495581_0478735
3050 Ga0495581_0494080
3051 Ga0495581_0722645
3052 Ga0495604_0032194
3053 Ga0495604_0293465
3054 Ga0495604_0449014
3055 Ga0495604_0731819
3056 Ga0495674_0000559
3057 Ga0495674_0027226
3058 Ga0495674_0036979
3059 Ga0495674_0307235
3060 Ga0495674_0720517
3061 Ga0495674_0736584
3062 Ga0495674_0935523
3063 Ga0495672_0006823
3064 Ga0495672_0185064
3065 Ga0495672_0189842
3066 Ga0495676_0063084
3067 Ga0495676_0077323
3068 Ga0495676_1115302
3069 Ga0495680_0023759
3070 Ga0495680_0216291
3071 Ga0495675_0200553
3072 Ga0495675_0225460
3073 Ga0495685_065541
3074 Ga0495673_0022015
3075 Ga0495673_0169106
3076 Ga0495684_0004169
3077 Ga0495684_0018085
3078 Ga0495684_0025746
3079 Ga0495684_0136491
3080 Ga0495686_0201235
3081 Ga0495686_0474691
3082 Ga0495593_0010511
3083 Ga0495593_0015108
3084 Ga0495593_0112655
3085 Ga0495593_0118269
3086 Ga0495602_0048612
3087 Ga0495602_0119490
3088 Ga0495602_0121856
3089 Ga0495614_0120054
3090 Ga0495614_0482762
3091 Ga0496100_0046021
3092 Ga0496100_0050707
3093 Ga0496100_0052796
3094 Ga0496100_0071267
3095 Ga0496100_0316437
3096 Ga0496100_0557560
3097 Ga0496100_0615096
3098 Ga0496100_0621164
3099 Ga0496101_0031805
3100 Ga0496101_0038658
3101 Ga0496101_0081744
3102 Ga0496101_0087255
3103 Ga0496101_0115840
3104 Ga0496101_0205977
3105 Ga0496101_0297279
3106 Ga0496101_0335861
3107 Ga0496102_0040369
3108 Ga0496102_0235381
3109 Ga0496102_0261400
3110 Ga0496102_0711138
3111 Ga0496103_0045684
3112 Ga0496103_0375969
3113 Ga0496103_0483396
3114 Ga0496103_0498542
3115 Ga0496103_0663955
3116 Ga0496104_0028279
3117 Ga0496104_0034259
3118 Ga0496104_0051847
3119 Ga0496104_0515383
3120 Ga0496104_0790186
3121 Ga0496104_0824417
3122 Ga0496105_0008852
3123 Ga0496105_0025832
3124 Ga0496105_0036011
3125 Ga0496105_0522331
3126 Ga0496106_0034402
3127 Ga0496106_0035026
3128 Ga0496106_0047123
3129 Ga0496106_0055110
3130 Ga0496106_0059950
3131 Ga0496106_0288994
3132 Ga0496106_0311545
3133 Ga0496106_0526078
3134 Ga0496106_0565297
3135 Ga0496106_0626290
3136 Ga0496107_0098614
3137 Ga0496107_0283617
3138 Ga0496108_0003043
3139 Ga0496108_0197454
3140 Ga0496108_0198549
3141 Ga0496108_0332468
3142 Ga0496108_0533638
3143 Ga0496108_0778245
3144 Ga0496108_0831821
3145 Ga0496109_0009711
3146 Ga0496109_0149407
3147 Ga0496109_0191019
3148 Ga0496109_0198648
3149 Ga0496109_0581071
3150 Ga0496109_1662183
3151 Ga0496109_1919558
3152 Ga0496110_0004491
3153 Ga0496110_0005229
3154 Ga0496110_0088768
3155 Ga0496110_0339977
3156 Ga0496110_0367549
3157 Ga0496110_0411415
3158 Ga0496110_1314802
3159 Ga0496110_1709304
3160 Ga0496111_0009814
3161 Ga0496111_0031327
3162 Ga0496111_0172410
3163 Ga0496111_0267541
3164 Ga0496111_0551614
3165 Ga0496111_0632185
3166 Ga0496112_0000046
3167 Ga0496112_0012428
3168 Ga0496112_0023031
3169 Ga0496112_0071634
3170 Ga0496112_0099111
3171 Ga0496112_0112577
3172 Ga0496112_0163689
3173 Ga0496112_0312861
3174 Ga0496112_0387308
3175 Ga0496112_0556686
3176 Ga0496112_1241505
3177 Ga0496113_0044643
3178 Ga0496113_0048018
3179 Ga0496113_0131622
3180 Ga0496113_0147516
3181 Ga0496113_0267909
3182 Ga0496113_1370963
3183 Ga0496114_0099620
3184 Ga0496114_0196415
3185 Ga0496114_0205692
3186 Ga0496114_0368535
3187 Ga0496114_0586261
3188 Ga0496114_0596970
3189 Ga0496114_0965475
3190 Ga0496114_1470854
3191 Ga0496115_0002909
3192 Ga0496115_0066846
3193 Ga0496115_0066985
3194 Ga0496115_0069623
3195 Ga0496115_0098350
3196 Ga0496115_0212681
3197 Ga0496115_0540473
3198 Ga0496115_0665980
3199 Ga0496117_0070896
3200 Ga0496117_0138996
3201 Ga0496117_0373243
3202 Ga0496118_0006802
3203 Ga0496118_0011822
3204 Ga0496118_0066857
3205 Ga0496118_0128508
3206 Ga0496118_0251502
3207 Ga0496119_0034242
3208 Ga0496119_0111350
3209 Ga0496120_0155353
3210 Ga0496121_0001986
3211 Ga0496121_0018240
3212 Ga0496121_0018643
3213 Ga0496121_0036041
3214 Ga0496121_0166631
3215 Ga0496121_0201014
3216 Ga0496121_0462043
3217 Ga0496121_0521909
3218 Ga0496121_0554476
3219 Ga0496122_0226298
3220 Ga0496122_0306329
3221 Ga0496123_0254621
3222 Ga0496124_0006608
3223 Ga0496124_0080396
3224 Ga0496124_0123368
3225 Ga0496124_0144217
3226 Ga0496124_0303222
3227 Ga0496124_0358801
3228 Ga0496124_0667052
3229 Ga0496125_0000063
3230 Ga0496125_0006261
3231 Ga0496125_0019586
3232 Ga0496125_0061100
3233 Ga0496125_0077973
3234 Ga0496125_0252591
3235 Ga0496125_0412207
3236 Ga0496126_0010555
3237 Ga0496126_0066644
3238 Ga0496126_0106374
3239 Ga0496126_0109200
3240 Ga0496126_0135669
3241 Ga0496126_0180108
3242 Ga0496126_0212877
3243 Ga0496126_0232991
3244 Ga0496126_0342455
3245 Ga0496126_0397278
3246 Ga0496126_0502674
3247 Ga0496126_0612854
3248 Ga0496126_0682209
3249 Ga0496126_0872275
3250 Ga0496126_0884853
3251 Ga0496126_1008170
3252 Ga0495682_0160041
3253 Ga0495682_0204573
3254 Ga0495682_0340248
3255 Ga0501031_0006400
3256 Ga0501031_0012001
3257 Ga0501031_0028674
3258 Ga0501031_0116400
3259 Ga0501032_0001803
3260 Ga0501032_0004911
3261 Ga0501032_0239594
3262 Ga0501033_0000523
3263 Ga0501033_0001240
3264 Ga0501033_0004826
3265 Ga0501033_0024599
3266 Ga0501033_0289234
3267 Ga0501033_0880398
3268 Ga0501034_0000717
3269 Ga0501034_0051314
3270 Ga0501034_0082701
3271 Ga0501034_0088722
3272 Ga0501034_0231883
3273 Ga0501034_0809119
3274 Ga0501036_0000027
3275 Ga0501036_0022965
3276 Ga0501036_0253831
3277 Ga0501036_0418554
3278 Ga0501036_0487067
3279 Ga0501036_1523264
3280 Ga0501037_0000104
3281 Ga0501037_0001986
3282 Ga0501037_0026399
3283 Ga0501037_0029042
3284 Ga0501037_0067887
3285 Ga0501038_0000477
3286 Ga0501038_0011478
3287 Ga0501038_0019478
3288 Ga0501038_0100633
3289 Ga0501038_0361996
3290 Ga0501039_0001050
3291 Ga0501039_0036741
3292 Ga0501039_0325226
3293 Ga0501039_0334264
3294 Ga0501039_0833716
3295 Ga0501040_0006915
3296 Ga0501040_0123072
3297 Ga0501042_0026182
3298 Ga0501042_0042559
3299 Ga0501042_0249237
3300 Ga0501043_0000076
3301 Ga0501043_0005019
3302 Ga0501043_0012465
3303 Ga0501043_0085138
3304 Ga0501043_0186687
3305 Ga0501043_0192722
3306 Ga0501046_0001785
3307 Ga0501046_0008324
3308 Ga0501046_0213911
3309 Ga0501047_0000123
3310 Ga0501047_0027982
3311 Ga0501047_0063198
3312 Ga0501047_0105537
3313 Ga0501047_0527750
3314 Ga0501047_1134197
3315 Ga0501048_0001197
3316 Ga0501048_0009900
3317 Ga0501067_0003629
3318 Ga0501067_0012611
3319 Ga0501068_0005455
3320 Ga0501068_0198448
3321 Ga0501069_0029662
3322 Ga0501070_0003948
3323 Ga0501070_0019003
3324 Ga0501070_0029926
3325 Ga0501070_0411142
3326 Ga0501070_0713467
3327 Ga0501071_0016328
3328 Ga0501071_0036287
3329 Ga0501071_0300531
3330 Ga0501072_0009992
3331 Ga0501072_0011011
3332 Ga0501072_0051068
3333 Ga0501073_0000014
3334 Ga0501073_0048823
3335 Ga0501073_0050698
3336 Ga0501073_0172707
3337 Ga0501074_0000615
3338 Ga0501074_0019020
3339 Ga0501075_0117688
3340 Ga0501075_1396422
3341 Ga0501076_0470144
3342 Ga0501079_0000830
3343 Ga0501079_0009379
3344 Ga0501079_1049956
3345 Ga0501079_1348852
3346 Ga0501080_0000547
3347 Ga0501080_0080707
3348 Ga0501080_0291576
3349 Ga0501081_0306248
3350 Ga0501081_1221894
3351 Ga0501083_0000174
3352 Ga0501083_0043137
3353 Ga0501035_0001320
3354 Ga0501035_0001597
3355 Ga0501035_0024312
3356 Ga0501035_0034283
3357 Ga0501035_0061445
3358 Ga0501035_0110858
3359 Ga0501035_0255463
3360 Ga0501035_0336441
3361 Ga0501044_0012380
3362 Ga0501044_0013936
3363 Ga0501044_0034011
3364 Ga0501044_0055534
3365 Ga0501044_0070448
3366 Ga0501044_0086977
3367 Ga0501044_0201252
3368 Ga0501044_0408151
3369 Ga0501045_0013305
3370 Ga0501045_0174546
3371 Ga0501045_0426907
3372 nmdc:mga03683_161160_c1
3373 nmdc:mga03683_31811_c1
3374 nmdc:mga03n38_298928_c1
3375 nmdc:mga03n38_450763_c1
3376 nmdc:mga00v17_392786_c1
3377 nmdc:mga00v17_47772_c1
3378 nmdc:mga0yw44_189421_c1
3379 nmdc:mga0yw44_37742_c1
3380 nmdc:mga0yw44_481599_c1
3381 nmdc:mga0yw44_610969_c1
3382 nmdc:mga0k408_174724_c1
3383 nmdc:mga0k408_341720_c1
3384 nmdc:mga06z11_158583_c1
3385 nmdc:mga06z11_478689_c1
3386 nmdc:mga06z11_552963_c1
3387 nmdc:mga06z11_692515_c1
3388 nmdc:mga04h51_313894_c1
3389 nmdc:mga07m45_128548_c1
3390 nmdc:mga07m45_222870_c1
3391 nmdc:mga05p37_671762_c1
3392 nmdc:mga05p37_75721_c1
3393 nmdc:mga08y16_1139274_c1
3394 nmdc:mga08y16_549393_c1
3395 nmdc:mga0n895_211449_c1
3396 nmdc:mga0rr50_1057741_c1
3397 nmdc:mga0rr50_505013_c1
3398 nmdc:mga08x19_113391_c1
3399 nmdc:mga08x19_1230309_c1
3400 nmdc:mga08x19_837281_c1
3401 nmdc:mga0a205_723618_c1
3402 nmdc:mga0sz30_46403_c1
3403 Ga0495601_0032181
3404 Ga0495601_0126922
3405 Ga0495601_0133917
3406 Ga0495601_0198588
3407 Ga0495601_0284115
3408 Ga0495612_0043479
3409 Ga0495612_0050233
3410 Ga0495612_0222109
3411 Ga0495612_0233479
3412 Ga0495612_0255290
3413 Ga0500635_0058336
3414 Ga0500635_0059408
3415 Ga0495655_0211203
3416 Ga0495595_0009446
3417 Ga0495595_0148261
3418 Ga0495595_0404740
3419 Ga0495619_0014450
3420 Ga0495619_0080719
3421 Ga0495619_0393790
3422 Ga0495619_0673392
3423 Ga0500643_089644
3424 Ga0500644_0136437
3425 Ga0500647_0178692
3426 Ga0500647_0266953
3427 Ga0500651_0070589
3428 Ga0500566_0000254
3429 Ga0500566_0003600
3430 Ga0500566_0211549
3431 Ga0500566_0303082
3432 Ga0500640_051642
3433 Ga0500641_0021282
3434 Ga0500641_0165216
3435 Ga0500641_0369353
3436 Ga0500554_004284
3437 Ga0500554_006809
3438 Ga0500555_171278
3439 Ga0500556_0042140
3440 Ga0500562_120112
3441 Ga0500569_158403
3442 Ga0500572_000178
3443 Ga0500572_005818
3444 Ga0500591_073827
3445 Ga0500594_0258797
3446 Ga0500595_002259
3447 Ga0500595_003316
3448 Ga0500595_008308
3449 Ga0500595_023364
3450 Ga0500595_025393
3451 Ga0500607_258411
3452 Ga0500608_045172
3453 Ga0500614_015435
3454 Ga0500614_111579
3455 Ga0500617_219617
3456 Ga0500621_214738
3457 Ga0500642_0067899
3458 Ga0500658_0529480
3459 Ga0500658_0573983
3460 Ga0500559_0002150
3461 Ga0500559_0002386
3462 Ga0500559_0103041
3463 Ga0500561_0285191
3464 Ga0500568_0010703
3465 Ga0500568_0020007
3466 Ga0500568_0150436
3467 Ga0500573_0083630
3468 Ga0500577_0365448
3469 Ga0500588_0234075
3470 Ga0500588_0386986
3471 Ga0500590_059871
3472 Ga0500590_182781
3473 Ga0500590_200691
3474 Ga0500603_000282
3475 Ga0500603_001384
3476 Ga0500603_011894
3477 Ga0500603_182662
3478 Ga0500604_0236855
3479 Ga0500616_0000084
3480 Ga0500616_0076717
3481 Ga0500622_0006086
3482 Ga0500627_0137977
3483 Ga0500630_001999
3484 Ga0500638_019089
3485 Ga0500638_051677
3486 Ga0500638_186828
3487 Ga0500638_193729
3488 Ga0500639_000025
3489 Ga0500639_169843
3490 Ga0500639_197028
3491 Ga0500636_0017152
3492 Ga0500636_0033663
3493 Ga0500636_0078103
3494 Ga0500636_0096663
3495 Ga0500636_0539956
3496 Ga0500637_0000520
3497 Ga0500637_0005157
3498 Ga0500637_0060228
3499 Ga0500637_0110048
3500 Ga0500576_010807
3501 Ga0500611_135833
3502 Ga0500656_015674
3503 Ga0500552_004980
3504 Ga0500596_001469
3505 Ga0500596_002457
3506 Ga0500596_003890
3507 Ga0500601_044126
3508 Ga0501084_0003729
3509 Ga0501084_0034764
3510 Ga0501084_0524440
3511 Ga0500661_004207
3512 Ga0500661_095768
3513 Ga0587073_0218694
3514 Ga0587090_024678
3515 Ga0587091_202700
3516 Ga0587129_014690
3517 Ga0587128_033317
3518 Ga0587078_054878
3519 Ga0501082_0002368
3520 Ga0501082_0043704
3521 Ga0501082_0575236
3522 Ga0466962_0135371
3523 2513661279
3524 2513673107
3525 2513697034
3526 2513723768
3527 2513858172
3528 2513891991
3529 2513923000
3530 2517893937
3531 2524540707
3532 2671122927
3533 2723846475
3534 2728748055
3535 2793072820
3536 2793076856
3537 2856325746
3538 2869279364
3539 2874145111
3540 2874610557
3541 2876810242
3542 2878743310
3543 2879111751
3544 2885379964
3545 2885389021
3546 2888340039
3547 2888388333
3548 2889039006
3549 2903451935
3550 2903749544
3551 2903774649
3552 2904693415
3553 2906610830
3554 2906636018
3555 2906663914
3556 2908744340
3557 2908761932
3558 2922428499
3559 2924723301
3560 2924739515
3561 2924781121
3562 2935634483
3563 2937877545
3564 2937975372
3565 2941508969
3566 2941516798
3567 2941525107
3568 2958035504
3569 2958043691
3570 2958084652
3571 2958152120
3572 2968017948
3573 2968087635
3574 2970471877
3575 2970593960
3576 2996350805
3577 3004169468
3578 3004277503
3579 3004295265
3580 3005478624
3581 8006942737
3582 8006964874
3583 8006982460
3584 8006995599
3585 8019558502
3586 8019566796
3587 8056685029
3588 8056691815

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

24

142

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zko-assembly1.cif.gz_A crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution 0.9937 2 119
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9793 1 120
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9726 2 118
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9709 2 120
3a7a-assembly2.cif.gz_D crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.966 2 118
ID Description Score Start End Superfamily
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9881 3 119 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9792 1 120 2.40.50.100
af_Q54JU3_2_142_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9745 2 121 2.40.50.100
af_Q54JV8_6_144_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9742 2 121 2.40.50.100
af_Q9U616_24_160_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9728 2 121 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A0N0KIH5-F1-model_v4 Glycine cleavage system H protein 0.9995 1 121 GO:0005829
GO:0005960
GO:0019464
AF-A0A0S3PS46-F1-model_v4 Glycine cleavage system H protein 0.9946 1 120 GO:0005829
GO:0005960
GO:0019464
AF-A0NV99-F1-model_v4 Glycine cleavage system H protein 0.9943 1 120 GO:0005829
GO:0005960
GO:0019464
AF-A0A6M1YG53-F1-model_v4 Glycine cleavage system H protein 0.994 3 120 GO:0005829
GO:0005960
GO:0019464
AF-A0A7M5XMK7-F1-model_v4 Glycine cleavage system H protein 0.994 2 120 GO:0005739
GO:0005960
GO:0019464

Map