F495724
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1794 | 619 | 3588 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300035111|Ga0373923_0066378|Ga0373923_0066378_607_1035 |
| Length | 142 |
| Sequence | LPTPTSAEFATAEFENAEEFVMTTLYTADHEWLRIEGDVATIGVTDYAQSQLGDVVFVELPKVGRSLKKAEAAAVVESVKAASDVYAPISGEVLEVNDAVTAEPALVNSDAAGKAWFFKMKIADKGELGGLMDEAAYAKHTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 88 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 89 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 90 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 91 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 103 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 104 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 110 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 111 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 112 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 113 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 114 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 115 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 130 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 148 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 149 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 150 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 151 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 152 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 153 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 154 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 225 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 226 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 227 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 231 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 236 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 237 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 239 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 243 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 244 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 246 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 247 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 248 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 249 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 250 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 251 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 252 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 253 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 254 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 255 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 256 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 257 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 258 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 259 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 260 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 261 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 262 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 263 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 264 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 265 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 266 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 267 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 268 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 269 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 272 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 276 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 277 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 278 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 279 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 280 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 281 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 283 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 284 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 285 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 286 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 287 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 288 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 289 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 290 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 291 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 292 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 293 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 294 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 295 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 296 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 298 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 299 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 300 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 301 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 302 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 303 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 304 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 305 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 306 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 307 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 308 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 309 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 310 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 313 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 315 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 316 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 317 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 318 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 319 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 320 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 321 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 322 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 323 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 324 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 325 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 326 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 327 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 328 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 329 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 330 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 331 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 332 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 333 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 334 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 335 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 336 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 337 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 420 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 421 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 422 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 423 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 424 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 425 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 426 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 427 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 428 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 429 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 430 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 431 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 432 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 433 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 434 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 435 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 436 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 437 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 438 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 439 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 440 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 441 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 442 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 443 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 444 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 445 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 477 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 478 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 479 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 480 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 481 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 482 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 483 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 484 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 485 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 486 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 487 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 488 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 489 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 490 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 491 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 492 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 495 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 499 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 500 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 501 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 502 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 503 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 504 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 505 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 506 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 507 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 508 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 509 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 510 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 511 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 512 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 513 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 514 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 515 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 516 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 517 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 518 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 519 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 520 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 521 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 522 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 523 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 524 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 525 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 526 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 527 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 528 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 529 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 530 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 531 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 532 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 533 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 534 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 535 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 536 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 537 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 538 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 539 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 540 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 541 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 542 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 543 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 544 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 545 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 546 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 547 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 548 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 549 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 550 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 551 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 553 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 554 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 555 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 556 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 557 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 558 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 559 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 560 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 561 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 562 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 563 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 564 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 565 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 566 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 567 | 2791355199 | |||
| 568 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 569 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 570 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 571 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 572 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 573 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 574 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 575 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 576 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 577 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 578 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 579 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 580 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 581 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 582 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 583 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 584 | 2906610324 | |||
| 585 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 586 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 587 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 588 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 589 | 2922425934 | |||
| 590 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 591 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 592 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 593 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 594 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 595 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 596 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 597 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 598 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 599 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 600 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 601 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 602 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 603 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 604 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 605 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 606 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 607 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 608 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 609 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 610 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 611 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 612 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 613 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 614 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 615 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 616 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 617 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 618 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 619 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.09 |
| Metatranscriptomes | 0.39 |
| Isolates | 3.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.08 |
| Nodule | 3.23 |
| Rhizoplane | 6.52 |
| Rhizosphere | 75.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373923_0066378 | 3300035111 | Bacteria | 1542 |
| 2 | LJQas_1024377 | 3300000549 | Bacteria | 704 |
| 3 | JGI24740J21852_10053397 | 3300001979 | Bacteria | 1146 |
| 4 | JGI24737J22298_10048933 | 3300001990 | Bacteria | 1286 |
| 5 | JGI24738J21930_10155461 | 3300002075 | Bacteria | 510 |
| 6 | JGI25406J46586_10000108 | 3300003203 | Bacteria | 36424 |
| 7 | JGI25406J46586_10001646 | 3300003203 | Bacteria | 10551 |
| 8 | JGI25165J46597_1024394 | 3300003214 | Bacteria | 785 |
| 9 | JGI25153J46596_10050604 | 3300003215 | Bacteria | 1196 |
| 10 | JGI25404J52841_10000644 | 3300003659 | Bacteria | 5303 |
| 11 | JGI25404J52841_10005197 | 3300003659 | Bacteria | 2683 |
| 12 | JGI25404J52841_10008083 | 3300003659 | Bacteria | 2233 |
| 13 | Ga0055539_1003154 | 3300003752 | Bacteria | 2348 |
| 14 | Ga0055529_1032799 | 3300003763 | Bacteria | 635 |
| 15 | Ga0065712_10488784 | 3300005290 | Bacteria | 657 |
| 16 | Ga0065715_10670048 | 3300005293 | Bacteria | 668 |
| 17 | Ga0065707_10999634 | 3300005295 | Bacteria | 539 |
| 18 | Ga0070658_10260390 | 3300005327 | Bacteria | 1473 |
| 19 | Ga0070658_10295838 | 3300005327 | Bacteria | 1380 |
| 20 | Ga0070676_10487858 | 3300005328 | Bacteria | 873 |
| 21 | Ga0070676_10583999 | 3300005328 | Bacteria | 804 |
| 22 | Ga0070676_11263007 | 3300005328 | Bacteria | 563 |
| 23 | Ga0070683_100014355 | 3300005329 | Bacteria | 6928 |
| 24 | Ga0070683_100088077 | 3300005329 | Bacteria | 2912 |
| 25 | Ga0070683_100242484 | 3300005329 | Bacteria | 1714 |
| 26 | Ga0070683_101817851 | 3300005329 | Bacteria | 586 |
| 27 | Ga0070690_100151047 | 3300005330 | Bacteria | 1585 |
| 28 | Ga0070670_100248435 | 3300005331 | Bacteria | 1550 |
| 29 | Ga0068869_100121997 | 3300005334 | Bacteria | 1994 |
| 30 | Ga0068869_100360168 | 3300005334 | Bacteria | 1187 |
| 31 | Ga0068869_101139702 | 3300005334 | Bacteria | 683 |
| 32 | Ga0068869_101456381 | 3300005334 | Bacteria | 607 |
| 33 | Ga0068869_101752895 | 3300005334 | Bacteria | 555 |
| 34 | Ga0070666_10866789 | 3300005335 | Bacteria | 667 |
| 35 | Ga0070680_100089144 | 3300005336 | Bacteria | 2552 |
| 36 | Ga0070682_100022647 | 3300005337 | Bacteria | 3723 |
| 37 | Ga0070682_100208447 | 3300005337 | Bacteria | 1384 |
| 38 | Ga0070682_100746269 | 3300005337 | Bacteria | 790 |
| 39 | Ga0068868_100050475 | 3300005338 | Bacteria | 3267 |
| 40 | Ga0068868_100289018 | 3300005338 | Bacteria | 1390 |
| 41 | Ga0068868_101210858 | 3300005338 | Bacteria | 698 |
| 42 | Ga0070660_100483094 | 3300005339 | Bacteria | 1029 |
| 43 | Ga0070660_100707145 | 3300005339 | Bacteria | 845 |
| 44 | Ga0070689_100245267 | 3300005340 | Bacteria | 1477 |
| 45 | Ga0070689_100259560 | 3300005340 | Bacteria | 1436 |
| 46 | Ga0070689_100370655 | 3300005340 | Bacteria | 1205 |
| 47 | Ga0070691_10222532 | 3300005341 | Bacteria | 1001 |
| 48 | Ga0070661_100497286 | 3300005344 | Bacteria | 976 |
| 49 | Ga0070661_101060465 | 3300005344 | Bacteria | 674 |
| 50 | Ga0070668_100088077 | 3300005347 | Bacteria | 2443 |
| 51 | Ga0070668_100166340 | 3300005347 | Bacteria | 1792 |
| 52 | Ga0070668_100539036 | 3300005347 | Bacteria | 1014 |
| 53 | Ga0070668_100551290 | 3300005347 | Bacteria | 1003 |
| 54 | Ga0070675_100722419 | 3300005354 | Bacteria | 908 |
| 55 | Ga0070675_102211501 | 3300005354 | Bacteria | 507 |
| 56 | Ga0070671_100648685 | 3300005355 | Bacteria | 914 |
| 57 | Ga0070671_101294720 | 3300005355 | Bacteria | 643 |
| 58 | Ga0070674_100037998 | 3300005356 | Bacteria | 3241 |
| 59 | Ga0070674_100122461 | 3300005356 | Bacteria | 1927 |
| 60 | Ga0070674_100186876 | 3300005356 | Bacteria | 1591 |
| 61 | Ga0070674_100361464 | 3300005356 | Bacteria | 1175 |
| 62 | Ga0070674_100798353 | 3300005356 | Bacteria | 815 |
| 63 | Ga0070673_100261600 | 3300005364 | Bacteria | 1512 |
| 64 | Ga0070673_100534165 | 3300005364 | Bacteria | 1064 |
| 65 | Ga0070673_100818164 | 3300005364 | Bacteria | 861 |
| 66 | Ga0070688_100679056 | 3300005365 | Bacteria | 796 |
| 67 | Ga0070659_100070899 | 3300005366 | Bacteria | 2770 |
| 68 | Ga0070659_100222247 | 3300005366 | Bacteria | 1559 |
| 69 | Ga0070667_100523251 | 3300005367 | Bacteria | 1088 |
| 70 | Ga0070667_100629517 | 3300005367 | Bacteria | 990 |
| 71 | Ga0070667_100968351 | 3300005367 | Bacteria | 793 |
| 72 | Ga0070667_101621456 | 3300005367 | Bacteria | 608 |
| 73 | Ga0070703_10455391 | 3300005406 | Bacteria | 568 |
| 74 | Ga0070709_10000711 | 3300005434 | Bacteria | 18912 |
| 75 | Ga0070709_10005923 | 3300005434 | Bacteria | 6633 |
| 76 | Ga0070709_10010651 | 3300005434 | Bacteria | 5099 |
| 77 | Ga0070709_10034579 | 3300005434 | Bacteria | 3064 |
| 78 | Ga0070709_10050656 | 3300005434 | Bacteria | 2603 |
| 79 | Ga0070709_10337566 | 3300005434 | Bacteria | 1110 |
| 80 | Ga0070709_10564081 | 3300005434 | Bacteria | 873 |
| 81 | Ga0070714_100122613 | 3300005435 | Bacteria | 2313 |
| 82 | Ga0070714_100147745 | 3300005435 | Bacteria | 2115 |
| 83 | Ga0070714_100160171 | 3300005435 | Bacteria | 2035 |
| 84 | Ga0070714_100172101 | 3300005435 | Bacteria | 1966 |
| 85 | Ga0070714_100187955 | 3300005435 | Bacteria | 1883 |
| 86 | Ga0070714_101001809 | 3300005435 | Bacteria | 813 |
| 87 | Ga0070714_101046724 | 3300005435 | Bacteria | 795 |
| 88 | Ga0070713_100009795 | 3300005436 | Bacteria | 6887 |
| 89 | Ga0070713_100013303 | 3300005436 | Bacteria | 6071 |
| 90 | Ga0070713_100016454 | 3300005436 | Bacteria | 5560 |
| 91 | Ga0070713_100099847 | 3300005436 | Bacteria | 2512 |
| 92 | Ga0070713_100931011 | 3300005436 | Bacteria | 836 |
| 93 | Ga0070713_101446220 | 3300005436 | Bacteria | 667 |
| 94 | Ga0070710_10006260 | 3300005437 | Bacteria | 5703 |
| 95 | Ga0070710_10015382 | 3300005437 | Bacteria | 3871 |
| 96 | Ga0070710_10043936 | 3300005437 | Bacteria | 2477 |
| 97 | Ga0070710_10230229 | 3300005437 | Bacteria | 1183 |
| 98 | Ga0070710_10455702 | 3300005437 | Bacteria | 868 |
| 99 | Ga0070710_10598786 | 3300005437 | Bacteria | 767 |
| 100 | Ga0070710_10648406 | 3300005437 | Bacteria | 740 |
| 101 | Ga0070710_10850946 | 3300005437 | Bacteria | 655 |
| 102 | Ga0070711_100019819 | 3300005439 | Bacteria | 4323 |
| 103 | Ga0070711_100038598 | 3300005439 | Bacteria | 3212 |
| 104 | Ga0070711_100045927 | 3300005439 | Bacteria | 2974 |
| 105 | Ga0070711_100083601 | 3300005439 | Bacteria | 2281 |
| 106 | Ga0070711_100117258 | 3300005439 | Bacteria | 1963 |
| 107 | Ga0070711_100179878 | 3300005439 | Bacteria | 1619 |
| 108 | Ga0070711_100579577 | 3300005439 | Bacteria | 934 |
| 109 | Ga0070711_101712159 | 3300005439 | Bacteria | 551 |
| 110 | Ga0070705_101006793 | 3300005440 | Bacteria | 677 |
| 111 | Ga0070700_100056764 | 3300005441 | Bacteria | 2455 |
| 112 | Ga0070700_101946535 | 3300005441 | Bacteria | 509 |
| 113 | Ga0070694_100651404 | 3300005444 | Bacteria | 852 |
| 114 | Ga0070663_100053735 | 3300005455 | Bacteria | 2876 |
| 115 | Ga0070663_100057596 | 3300005455 | Bacteria | 2788 |
| 116 | Ga0070663_100297974 | 3300005455 | Bacteria | 1290 |
| 117 | Ga0070663_100486186 | 3300005455 | Bacteria | 1023 |
| 118 | Ga0070663_100732786 | 3300005455 | Bacteria | 843 |
| 119 | Ga0070663_102062773 | 3300005455 | Bacteria | 514 |
| 120 | Ga0070678_100172355 | 3300005456 | Bacteria | 1764 |
| 121 | Ga0070678_100388036 | 3300005456 | Bacteria | 1210 |
| 122 | Ga0070678_100499506 | 3300005456 | Bacteria | 1073 |
| 123 | Ga0070678_100856078 | 3300005456 | Bacteria | 829 |
| 124 | Ga0070662_100184538 | 3300005457 | Bacteria | 1646 |
| 125 | Ga0070662_100307962 | 3300005457 | Bacteria | 1289 |
| 126 | Ga0070662_101069398 | 3300005457 | Bacteria | 692 |
| 127 | Ga0070662_101287692 | 3300005457 | Bacteria | 629 |
| 128 | Ga0070681_10015887 | 3300005458 | Bacteria | 7506 |
| 129 | Ga0070681_10024393 | 3300005458 | Bacteria | 6088 |
| 130 | Ga0070681_10108764 | 3300005458 | Bacteria | 2712 |
| 131 | Ga0070681_10406727 | 3300005458 | Bacteria | 1273 |
| 132 | Ga0070681_11250672 | 3300005458 | Bacteria | 665 |
| 133 | Ga0070685_10235074 | 3300005466 | Bacteria | 1207 |
| 134 | Ga0070685_10625187 | 3300005466 | Bacteria | 777 |
| 135 | Ga0070685_10908482 | 3300005466 | Bacteria | 656 |
| 136 | Ga0070706_100559633 | 3300005467 | Bacteria | 1063 |
| 137 | Ga0070706_100714804 | 3300005467 | Bacteria | 929 |
| 138 | Ga0070706_100782188 | 3300005467 | Bacteria | 884 |
| 139 | Ga0070707_100066943 | 3300005468 | Bacteria | 3454 |
| 140 | Ga0070707_101487963 | 3300005468 | Bacteria | 644 |
| 141 | Ga0070698_100078989 | 3300005471 | Bacteria | 3287 |
| 142 | Ga0070698_100337454 | 3300005471 | Bacteria | 1439 |
| 143 | Ga0070698_100504663 | 3300005471 | Bacteria | 1148 |
| 144 | Ga0070698_101128762 | 3300005471 | Bacteria | 733 |
| 145 | Ga0070699_100912368 | 3300005518 | Bacteria | 805 |
| 146 | Ga0070699_101106803 | 3300005518 | Bacteria | 727 |
| 147 | Ga0070679_100047533 | 3300005530 | Bacteria | 4276 |
| 148 | Ga0070679_100088927 | 3300005530 | Bacteria | 3075 |
| 149 | Ga0070679_100091402 | 3300005530 | Bacteria | 3032 |
| 150 | Ga0070679_100496444 | 3300005530 | Bacteria | 1164 |
| 151 | Ga0070679_100716012 | 3300005530 | Bacteria | 944 |
| 152 | Ga0070684_100018307 | 3300005535 | Bacteria | 5769 |
| 153 | Ga0070684_100019711 | 3300005535 | Bacteria | 5582 |
| 154 | Ga0070684_100070933 | 3300005535 | Bacteria | 3066 |
| 155 | Ga0070697_100665161 | 3300005536 | Bacteria | 918 |
| 156 | Ga0068853_100015002 | 3300005539 | Bacteria | 6365 |
| 157 | Ga0068853_100114236 | 3300005539 | Bacteria | 2402 |
| 158 | Ga0068853_100167477 | 3300005539 | Bacteria | 1986 |
| 159 | Ga0070672_100365276 | 3300005543 | Bacteria | 1232 |
| 160 | Ga0070672_101119556 | 3300005543 | Bacteria | 700 |
| 161 | Ga0070686_100332212 | 3300005544 | Bacteria | 1137 |
| 162 | Ga0070686_100981667 | 3300005544 | Bacteria | 692 |
| 163 | Ga0070695_101196752 | 3300005545 | Bacteria | 625 |
| 164 | Ga0070696_101037466 | 3300005546 | Bacteria | 687 |
| 165 | Ga0070696_101091012 | 3300005546 | Bacteria | 671 |
| 166 | Ga0070693_100130062 | 3300005547 | Bacteria | 1572 |
| 167 | Ga0070665_100473791 | 3300005548 | Bacteria | 1263 |
| 168 | Ga0070665_100619516 | 3300005548 | Bacteria | 1095 |
| 169 | Ga0070665_100643163 | 3300005548 | Bacteria | 1073 |
| 170 | Ga0070665_100689684 | 3300005548 | Bacteria | 1034 |
| 171 | Ga0070665_101353326 | 3300005548 | Bacteria | 721 |
| 172 | Ga0070704_100074071 | 3300005549 | Bacteria | 2482 |
| 173 | Ga0070704_100723180 | 3300005549 | Bacteria | 885 |
| 174 | Ga0070704_102180459 | 3300005549 | Bacteria | 515 |
| 175 | Ga0068855_100115160 | 3300005563 | Bacteria | 3082 |
| 176 | Ga0068855_100172088 | 3300005563 | Bacteria | 2452 |
| 177 | Ga0068855_100287225 | 3300005563 | Bacteria | 1825 |
| 178 | Ga0068855_100303265 | 3300005563 | Bacteria | 1768 |
| 179 | Ga0068855_100443398 | 3300005563 | Bacteria | 1417 |
| 180 | Ga0068855_100471582 | 3300005563 | Bacteria | 1367 |
| 181 | Ga0068855_100543251 | 3300005563 | Bacteria | 1259 |
| 182 | Ga0068855_102056495 | 3300005563 | Bacteria | 576 |
| 183 | Ga0070664_100256517 | 3300005564 | Bacteria | 1573 |
| 184 | Ga0070664_100330475 | 3300005564 | Bacteria | 1383 |
| 185 | Ga0068857_100050842 | 3300005577 | Bacteria | 3676 |
| 186 | Ga0068857_100137022 | 3300005577 | Bacteria | 2210 |
| 187 | Ga0068857_100262384 | 3300005577 | Bacteria | 1586 |
| 188 | Ga0068857_100458566 | 3300005577 | Bacteria | 1192 |
| 189 | Ga0068854_100044784 | 3300005578 | Bacteria | 3143 |
| 190 | Ga0068854_100205677 | 3300005578 | Bacteria | 1550 |
| 191 | Ga0068854_100376562 | 3300005578 | Bacteria | 1169 |
| 192 | Ga0068854_100785867 | 3300005578 | Bacteria | 829 |
| 193 | Ga0068854_100821247 | 3300005578 | Bacteria | 812 |
| 194 | Ga0068854_100990579 | 3300005578 | Bacteria | 744 |
| 195 | Ga0068854_101065639 | 3300005578 | Bacteria | 719 |
| 196 | Ga0068854_101071515 | 3300005578 | Bacteria | 717 |
| 197 | Ga0068856_100012484 | 3300005614 | Bacteria | 8223 |
| 198 | Ga0068856_100068789 | 3300005614 | Bacteria | 3500 |
| 199 | Ga0068856_100277470 | 3300005614 | Bacteria | 1692 |
| 200 | Ga0068856_100356049 | 3300005614 | Bacteria | 1482 |
| 201 | Ga0068856_100425581 | 3300005614 | Bacteria | 1348 |
| 202 | Ga0068856_100732744 | 3300005614 | Bacteria | 1009 |
| 203 | Ga0068856_102309127 | 3300005614 | Bacteria | 546 |
| 204 | Ga0070702_100798160 | 3300005615 | Bacteria | 730 |
| 205 | Ga0068852_100090179 | 3300005616 | Bacteria | 2741 |
| 206 | Ga0068852_100100343 | 3300005616 | Bacteria | 2611 |
| 207 | Ga0068852_100106181 | 3300005616 | Bacteria | 2545 |
| 208 | Ga0068852_100173219 | 3300005616 | Bacteria | 2024 |
| 209 | Ga0068852_100817382 | 3300005616 | Bacteria | 947 |
| 210 | Ga0068859_100385816 | 3300005617 | Bacteria | 1496 |
| 211 | Ga0068859_101222746 | 3300005617 | Bacteria | 827 |
| 212 | Ga0068864_100133909 | 3300005618 | Bacteria | 2230 |
| 213 | Ga0068864_100524318 | 3300005618 | Bacteria | 1142 |
| 214 | Ga0068864_100761187 | 3300005618 | Bacteria | 950 |
| 215 | Ga0068866_10220054 | 3300005718 | Bacteria | 1145 |
| 216 | Ga0068866_11081523 | 3300005718 | Bacteria | 574 |
| 217 | Ga0068861_100160363 | 3300005719 | Bacteria | 1854 |
| 218 | Ga0068861_100168456 | 3300005719 | Bacteria | 1813 |
| 219 | Ga0068861_100297953 | 3300005719 | Bacteria | 1395 |
| 220 | Ga0068861_100365240 | 3300005719 | Bacteria | 1271 |
| 221 | Ga0068851_10005108 | 3300005834 | Bacteria | 5950 |
| 222 | Ga0068851_10257272 | 3300005834 | Bacteria | 992 |
| 223 | Ga0068870_10275921 | 3300005840 | Bacteria | 1052 |
| 224 | Ga0068870_10290969 | 3300005840 | Bacteria | 1027 |
| 225 | Ga0068870_10516662 | 3300005840 | Bacteria | 798 |
| 226 | Ga0068863_100176845 | 3300005841 | Bacteria | 2048 |
| 227 | Ga0068863_100247083 | 3300005841 | Bacteria | 1723 |
| 228 | Ga0068863_100699159 | 3300005841 | Bacteria | 1008 |
| 229 | Ga0068863_100975027 | 3300005841 | Bacteria | 850 |
| 230 | Ga0068858_100033733 | 3300005842 | Bacteria | 4747 |
| 231 | Ga0068858_100193136 | 3300005842 | Bacteria | 1924 |
| 232 | Ga0068858_100210555 | 3300005842 | Bacteria | 1840 |
| 233 | Ga0068858_100255666 | 3300005842 | Bacteria | 1664 |
| 234 | Ga0068858_100391269 | 3300005842 | Bacteria | 1335 |
| 235 | Ga0068858_100521331 | 3300005842 | Bacteria | 1149 |
| 236 | Ga0068858_100749239 | 3300005842 | Bacteria | 952 |
| 237 | Ga0068860_100000161 | 3300005843 | Bacteria | 110123 |
| 238 | Ga0068860_100238519 | 3300005843 | Bacteria | 1768 |
| 239 | Ga0068860_100428901 | 3300005843 | Bacteria | 1311 |
| 240 | Ga0068860_100672045 | 3300005843 | Bacteria | 1044 |
| 241 | Ga0068860_100789017 | 3300005843 | Bacteria | 963 |
| 242 | Ga0068862_100118043 | 3300005844 | Bacteria | 2335 |
| 243 | Ga0068862_100167431 | 3300005844 | Bacteria | 1965 |
| 244 | Ga0068862_100367413 | 3300005844 | Bacteria | 1338 |
| 245 | Ga0068862_100833940 | 3300005844 | Bacteria | 902 |
| 246 | Ga0068862_100978952 | 3300005844 | Bacteria | 835 |
| 247 | Ga0068862_102590875 | 3300005844 | Bacteria | 519 |
| 248 | Ga0081455_10011653 | 3300005937 | Bacteria | 8819 |
| 249 | Ga0081455_10025146 | 3300005937 | Bacteria | 5501 |
| 250 | Ga0081455_10033819 | 3300005937 | Bacteria | 4588 |
| 251 | Ga0081455_10124483 | 3300005937 | Bacteria | 2026 |
| 252 | Ga0081540_1000533 | 3300005983 | Bacteria | 37025 |
| 253 | Ga0081540_1008405 | 3300005983 | Bacteria | 7215 |
| 254 | Ga0081540_1008486 | 3300005983 | Bacteria | 7172 |
| 255 | Ga0081540_1014919 | 3300005983 | Bacteria | 4943 |
| 256 | Ga0081540_1018724 | 3300005983 | Bacteria | 4237 |
| 257 | Ga0081540_1021152 | 3300005983 | Bacteria | 3885 |
| 258 | Ga0081540_1024938 | 3300005983 | Bacteria | 3456 |
| 259 | Ga0081540_1097380 | 3300005983 | Bacteria | 1277 |
| 260 | Ga0081540_1108410 | 3300005983 | Bacteria | 1180 |
| 261 | Ga0081540_1109766 | 3300005983 | Bacteria | 1169 |
| 262 | Ga0081540_1158287 | 3300005983 | Bacteria | 883 |
| 263 | Ga0081540_1193830 | 3300005983 | Bacteria | 746 |
| 264 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 265 | Ga0081539_10000319 | 3300005985 | Bacteria | 106944 |
| 266 | Ga0081539_10051298 | 3300005985 | Bacteria | 2326 |
| 267 | Ga0070717_10010806 | 3300006028 | Bacteria | 6906 |
| 268 | Ga0070717_10011078 | 3300006028 | Bacteria | 6833 |
| 269 | Ga0070717_10093601 | 3300006028 | Bacteria | 2541 |
| 270 | Ga0070717_10146777 | 3300006028 | Bacteria | 2038 |
| 271 | Ga0070717_10732411 | 3300006028 | Bacteria | 899 |
| 272 | Ga0070717_10936103 | 3300006028 | Bacteria | 789 |
| 273 | Ga0070717_10987235 | 3300006028 | Bacteria | 767 |
| 274 | Ga0070717_11385236 | 3300006028 | Bacteria | 639 |
| 275 | Ga0075365_10170429 | 3300006038 | Bacteria | 1519 |
| 276 | Ga0075365_10266966 | 3300006038 | Bacteria | 1203 |
| 277 | Ga0075365_10275562 | 3300006038 | Bacteria | 1183 |
| 278 | Ga0075365_10745657 | 3300006038 | Bacteria | 691 |
| 279 | Ga0075368_10057566 | 3300006042 | Bacteria | 1552 |
| 280 | Ga0075368_10126101 | 3300006042 | Bacteria | 1062 |
| 281 | Ga0075363_100434923 | 3300006048 | Bacteria | 774 |
| 282 | Ga0075364_10498452 | 3300006051 | Bacteria | 832 |
| 283 | Ga0075432_10154891 | 3300006058 | Bacteria | 883 |
| 284 | Ga0070715_10054998 | 3300006163 | Bacteria | 1726 |
| 285 | Ga0070715_11093669 | 3300006163 | Bacteria | 502 |
| 286 | Ga0070716_100005426 | 3300006173 | Bacteria | 6177 |
| 287 | Ga0070716_100036012 | 3300006173 | Bacteria | 2726 |
| 288 | Ga0070716_100073640 | 3300006173 | Bacteria | 2015 |
| 289 | Ga0070716_100397944 | 3300006173 | Bacteria | 990 |
| 290 | Ga0070716_100654825 | 3300006173 | Bacteria | 797 |
| 291 | Ga0070716_100844024 | 3300006173 | Bacteria | 713 |
| 292 | Ga0070716_100918555 | 3300006173 | Bacteria | 687 |
| 293 | Ga0070716_101763030 | 3300006173 | Bacteria | 512 |
| 294 | Ga0070712_100031648 | 3300006175 | Bacteria | 3566 |
| 295 | Ga0070712_100149458 | 3300006175 | Bacteria | 1792 |
| 296 | Ga0070712_100249535 | 3300006175 | Bacteria | 1417 |
| 297 | Ga0070712_100319096 | 3300006175 | Bacteria | 1263 |
| 298 | Ga0070712_100401046 | 3300006175 | Bacteria | 1133 |
| 299 | Ga0070712_100782561 | 3300006175 | Bacteria | 818 |
| 300 | Ga0075362_10044251 | 3300006177 | Bacteria | 1974 |
| 301 | Ga0075362_10475899 | 3300006177 | Bacteria | 637 |
| 302 | Ga0075367_10179634 | 3300006178 | Bacteria | 1319 |
| 303 | Ga0075367_10359999 | 3300006178 | Bacteria | 919 |
| 304 | Ga0075367_10678756 | 3300006178 | Bacteria | 655 |
| 305 | Ga0075369_10028743 | 3300006186 | Bacteria | 2332 |
| 306 | Ga0075369_10145108 | 3300006186 | Bacteria | 1083 |
| 307 | Ga0075369_10360163 | 3300006186 | Bacteria | 683 |
| 308 | Ga0075366_10496499 | 3300006195 | Bacteria | 754 |
| 309 | Ga0097621_100540451 | 3300006237 | Bacteria | 1060 |
| 310 | Ga0097621_100576082 | 3300006237 | Bacteria | 1027 |
| 311 | Ga0097621_100806756 | 3300006237 | Bacteria | 870 |
| 312 | Ga0097621_101336351 | 3300006237 | Bacteria | 677 |
| 313 | Ga0075370_10095230 | 3300006353 | Bacteria | 1720 |
| 314 | Ga0075370_10103519 | 3300006353 | Bacteria | 1649 |
| 315 | Ga0075370_10537320 | 3300006353 | Bacteria | 707 |
| 316 | Ga0068871_100170257 | 3300006358 | Bacteria | 1866 |
| 317 | Ga0068871_100204319 | 3300006358 | Bacteria | 1707 |
| 318 | Ga0068871_100369542 | 3300006358 | Bacteria | 1272 |
| 319 | Ga0068871_101128277 | 3300006358 | Bacteria | 734 |
| 320 | Ga0068871_101422156 | 3300006358 | Bacteria | 654 |
| 321 | Ga0068871_102088589 | 3300006358 | Bacteria | 539 |
| 322 | Ga0068871_102156303 | 3300006358 | Bacteria | 531 |
| 323 | Ga0075428_101045257 | 3300006844 | Bacteria | 864 |
| 324 | Ga0075430_100647269 | 3300006846 | Bacteria | 872 |
| 325 | Ga0075431_101726346 | 3300006847 | Bacteria | 583 |
| 326 | Ga0075434_100207420 | 3300006871 | Bacteria | 1980 |
| 327 | Ga0075434_100342945 | 3300006871 | Bacteria | 1515 |
| 328 | Ga0068865_100686583 | 3300006881 | Bacteria | 873 |
| 329 | Ga0068865_100902238 | 3300006881 | Bacteria | 769 |
| 330 | Ga0075436_100074879 | 3300006914 | Bacteria | 2344 |
| 331 | Ga0075436_101390907 | 3300006914 | Bacteria | 532 |
| 332 | Ga0097620_100385840 | 3300006931 | Bacteria | 1496 |
| 333 | Ga0097620_101222756 | 3300006931 | Bacteria | 827 |
| 334 | Ga0099825_1025798 | 3300006941 | Bacteria | 3220 |
| 335 | Ga0099824_1002235 | 3300006942 | Bacteria | 28253 |
| 336 | Ga0099822_1006882 | 3300006943 | Bacteria | 14762 |
| 337 | Ga0075435_100575742 | 3300007076 | Bacteria | 976 |
| 338 | Ga0075435_101201063 | 3300007076 | Bacteria | 664 |
| 339 | Ga0075435_101333737 | 3300007076 | Bacteria | 628 |
| 340 | Ga0099794_10026969 | 3300007265 | Bacteria | 2660 |
| 341 | Ga0099794_10110647 | 3300007265 | Bacteria | 1376 |
| 342 | Ga0099794_10227749 | 3300007265 | Bacteria | 958 |
| 343 | Ga0099794_10775838 | 3300007265 | Bacteria | 512 |
| 344 | Ga0099795_10055193 | 3300007788 | Bacteria | 1458 |
| 345 | Ga0099795_10096048 | 3300007788 | Bacteria | 1156 |
| 346 | Ga0099795_10152514 | 3300007788 | Bacteria | 947 |
| 347 | Ga0099795_10328200 | 3300007788 | Bacteria | 679 |
| 348 | Ga0099795_10357315 | 3300007788 | Bacteria | 655 |
| 349 | Ga0105251_10539554 | 3300009011 | Bacteria | 548 |
| 350 | Ga0105250_10469832 | 3300009092 | Bacteria | 567 |
| 351 | Ga0105240_10074299 | 3300009093 | Bacteria | 4197 |
| 352 | Ga0105240_10108370 | 3300009093 | Bacteria | 3365 |
| 353 | Ga0105240_10132523 | 3300009093 | Bacteria | 2988 |
| 354 | Ga0105240_10174911 | 3300009093 | Bacteria | 2539 |
| 355 | Ga0105240_10273738 | 3300009093 | Bacteria | 1943 |
| 356 | Ga0105240_10276477 | 3300009093 | Bacteria | 1931 |
| 357 | Ga0105240_10750917 | 3300009093 | Bacteria | 1061 |
| 358 | Ga0105240_10906311 | 3300009093 | Bacteria | 948 |
| 359 | Ga0105240_11406332 | 3300009093 | Unclassified | 733 |
| 360 | Ga0105240_11517282 | 3300009093 | Bacteria | 702 |
| 361 | Ga0105240_11563359 | 3300009093 | Bacteria | 691 |
| 362 | Ga0111539_12268288 | 3300009094 | Bacteria | 630 |
| 363 | Ga0111539_12432873 | 3300009094 | Bacteria | 607 |
| 364 | Ga0105245_10113770 | 3300009098 | Bacteria | 2520 |
| 365 | Ga0105245_10165372 | 3300009098 | Bacteria | 2103 |
| 366 | Ga0105245_10550704 | 3300009098 | Bacteria | 1175 |
| 367 | Ga0105245_10860058 | 3300009098 | Bacteria | 947 |
| 368 | Ga0105245_10932570 | 3300009098 | Bacteria | 911 |
| 369 | Ga0105245_11067005 | 3300009098 | Bacteria | 853 |
| 370 | Ga0105247_10033343 | 3300009101 | Bacteria | 3132 |
| 371 | Ga0105247_10079482 | 3300009101 | Bacteria | 2064 |
| 372 | Ga0105247_10127166 | 3300009101 | Bacteria | 1657 |
| 373 | Ga0105247_10144790 | 3300009101 | Bacteria | 1560 |
| 374 | Ga0105247_10152058 | 3300009101 | Bacteria | 1526 |
| 375 | Ga0105247_10366853 | 3300009101 | Bacteria | 1017 |
| 376 | Ga0105247_10711033 | 3300009101 | Bacteria | 757 |
| 377 | Ga0114129_10226285 | 3300009147 | Bacteria | 2521 |
| 378 | Ga0105243_10389767 | 3300009148 | Bacteria | 1291 |
| 379 | Ga0105243_10815473 | 3300009148 | Bacteria | 921 |
| 380 | Ga0105243_10901638 | 3300009148 | Bacteria | 879 |
| 381 | Ga0105243_11013930 | 3300009148 | Bacteria | 833 |
| 382 | Ga0105241_10001465 | 3300009174 | Bacteria | 18092 |
| 383 | Ga0105241_10049278 | 3300009174 | Bacteria | 3207 |
| 384 | Ga0105241_10132093 | 3300009174 | Bacteria | 2023 |
| 385 | Ga0105241_11148235 | 3300009174 | Bacteria | 733 |
| 386 | Ga0105241_12638700 | 3300009174 | Bacteria | 505 |
| 387 | Ga0105242_10298121 | 3300009176 | Bacteria | 1470 |
| 388 | Ga0105242_10780212 | 3300009176 | Bacteria | 944 |
| 389 | Ga0105242_10958571 | 3300009176 | Bacteria | 860 |
| 390 | Ga0105242_12479757 | 3300009176 | Bacteria | 567 |
| 391 | Ga0105242_12737101 | 3300009176 | Bacteria | 543 |
| 392 | Ga0105248_10079208 | 3300009177 | Bacteria | 3692 |
| 393 | Ga0105248_10180846 | 3300009177 | Bacteria | 2376 |
| 394 | Ga0105248_10443094 | 3300009177 | Bacteria | 1463 |
| 395 | Ga0105248_11481593 | 3300009177 | Bacteria | 768 |
| 396 | Ga0105248_13041081 | 3300009177 | Bacteria | 534 |
| 397 | Ga0105237_10082775 | 3300009545 | Bacteria | 3200 |
| 398 | Ga0105237_10160602 | 3300009545 | Bacteria | 2246 |
| 399 | Ga0105237_10162256 | 3300009545 | Bacteria | 2234 |
| 400 | Ga0105237_10233768 | 3300009545 | Bacteria | 1839 |
| 401 | Ga0105237_10509940 | 3300009545 | Bacteria | 1209 |
| 402 | Ga0105237_10609634 | 3300009545 | Bacteria | 1098 |
| 403 | Ga0105237_10614061 | 3300009545 | Bacteria | 1094 |
| 404 | Ga0105237_11183166 | 3300009545 | Bacteria | 771 |
| 405 | Ga0105237_11443767 | 3300009545 | Bacteria | 694 |
| 406 | Ga0105238_10061520 | 3300009551 | Bacteria | 3757 |
| 407 | Ga0105238_10082122 | 3300009551 | Bacteria | 3212 |
| 408 | Ga0105238_10267973 | 3300009551 | Bacteria | 1688 |
| 409 | Ga0105238_10291187 | 3300009551 | Bacteria | 1615 |
| 410 | Ga0105238_10483474 | 3300009551 | Bacteria | 1238 |
| 411 | Ga0105238_10602130 | 3300009551 | Bacteria | 1107 |
| 412 | Ga0105238_11838552 | 3300009551 | Bacteria | 638 |
| 413 | Ga0105238_12020289 | 3300009551 | Bacteria | 610 |
| 414 | Ga0105238_13059924 | 3300009551 | Bacteria | 502 |
| 415 | Ga0105249_10068182 | 3300009553 | Bacteria | 3280 |
| 416 | Ga0105249_10410318 | 3300009553 | Bacteria | 1386 |
| 417 | Ga0105249_10577193 | 3300009553 | Bacteria | 1177 |
| 418 | Ga0105249_12026154 | 3300009553 | Bacteria | 648 |
| 419 | Ga0105249_12991147 | 3300009553 | Bacteria | 543 |
| 420 | Ga0099796_10115466 | 3300010159 | Bacteria | 1026 |
| 421 | Ga0099796_10296990 | 3300010159 | Bacteria | 683 |
| 422 | Ga0099796_10320592 | 3300010159 | Bacteria | 661 |
| 423 | Ga0105239_10088062 | 3300010375 | Bacteria | 3423 |
| 424 | Ga0105239_10101265 | 3300010375 | Bacteria | 3187 |
| 425 | Ga0105239_10131659 | 3300010375 | Bacteria | 2782 |
| 426 | Ga0105239_10220159 | 3300010375 | Bacteria | 2129 |
| 427 | Ga0105239_10226651 | 3300010375 | Bacteria | 2097 |
| 428 | Ga0105239_10260778 | 3300010375 | Bacteria | 1948 |
| 429 | Ga0105239_10339626 | 3300010375 | Bacteria | 1695 |
| 430 | Ga0105239_10597532 | 3300010375 | Bacteria | 1258 |
| 431 | Ga0105239_10700420 | 3300010375 | Bacteria | 1158 |
| 432 | Ga0105239_11293569 | 3300010375 | Bacteria | 841 |
| 433 | Ga0105239_12007311 | 3300010375 | Bacteria | 671 |
| 434 | Ga0105239_12450229 | 3300010375 | Bacteria | 608 |
| 435 | Ga0105246_10241362 | 3300011119 | Bacteria | 1428 |
| 436 | Ga0105246_10371949 | 3300011119 | Bacteria | 1178 |
| 437 | Ga0105246_10760957 | 3300011119 | Bacteria | 855 |
| 438 | Ga0105246_11145659 | 3300011119 | Bacteria | 713 |
| 439 | Ga0157371_10284552 | 3300013102 | Bacteria | 1195 |
| 440 | Ga0157370_10160379 | 3300013104 | Bacteria | 2092 |
| 441 | Ga0157370_10173993 | 3300013104 | Bacteria | 2001 |
| 442 | Ga0157369_10008049 | 3300013105 | Bacteria | 12091 |
| 443 | Ga0157369_10213310 | 3300013105 | Bacteria | 2023 |
| 444 | Ga0157369_10247375 | 3300013105 | Bacteria | 1862 |
| 445 | Ga0157369_10778389 | 3300013105 | Bacteria | 984 |
| 446 | Ga0157369_12451210 | 3300013105 | Bacteria | 528 |
| 447 | Ga0157374_10096142 | 3300013296 | Bacteria | 2833 |
| 448 | Ga0157374_11022102 | 3300013296 | Bacteria | 846 |
| 449 | Ga0157374_11298936 | 3300013296 | Bacteria | 750 |
| 450 | Ga0157378_10269866 | 3300013297 | Bacteria | 1636 |
| 451 | Ga0157378_10414848 | 3300013297 | Bacteria | 1330 |
| 452 | Ga0157378_11454845 | 3300013297 | Bacteria | 729 |
| 453 | Ga0157378_11577077 | 3300013297 | Bacteria | 702 |
| 454 | Ga0163162_10058369 | 3300013306 | Bacteria | 3888 |
| 455 | Ga0163162_10309215 | 3300013306 | Bacteria | 1713 |
| 456 | Ga0163162_10321723 | 3300013306 | Bacteria | 1679 |
| 457 | Ga0163162_10367943 | 3300013306 | Bacteria | 1571 |
| 458 | Ga0163162_10398679 | 3300013306 | Bacteria | 1508 |
| 459 | Ga0163162_11222532 | 3300013306 | Bacteria | 853 |
| 460 | Ga0157372_10319813 | 3300013307 | Bacteria | 1807 |
| 461 | Ga0157372_10579081 | 3300013307 | Bacteria | 1308 |
| 462 | Ga0157372_10759731 | 3300013307 | Bacteria | 1127 |
| 463 | Ga0157372_11165745 | 3300013307 | Bacteria | 891 |
| 464 | Ga0157372_12136808 | 3300013307 | Bacteria | 643 |
| 465 | Ga0157375_10150857 | 3300013308 | Bacteria | 2460 |
| 466 | Ga0157375_10250632 | 3300013308 | Bacteria | 1931 |
| 467 | Ga0157375_10678966 | 3300013308 | Bacteria | 1185 |
| 468 | Ga0157375_13474794 | 3300013308 | Bacteria | 524 |
| 469 | Ga0163163_10041903 | 3300014325 | Bacteria | 4480 |
| 470 | Ga0163163_10162927 | 3300014325 | Bacteria | 2276 |
| 471 | Ga0163163_10216026 | 3300014325 | Bacteria | 1966 |
| 472 | Ga0163163_11372685 | 3300014325 | Bacteria | 768 |
| 473 | Ga0163163_11520999 | 3300014325 | Bacteria | 730 |
| 474 | Ga0163163_11618380 | 3300014325 | Bacteria | 708 |
| 475 | Ga0157380_10380529 | 3300014326 | Bacteria | 1332 |
| 476 | Ga0157380_10725191 | 3300014326 | Bacteria | 1002 |
| 477 | Ga0157380_11824342 | 3300014326 | Bacteria | 668 |
| 478 | Ga0157380_11953605 | 3300014326 | Bacteria | 648 |
| 479 | Ga0182008_10196178 | 3300014497 | Bacteria | 1026 |
| 480 | Ga0157379_10144727 | 3300014968 | Bacteria | 2143 |
| 481 | Ga0157379_10248801 | 3300014968 | Bacteria | 1613 |
| 482 | Ga0157379_10329119 | 3300014968 | Bacteria | 1396 |
| 483 | Ga0157379_10398734 | 3300014968 | Bacteria | 1264 |
| 484 | Ga0157379_11027200 | 3300014968 | Bacteria | 787 |
| 485 | Ga0157379_11241282 | 3300014968 | Bacteria | 718 |
| 486 | Ga0157379_11784923 | 3300014968 | Bacteria | 604 |
| 487 | Ga0157376_10046774 | 3300014969 | Bacteria | 3570 |
| 488 | Ga0157376_10267297 | 3300014969 | Bacteria | 1605 |
| 489 | Ga0157376_12623663 | 3300014969 | Bacteria | 544 |
| 490 | Ga0182007_10073559 | 3300015262 | Bacteria | 1120 |
| 491 | Ga0163161_10149277 | 3300017792 | Bacteria | 1775 |
| 492 | Ga0163161_10348488 | 3300017792 | Bacteria | 1177 |
| 493 | Ga0163161_11194055 | 3300017792 | Bacteria | 657 |
| 494 | Ga0163161_11272012 | 3300017792 | Bacteria | 639 |
| 495 | Ga0213873_10008342 | 3300021358 | Bacteria | 2112 |
| 496 | Ga0213872_10147300 | 3300021361 | Bacteria | 1030 |
| 497 | Ga0213872_10247740 | 3300021361 | Bacteria | 751 |
| 498 | Ga0213872_10338979 | 3300021361 | Bacteria | 618 |
| 499 | Ga0213874_10027137 | 3300021377 | Bacteria | 1627 |
| 500 | Ga0213876_10001294 | 3300021384 | Bacteria | 15771 |
| 501 | Ga0213876_10190064 | 3300021384 | Bacteria | 1092 |
| 502 | Ga0213876_10712441 | 3300021384 | Bacteria | 534 |
| 503 | Ga0213875_10014183 | 3300021388 | Bacteria | 3894 |
| 504 | Ga0213871_10027908 | 3300021441 | Bacteria | 1453 |
| 505 | Ga0224570_105443 | 3300022730 | Bacteria | 774 |
| 506 | Ga0209563_104166 | 3300025230 | Bacteria | 2814 |
| 507 | Ga0209677_101183 | 3300025253 | Bacteria | 11970 |
| 508 | Ga0209677_126603 | 3300025253 | Bacteria | 616 |
| 509 | Ga0209148_1014592 | 3300025254 | Bacteria | 1386 |
| 510 | Ga0209148_1035414 | 3300025254 | Bacteria | 718 |
| 511 | Ga0209233_1002172 | 3300025261 | Bacteria | 7348 |
| 512 | Ga0209233_1014836 | 3300025261 | Bacteria | 2184 |
| 513 | Ga0207666_1076584 | 3300025271 | Bacteria | 540 |
| 514 | Ga0209455_1005408 | 3300025272 | Bacteria | 3951 |
| 515 | Ga0209758_1002105 | 3300025297 | Bacteria | 21114 |
| 516 | Ga0209758_1011397 | 3300025297 | Bacteria | 5155 |
| 517 | Ga0209758_1011463 | 3300025297 | Bacteria | 5131 |
| 518 | Ga0207697_10095122 | 3300025315 | Bacteria | 1265 |
| 519 | Ga0207697_10383970 | 3300025315 | Bacteria | 624 |
| 520 | Ga0207656_10012398 | 3300025321 | Bacteria | 3239 |
| 521 | Ga0207692_10002007 | 3300025898 | Bacteria | 7770 |
| 522 | Ga0207692_10062420 | 3300025898 | Bacteria | 1934 |
| 523 | Ga0207692_10129499 | 3300025898 | Bacteria | 1423 |
| 524 | Ga0207692_10214961 | 3300025898 | Bacteria | 1137 |
| 525 | Ga0207692_10269141 | 3300025898 | Bacteria | 1027 |
| 526 | Ga0207692_10292578 | 3300025898 | Bacteria | 989 |
| 527 | Ga0207692_10874660 | 3300025898 | Bacteria | 590 |
| 528 | Ga0207642_10250547 | 3300025899 | Bacteria | 1005 |
| 529 | Ga0207710_10011777 | 3300025900 | Bacteria | 3678 |
| 530 | Ga0207710_10137033 | 3300025900 | Bacteria | 1179 |
| 531 | Ga0207710_10192100 | 3300025900 | Bacteria | 1005 |
| 532 | Ga0207688_10393371 | 3300025901 | Bacteria | 859 |
| 533 | Ga0207688_10599482 | 3300025901 | Bacteria | 694 |
| 534 | Ga0207680_11050146 | 3300025903 | Bacteria | 583 |
| 535 | Ga0207647_10087783 | 3300025904 | Bacteria | 1857 |
| 536 | Ga0207685_10069066 | 3300025905 | Bacteria | 1426 |
| 537 | Ga0207685_10092936 | 3300025905 | Bacteria | 1274 |
| 538 | Ga0207699_10002233 | 3300025906 | Bacteria | 9138 |
| 539 | Ga0207699_10024823 | 3300025906 | Bacteria | 3283 |
| 540 | Ga0207699_10107078 | 3300025906 | Bacteria | 1785 |
| 541 | Ga0207699_10125076 | 3300025906 | Bacteria | 1668 |
| 542 | Ga0207699_10264414 | 3300025906 | Bacteria | 1190 |
| 543 | Ga0207699_10543321 | 3300025906 | Bacteria | 842 |
| 544 | Ga0207699_10691817 | 3300025906 | Bacteria | 746 |
| 545 | Ga0207645_10075012 | 3300025907 | Bacteria | 2165 |
| 546 | Ga0207645_10727170 | 3300025907 | Bacteria | 675 |
| 547 | Ga0207643_10101240 | 3300025908 | Bacteria | 1690 |
| 548 | Ga0207643_10135766 | 3300025908 | Bacteria | 1466 |
| 549 | Ga0207705_10127476 | 3300025909 | Bacteria | 1892 |
| 550 | Ga0207705_10215223 | 3300025909 | Bacteria | 1458 |
| 551 | Ga0207684_10128732 | 3300025910 | Bacteria | 2173 |
| 552 | Ga0207684_10740532 | 3300025910 | Bacteria | 833 |
| 553 | Ga0207684_10948995 | 3300025910 | Bacteria | 721 |
| 554 | Ga0207654_10090759 | 3300025911 | Bacteria | 1862 |
| 555 | Ga0207654_10721163 | 3300025911 | Bacteria | 717 |
| 556 | Ga0207654_11421404 | 3300025911 | Bacteria | 506 |
| 557 | Ga0207707_10006493 | 3300025912 | Bacteria | 10212 |
| 558 | Ga0207707_10116161 | 3300025912 | Bacteria | 2338 |
| 559 | Ga0207707_10158160 | 3300025912 | Bacteria | 1981 |
| 560 | Ga0207707_10336641 | 3300025912 | Bacteria | 1301 |
| 561 | Ga0207695_10001299 | 3300025913 | Bacteria | 42408 |
| 562 | Ga0207695_10086044 | 3300025913 | Bacteria | 3171 |
| 563 | Ga0207695_10090236 | 3300025913 | Bacteria | 3080 |
| 564 | Ga0207695_10161353 | 3300025913 | Bacteria | 2173 |
| 565 | Ga0207695_10228138 | 3300025913 | Bacteria | 1768 |
| 566 | Ga0207695_10596445 | 3300025913 | Bacteria | 986 |
| 567 | Ga0207695_10853344 | 3300025913 | Bacteria | 791 |
| 568 | Ga0207695_11147792 | 3300025913 | Bacteria | 657 |
| 569 | Ga0207695_11172626 | 3300025913 | Bacteria | 648 |
| 570 | Ga0207671_10044178 | 3300025914 | Bacteria | 3295 |
| 571 | Ga0207671_10083902 | 3300025914 | Bacteria | 2392 |
| 572 | Ga0207671_10154578 | 3300025914 | Bacteria | 1774 |
| 573 | Ga0207671_10217149 | 3300025914 | Bacteria | 1497 |
| 574 | Ga0207671_10503011 | 3300025914 | Bacteria | 966 |
| 575 | Ga0207671_10642607 | 3300025914 | Bacteria | 845 |
| 576 | Ga0207671_11053644 | 3300025914 | Bacteria | 640 |
| 577 | Ga0207693_10005604 | 3300025915 | Bacteria | 10440 |
| 578 | Ga0207693_10042357 | 3300025915 | Bacteria | 3584 |
| 579 | Ga0207693_10085535 | 3300025915 | Bacteria | 2470 |
| 580 | Ga0207693_10127830 | 3300025915 | Bacteria | 1998 |
| 581 | Ga0207693_10185023 | 3300025915 | Bacteria | 1640 |
| 582 | Ga0207693_10801212 | 3300025915 | Bacteria | 726 |
| 583 | Ga0207663_10000136 | 3300025916 | Bacteria | 34085 |
| 584 | Ga0207663_10041045 | 3300025916 | Bacteria | 2817 |
| 585 | Ga0207663_10286479 | 3300025916 | Bacteria | 1226 |
| 586 | Ga0207663_10341782 | 3300025916 | Bacteria | 1131 |
| 587 | Ga0207663_10430954 | 3300025916 | Bacteria | 1014 |
| 588 | Ga0207663_11707686 | 3300025916 | Bacteria | 506 |
| 589 | Ga0207660_10115735 | 3300025917 | Bacteria | 2024 |
| 590 | Ga0207660_10134207 | 3300025917 | Bacteria | 1887 |
| 591 | Ga0207660_10203717 | 3300025917 | Bacteria | 1546 |
| 592 | Ga0207660_10208403 | 3300025917 | Bacteria | 1530 |
| 593 | Ga0207660_10607039 | 3300025917 | Bacteria | 891 |
| 594 | Ga0207662_10786502 | 3300025918 | Bacteria | 670 |
| 595 | Ga0207657_10016940 | 3300025919 | Bacteria | 7011 |
| 596 | Ga0207657_10105232 | 3300025919 | Bacteria | 2336 |
| 597 | Ga0207657_10218778 | 3300025919 | Bacteria | 1526 |
| 598 | Ga0207652_10017419 | 3300025921 | Bacteria | 5879 |
| 599 | Ga0207652_10222982 | 3300025921 | Bacteria | 1699 |
| 600 | Ga0207652_10229710 | 3300025921 | Bacteria | 1672 |
| 601 | Ga0207652_10992972 | 3300025921 | Bacteria | 738 |
| 602 | Ga0207652_11281640 | 3300025921 | Bacteria | 635 |
| 603 | Ga0207681_10413143 | 3300025923 | Bacteria | 1092 |
| 604 | Ga0207681_10512593 | 3300025923 | Bacteria | 983 |
| 605 | Ga0207694_10000131 | 3300025924 | Bacteria | 76343 |
| 606 | Ga0207694_10056928 | 3300025924 | Bacteria | 3038 |
| 607 | Ga0207694_10089914 | 3300025924 | Bacteria | 2422 |
| 608 | Ga0207694_10127899 | 3300025924 | Bacteria | 2034 |
| 609 | Ga0207694_11271848 | 3300025924 | Bacteria | 622 |
| 610 | Ga0207650_10376305 | 3300025925 | Bacteria | 1172 |
| 611 | Ga0207659_10966195 | 3300025926 | Bacteria | 733 |
| 612 | Ga0207659_11080948 | 3300025926 | Bacteria | 690 |
| 613 | Ga0207659_11082834 | 3300025926 | Bacteria | 690 |
| 614 | Ga0207687_10170480 | 3300025927 | Bacteria | 1678 |
| 615 | Ga0207687_10572476 | 3300025927 | Bacteria | 949 |
| 616 | Ga0207687_10738762 | 3300025927 | Bacteria | 837 |
| 617 | Ga0207687_11682122 | 3300025927 | Bacteria | 544 |
| 618 | Ga0207687_11814114 | 3300025927 | Bacteria | 522 |
| 619 | Ga0207700_10019504 | 3300025928 | Bacteria | 4580 |
| 620 | Ga0207700_10044976 | 3300025928 | Bacteria | 3254 |
| 621 | Ga0207700_10064226 | 3300025928 | Bacteria | 2795 |
| 622 | Ga0207700_10244234 | 3300025928 | Bacteria | 1531 |
| 623 | Ga0207700_10308406 | 3300025928 | Bacteria | 1368 |
| 624 | Ga0207700_10536989 | 3300025928 | Bacteria | 1037 |
| 625 | Ga0207700_10646838 | 3300025928 | Bacteria | 942 |
| 626 | Ga0207664_10040605 | 3300025929 | Bacteria | 3620 |
| 627 | Ga0207664_10161604 | 3300025929 | Bacteria | 1911 |
| 628 | Ga0207664_10163572 | 3300025929 | Bacteria | 1900 |
| 629 | Ga0207664_10179136 | 3300025929 | Bacteria | 1819 |
| 630 | Ga0207664_10240143 | 3300025929 | Bacteria | 1577 |
| 631 | Ga0207664_10413338 | 3300025929 | Bacteria | 1201 |
| 632 | Ga0207664_11259880 | 3300025929 | Bacteria | 658 |
| 633 | Ga0207644_10544116 | 3300025931 | Bacteria | 961 |
| 634 | Ga0207644_10597653 | 3300025931 | Bacteria | 916 |
| 635 | Ga0207690_10341449 | 3300025932 | Bacteria | 1182 |
| 636 | Ga0207690_10344356 | 3300025932 | Bacteria | 1177 |
| 637 | Ga0207706_10191515 | 3300025933 | Bacteria | 1795 |
| 638 | Ga0207706_10260895 | 3300025933 | Bacteria | 1513 |
| 639 | Ga0207706_10384613 | 3300025933 | Bacteria | 1217 |
| 640 | Ga0207706_11135438 | 3300025933 | Bacteria | 652 |
| 641 | Ga0207706_11262928 | 3300025933 | Bacteria | 611 |
| 642 | Ga0207709_10285175 | 3300025935 | Bacteria | 1221 |
| 643 | Ga0207709_10545443 | 3300025935 | Bacteria | 911 |
| 644 | Ga0207709_10646333 | 3300025935 | Bacteria | 842 |
| 645 | Ga0207709_10923212 | 3300025935 | Bacteria | 710 |
| 646 | Ga0207709_11104650 | 3300025935 | Bacteria | 651 |
| 647 | Ga0207709_11686995 | 3300025935 | Bacteria | 527 |
| 648 | Ga0207670_10369137 | 3300025936 | Bacteria | 1140 |
| 649 | Ga0207669_10029295 | 3300025937 | Bacteria | 3042 |
| 650 | Ga0207669_10557795 | 3300025937 | Bacteria | 925 |
| 651 | Ga0207704_11166233 | 3300025938 | Bacteria | 656 |
| 652 | Ga0207665_10003171 | 3300025939 | Bacteria | 11017 |
| 653 | Ga0207665_10082081 | 3300025939 | Bacteria | 2221 |
| 654 | Ga0207665_10435712 | 3300025939 | Bacteria | 1003 |
| 655 | Ga0207665_10483197 | 3300025939 | Bacteria | 955 |
| 656 | Ga0207665_10725983 | 3300025939 | Bacteria | 782 |
| 657 | Ga0207665_10911030 | 3300025939 | Bacteria | 698 |
| 658 | Ga0207665_11467003 | 3300025939 | Bacteria | 542 |
| 659 | Ga0207691_10131807 | 3300025940 | Bacteria | 2207 |
| 660 | Ga0207691_10241472 | 3300025940 | Bacteria | 1561 |
| 661 | Ga0207691_10756432 | 3300025940 | Bacteria | 818 |
| 662 | Ga0207691_11292630 | 3300025940 | Bacteria | 603 |
| 663 | Ga0207711_10290933 | 3300025941 | Bacteria | 1506 |
| 664 | Ga0207711_10309354 | 3300025941 | Bacteria | 1459 |
| 665 | Ga0207711_10384237 | 3300025941 | Bacteria | 1303 |
| 666 | Ga0207711_11619265 | 3300025941 | Bacteria | 591 |
| 667 | Ga0207689_10118294 | 3300025942 | Bacteria | 2179 |
| 668 | Ga0207689_11713111 | 3300025942 | Bacteria | 521 |
| 669 | Ga0207661_10003939 | 3300025944 | Bacteria | 10368 |
| 670 | Ga0207661_10131723 | 3300025944 | Bacteria | 2142 |
| 671 | Ga0207661_10157752 | 3300025944 | Bacteria | 1967 |
| 672 | Ga0207661_10257895 | 3300025944 | Bacteria | 1552 |
| 673 | Ga0207679_10087005 | 3300025945 | Bacteria | 2405 |
| 674 | Ga0207679_11252738 | 3300025945 | Bacteria | 681 |
| 675 | Ga0207679_11613808 | 3300025945 | Bacteria | 594 |
| 676 | Ga0207667_10077674 | 3300025949 | Bacteria | 3442 |
| 677 | Ga0207667_10091938 | 3300025949 | Bacteria | 3134 |
| 678 | Ga0207667_10134297 | 3300025949 | Bacteria | 2548 |
| 679 | Ga0207667_10154984 | 3300025949 | Bacteria | 2357 |
| 680 | Ga0207667_10225581 | 3300025949 | Bacteria | 1919 |
| 681 | Ga0207667_10272462 | 3300025949 | Bacteria | 1730 |
| 682 | Ga0207667_11074115 | 3300025949 | Bacteria | 789 |
| 683 | Ga0207667_11894950 | 3300025949 | Bacteria | 558 |
| 684 | Ga0207651_10125168 | 3300025960 | Bacteria | 1957 |
| 685 | Ga0207651_11109452 | 3300025960 | Bacteria | 709 |
| 686 | Ga0207651_11166438 | 3300025960 | Bacteria | 691 |
| 687 | Ga0207712_10057243 | 3300025961 | Bacteria | 2750 |
| 688 | Ga0207712_10388714 | 3300025961 | Bacteria | 1170 |
| 689 | Ga0207712_10884699 | 3300025961 | Bacteria | 789 |
| 690 | Ga0207712_11914681 | 3300025961 | Bacteria | 531 |
| 691 | Ga0207668_10013333 | 3300025972 | Bacteria | 5057 |
| 692 | Ga0207668_10047708 | 3300025972 | Bacteria | 2934 |
| 693 | Ga0207668_10085181 | 3300025972 | Bacteria | 2305 |
| 694 | Ga0207668_10374965 | 3300025972 | Bacteria | 1196 |
| 695 | Ga0207668_10528439 | 3300025972 | Bacteria | 1019 |
| 696 | Ga0207668_10636147 | 3300025972 | Bacteria | 932 |
| 697 | Ga0207668_10927951 | 3300025972 | Bacteria | 776 |
| 698 | Ga0207668_11147218 | 3300025972 | Bacteria | 697 |
| 699 | Ga0207668_11497823 | 3300025972 | Bacteria | 609 |
| 700 | Ga0207640_10298194 | 3300025981 | Bacteria | 1274 |
| 701 | Ga0207640_10465812 | 3300025981 | Bacteria | 1045 |
| 702 | Ga0207640_10531339 | 3300025981 | Bacteria | 985 |
| 703 | Ga0207640_10545035 | 3300025981 | Bacteria | 974 |
| 704 | Ga0207640_11227400 | 3300025981 | Bacteria | 667 |
| 705 | Ga0207640_11274829 | 3300025981 | Bacteria | 655 |
| 706 | Ga0207658_10193212 | 3300025986 | Bacteria | 1694 |
| 707 | Ga0207658_10304636 | 3300025986 | Bacteria | 1374 |
| 708 | Ga0207658_10981278 | 3300025986 | Bacteria | 770 |
| 709 | Ga0207658_11079085 | 3300025986 | Bacteria | 733 |
| 710 | Ga0207677_10015130 | 3300026023 | Bacteria | 4527 |
| 711 | Ga0207677_10063701 | 3300026023 | Bacteria | 2564 |
| 712 | Ga0207703_10097777 | 3300026035 | Bacteria | 2481 |
| 713 | Ga0207703_10209413 | 3300026035 | Bacteria | 1737 |
| 714 | Ga0207703_10251105 | 3300026035 | Bacteria | 1594 |
| 715 | Ga0207703_10775852 | 3300026035 | Bacteria | 914 |
| 716 | Ga0207703_11406455 | 3300026035 | Bacteria | 671 |
| 717 | Ga0207639_10022677 | 3300026041 | Bacteria | 4524 |
| 718 | Ga0207639_10071933 | 3300026041 | Bacteria | 2707 |
| 719 | Ga0207639_10084661 | 3300026041 | Bacteria | 2519 |
| 720 | Ga0207639_10581839 | 3300026041 | Bacteria | 1031 |
| 721 | Ga0207639_10694494 | 3300026041 | Bacteria | 944 |
| 722 | Ga0207639_12187392 | 3300026041 | Bacteria | 514 |
| 723 | Ga0207678_10155088 | 3300026067 | Bacteria | 1955 |
| 724 | Ga0207678_10162209 | 3300026067 | Bacteria | 1909 |
| 725 | Ga0207678_10253588 | 3300026067 | Bacteria | 1507 |
| 726 | Ga0207678_10674527 | 3300026067 | Bacteria | 909 |
| 727 | Ga0207678_11362880 | 3300026067 | Bacteria | 627 |
| 728 | Ga0207678_11861889 | 3300026067 | Bacteria | 526 |
| 729 | Ga0207708_10052763 | 3300026075 | Bacteria | 3097 |
| 730 | Ga0207708_11470586 | 3300026075 | Bacteria | 598 |
| 731 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 732 | Ga0207702_10018516 | 3300026078 | Bacteria | 5762 |
| 733 | Ga0207702_10205301 | 3300026078 | Bacteria | 1829 |
| 734 | Ga0207702_10360799 | 3300026078 | Bacteria | 1393 |
| 735 | Ga0207702_11188008 | 3300026078 | Bacteria | 757 |
| 736 | Ga0207702_12203316 | 3300026078 | Bacteria | 540 |
| 737 | Ga0207641_10437414 | 3300026088 | Bacteria | 1262 |
| 738 | Ga0207641_10638346 | 3300026088 | Bacteria | 1045 |
| 739 | Ga0207641_10733058 | 3300026088 | Bacteria | 975 |
| 740 | Ga0207648_10164176 | 3300026089 | Bacteria | 1962 |
| 741 | Ga0207648_11033849 | 3300026089 | Bacteria | 770 |
| 742 | Ga0207648_11041264 | 3300026089 | Bacteria | 767 |
| 743 | Ga0207648_11795369 | 3300026089 | Bacteria | 575 |
| 744 | Ga0207676_10466374 | 3300026095 | Bacteria | 1193 |
| 745 | Ga0207676_10788454 | 3300026095 | Bacteria | 926 |
| 746 | Ga0207676_12228019 | 3300026095 | Bacteria | 546 |
| 747 | Ga0207674_10028556 | 3300026116 | Bacteria | 5886 |
| 748 | Ga0207674_10090864 | 3300026116 | Bacteria | 3044 |
| 749 | Ga0207674_10170416 | 3300026116 | Bacteria | 2130 |
| 750 | Ga0207674_10348816 | 3300026116 | Bacteria | 1431 |
| 751 | Ga0207675_100096830 | 3300026118 | Bacteria | 2778 |
| 752 | Ga0207675_100174781 | 3300026118 | Bacteria | 2054 |
| 753 | Ga0207675_100195761 | 3300026118 | Bacteria | 1940 |
| 754 | Ga0207683_10095129 | 3300026121 | Bacteria | 2656 |
| 755 | Ga0207683_10099596 | 3300026121 | Bacteria | 2594 |
| 756 | Ga0207683_10124581 | 3300026121 | Bacteria | 2315 |
| 757 | Ga0207683_10406819 | 3300026121 | Bacteria | 1252 |
| 758 | Ga0207683_10833926 | 3300026121 | Bacteria | 856 |
| 759 | Ga0207683_11229216 | 3300026121 | Bacteria | 694 |
| 760 | Ga0207698_10055219 | 3300026142 | Bacteria | 3059 |
| 761 | Ga0207698_11153787 | 3300026142 | Bacteria | 788 |
| 762 | Ga0207698_11299061 | 3300026142 | Bacteria | 742 |
| 763 | Ga0207698_11767886 | 3300026142 | Bacteria | 633 |
| 764 | Ga0207698_11875379 | 3300026142 | Bacteria | 614 |
| 765 | Ga0209589_1000018 | 3300027357 | Bacteria | 192614 |
| 766 | Ga0209489_100026 | 3300027361 | Bacteria | 192614 |
| 767 | Ga0209700_100035 | 3300027363 | Bacteria | 192614 |
| 768 | Ga0209179_1059022 | 3300027512 | Bacteria | 831 |
| 769 | Ga0209179_1127771 | 3300027512 | Bacteria | 568 |
| 770 | Ga0209588_1018157 | 3300027671 | Bacteria | 2189 |
| 771 | Ga0209588_1150638 | 3300027671 | Bacteria | 737 |
| 772 | Ga0209813_10242785 | 3300027866 | Bacteria | 682 |
| 773 | Ga0207428_10545785 | 3300027907 | Bacteria | 839 |
| 774 | Ga0268266_10061797 | 3300028379 | Bacteria | 3230 |
| 775 | Ga0268266_10073425 | 3300028379 | Bacteria | 2968 |
| 776 | Ga0268266_10074719 | 3300028379 | Bacteria | 2943 |
| 777 | Ga0268266_10129418 | 3300028379 | Bacteria | 2256 |
| 778 | Ga0268266_10432944 | 3300028379 | Bacteria | 1248 |
| 779 | Ga0268266_10512564 | 3300028379 | Bacteria | 1146 |
| 780 | Ga0268265_10218062 | 3300028380 | Bacteria | 1667 |
| 781 | Ga0268265_10319468 | 3300028380 | Bacteria | 1405 |
| 782 | Ga0268265_10709541 | 3300028380 | Bacteria | 972 |
| 783 | Ga0268265_11389090 | 3300028380 | Bacteria | 704 |
| 784 | Ga0268265_11437857 | 3300028380 | Bacteria | 692 |
| 785 | Ga0268265_12565431 | 3300028380 | Bacteria | 515 |
| 786 | Ga0268264_10000096 | 3300028381 | Bacteria | 230188 |
| 787 | Ga0268264_10654995 | 3300028381 | Bacteria | 1040 |
| 788 | Ga0268264_10666017 | 3300028381 | Bacteria | 1031 |
| 789 | Ga0268264_10785903 | 3300028381 | Bacteria | 950 |
| 790 | Ga0265334_10011607 | 3300028573 | Bacteria | 3706 |
| 791 | Ga0307517_10000049 | 3300028786 | Bacteria | 160368 |
| 792 | Ga0307517_10497589 | 3300028786 | Bacteria | 621 |
| 793 | Ga0307515_10389190 | 3300028794 | Bacteria | 1024 |
| 794 | Ga0307515_10414782 | 3300028794 | Bacteria | 968 |
| 795 | Ga0307515_10583891 | 3300028794 | Bacteria | 727 |
| 796 | Ga0307515_10779836 | 3300028794 | Bacteria | 577 |
| 797 | Ga0265338_10774896 | 3300028800 | Bacteria | 658 |
| 798 | Ga0307511_10198086 | 3300030521 | Bacteria | 1048 |
| 799 | Ga0265763_1030814 | 3300030763 | Bacteria | 609 |
| 800 | Ga0265330_10003983 | 3300031235 | Bacteria | 7578 |
| 801 | Ga0265330_10076540 | 3300031235 | Bacteria | 1444 |
| 802 | Ga0265330_10104976 | 3300031235 | Bacteria | 1208 |
| 803 | Ga0265330_10128906 | 3300031235 | Bacteria | 1077 |
| 804 | Ga0265332_10093032 | 3300031238 | Bacteria | 1274 |
| 805 | Ga0265325_10265263 | 3300031241 | Bacteria | 774 |
| 806 | Ga0265340_10012561 | 3300031247 | Bacteria | 4471 |
| 807 | Ga0265340_10017348 | 3300031247 | Bacteria | 3723 |
| 808 | Ga0265339_10008611 | 3300031249 | Bacteria | 6478 |
| 809 | Ga0265339_10070095 | 3300031249 | Bacteria | 1870 |
| 810 | Ga0265339_10517743 | 3300031249 | Bacteria | 550 |
| 811 | Ga0265331_10162904 | 3300031250 | Bacteria | 1011 |
| 812 | Ga0265316_10537539 | 3300031344 | Bacteria | 833 |
| 813 | Ga0265316_10826260 | 3300031344 | Bacteria | 649 |
| 814 | Ga0265316_11009934 | 3300031344 | Bacteria | 579 |
| 815 | Ga0307513_10088523 | 3300031456 | Bacteria | 3164 |
| 816 | Ga0307513_10155863 | 3300031456 | Bacteria | 2184 |
| 817 | Ga0307513_10841173 | 3300031456 | Bacteria | 624 |
| 818 | Ga0307513_10882819 | 3300031456 | Bacteria | 601 |
| 819 | Ga0307509_10587857 | 3300031507 | Bacteria | 787 |
| 820 | Ga0307509_10613045 | 3300031507 | Bacteria | 760 |
| 821 | Ga0307509_10679025 | 3300031507 | Bacteria | 697 |
| 822 | Ga0307408_100199014 | 3300031548 | Bacteria | 1620 |
| 823 | Ga0307408_100940495 | 3300031548 | Bacteria | 793 |
| 824 | Ga0307508_10000731 | 3300031616 | Bacteria | 38975 |
| 825 | Ga0307508_10054710 | 3300031616 | Bacteria | 3537 |
| 826 | Ga0307508_10072072 | 3300031616 | Bacteria | 3028 |
| 827 | Ga0307508_10151659 | 3300031616 | Bacteria | 1922 |
| 828 | Ga0307514_10307685 | 3300031649 | Bacteria | 882 |
| 829 | Ga0265314_10013390 | 3300031711 | Bacteria | 6627 |
| 830 | Ga0265314_10408282 | 3300031711 | Bacteria | 733 |
| 831 | Ga0265342_10292805 | 3300031712 | Bacteria | 859 |
| 832 | Ga0265342_10450628 | 3300031712 | Bacteria | 660 |
| 833 | Ga0307516_10018018 | 3300031730 | Bacteria | 7347 |
| 834 | Ga0307516_10118652 | 3300031730 | Bacteria | 2439 |
| 835 | Ga0307516_10269504 | 3300031730 | Bacteria | 1389 |
| 836 | Ga0307516_10280878 | 3300031730 | Bacteria | 1347 |
| 837 | Ga0307516_10501689 | 3300031730 | Bacteria | 868 |
| 838 | Ga0307516_10501846 | 3300031730 | Bacteria | 868 |
| 839 | Ga0307405_10815430 | 3300031731 | Bacteria | 783 |
| 840 | Ga0307413_10547331 | 3300031824 | Bacteria | 938 |
| 841 | Ga0307410_11193499 | 3300031852 | Bacteria | 663 |
| 842 | Ga0307406_10974300 | 3300031901 | Bacteria | 726 |
| 843 | Ga0307406_11215635 | 3300031901 | Bacteria | 655 |
| 844 | Ga0307412_10424043 | 3300031911 | Bacteria | 1089 |
| 845 | Ga0307412_10761035 | 3300031911 | Bacteria | 837 |
| 846 | Ga0307411_10043403 | 3300032005 | Bacteria | 2876 |
| 847 | Ga0307411_11526294 | 3300032005 | Bacteria | 614 |
| 848 | Ga0307415_100233697 | 3300032126 | Bacteria | 1482 |
| 849 | Ga0307415_101409146 | 3300032126 | Bacteria | 664 |
| 850 | Ga0307510_10024603 | 3300033180 | Bacteria | 6955 |
| 851 | Ga0307510_10029438 | 3300033180 | Bacteria | 6251 |
| 852 | Ga0307510_10059937 | 3300033180 | Bacteria | 3923 |
| 853 | Ga0307510_10205350 | 3300033180 | Bacteria | 1499 |
| 854 | Ga0315911_1000011 | 3300033442 | Bacteria | 264678 |
| 855 | Ga0316214_1029407 | 3300033545 | Bacteria | 779 |
| 856 | Ga0316212_1031585 | 3300033547 | Bacteria | 745 |
| 857 | Ga0373950_0116448 | 3300034818 | Bacteria | 588 |
| 858 | Ga0373926_0005959 | 3300035083 | Bacteria | 4034 |
| 859 | Ga0373926_0380901 | 3300035083 | Bacteria | 556 |
| 860 | Ga0373929_0006593 | 3300035085 | Bacteria | 2101 |
| 861 | Ga0373934_0010297 | 3300035086 | Bacteria | 3510 |
| 862 | Ga0373934_0029548 | 3300035086 | Bacteria | 2141 |
| 863 | Ga0373940_0156661 | 3300035088 | Bacteria | 729 |
| 864 | Ga0373944_0040097 | 3300035089 | Bacteria | 1444 |
| 865 | Ga0373944_0199167 | 3300035089 | Bacteria | 724 |
| 866 | Ga0373949_0132794 | 3300035090 | Bacteria | 708 |
| 867 | Ga0373951_0104252 | 3300035091 | Bacteria | 757 |
| 868 | Ga0373923_0020587 | 3300035111 | Bacteria | 2564 |
| 869 | Ga0373923_0051471 | 3300035111 | Bacteria | 1728 |
| 870 | Ga0373932_0007201 | 3300035112 | Bacteria | 2644 |
| 871 | Ga0373932_0203447 | 3300035112 | Bacteria | 705 |
| 872 | Ga0373936_0004101 | 3300035113 | Bacteria | 5486 |
| 873 | Ga0373936_0013140 | 3300035113 | Bacteria | 3158 |
| 874 | Ga0373936_0032185 | 3300035113 | Bacteria | 2073 |
| 875 | Ga0373936_0087161 | 3300035113 | Bacteria | 1305 |
| 876 | Ga0373936_0104690 | 3300035113 | Bacteria | 1197 |
| 877 | Ga0373939_0027867 | 3300035114 | Bacteria | 1604 |
| 878 | Ga0373941_0271671 | 3300035115 | Bacteria | 668 |
| 879 | Ga0373941_0298140 | 3300035115 | Bacteria | 643 |
| 880 | Ga0373945_0021976 | 3300035116 | Bacteria | 2195 |
| 881 | Ga0373945_0106499 | 3300035116 | Bacteria | 1103 |
| 882 | Ga0373945_0325368 | 3300035116 | Bacteria | 663 |
| 883 | Ga0373953_0002102 | 3300035117 | Bacteria | 5944 |
| 884 | Ga0373953_0032224 | 3300035117 | Bacteria | 2043 |
| 885 | Ga0373953_0049200 | 3300035117 | Bacteria | 1700 |
| 886 | Ga0373954_0003682 | 3300035118 | Bacteria | 6528 |
| 887 | Ga0373954_0003903 | 3300035118 | Bacteria | 6380 |
| 888 | Ga0373954_0064964 | 3300035118 | Bacteria | 1726 |
| 889 | Ga0373954_0179576 | 3300035118 | Bacteria | 1038 |
| 890 | Ga0373956_0087005 | 3300035119 | Bacteria | 1438 |
| 891 | Ga0373956_0192506 | 3300035119 | Bacteria | 966 |
| 892 | Ga0373957_0050529 | 3300035120 | Bacteria | 1589 |
| 893 | Ga0373957_0270436 | 3300035120 | Bacteria | 717 |
| 894 | Ga0373960_0140826 | 3300035121 | Bacteria | 817 |
| 895 | Ga0373943_0013515 | 3300035170 | Bacteria | 3688 |
| 896 | Ga0373943_0019155 | 3300035170 | Bacteria | 3147 |
| 897 | Ga0373943_0159136 | 3300035170 | Bacteria | 1228 |
| 898 | Ga0373946_0007469 | 3300035171 | Bacteria | 3996 |
| 899 | Ga0373946_0019231 | 3300035171 | Bacteria | 2631 |
| 900 | Ga0373946_0033987 | 3300035171 | Bacteria | 2056 |
| 901 | Ga0373946_0237641 | 3300035171 | Bacteria | 885 |
| 902 | Ga0373946_0500378 | 3300035171 | Bacteria | 623 |
| 903 | Ga0373955_0002813 | 3300035172 | Bacteria | 7643 |
| 904 | Ga0373955_0004594 | 3300035172 | Bacteria | 6118 |
| 905 | Ga0373955_0031043 | 3300035172 | Bacteria | 2796 |
| 906 | Ga0373955_0066668 | 3300035172 | Bacteria | 2001 |
| 907 | Ga0373955_0401979 | 3300035172 | Bacteria | 832 |
| 908 | Ga0373942_0383683 | 3300035207 | Bacteria | 502 |
| 909 | Ga0373962_0059436 | 3300035242 | Bacteria | 1120 |
| 910 | Ga0373962_0115549 | 3300035242 | Bacteria | 851 |
| 911 | Ga0373924_0008710 | 3300035410 | Bacteria | 3697 |
| 912 | Ga0373924_0038459 | 3300035410 | Bacteria | 1952 |
| 913 | Ga0373924_0102591 | 3300035410 | Bacteria | 1231 |
| 914 | Ga0373924_0116917 | 3300035410 | Bacteria | 1155 |
| 915 | Ga0373931_0010082 | 3300035691 | Bacteria | 4531 |
| 916 | Ga0373931_0107836 | 3300035691 | Bacteria | 1576 |
| 917 | Ga0373931_0125247 | 3300035691 | Bacteria | 1473 |
| 918 | Ga0373931_0210435 | 3300035691 | Bacteria | 1166 |
| 919 | Ga0373931_0570184 | 3300035691 | Bacteria | 737 |
| 920 | Ga0373935_0033366 | 3300035692 | Bacteria | 3202 |
| 921 | Ga0373935_0070809 | 3300035692 | Bacteria | 2248 |
| 922 | Ga0373935_0095773 | 3300035692 | Bacteria | 1950 |
| 923 | Ga0373935_0174430 | 3300035692 | Bacteria | 1472 |
| 924 | Ga0373935_0261731 | 3300035692 | Bacteria | 1213 |
| 925 | Ga0373927_0002864 | 3300035695 | Bacteria | 12558 |
| 926 | Ga0373927_0003673 | 3300035695 | Bacteria | 10929 |
| 927 | Ga0373927_0010232 | 3300035695 | Bacteria | 6265 |
| 928 | Ga0373927_0010787 | 3300035695 | Bacteria | 6087 |
| 929 | Ga0373927_0027325 | 3300035695 | Bacteria | 3726 |
| 930 | Ga0373927_0065850 | 3300035695 | Bacteria | 2343 |
| 931 | Ga0373927_0115311 | 3300035695 | Bacteria | 1751 |
| 932 | Ga0373927_1007703 | 3300035695 | Bacteria | 549 |
| 933 | Ga0373933_0000466 | 3300035724 | Bacteria | 25296 |
| 934 | Ga0373933_0216019 | 3300035724 | Bacteria | 1229 |
| 935 | Ga0373933_0339166 | 3300035724 | Bacteria | 975 |
| 936 | Ga0373933_0354758 | 3300035724 | Bacteria | 953 |
| 937 | Ga0373933_0631550 | 3300035724 | Bacteria | 704 |
| 938 | Ga0373947_0014032 | 3300035725 | Bacteria | 4593 |
| 939 | Ga0373947_0021300 | 3300035725 | Bacteria | 3751 |
| 940 | Ga0373947_0066819 | 3300035725 | Bacteria | 2195 |
| 941 | Ga0373947_0889459 | 3300035725 | Bacteria | 608 |
| 942 | Ga0373937_0158941 | 3300036401 | Bacteria | 2118 |
| 943 | Ga0373937_0851548 | 3300036401 | Bacteria | 860 |
| 944 | Ga0373937_1025702 | 3300036401 | Bacteria | 774 |
| 945 | Ga0373937_1376277 | 3300036401 | Bacteria | 653 |
| 946 | Ga0373937_1798487 | 3300036401 | Bacteria | 559 |
| 947 | Ga0373925_0012681 | 3300037068 | Bacteria | 6104 |
| 948 | Ga0373925_0021354 | 3300037068 | Bacteria | 4716 |
| 949 | Ga0373925_0027352 | 3300037068 | Bacteria | 4175 |
| 950 | Ga0373925_0066476 | 3300037068 | Bacteria | 2718 |
| 951 | Ga0373925_0077878 | 3300037068 | Bacteria | 2517 |
| 952 | Ga0373925_0232102 | 3300037068 | Bacteria | 1476 |
| 953 | Ga0373925_0271728 | 3300037068 | Bacteria | 1364 |
| 954 | Ga0373925_0411782 | 3300037068 | Bacteria | 1103 |
| 955 | Ga0373925_0520156 | 3300037068 | Bacteria | 978 |
| 956 | Ga0395899_0502013 | 3300037312 | Bacteria | 787 |
| 957 | Ga0395900_0092192 | 3300037418 | Bacteria | 3113 |
| 958 | Ga0395900_0398077 | 3300037418 | Bacteria | 1342 |
| 959 | Ga0395900_0865802 | 3300037418 | Bacteria | 828 |
| 960 | Ga0395900_0955183 | 3300037418 | Bacteria | 778 |
| 961 | Ga0395898_0174963 | 3300037466 | Bacteria | 2052 |
| 962 | Ga0395905_0135856 | 3300037471 | Bacteria | 2313 |
| 963 | Ga0395905_0384353 | 3300037471 | Bacteria | 1298 |
| 964 | Ga0395905_0622403 | 3300037471 | Bacteria | 981 |
| 965 | Ga0395905_1322460 | 3300037471 | Bacteria | 625 |
| 966 | Ga0436364_0367164 | 3300037853 | Bacteria | 1285 |
| 967 | Ga0436364_0570855 | 3300037853 | Bacteria | 5958 |
| 968 | Ga0436364_0710321 | 3300037853 | Bacteria | 510 |
| 969 | Ga0395901_0282898 | 3300038443 | Bacteria | 1723 |
| 970 | Ga0395901_0310793 | 3300038443 | Bacteria | 1632 |
| 971 | Ga0395901_0400732 | 3300038443 | Bacteria | 1410 |
| 972 | Ga0436365_0063216 | 3300039437 | Bacteria | 2823 |
| 973 | Ga0436365_0341884 | 3300039437 | Bacteria | 1264 |
| 974 | Ga0436365_0521739 | 3300039437 | Bacteria | 1444 |
| 975 | Ga0436365_0986223 | 3300039437 | Bacteria | 1324 |
| 976 | Ga0436365_1184573 | 3300039437 | Bacteria | 1055 |
| 977 | Ga0436365_1331614 | 3300039437 | Bacteria | 11360 |
| 978 | Ga0436365_1546547 | 3300039437 | Bacteria | 4902 |
| 979 | Ga0436365_1592603 | 3300039437 | Bacteria | 982 |
| 980 | Ga0436365_1707337 | 3300039437 | Bacteria | 2912 |
| 981 | Ga0436360_0142267 | 3300039438 | Bacteria | 1069 |
| 982 | Ga0436360_0745328 | 3300039438 | Bacteria | 2378 |
| 983 | Ga0436360_1338677 | 3300039438 | Bacteria | 1229 |
| 984 | Ga0436361_0236119 | 3300039447 | Bacteria | 1245 |
| 985 | Ga0436361_0437201 | 3300039447 | Bacteria | 2404 |
| 986 | Ga0436361_0889836 | 3300039447 | Bacteria | 2600 |
| 987 | Ga0436361_0906525 | 3300039447 | Bacteria | 859 |
| 988 | Ga0436361_0993311 | 3300039447 | Bacteria | 2334 |
| 989 | Ga0436363_0239993 | 3300039450 | Bacteria | 1088 |
| 990 | Ga0436363_0564280 | 3300039450 | Bacteria | 3272 |
| 991 | Ga0436363_1076737 | 3300039450 | Bacteria | 637 |
| 992 | Ga0436363_1285406 | 3300039450 | Bacteria | 943 |
| 993 | Ga0436363_1431327 | 3300039450 | Bacteria | 838 |
| 994 | Ga0436363_1567451 | 3300039450 | Bacteria | 553 |
| 995 | Ga0436363_1586010 | 3300039450 | Bacteria | 796 |
| 996 | Ga0436363_1718188 | 3300039450 | Bacteria | 2982 |
| 997 | Ga0436362_0127034 | 3300039453 | Bacteria | 3918 |
| 998 | Ga0436362_0635133 | 3300039453 | Bacteria | 611 |
| 999 | Ga0436362_1052023 | 3300039453 | Bacteria | 1086 |
| 1000 | Ga0439461_0126632 | 3300041410 | Bacteria | 643 |
| 1001 | Ga0439465_0292946 | 3300041413 | Bacteria | 608 |
| 1002 | Ga0451787_685306 | 3300041441 | Bacteria | 679 |
| 1003 | Ga0451791_0302238 | 3300041451 | Bacteria | 586 |
| 1004 | Ga0451793_1902718 | 3300041452 | Bacteria | 546 |
| 1005 | Ga0451797_0178116 | 3300041453 | Bacteria | 636 |
| 1006 | Ga0451798_0525704 | 3300041458 | Bacteria | 714 |
| 1007 | Ga0451798_0766331 | 3300041458 | Bacteria | 632 |
| 1008 | Ga0451806_573896 | 3300041462 | Bacteria | 651 |
| 1009 | Ga0451804_0932924 | 3300041463 | Bacteria | 591 |
| 1010 | Ga0451837_0039678 | 3300041494 | Bacteria | 659 |
| 1011 | Ga0451839_0744572 | 3300041496 | Bacteria | 891 |
| 1012 | Ga0451849_0110876 | 3300041505 | Bacteria | 722 |
| 1013 | Ga0451853_1409169 | 3300041512 | Bacteria | 528 |
| 1014 | Ga0439442_161171 | 3300042002 | Bacteria | 502 |
| 1015 | Ga0439455_0066730 | 3300042012 | Bacteria | 962 |
| 1016 | Ga0439440_0036338 | 3300042993 | Bacteria | 1185 |
| 1017 | Ga0466969_0203686 | 3300044656 | Bacteria | 902 |
| 1018 | Ga0466969_0493348 | 3300044656 | Bacteria | 559 |
| 1019 | Ga0466965_0209519 | 3300044683 | Bacteria | 1036 |
| 1020 | Ga0466966_0355105 | 3300044684 | Bacteria | 881 |
| 1021 | Ga0466966_0947857 | 3300044684 | Bacteria | 519 |
| 1022 | Ga0466961_0050554 | 3300044693 | Bacteria | 2655 |
| 1023 | Ga0466963_0066871 | 3300044694 | Bacteria | 2411 |
| 1024 | Ga0466963_0192978 | 3300044694 | Bacteria | 1423 |
| 1025 | Ga0466963_0460604 | 3300044694 | Bacteria | 897 |
| 1026 | Ga0466964_0177002 | 3300044706 | Bacteria | 1009 |
| 1027 | Ga0466964_0184585 | 3300044706 | Bacteria | 991 |
| 1028 | Ga0466964_0473245 | 3300044706 | Bacteria | 668 |
| 1029 | Ga0466971_0096053 | 3300044719 | Bacteria | 1359 |
| 1030 | Ga0466968_0249357 | 3300044735 | Bacteria | 843 |
| 1031 | Ga0466968_0302093 | 3300044735 | Bacteria | 770 |
| 1032 | Ga0466968_0517622 | 3300044735 | Bacteria | 596 |
| 1033 | Ga0466970_0212186 | 3300044765 | Bacteria | 1079 |
| 1034 | Ga0466957_0100830 | 3300044842 | Bacteria | 1820 |
| 1035 | Ga0466957_0100932 | 3300044842 | Bacteria | 1819 |
| 1036 | Ga0466957_0135927 | 3300044842 | Bacteria | 1580 |
| 1037 | Ga0466957_1002090 | 3300044842 | Bacteria | 600 |
| 1038 | Ga0466959_0077576 | 3300045049 | Bacteria | 2397 |
| 1039 | Ga0466959_0122873 | 3300045049 | Bacteria | 1844 |
| 1040 | Ga0466959_0368600 | 3300045049 | Bacteria | 978 |
| 1041 | Ga0466959_0374067 | 3300045049 | Bacteria | 970 |
| 1042 | Ga0466959_0615049 | 3300045049 | Bacteria | 730 |
| 1043 | Ga0466958_0497578 | 3300045836 | Bacteria | 791 |
| 1044 | Ga0466967_0058260 | 3300045976 | Bacteria | 3414 |
| 1045 | Ga0466967_0518670 | 3300045976 | Bacteria | 1171 |
| 1046 | Ga0466967_0895125 | 3300045976 | Bacteria | 882 |
| 1047 | Ga0466967_1121943 | 3300045976 | Bacteria | 784 |
| 1048 | Ga0466967_1221002 | 3300045976 | Bacteria | 749 |
| 1049 | Ga0495617_014228 | 3300046452 | Bacteria | 2705 |
| 1050 | Ga0495592_0014958 | 3300046454 | Bacteria | 5892 |
| 1051 | Ga0495592_0043583 | 3300046454 | Bacteria | 3356 |
| 1052 | Ga0495592_0065311 | 3300046454 | Bacteria | 2664 |
| 1053 | Ga0495592_0091605 | 3300046454 | Bacteria | 2180 |
| 1054 | Ga0495592_0368385 | 3300046454 | Bacteria | 917 |
| 1055 | Ga0495603_0009404 | 3300046455 | Bacteria | 5906 |
| 1056 | Ga0495603_0014373 | 3300046455 | Bacteria | 4788 |
| 1057 | Ga0495603_0014979 | 3300046455 | Bacteria | 4688 |
| 1058 | Ga0495603_0016796 | 3300046455 | Bacteria | 4428 |
| 1059 | Ga0495603_0042944 | 3300046455 | Bacteria | 2701 |
| 1060 | Ga0495603_0113512 | 3300046455 | Bacteria | 1580 |
| 1061 | Ga0495603_0189645 | 3300046455 | Bacteria | 1189 |
| 1062 | Ga0495603_0269844 | 3300046455 | Bacteria | 979 |
| 1063 | Ga0495590_0091217 | 3300046457 | Bacteria | 1078 |
| 1064 | Ga0495590_0242746 | 3300046457 | Bacteria | 669 |
| 1065 | Ga0495629_0000613 | 3300046459 | Bacteria | 29030 |
| 1066 | Ga0495629_0017830 | 3300046459 | Bacteria | 5089 |
| 1067 | Ga0495629_0040867 | 3300046459 | Bacteria | 3263 |
| 1068 | Ga0495629_0111404 | 3300046459 | Bacteria | 1908 |
| 1069 | Ga0495629_0111418 | 3300046459 | Bacteria | 1908 |
| 1070 | Ga0495629_0532630 | 3300046459 | Bacteria | 790 |
| 1071 | Ga0495629_0771007 | 3300046459 | Bacteria | 636 |
| 1072 | Ga0495638_0042575 | 3300046460 | Bacteria | 2867 |
| 1073 | Ga0495638_0289831 | 3300046460 | Bacteria | 886 |
| 1074 | Ga0495638_0328574 | 3300046460 | Bacteria | 815 |
| 1075 | Ga0495641_0003482 | 3300046461 | Bacteria | 11741 |
| 1076 | Ga0495641_0169821 | 3300046461 | Bacteria | 976 |
| 1077 | Ga0495651_0032896 | 3300046462 | Bacteria | 4044 |
| 1078 | Ga0495651_0162003 | 3300046462 | Bacteria | 1601 |
| 1079 | Ga0495651_0173806 | 3300046462 | Bacteria | 1531 |
| 1080 | Ga0495651_0339993 | 3300046462 | Bacteria | 995 |
| 1081 | Ga0495651_0368488 | 3300046462 | Bacteria | 945 |
| 1082 | Ga0495653_0018693 | 3300046463 | Bacteria | 5626 |
| 1083 | Ga0495653_0101477 | 3300046463 | Bacteria | 2084 |
| 1084 | Ga0495650_0192206 | 3300046471 | Bacteria | 713 |
| 1085 | Ga0495580_0015760 | 3300046472 | Bacteria | 5693 |
| 1086 | Ga0495580_0037287 | 3300046472 | Bacteria | 3490 |
| 1087 | Ga0495580_0423702 | 3300046472 | Bacteria | 895 |
| 1088 | Ga0495582_0000354 | 3300046473 | Bacteria | 25130 |
| 1089 | Ga0495582_0029563 | 3300046473 | Bacteria | 3008 |
| 1090 | Ga0495582_0049634 | 3300046473 | Bacteria | 2311 |
| 1091 | Ga0495582_0057451 | 3300046473 | Bacteria | 2145 |
| 1092 | Ga0495582_0216545 | 3300046473 | Bacteria | 1095 |
| 1093 | Ga0495582_0774766 | 3300046473 | Bacteria | 555 |
| 1094 | Ga0495605_0105093 | 3300046474 | Bacteria | 1293 |
| 1095 | Ga0495605_0227067 | 3300046474 | Bacteria | 805 |
| 1096 | Ga0495639_0000140 | 3300046475 | Bacteria | 37499 |
| 1097 | Ga0495639_0049373 | 3300046475 | Bacteria | 1910 |
| 1098 | Ga0495639_0244899 | 3300046475 | Bacteria | 885 |
| 1099 | Ga0495639_0468958 | 3300046475 | Bacteria | 641 |
| 1100 | Ga0495639_0604451 | 3300046475 | Bacteria | 564 |
| 1101 | Ga0495662_0010658 | 3300046476 | Bacteria | 4496 |
| 1102 | Ga0495662_0077201 | 3300046476 | Bacteria | 1618 |
| 1103 | Ga0495662_0108703 | 3300046476 | Bacteria | 1358 |
| 1104 | Ga0495664_0045438 | 3300046477 | Bacteria | 2605 |
| 1105 | Ga0495664_0192392 | 3300046477 | Bacteria | 1236 |
| 1106 | Ga0495664_0200726 | 3300046477 | Bacteria | 1208 |
| 1107 | Ga0495664_0628833 | 3300046477 | Bacteria | 637 |
| 1108 | Ga0495664_0955557 | 3300046477 | Bacteria | 500 |
| 1109 | Ga0495584_0082641 | 3300046491 | Bacteria | 1617 |
| 1110 | Ga0495584_0414117 | 3300046491 | Bacteria | 685 |
| 1111 | Ga0495585_0098194 | 3300046492 | Bacteria | 1569 |
| 1112 | Ga0495585_0137054 | 3300046492 | Bacteria | 1284 |
| 1113 | Ga0495594_0000198 | 3300046499 | Bacteria | 29459 |
| 1114 | Ga0495594_0174150 | 3300046499 | Bacteria | 1224 |
| 1115 | Ga0495596_0178342 | 3300046500 | Bacteria | 826 |
| 1116 | Ga0495606_0002687 | 3300046507 | Bacteria | 20107 |
| 1117 | Ga0495606_0136669 | 3300046507 | Bacteria | 1451 |
| 1118 | Ga0495606_0355431 | 3300046507 | Bacteria | 776 |
| 1119 | Ga0495608_0105818 | 3300046511 | Bacteria | 1811 |
| 1120 | Ga0495608_0151351 | 3300046511 | Bacteria | 1478 |
| 1121 | Ga0495608_0580030 | 3300046511 | Bacteria | 674 |
| 1122 | Ga0495610_0062565 | 3300046512 | Bacteria | 1765 |
| 1123 | Ga0495610_0131844 | 3300046512 | Bacteria | 1084 |
| 1124 | Ga0495610_0213145 | 3300046512 | Bacteria | 784 |
| 1125 | Ga0495610_0222809 | 3300046512 | Bacteria | 761 |
| 1126 | Ga0495616_0117900 | 3300046513 | Bacteria | 1228 |
| 1127 | Ga0495616_0176797 | 3300046513 | Bacteria | 951 |
| 1128 | Ga0495616_0203889 | 3300046513 | Bacteria | 868 |
| 1129 | Ga0495618_0065533 | 3300046514 | Bacteria | 2309 |
| 1130 | Ga0495618_0102863 | 3300046514 | Bacteria | 1828 |
| 1131 | Ga0495618_0138628 | 3300046514 | Bacteria | 1556 |
| 1132 | Ga0495618_0183687 | 3300046514 | Bacteria | 1328 |
| 1133 | Ga0495618_0323491 | 3300046514 | Bacteria | 955 |
| 1134 | Ga0495620_0140670 | 3300046515 | Bacteria | 944 |
| 1135 | Ga0495628_0018107 | 3300046516 | Bacteria | 5842 |
| 1136 | Ga0495628_0022236 | 3300046516 | Bacteria | 5211 |
| 1137 | Ga0495628_0041672 | 3300046516 | Bacteria | 3665 |
| 1138 | Ga0495628_0065353 | 3300046516 | Bacteria | 2846 |
| 1139 | Ga0495630_0020468 | 3300046517 | Bacteria | 4879 |
| 1140 | Ga0495630_0052250 | 3300046517 | Bacteria | 3059 |
| 1141 | Ga0495630_0186619 | 3300046517 | Bacteria | 1582 |
| 1142 | Ga0495631_0050891 | 3300046518 | Bacteria | 1811 |
| 1143 | Ga0495631_0068928 | 3300046518 | Bacteria | 1530 |
| 1144 | Ga0495631_0518398 | 3300046518 | Bacteria | 508 |
| 1145 | Ga0495632_0166879 | 3300046519 | Bacteria | 1012 |
| 1146 | Ga0495632_0241351 | 3300046519 | Bacteria | 812 |
| 1147 | Ga0495643_0504646 | 3300046522 | Bacteria | 520 |
| 1148 | Ga0495644_0421631 | 3300046523 | Bacteria | 529 |
| 1149 | Ga0495648_0078089 | 3300046524 | Bacteria | 1894 |
| 1150 | Ga0495648_0186538 | 3300046524 | Bacteria | 1050 |
| 1151 | Ga0495663_0190439 | 3300046525 | Bacteria | 713 |
| 1152 | Ga0495666_0018838 | 3300046526 | Bacteria | 3429 |
| 1153 | Ga0495666_0112865 | 3300046526 | Bacteria | 1276 |
| 1154 | Ga0495666_0115885 | 3300046526 | Bacteria | 1257 |
| 1155 | Ga0495652_0032645 | 3300046529 | Bacteria | 4552 |
| 1156 | Ga0495652_0049225 | 3300046529 | Bacteria | 3608 |
| 1157 | Ga0495652_0203923 | 3300046529 | Bacteria | 1499 |
| 1158 | Ga0495652_0208934 | 3300046529 | Bacteria | 1475 |
| 1159 | Ga0495652_0708619 | 3300046529 | Bacteria | 677 |
| 1160 | Ga0495665_0021456 | 3300046531 | Bacteria | 3469 |
| 1161 | Ga0495665_0112957 | 3300046531 | Bacteria | 1424 |
| 1162 | Ga0495640_0024235 | 3300046533 | Bacteria | 4415 |
| 1163 | Ga0495640_0025557 | 3300046533 | Bacteria | 4281 |
| 1164 | Ga0495640_0025627 | 3300046533 | Bacteria | 4273 |
| 1165 | Ga0495640_0118037 | 3300046533 | Bacteria | 1727 |
| 1166 | Ga0495640_0255291 | 3300046533 | Bacteria | 1097 |
| 1167 | Ga0495640_0289683 | 3300046533 | Bacteria | 1018 |
| 1168 | Ga0495586_0037796 | 3300046535 | Bacteria | 2592 |
| 1169 | Ga0495586_0317554 | 3300046535 | Bacteria | 893 |
| 1170 | Ga0495587_0035917 | 3300046536 | Bacteria | 2983 |
| 1171 | Ga0495587_0059128 | 3300046536 | Bacteria | 2250 |
| 1172 | Ga0495587_0200679 | 3300046536 | Bacteria | 1128 |
| 1173 | Ga0495598_0113678 | 3300046537 | Bacteria | 910 |
| 1174 | Ga0495609_0035099 | 3300046538 | Bacteria | 2271 |
| 1175 | Ga0495597_0166257 | 3300046542 | Bacteria | 898 |
| 1176 | Ga0495645_0163967 | 3300046543 | Bacteria | 1534 |
| 1177 | Ga0495645_0264314 | 3300046543 | Bacteria | 1138 |
| 1178 | Ga0495645_0689287 | 3300046543 | Bacteria | 621 |
| 1179 | Ga0495645_0808773 | 3300046543 | Bacteria | 562 |
| 1180 | Ga0495622_0016759 | 3300046557 | Bacteria | 3413 |
| 1181 | Ga0495622_0163687 | 3300046557 | Bacteria | 1002 |
| 1182 | Ga0495622_0224576 | 3300046557 | Bacteria | 831 |
| 1183 | Ga0495667_0003356 | 3300046559 | Bacteria | 10715 |
| 1184 | Ga0495667_0019293 | 3300046559 | Bacteria | 4601 |
| 1185 | Ga0495667_0052675 | 3300046559 | Bacteria | 2680 |
| 1186 | Ga0495667_0176474 | 3300046559 | Bacteria | 1372 |
| 1187 | Ga0495667_0280803 | 3300046559 | Bacteria | 1057 |
| 1188 | Ga0495656_0005814 | 3300046615 | Bacteria | 4285 |
| 1189 | Ga0495656_0171849 | 3300046615 | Bacteria | 1060 |
| 1190 | Ga0495668_0078445 | 3300046616 | Bacteria | 1813 |
| 1191 | Ga0495668_0530980 | 3300046616 | Bacteria | 649 |
| 1192 | Ga0495634_0004959 | 3300046642 | Bacteria | 10289 |
| 1193 | Ga0495634_0011642 | 3300046642 | Bacteria | 6399 |
| 1194 | Ga0495634_0042389 | 3300046642 | Bacteria | 3087 |
| 1195 | Ga0495634_0246183 | 3300046642 | Bacteria | 1095 |
| 1196 | Ga0495611_0200268 | 3300046648 | Bacteria | 931 |
| 1197 | Ga0495625_0728227 | 3300046660 | Bacteria | 583 |
| 1198 | Ga0495635_0003204 | 3300046663 | Bacteria | 11282 |
| 1199 | Ga0495635_0123500 | 3300046663 | Bacteria | 1765 |
| 1200 | Ga0495635_0124409 | 3300046663 | Bacteria | 1758 |
| 1201 | Ga0495661_0183860 | 3300046665 | Bacteria | 1106 |
| 1202 | Ga0495661_0422600 | 3300046665 | Bacteria | 645 |
| 1203 | Ga0495588_0005521 | 3300046674 | Bacteria | 5631 |
| 1204 | Ga0495588_0240579 | 3300046674 | Bacteria | 955 |
| 1205 | Ga0495588_0290350 | 3300046674 | Bacteria | 862 |
| 1206 | Ga0495657_0016048 | 3300046675 | Bacteria | 5463 |
| 1207 | Ga0495657_0063091 | 3300046675 | Bacteria | 2445 |
| 1208 | Ga0495599_0004470 | 3300046678 | Bacteria | 8285 |
| 1209 | Ga0495599_0038853 | 3300046678 | Bacteria | 2991 |
| 1210 | Ga0495599_0052626 | 3300046678 | Bacteria | 2551 |
| 1211 | Ga0495599_0236615 | 3300046678 | Bacteria | 1114 |
| 1212 | Ga0495623_0101004 | 3300046679 | Bacteria | 1757 |
| 1213 | Ga0495623_0116121 | 3300046679 | Bacteria | 1617 |
| 1214 | Ga0495623_0142086 | 3300046679 | Bacteria | 1426 |
| 1215 | Ga0495646_0012855 | 3300046680 | Bacteria | 5322 |
| 1216 | Ga0495646_0018662 | 3300046680 | Bacteria | 4393 |
| 1217 | Ga0495646_0023205 | 3300046680 | Bacteria | 3906 |
| 1218 | Ga0495647_0024985 | 3300046681 | Bacteria | 2179 |
| 1219 | Ga0495647_0035229 | 3300046681 | Bacteria | 1878 |
| 1220 | Ga0495647_0106711 | 3300046681 | Bacteria | 1165 |
| 1221 | Ga0495658_0000888 | 3300046683 | Bacteria | 16070 |
| 1222 | Ga0495658_0024311 | 3300046683 | Bacteria | 3225 |
| 1223 | Ga0495658_0242565 | 3300046683 | Bacteria | 1132 |
| 1224 | Ga0495658_0259464 | 3300046683 | Bacteria | 1094 |
| 1225 | Ga0495669_0011937 | 3300046684 | Bacteria | 3695 |
| 1226 | Ga0495669_0016724 | 3300046684 | Bacteria | 3145 |
| 1227 | Ga0495669_0516119 | 3300046684 | Bacteria | 581 |
| 1228 | Ga0495669_0591347 | 3300046684 | Bacteria | 540 |
| 1229 | Ga0495669_0626707 | 3300046684 | Bacteria | 523 |
| 1230 | Ga0495613_0004930 | 3300046689 | Bacteria | 10028 |
| 1231 | Ga0495613_0026647 | 3300046689 | Bacteria | 4306 |
| 1232 | Ga0495613_0049642 | 3300046689 | Bacteria | 3096 |
| 1233 | Ga0495613_0228106 | 3300046689 | Bacteria | 1305 |
| 1234 | Ga0495624_0014296 | 3300046690 | Bacteria | 5389 |
| 1235 | Ga0495624_0031976 | 3300046690 | Bacteria | 3415 |
| 1236 | Ga0495624_0514485 | 3300046690 | Bacteria | 716 |
| 1237 | Ga0495670_0289113 | 3300046691 | Bacteria | 877 |
| 1238 | Ga0495670_0705379 | 3300046691 | Bacteria | 550 |
| 1239 | Ga0495670_0816391 | 3300046691 | Bacteria | 509 |
| 1240 | Ga0495671_0069276 | 3300046692 | Bacteria | 1734 |
| 1241 | Ga0495671_0258088 | 3300046692 | Bacteria | 841 |
| 1242 | Ga0495649_0183835 | 3300046694 | Bacteria | 1090 |
| 1243 | Ga0495589_0198788 | 3300046794 | Bacteria | 947 |
| 1244 | Ga0495589_0258357 | 3300046794 | Bacteria | 813 |
| 1245 | Ga0495600_0010040 | 3300046809 | Bacteria | 5869 |
| 1246 | Ga0495600_0014804 | 3300046809 | Bacteria | 4920 |
| 1247 | Ga0495600_0134365 | 3300046809 | Bacteria | 1607 |
| 1248 | Ga0495600_0383849 | 3300046809 | Bacteria | 876 |
| 1249 | Ga0495600_0548353 | 3300046809 | Bacteria | 707 |
| 1250 | Ga0495600_0619142 | 3300046809 | Bacteria | 657 |
| 1251 | Ga0495600_0636127 | 3300046809 | Bacteria | 646 |
| 1252 | Ga0495581_0000600 | 3300047315 | Bacteria | 18833 |
| 1253 | Ga0495581_0180415 | 3300047315 | Bacteria | 1235 |
| 1254 | Ga0495581_0227293 | 3300047315 | Bacteria | 1092 |
| 1255 | Ga0495581_0478735 | 3300047315 | Bacteria | 724 |
| 1256 | Ga0495581_0494080 | 3300047315 | Bacteria | 712 |
| 1257 | Ga0495581_0722645 | 3300047315 | Bacteria | 574 |
| 1258 | Ga0495604_0032194 | 3300047317 | Bacteria | 4157 |
| 1259 | Ga0495604_0293465 | 3300047317 | Bacteria | 1094 |
| 1260 | Ga0495604_0449014 | 3300047317 | Bacteria | 843 |
| 1261 | Ga0495604_0731819 | 3300047317 | Bacteria | 627 |
| 1262 | Ga0495674_0000559 | 3300047319 | Bacteria | 34585 |
| 1263 | Ga0495674_0027226 | 3300047319 | Bacteria | 5225 |
| 1264 | Ga0495674_0036979 | 3300047319 | Bacteria | 4388 |
| 1265 | Ga0495674_0307235 | 3300047319 | Bacteria | 1294 |
| 1266 | Ga0495674_0720517 | 3300047319 | Bacteria | 781 |
| 1267 | Ga0495674_0736584 | 3300047319 | Bacteria | 771 |
| 1268 | Ga0495674_0935523 | 3300047319 | Bacteria | 667 |
| 1269 | Ga0495672_0006823 | 3300047320 | Bacteria | 8724 |
| 1270 | Ga0495672_0185064 | 3300047320 | Bacteria | 1052 |
| 1271 | Ga0495672_0189842 | 3300047320 | Bacteria | 1034 |
| 1272 | Ga0495676_0063084 | 3300047321 | Bacteria | 2890 |
| 1273 | Ga0495676_0077323 | 3300047321 | Bacteria | 2538 |
| 1274 | Ga0495676_1115302 | 3300047321 | Bacteria | 501 |
| 1275 | Ga0495680_0023759 | 3300047322 | Bacteria | 5094 |
| 1276 | Ga0495680_0216291 | 3300047322 | Bacteria | 1370 |
| 1277 | Ga0495675_0200553 | 3300047444 | Bacteria | 1214 |
| 1278 | Ga0495675_0225460 | 3300047444 | Bacteria | 1132 |
| 1279 | Ga0495685_065541 | 3300047447 | Bacteria | 1221 |
| 1280 | Ga0495673_0022015 | 3300047469 | Bacteria | 3132 |
| 1281 | Ga0495673_0169106 | 3300047469 | Bacteria | 834 |
| 1282 | Ga0495684_0004169 | 3300047471 | Bacteria | 11285 |
| 1283 | Ga0495684_0018085 | 3300047471 | Bacteria | 5432 |
| 1284 | Ga0495684_0025746 | 3300047471 | Bacteria | 4520 |
| 1285 | Ga0495684_0136491 | 3300047471 | Bacteria | 1840 |
| 1286 | Ga0495686_0201235 | 3300047472 | Bacteria | 1143 |
| 1287 | Ga0495686_0474691 | 3300047472 | Bacteria | 662 |
| 1288 | Ga0495593_0010511 | 3300047673 | Bacteria | 5341 |
| 1289 | Ga0495593_0015108 | 3300047673 | Bacteria | 4384 |
| 1290 | Ga0495593_0112655 | 3300047673 | Bacteria | 1388 |
| 1291 | Ga0495593_0118269 | 3300047673 | Bacteria | 1350 |
| 1292 | Ga0495602_0048612 | 3300048088 | Bacteria | 3809 |
| 1293 | Ga0495602_0119490 | 3300048088 | Bacteria | 2123 |
| 1294 | Ga0495602_0121856 | 3300048088 | Bacteria | 2097 |
| 1295 | Ga0495614_0120054 | 3300048089 | Bacteria | 1159 |
| 1296 | Ga0495614_0482762 | 3300048089 | Bacteria | 589 |
| 1297 | Ga0496100_0046021 | 3300048903 | Bacteria | 2803 |
| 1298 | Ga0496100_0050707 | 3300048903 | Bacteria | 2690 |
| 1299 | Ga0496100_0052796 | 3300048903 | Bacteria | 2644 |
| 1300 | Ga0496100_0071267 | 3300048903 | Bacteria | 2320 |
| 1301 | Ga0496100_0316437 | 3300048903 | Bacteria | 1171 |
| 1302 | Ga0496100_0557560 | 3300048903 | Bacteria | 887 |
| 1303 | Ga0496100_0615096 | 3300048903 | Bacteria | 844 |
| 1304 | Ga0496100_0621164 | 3300048903 | Bacteria | 840 |
| 1305 | Ga0496101_0031805 | 3300048904 | Bacteria | 3712 |
| 1306 | Ga0496101_0038658 | 3300048904 | Bacteria | 3389 |
| 1307 | Ga0496101_0081744 | 3300048904 | Bacteria | 2390 |
| 1308 | Ga0496101_0087255 | 3300048904 | Bacteria | 2316 |
| 1309 | Ga0496101_0115840 | 3300048904 | Bacteria | 2022 |
| 1310 | Ga0496101_0205977 | 3300048904 | Bacteria | 1522 |
| 1311 | Ga0496101_0297279 | 3300048904 | Bacteria | 1264 |
| 1312 | Ga0496101_0335861 | 3300048904 | Bacteria | 1186 |
| 1313 | Ga0496102_0040369 | 3300048905 | Bacteria | 4221 |
| 1314 | Ga0496102_0235381 | 3300048905 | Bacteria | 1727 |
| 1315 | Ga0496102_0261400 | 3300048905 | Bacteria | 1632 |
| 1316 | Ga0496102_0711138 | 3300048905 | Bacteria | 927 |
| 1317 | Ga0496103_0045684 | 3300048906 | Bacteria | 2702 |
| 1318 | Ga0496103_0375969 | 3300048906 | Bacteria | 913 |
| 1319 | Ga0496103_0483396 | 3300048906 | Bacteria | 793 |
| 1320 | Ga0496103_0498542 | 3300048906 | Bacteria | 779 |
| 1321 | Ga0496103_0663955 | 3300048906 | Bacteria | 662 |
| 1322 | Ga0496104_0028279 | 3300048907 | Bacteria | 5196 |
| 1323 | Ga0496104_0034259 | 3300048907 | Bacteria | 4733 |
| 1324 | Ga0496104_0051847 | 3300048907 | Bacteria | 3874 |
| 1325 | Ga0496104_0515383 | 3300048907 | Bacteria | 1107 |
| 1326 | Ga0496104_0790186 | 3300048907 | Bacteria | 855 |
| 1327 | Ga0496104_0824417 | 3300048907 | Bacteria | 833 |
| 1328 | Ga0496105_0008852 | 3300048908 | Bacteria | 7843 |
| 1329 | Ga0496105_0025832 | 3300048908 | Bacteria | 4784 |
| 1330 | Ga0496105_0036011 | 3300048908 | Bacteria | 4075 |
| 1331 | Ga0496105_0522331 | 3300048908 | Bacteria | 930 |
| 1332 | Ga0496106_0034402 | 3300048909 | Bacteria | 3783 |
| 1333 | Ga0496106_0035026 | 3300048909 | Bacteria | 3752 |
| 1334 | Ga0496106_0047123 | 3300048909 | Bacteria | 3243 |
| 1335 | Ga0496106_0055110 | 3300048909 | Bacteria | 3004 |
| 1336 | Ga0496106_0059950 | 3300048909 | Bacteria | 2884 |
| 1337 | Ga0496106_0288994 | 3300048909 | Bacteria | 1314 |
| 1338 | Ga0496106_0311545 | 3300048909 | Bacteria | 1263 |
| 1339 | Ga0496106_0526078 | 3300048909 | Bacteria | 950 |
| 1340 | Ga0496106_0565297 | 3300048909 | Bacteria | 912 |
| 1341 | Ga0496106_0626290 | 3300048909 | Bacteria | 861 |
| 1342 | Ga0496107_0098614 | 3300048910 | Bacteria | 2140 |
| 1343 | Ga0496107_0283617 | 3300048910 | Bacteria | 1233 |
| 1344 | Ga0496108_0003043 | 3300048911 | Bacteria | 13477 |
| 1345 | Ga0496108_0197454 | 3300048911 | Bacteria | 1745 |
| 1346 | Ga0496108_0198549 | 3300048911 | Bacteria | 1740 |
| 1347 | Ga0496108_0332468 | 3300048911 | Bacteria | 1325 |
| 1348 | Ga0496108_0533638 | 3300048911 | Bacteria | 1024 |
| 1349 | Ga0496108_0778245 | 3300048911 | Bacteria | 826 |
| 1350 | Ga0496108_0831821 | 3300048911 | Bacteria | 795 |
| 1351 | Ga0496109_0009711 | 3300048912 | Bacteria | 8213 |
| 1352 | Ga0496109_0149407 | 3300048912 | Bacteria | 2187 |
| 1353 | Ga0496109_0191019 | 3300048912 | Bacteria | 1924 |
| 1354 | Ga0496109_0198648 | 3300048912 | Bacteria | 1885 |
| 1355 | Ga0496109_0581071 | 3300048912 | Bacteria | 1056 |
| 1356 | Ga0496109_1662183 | 3300048912 | Bacteria | 573 |
| 1357 | Ga0496109_1919558 | 3300048912 | Bacteria | 524 |
| 1358 | Ga0496110_0004491 | 3300048913 | Bacteria | 10821 |
| 1359 | Ga0496110_0005229 | 3300048913 | Bacteria | 10154 |
| 1360 | Ga0496110_0088768 | 3300048913 | Bacteria | 2762 |
| 1361 | Ga0496110_0339977 | 3300048913 | Bacteria | 1367 |
| 1362 | Ga0496110_0367549 | 3300048913 | Bacteria | 1311 |
| 1363 | Ga0496110_0411415 | 3300048913 | Bacteria | 1233 |
| 1364 | Ga0496110_1314802 | 3300048913 | Bacteria | 632 |
| 1365 | Ga0496110_1709304 | 3300048913 | Bacteria | 539 |
| 1366 | Ga0496111_0009814 | 3300048914 | Bacteria | 6399 |
| 1367 | Ga0496111_0031327 | 3300048914 | Bacteria | 3788 |
| 1368 | Ga0496111_0172410 | 3300048914 | Bacteria | 1607 |
| 1369 | Ga0496111_0267541 | 3300048914 | Bacteria | 1268 |
| 1370 | Ga0496111_0551614 | 3300048914 | Bacteria | 846 |
| 1371 | Ga0496111_0632185 | 3300048914 | Bacteria | 782 |
| 1372 | Ga0496112_0000046 | 3300048915 | Bacteria | 85631 |
| 1373 | Ga0496112_0012428 | 3300048915 | Bacteria | 7827 |
| 1374 | Ga0496112_0023031 | 3300048915 | Bacteria | 5943 |
| 1375 | Ga0496112_0071634 | 3300048915 | Bacteria | 3425 |
| 1376 | Ga0496112_0099111 | 3300048915 | Bacteria | 2884 |
| 1377 | Ga0496112_0112577 | 3300048915 | Bacteria | 2692 |
| 1378 | Ga0496112_0163689 | 3300048915 | Bacteria | 2190 |
| 1379 | Ga0496112_0312861 | 3300048915 | Bacteria | 1515 |
| 1380 | Ga0496112_0387308 | 3300048915 | Bacteria | 1338 |
| 1381 | Ga0496112_0556686 | 3300048915 | Bacteria | 1080 |
| 1382 | Ga0496112_1241505 | 3300048915 | Bacteria | 661 |
| 1383 | Ga0496113_0044643 | 3300048916 | Bacteria | 3284 |
| 1384 | Ga0496113_0048018 | 3300048916 | Bacteria | 3175 |
| 1385 | Ga0496113_0131622 | 3300048916 | Bacteria | 1963 |
| 1386 | Ga0496113_0147516 | 3300048916 | Bacteria | 1854 |
| 1387 | Ga0496113_0267909 | 3300048916 | Bacteria | 1365 |
| 1388 | Ga0496113_1370963 | 3300048916 | Bacteria | 548 |
| 1389 | Ga0496114_0099620 | 3300048917 | Bacteria | 2479 |
| 1390 | Ga0496114_0196415 | 3300048917 | Bacteria | 1766 |
| 1391 | Ga0496114_0205692 | 3300048917 | Bacteria | 1725 |
| 1392 | Ga0496114_0368535 | 3300048917 | Bacteria | 1271 |
| 1393 | Ga0496114_0586261 | 3300048917 | Bacteria | 984 |
| 1394 | Ga0496114_0596970 | 3300048917 | Bacteria | 974 |
| 1395 | Ga0496114_0965475 | 3300048917 | Bacteria | 735 |
| 1396 | Ga0496114_1470854 | 3300048917 | Bacteria | 569 |
| 1397 | Ga0496115_0002909 | 3300048918 | Bacteria | 12354 |
| 1398 | Ga0496115_0066846 | 3300048918 | Bacteria | 2906 |
| 1399 | Ga0496115_0066985 | 3300048918 | Bacteria | 2903 |
| 1400 | Ga0496115_0069623 | 3300048918 | Bacteria | 2850 |
| 1401 | Ga0496115_0098350 | 3300048918 | Bacteria | 2396 |
| 1402 | Ga0496115_0212681 | 3300048918 | Bacteria | 1597 |
| 1403 | Ga0496115_0540473 | 3300048918 | Bacteria | 932 |
| 1404 | Ga0496115_0665980 | 3300048918 | Bacteria | 821 |
| 1405 | Ga0496117_0070896 | 3300048920 | Bacteria | 2338 |
| 1406 | Ga0496117_0138996 | 3300048920 | Bacteria | 1458 |
| 1407 | Ga0496117_0373243 | 3300048920 | Bacteria | 729 |
| 1408 | Ga0496118_0006802 | 3300048921 | Bacteria | 12416 |
| 1409 | Ga0496118_0011822 | 3300048921 | Bacteria | 8470 |
| 1410 | Ga0496118_0066857 | 3300048921 | Bacteria | 2622 |
| 1411 | Ga0496118_0128508 | 3300048921 | Bacteria | 1633 |
| 1412 | Ga0496118_0251502 | 3300048921 | Bacteria | 1004 |
| 1413 | Ga0496119_0034242 | 3300048922 | Bacteria | 3351 |
| 1414 | Ga0496119_0111350 | 3300048922 | Bacteria | 1519 |
| 1415 | Ga0496120_0155353 | 3300048923 | Bacteria | 1146 |
| 1416 | Ga0496121_0001986 | 3300048924 | Bacteria | 32509 |
| 1417 | Ga0496121_0018240 | 3300048924 | Bacteria | 7092 |
| 1418 | Ga0496121_0018643 | 3300048924 | Bacteria | 6985 |
| 1419 | Ga0496121_0036041 | 3300048924 | Bacteria | 4417 |
| 1420 | Ga0496121_0166631 | 3300048924 | Bacteria | 1605 |
| 1421 | Ga0496121_0201014 | 3300048924 | Bacteria | 1420 |
| 1422 | Ga0496121_0462043 | 3300048924 | Bacteria | 815 |
| 1423 | Ga0496121_0521909 | 3300048924 | Bacteria | 749 |
| 1424 | Ga0496121_0554476 | 3300048924 | Bacteria | 718 |
| 1425 | Ga0496122_0226298 | 3300048925 | Bacteria | 1068 |
| 1426 | Ga0496122_0306329 | 3300048925 | Bacteria | 853 |
| 1427 | Ga0496123_0254621 | 3300048926 | Bacteria | 864 |
| 1428 | Ga0496124_0006608 | 3300048927 | Bacteria | 12593 |
| 1429 | Ga0496124_0080396 | 3300048927 | Bacteria | 2682 |
| 1430 | Ga0496124_0123368 | 3300048927 | Bacteria | 2067 |
| 1431 | Ga0496124_0144217 | 3300048927 | Bacteria | 1876 |
| 1432 | Ga0496124_0303222 | 3300048927 | Bacteria | 1152 |
| 1433 | Ga0496124_0358801 | 3300048927 | Bacteria | 1028 |
| 1434 | Ga0496124_0667052 | 3300048927 | Bacteria | 665 |
| 1435 | Ga0496125_0000063 | 3300048928 | Bacteria | 250260 |
| 1436 | Ga0496125_0006261 | 3300048928 | Bacteria | 12936 |
| 1437 | Ga0496125_0019586 | 3300048928 | Bacteria | 6376 |
| 1438 | Ga0496125_0061100 | 3300048928 | Bacteria | 3024 |
| 1439 | Ga0496125_0077973 | 3300048928 | Bacteria | 2550 |
| 1440 | Ga0496125_0252591 | 3300048928 | Bacteria | 1111 |
| 1441 | Ga0496125_0412207 | 3300048928 | Bacteria | 786 |
| 1442 | Ga0496126_0010555 | 3300048929 | Bacteria | 9662 |
| 1443 | Ga0496126_0066644 | 3300048929 | Bacteria | 3219 |
| 1444 | Ga0496126_0106374 | 3300048929 | Bacteria | 2448 |
| 1445 | Ga0496126_0109200 | 3300048929 | Bacteria | 2411 |
| 1446 | Ga0496126_0135669 | 3300048929 | Bacteria | 2123 |
| 1447 | Ga0496126_0180108 | 3300048929 | Bacteria | 1796 |
| 1448 | Ga0496126_0212877 | 3300048929 | Bacteria | 1626 |
| 1449 | Ga0496126_0232991 | 3300048929 | Bacteria | 1542 |
| 1450 | Ga0496126_0342455 | 3300048929 | Bacteria | 1224 |
| 1451 | Ga0496126_0397278 | 3300048929 | Bacteria | 1119 |
| 1452 | Ga0496126_0502674 | 3300048929 | Bacteria | 968 |
| 1453 | Ga0496126_0612854 | 3300048929 | Bacteria | 856 |
| 1454 | Ga0496126_0682209 | 3300048929 | Bacteria | 800 |
| 1455 | Ga0496126_0872275 | 3300048929 | Bacteria | 685 |
| 1456 | Ga0496126_0884853 | 3300048929 | Bacteria | 678 |
| 1457 | Ga0496126_1008170 | 3300048929 | Bacteria | 624 |
| 1458 | Ga0495682_0160041 | 3300049460 | Bacteria | 802 |
| 1459 | Ga0495682_0204573 | 3300049460 | Bacteria | 700 |
| 1460 | Ga0495682_0340248 | 3300049460 | Bacteria | 529 |
| 1461 | Ga0501031_0006400 | 3300049568 | Bacteria | 7678 |
| 1462 | Ga0501031_0012001 | 3300049568 | Bacteria | 5650 |
| 1463 | Ga0501031_0028674 | 3300049568 | Bacteria | 3629 |
| 1464 | Ga0501031_0116400 | 3300049568 | Bacteria | 1746 |
| 1465 | Ga0501032_0001803 | 3300049569 | Bacteria | 16905 |
| 1466 | Ga0501032_0004911 | 3300049569 | Bacteria | 10005 |
| 1467 | Ga0501032_0239594 | 3300049569 | Bacteria | 1179 |
| 1468 | Ga0501033_0000523 | 3300049570 | Bacteria | 35975 |
| 1469 | Ga0501033_0001240 | 3300049570 | Bacteria | 22917 |
| 1470 | Ga0501033_0004826 | 3300049570 | Bacteria | 10758 |
| 1471 | Ga0501033_0024599 | 3300049570 | Bacteria | 4542 |
| 1472 | Ga0501033_0289234 | 3300049570 | Bacteria | 1156 |
| 1473 | Ga0501033_0880398 | 3300049570 | Bacteria | 602 |
| 1474 | Ga0501034_0000717 | 3300049571 | Bacteria | 50424 |
| 1475 | Ga0501034_0051314 | 3300049571 | Bacteria | 4159 |
| 1476 | Ga0501034_0082701 | 3300049571 | Bacteria | 3212 |
| 1477 | Ga0501034_0088722 | 3300049571 | Bacteria | 3090 |
| 1478 | Ga0501034_0231883 | 3300049571 | Bacteria | 1795 |
| 1479 | Ga0501034_0809119 | 3300049571 | Bacteria | 829 |
| 1480 | Ga0501036_0000027 | 3300049572 | Bacteria | 99799 |
| 1481 | Ga0501036_0022965 | 3300049572 | Bacteria | 5251 |
| 1482 | Ga0501036_0253831 | 3300049572 | Bacteria | 1473 |
| 1483 | Ga0501036_0418554 | 3300049572 | Bacteria | 1117 |
| 1484 | Ga0501036_0487067 | 3300049572 | Bacteria | 1026 |
| 1485 | Ga0501036_1523264 | 3300049572 | Bacteria | 541 |
| 1486 | Ga0501037_0000104 | 3300049573 | Bacteria | 80204 |
| 1487 | Ga0501037_0001986 | 3300049573 | Bacteria | 14819 |
| 1488 | Ga0501037_0026399 | 3300049573 | Bacteria | 4293 |
| 1489 | Ga0501037_0029042 | 3300049573 | Bacteria | 4084 |
| 1490 | Ga0501037_0067887 | 3300049573 | Bacteria | 2596 |
| 1491 | Ga0501038_0000477 | 3300049574 | Bacteria | 35252 |
| 1492 | Ga0501038_0011478 | 3300049574 | Bacteria | 8081 |
| 1493 | Ga0501038_0019478 | 3300049574 | Bacteria | 6115 |
| 1494 | Ga0501038_0100633 | 3300049574 | Bacteria | 2407 |
| 1495 | Ga0501038_0361996 | 3300049574 | Bacteria | 1128 |
| 1496 | Ga0501039_0001050 | 3300049575 | Bacteria | 20238 |
| 1497 | Ga0501039_0036741 | 3300049575 | Bacteria | 3780 |
| 1498 | Ga0501039_0325226 | 3300049575 | Bacteria | 1208 |
| 1499 | Ga0501039_0334264 | 3300049575 | Bacteria | 1190 |
| 1500 | Ga0501039_0833716 | 3300049575 | Bacteria | 719 |
| 1501 | Ga0501040_0006915 | 3300049576 | Bacteria | 7345 |
| 1502 | Ga0501040_0123072 | 3300049576 | Bacteria | 1821 |
| 1503 | Ga0501042_0026182 | 3300049578 | Bacteria | 4100 |
| 1504 | Ga0501042_0042559 | 3300049578 | Bacteria | 3233 |
| 1505 | Ga0501042_0249237 | 3300049578 | Bacteria | 1281 |
| 1506 | Ga0501043_0000076 | 3300049579 | Bacteria | 86074 |
| 1507 | Ga0501043_0005019 | 3300049579 | Bacteria | 10713 |
| 1508 | Ga0501043_0012465 | 3300049579 | Bacteria | 6651 |
| 1509 | Ga0501043_0085138 | 3300049579 | Bacteria | 2484 |
| 1510 | Ga0501043_0186687 | 3300049579 | Bacteria | 1614 |
| 1511 | Ga0501043_0192722 | 3300049579 | Bacteria | 1584 |
| 1512 | Ga0501046_0001785 | 3300049580 | Bacteria | 20526 |
| 1513 | Ga0501046_0008324 | 3300049580 | Bacteria | 9048 |
| 1514 | Ga0501046_0213911 | 3300049580 | Bacteria | 1430 |
| 1515 | Ga0501047_0000123 | 3300049581 | Bacteria | 95016 |
| 1516 | Ga0501047_0027982 | 3300049581 | Bacteria | 5432 |
| 1517 | Ga0501047_0063198 | 3300049581 | Bacteria | 3571 |
| 1518 | Ga0501047_0105537 | 3300049581 | Bacteria | 2698 |
| 1519 | Ga0501047_0527750 | 3300049581 | Bacteria | 1006 |
| 1520 | Ga0501047_1134197 | 3300049581 | Bacteria | 595 |
| 1521 | Ga0501048_0001197 | 3300049582 | Bacteria | 19639 |
| 1522 | Ga0501048_0009900 | 3300049582 | Bacteria | 7145 |
| 1523 | Ga0501067_0003629 | 3300049583 | Bacteria | 8499 |
| 1524 | Ga0501067_0012611 | 3300049583 | Bacteria | 4690 |
| 1525 | Ga0501068_0005455 | 3300049584 | Bacteria | 6961 |
| 1526 | Ga0501068_0198448 | 3300049584 | Bacteria | 1272 |
| 1527 | Ga0501069_0029662 | 3300049585 | Bacteria | 3002 |
| 1528 | Ga0501070_0003948 | 3300049586 | Bacteria | 12769 |
| 1529 | Ga0501070_0019003 | 3300049586 | Bacteria | 5764 |
| 1530 | Ga0501070_0029926 | 3300049586 | Bacteria | 4562 |
| 1531 | Ga0501070_0411142 | 3300049586 | Bacteria | 1093 |
| 1532 | Ga0501070_0713467 | 3300049586 | Bacteria | 792 |
| 1533 | Ga0501071_0016328 | 3300049587 | Bacteria | 5106 |
| 1534 | Ga0501071_0036287 | 3300049587 | Bacteria | 3515 |
| 1535 | Ga0501071_0300531 | 3300049587 | Bacteria | 1217 |
| 1536 | Ga0501072_0009992 | 3300049588 | Bacteria | 7216 |
| 1537 | Ga0501072_0011011 | 3300049588 | Bacteria | 6900 |
| 1538 | Ga0501072_0051068 | 3300049588 | Bacteria | 3256 |
| 1539 | Ga0501073_0000014 | 3300049589 | Bacteria | 159719 |
| 1540 | Ga0501073_0048823 | 3300049589 | Bacteria | 2969 |
| 1541 | Ga0501073_0050698 | 3300049589 | Bacteria | 2908 |
| 1542 | Ga0501073_0172707 | 3300049589 | Bacteria | 1496 |
| 1543 | Ga0501074_0000615 | 3300049590 | Bacteria | 22190 |
| 1544 | Ga0501074_0019020 | 3300049590 | Bacteria | 4988 |
| 1545 | Ga0501075_0117688 | 3300049591 | Bacteria | 2020 |
| 1546 | Ga0501075_1396422 | 3300049591 | Bacteria | 530 |
| 1547 | Ga0501076_0470144 | 3300049592 | Bacteria | 1036 |
| 1548 | Ga0501079_0000830 | 3300049741 | Bacteria | 20998 |
| 1549 | Ga0501079_0009379 | 3300049741 | Bacteria | 7416 |
| 1550 | Ga0501079_1049956 | 3300049741 | Bacteria | 642 |
| 1551 | Ga0501079_1348852 | 3300049741 | Bacteria | 561 |
| 1552 | Ga0501080_0000547 | 3300049742 | Bacteria | 29661 |
| 1553 | Ga0501080_0080707 | 3300049742 | Bacteria | 3023 |
| 1554 | Ga0501080_0291576 | 3300049742 | Bacteria | 1481 |
| 1555 | Ga0501081_0306248 | 3300049743 | Bacteria | 1166 |
| 1556 | Ga0501081_1221894 | 3300049743 | Bacteria | 569 |
| 1557 | Ga0501083_0000174 | 3300049744 | Bacteria | 41662 |
| 1558 | Ga0501083_0043137 | 3300049744 | Bacteria | 3056 |
| 1559 | Ga0501035_0001320 | 3300049822 | Bacteria | 25596 |
| 1560 | Ga0501035_0001597 | 3300049822 | Bacteria | 22938 |
| 1561 | Ga0501035_0024312 | 3300049822 | Bacteria | 5556 |
| 1562 | Ga0501035_0034283 | 3300049822 | Bacteria | 4614 |
| 1563 | Ga0501035_0061445 | 3300049822 | Bacteria | 3343 |
| 1564 | Ga0501035_0110858 | 3300049822 | Bacteria | 2405 |
| 1565 | Ga0501035_0255463 | 3300049822 | Bacteria | 1487 |
| 1566 | Ga0501035_0336441 | 3300049822 | Bacteria | 1266 |
| 1567 | Ga0501044_0012380 | 3300049823 | Bacteria | 9235 |
| 1568 | Ga0501044_0013936 | 3300049823 | Bacteria | 8685 |
| 1569 | Ga0501044_0034011 | 3300049823 | Bacteria | 5349 |
| 1570 | Ga0501044_0055534 | 3300049823 | Bacteria | 4067 |
| 1571 | Ga0501044_0070448 | 3300049823 | Bacteria | 3556 |
| 1572 | Ga0501044_0086977 | 3300049823 | Bacteria | 3157 |
| 1573 | Ga0501044_0201252 | 3300049823 | Bacteria | 1950 |
| 1574 | Ga0501044_0408151 | 3300049823 | Bacteria | 1270 |
| 1575 | Ga0501045_0013305 | 3300049824 | Bacteria | 5809 |
| 1576 | Ga0501045_0174546 | 3300049824 | Bacteria | 1601 |
| 1577 | Ga0501045_0426907 | 3300049824 | Bacteria | 986 |
| 1578 | nmdc:mga03683_161160_c1 | 3300050489 | Bacteria | 1016 |
| 1579 | nmdc:mga03683_31811_c1 | 3300050489 | Bacteria | 2119 |
| 1580 | nmdc:mga03n38_298928_c1 | 3300050490 | Bacteria | 864 |
| 1581 | nmdc:mga03n38_450763_c1 | 3300050490 | Bacteria | 716 |
| 1582 | nmdc:mga00v17_392786_c1 | 3300050491 | Bacteria | 902 |
| 1583 | nmdc:mga00v17_47772_c1 | 3300050491 | Bacteria | 2593 |
| 1584 | nmdc:mga0yw44_189421_c1 | 3300050492 | Bacteria | 1356 |
| 1585 | nmdc:mga0yw44_37742_c1 | 3300050492 | Bacteria | 2854 |
| 1586 | nmdc:mga0yw44_481599_c1 | 3300050492 | Bacteria | 842 |
| 1587 | nmdc:mga0yw44_610969_c1 | 3300050492 | Bacteria | 741 |
| 1588 | nmdc:mga0k408_174724_c1 | 3300050493 | Bacteria | 1281 |
| 1589 | nmdc:mga0k408_341720_c1 | 3300050493 | Bacteria | 892 |
| 1590 | nmdc:mga06z11_158583_c1 | 3300050494 | Bacteria | 1292 |
| 1591 | nmdc:mga06z11_478689_c1 | 3300050494 | Bacteria | 753 |
| 1592 | nmdc:mga06z11_552963_c1 | 3300050494 | Bacteria | 699 |
| 1593 | nmdc:mga06z11_692515_c1 | 3300050494 | Bacteria | 621 |
| 1594 | nmdc:mga04h51_313894_c1 | 3300050495 | Bacteria | 641 |
| 1595 | nmdc:mga07m45_128548_c1 | 3300050496 | Bacteria | 1465 |
| 1596 | nmdc:mga07m45_222870_c1 | 3300050496 | Bacteria | 1097 |
| 1597 | nmdc:mga05p37_671762_c1 | 3300050507 | Bacteria | 1156 |
| 1598 | nmdc:mga05p37_75721_c1 | 3300050507 | Bacteria | 4142 |
| 1599 | nmdc:mga08y16_1139274_c1 | 3300050511 | Bacteria | 753 |
| 1600 | nmdc:mga08y16_549393_c1 | 3300050511 | Bacteria | 1169 |
| 1601 | nmdc:mga0n895_211449_c1 | 3300050512 | Bacteria | 1970 |
| 1602 | nmdc:mga0rr50_1057741_c1 | 3300050513 | Bacteria | 691 |
| 1603 | nmdc:mga0rr50_505013_c1 | 3300050513 | Bacteria | 1028 |
| 1604 | nmdc:mga08x19_113391_c1 | 3300050514 | Bacteria | 1810 |
| 1605 | nmdc:mga08x19_1230309_c1 | 3300050514 | Bacteria | 531 |
| 1606 | nmdc:mga08x19_837281_c1 | 3300050514 | Bacteria | 653 |
| 1607 | nmdc:mga0a205_723618_c1 | 3300050515 | Bacteria | 844 |
| 1608 | nmdc:mga0sz30_46403_c1 | 3300050516 | Bacteria | 1834 |
| 1609 | Ga0495601_0032181 | 3300053077 | Bacteria | 3264 |
| 1610 | Ga0495601_0126922 | 3300053077 | Bacteria | 1660 |
| 1611 | Ga0495601_0133917 | 3300053077 | Bacteria | 1615 |
| 1612 | Ga0495601_0198588 | 3300053077 | Bacteria | 1311 |
| 1613 | Ga0495601_0284115 | 3300053077 | Bacteria | 1079 |
| 1614 | Ga0495612_0043479 | 3300053078 | Bacteria | 1836 |
| 1615 | Ga0495612_0050233 | 3300053078 | Bacteria | 1712 |
| 1616 | Ga0495612_0222109 | 3300053078 | Bacteria | 837 |
| 1617 | Ga0495612_0233479 | 3300053078 | Bacteria | 816 |
| 1618 | Ga0495612_0255290 | 3300053078 | Bacteria | 780 |
| 1619 | Ga0500635_0058336 | 3300053080 | Bacteria | 1340 |
| 1620 | Ga0500635_0059408 | 3300053080 | Bacteria | 1330 |
| 1621 | Ga0495655_0211203 | 3300053083 | Bacteria | 639 |
| 1622 | Ga0495595_0009446 | 3300053084 | Bacteria | 4035 |
| 1623 | Ga0495595_0148261 | 3300053084 | Bacteria | 1153 |
| 1624 | Ga0495595_0404740 | 3300053084 | Bacteria | 692 |
| 1625 | Ga0495619_0014450 | 3300053085 | Bacteria | 4986 |
| 1626 | Ga0495619_0080719 | 3300053085 | Bacteria | 2189 |
| 1627 | Ga0495619_0393790 | 3300053085 | Bacteria | 957 |
| 1628 | Ga0495619_0673392 | 3300053085 | Bacteria | 704 |
| 1629 | Ga0500643_089644 | 3300053087 | Bacteria | 839 |
| 1630 | Ga0500644_0136437 | 3300053088 | Bacteria | 971 |
| 1631 | Ga0500647_0178692 | 3300053091 | Bacteria | 975 |
| 1632 | Ga0500647_0266953 | 3300053091 | Bacteria | 745 |
| 1633 | Ga0500651_0070589 | 3300053093 | Bacteria | 2174 |
| 1634 | Ga0500566_0000254 | 3300053094 | Bacteria | 28717 |
| 1635 | Ga0500566_0003600 | 3300053094 | Bacteria | 9237 |
| 1636 | Ga0500566_0211549 | 3300053094 | Bacteria | 971 |
| 1637 | Ga0500566_0303082 | 3300053094 | Bacteria | 751 |
| 1638 | Ga0500640_051642 | 3300053095 | Bacteria | 1797 |
| 1639 | Ga0500641_0021282 | 3300053096 | Bacteria | 2470 |
| 1640 | Ga0500641_0165216 | 3300053096 | Bacteria | 954 |
| 1641 | Ga0500641_0369353 | 3300053096 | Bacteria | 572 |
| 1642 | Ga0500554_004284 | 3300053102 | Bacteria | 3010 |
| 1643 | Ga0500554_006809 | 3300053102 | Bacteria | 2590 |
| 1644 | Ga0500555_171278 | 3300053103 | Bacteria | 527 |
| 1645 | Ga0500556_0042140 | 3300053104 | Bacteria | 1613 |
| 1646 | Ga0500562_120112 | 3300053108 | Bacteria | 716 |
| 1647 | Ga0500569_158403 | 3300053109 | Bacteria | 766 |
| 1648 | Ga0500572_000178 | 3300053111 | Bacteria | 22343 |
| 1649 | Ga0500572_005818 | 3300053111 | Bacteria | 2806 |
| 1650 | Ga0500591_073827 | 3300053115 | Bacteria | 1538 |
| 1651 | Ga0500594_0258797 | 3300053118 | Bacteria | 580 |
| 1652 | Ga0500595_002259 | 3300053119 | Bacteria | 9742 |
| 1653 | Ga0500595_003316 | 3300053119 | Bacteria | 7570 |
| 1654 | Ga0500595_008308 | 3300053119 | Bacteria | 4248 |
| 1655 | Ga0500595_023364 | 3300053119 | Bacteria | 2174 |
| 1656 | Ga0500595_025393 | 3300053119 | Bacteria | 2054 |
| 1657 | Ga0500607_258411 | 3300053121 | Bacteria | 685 |
| 1658 | Ga0500608_045172 | 3300053122 | Bacteria | 2116 |
| 1659 | Ga0500614_015435 | 3300053123 | Bacteria | 1703 |
| 1660 | Ga0500614_111579 | 3300053123 | Bacteria | 798 |
| 1661 | Ga0500617_219617 | 3300053124 | Bacteria | 677 |
| 1662 | Ga0500621_214738 | 3300053126 | Bacteria | 671 |
| 1663 | Ga0500642_0067899 | 3300053130 | Bacteria | 1617 |
| 1664 | Ga0500658_0529480 | 3300053134 | Bacteria | 532 |
| 1665 | Ga0500658_0573983 | 3300053134 | Bacteria | 506 |
| 1666 | Ga0500559_0002150 | 3300053136 | Bacteria | 10482 |
| 1667 | Ga0500559_0002386 | 3300053136 | Bacteria | 9764 |
| 1668 | Ga0500559_0103041 | 3300053136 | Bacteria | 1316 |
| 1669 | Ga0500561_0285191 | 3300053137 | Bacteria | 526 |
| 1670 | Ga0500568_0010703 | 3300053139 | Bacteria | 4285 |
| 1671 | Ga0500568_0020007 | 3300053139 | Bacteria | 2903 |
| 1672 | Ga0500568_0150436 | 3300053139 | Bacteria | 861 |
| 1673 | Ga0500573_0083630 | 3300053140 | Bacteria | 1811 |
| 1674 | Ga0500577_0365448 | 3300053142 | Bacteria | 631 |
| 1675 | Ga0500588_0234075 | 3300053146 | Bacteria | 687 |
| 1676 | Ga0500588_0386986 | 3300053146 | Bacteria | 532 |
| 1677 | Ga0500590_059871 | 3300053148 | Bacteria | 1916 |
| 1678 | Ga0500590_182781 | 3300053148 | Bacteria | 908 |
| 1679 | Ga0500590_200691 | 3300053148 | Bacteria | 844 |
| 1680 | Ga0500603_000282 | 3300053150 | Bacteria | 13460 |
| 1681 | Ga0500603_001384 | 3300053150 | Bacteria | 5530 |
| 1682 | Ga0500603_011894 | 3300053150 | Bacteria | 1990 |
| 1683 | Ga0500603_182662 | 3300053150 | Bacteria | 660 |
| 1684 | Ga0500604_0236855 | 3300053151 | Bacteria | 631 |
| 1685 | Ga0500616_0000084 | 3300053153 | Bacteria | 195562 |
| 1686 | Ga0500616_0076717 | 3300053153 | Bacteria | 1689 |
| 1687 | Ga0500622_0006086 | 3300053156 | Bacteria | 7086 |
| 1688 | Ga0500627_0137977 | 3300053158 | Bacteria | 1102 |
| 1689 | Ga0500630_001999 | 3300053159 | Bacteria | 9797 |
| 1690 | Ga0500638_019089 | 3300053162 | Bacteria | 3209 |
| 1691 | Ga0500638_051677 | 3300053162 | Bacteria | 1986 |
| 1692 | Ga0500638_186828 | 3300053162 | Bacteria | 889 |
| 1693 | Ga0500638_193729 | 3300053162 | Bacteria | 866 |
| 1694 | Ga0500639_000025 | 3300053163 | Bacteria | 84839 |
| 1695 | Ga0500639_169843 | 3300053163 | Bacteria | 979 |
| 1696 | Ga0500639_197028 | 3300053163 | Bacteria | 870 |
| 1697 | Ga0500636_0017152 | 3300053177 | Bacteria | 4272 |
| 1698 | Ga0500636_0033663 | 3300053177 | Bacteria | 3033 |
| 1699 | Ga0500636_0078103 | 3300053177 | Bacteria | 1911 |
| 1700 | Ga0500636_0096663 | 3300053177 | Bacteria | 1685 |
| 1701 | Ga0500636_0539956 | 3300053177 | Bacteria | 506 |
| 1702 | Ga0500637_0000520 | 3300053178 | Bacteria | 15017 |
| 1703 | Ga0500637_0005157 | 3300053178 | Bacteria | 6298 |
| 1704 | Ga0500637_0060228 | 3300053178 | Bacteria | 2174 |
| 1705 | Ga0500637_0110048 | 3300053178 | Bacteria | 1597 |
| 1706 | Ga0500576_010807 | 3300053725 | Bacteria | 4039 |
| 1707 | Ga0500611_135833 | 3300053727 | Bacteria | 666 |
| 1708 | Ga0500656_015674 | 3300053732 | Bacteria | 891 |
| 1709 | Ga0500552_004980 | 3300053733 | Bacteria | 1426 |
| 1710 | Ga0500596_001469 | 3300053735 | Bacteria | 4761 |
| 1711 | Ga0500596_002457 | 3300053735 | Bacteria | 3651 |
| 1712 | Ga0500596_003890 | 3300053735 | Bacteria | 2793 |
| 1713 | Ga0500601_044126 | 3300053737 | Bacteria | 546 |
| 1714 | Ga0501084_0003729 | 3300054114 | Bacteria | 12367 |
| 1715 | Ga0501084_0034764 | 3300054114 | Bacteria | 4214 |
| 1716 | Ga0501084_0524440 | 3300054114 | Bacteria | 1001 |
| 1717 | Ga0500661_004207 | 3300055283 | Bacteria | 2693 |
| 1718 | Ga0500661_095768 | 3300055283 | Bacteria | 560 |
| 1719 | Ga0587073_0218694 | 3300059492 | Bacteria | 581 |
| 1720 | Ga0587090_024678 | 3300059510 | Bacteria | 966 |
| 1721 | Ga0587091_202700 | 3300059511 | Bacteria | 534 |
| 1722 | Ga0587129_014690 | 3300059608 | Bacteria | 646 |
| 1723 | Ga0587128_033317 | 3300059630 | Bacteria | 866 |
| 1724 | Ga0587078_054878 | 3300059646 | Bacteria | 592 |
| 1725 | Ga0501082_0002368 | 3300060353 | Bacteria | 16508 |
| 1726 | Ga0501082_0043704 | 3300060353 | Bacteria | 3864 |
| 1727 | Ga0501082_0575236 | 3300060353 | Bacteria | 986 |
| 1728 | Ga0466962_0135371 | 3300061719 | Bacteria | 1192 |
| 1729 | 2513661279 | 2513237096 | Bacteria | 8722461 |
| 1730 | 2513673107 | 2513237098 | Bacteria | 9902361 |
| 1731 | 2513697034 | 2513237101 | Bacteria | 7952346 |
| 1732 | 2513723768 | 2513237104 | Bacteria | 10034502 |
| 1733 | 2513858172 | 2513237137 | Bacteria | 9558895 |
| 1734 | 2513891991 | 2513237141 | Bacteria | 8496279 |
| 1735 | 2513923000 | 2513237145 | Bacteria | 8979722 |
| 1736 | 2517893937 | 2517572143 | Bacteria | 9484767 |
| 1737 | 2524540707 | 2524023228 | Bacteria | 10118060 |
| 1738 | 2671122927 | 2667528175 | Bacteria | 7532676 |
| 1739 | 2723846475 | 2721755755 | Bacteria | 8322773 |
| 1740 | 2728748055 | 2728368998 | Bacteria | 8720350 |
| 1741 | 2793072820 | 2791355197 | Bacteria | 8420563 |
| 1742 | 2793076856 | |||
| 1743 | 2856325746 | 2856320880 | Bacteria | 7263508 |
| 1744 | 2869279364 | 2869278585 | Bacteria | 7077053 |
| 1745 | 2874145111 | 2874139085 | Bacteria | 7021506 |
| 1746 | 2874610557 | 2874604998 | Bacteria | 7834745 |
| 1747 | 2876810242 | 2876808645 | Bacteria | 8824342 |
| 1748 | 2878743310 | 2878738818 | Bacteria | 7136951 |
| 1749 | 2879111751 | 2879110137 | Bacteria | 8907982 |
| 1750 | 2885379964 | 2885374607 | Bacteria | 8927485 |
| 1751 | 2885389021 | 2885383462 | Bacteria | 9473874 |
| 1752 | 2888340039 | 2888337043 | Bacteria | 6629336 |
| 1753 | 2888388333 | 2888388044 | Bacteria | 7304136 |
| 1754 | 2889039006 | 2889033259 | Bacteria | 9099371 |
| 1755 | 2903451935 | 2903448605 | Bacteria | 7357801 |
| 1756 | 2903749544 | 2903748898 | Bacteria | 9972761 |
| 1757 | 2903774649 | 2903768456 | Bacteria | 9749579 |
| 1758 | 2904693415 | 2904690495 | Bacteria | 9412302 |
| 1759 | 2906610830 | |||
| 1760 | 2906636018 | 2906635258 | Bacteria | 8601019 |
| 1761 | 2906663914 | 2906660503 | Bacteria | 8595048 |
| 1762 | 2908744340 | 2908739725 | Bacteria | 8628932 |
| 1763 | 2908761932 | 2908756301 | Bacteria | 8864324 |
| 1764 | 2922428499 | |||
| 1765 | 2924723301 | 2924718760 | Bacteria | 6331356 |
| 1766 | 2924739515 | 2924733363 | Bacteria | 7574837 |
| 1767 | 2924781121 | 2924776078 | Bacteria | 7492003 |
| 1768 | 2935634483 | 2935630451 | Bacteria | 8169952 |
| 1769 | 2937877545 | 2937877337 | Bacteria | 7246526 |
| 1770 | 2937975372 | 2937972304 | Bacteria | 7532020 |
| 1771 | 2941508969 | 2941507105 | Bacteria | 8166816 |
| 1772 | 2941516798 | 2941515067 | Bacteria | 8166720 |
| 1773 | 2941525107 | 2941523033 | Bacteria | 8169134 |
| 1774 | 2958035504 | 2958034702 | Bacteria | 6989922 |
| 1775 | 2958043691 | 2958041894 | Bacteria | 13082850 |
| 1776 | 2958084652 | 2958084443 | Bacteria | 7312792 |
| 1777 | 2958152120 | 2958144490 | Bacteria | 6677056 |
| 1778 | 2968017948 | 2968016561 | Bacteria | 7022047 |
| 1779 | 2968087635 | 2968083720 | Bacteria | 7351627 |
| 1780 | 2970471877 | 2970469710 | Bacteria | 6969209 |
| 1781 | 2970593960 | 2970593180 | Bacteria | 7073582 |
| 1782 | 2996350805 | 2996348954 | Bacteria | 7239054 |
| 1783 | 3004169468 | 3004167301 | Bacteria | 8330599 |
| 1784 | 3004277503 | 3004275668 | Bacteria | 7114440 |
| 1785 | 3004295265 | 3004289098 | Bacteria | 6135450 |
| 1786 | 3005478624 | 3005474847 | Bacteria | 9259049 |
| 1787 | 8006942737 | 8006933436 | Bacteria | 10410654 |
| 1788 | 8006964874 | 8006964411 | Bacteria | 8966052 |
| 1789 | 8006982460 | 8006973647 | Bacteria | 10679141 |
| 1790 | 8006995599 | 8006994254 | Bacteria | 8309700 |
| 1791 | 8019558502 | 8019555841 | Bacteria | 9642137 |
| 1792 | 8019566796 | 8019565922 | Bacteria | 9639779 |
| 1793 | 8056685029 | 8056681323 | Bacteria | 8472857 |
| 1794 | 8056691815 | 8056689827 | Bacteria | 6712655 |
| 1795 | Ga0373923_0066378 | |||
| 1796 | LJQas_1024377 | |||
| 1797 | JGI24740J21852_10053397 | |||
| 1798 | JGI24737J22298_10048933 | |||
| 1799 | JGI24738J21930_10155461 | |||
| 1800 | JGI25406J46586_10000108 | |||
| 1801 | JGI25406J46586_10001646 | |||
| 1802 | JGI25165J46597_1024394 | |||
| 1803 | JGI25153J46596_10050604 | |||
| 1804 | JGI25404J52841_10000644 | |||
| 1805 | JGI25404J52841_10005197 | |||
| 1806 | JGI25404J52841_10008083 | |||
| 1807 | Ga0055539_1003154 | |||
| 1808 | Ga0055529_1032799 | |||
| 1809 | Ga0065712_10488784 | |||
| 1810 | Ga0065715_10670048 | |||
| 1811 | Ga0065707_10999634 | |||
| 1812 | Ga0070658_10260390 | |||
| 1813 | Ga0070658_10295838 | |||
| 1814 | Ga0070676_10487858 | |||
| 1815 | Ga0070676_10583999 | |||
| 1816 | Ga0070676_11263007 | |||
| 1817 | Ga0070683_100014355 | |||
| 1818 | Ga0070683_100088077 | |||
| 1819 | Ga0070683_100242484 | |||
| 1820 | Ga0070683_101817851 | |||
| 1821 | Ga0070690_100151047 | |||
| 1822 | Ga0070670_100248435 | |||
| 1823 | Ga0068869_100121997 | |||
| 1824 | Ga0068869_100360168 | |||
| 1825 | Ga0068869_101139702 | |||
| 1826 | Ga0068869_101456381 | |||
| 1827 | Ga0068869_101752895 | |||
| 1828 | Ga0070666_10866789 | |||
| 1829 | Ga0070680_100089144 | |||
| 1830 | Ga0070682_100022647 | |||
| 1831 | Ga0070682_100208447 | |||
| 1832 | Ga0070682_100746269 | |||
| 1833 | Ga0068868_100050475 | |||
| 1834 | Ga0068868_100289018 | |||
| 1835 | Ga0068868_101210858 | |||
| 1836 | Ga0070660_100483094 | |||
| 1837 | Ga0070660_100707145 | |||
| 1838 | Ga0070689_100245267 | |||
| 1839 | Ga0070689_100259560 | |||
| 1840 | Ga0070689_100370655 | |||
| 1841 | Ga0070691_10222532 | |||
| 1842 | Ga0070661_100497286 | |||
| 1843 | Ga0070661_101060465 | |||
| 1844 | Ga0070668_100088077 | |||
| 1845 | Ga0070668_100166340 | |||
| 1846 | Ga0070668_100539036 | |||
| 1847 | Ga0070668_100551290 | |||
| 1848 | Ga0070675_100722419 | |||
| 1849 | Ga0070675_102211501 | |||
| 1850 | Ga0070671_100648685 | |||
| 1851 | Ga0070671_101294720 | |||
| 1852 | Ga0070674_100037998 | |||
| 1853 | Ga0070674_100122461 | |||
| 1854 | Ga0070674_100186876 | |||
| 1855 | Ga0070674_100361464 | |||
| 1856 | Ga0070674_100798353 | |||
| 1857 | Ga0070673_100261600 | |||
| 1858 | Ga0070673_100534165 | |||
| 1859 | Ga0070673_100818164 | |||
| 1860 | Ga0070688_100679056 | |||
| 1861 | Ga0070659_100070899 | |||
| 1862 | Ga0070659_100222247 | |||
| 1863 | Ga0070667_100523251 | |||
| 1864 | Ga0070667_100629517 | |||
| 1865 | Ga0070667_100968351 | |||
| 1866 | Ga0070667_101621456 | |||
| 1867 | Ga0070703_10455391 | |||
| 1868 | Ga0070709_10000711 | |||
| 1869 | Ga0070709_10005923 | |||
| 1870 | Ga0070709_10010651 | |||
| 1871 | Ga0070709_10034579 | |||
| 1872 | Ga0070709_10050656 | |||
| 1873 | Ga0070709_10337566 | |||
| 1874 | Ga0070709_10564081 | |||
| 1875 | Ga0070714_100122613 | |||
| 1876 | Ga0070714_100147745 | |||
| 1877 | Ga0070714_100160171 | |||
| 1878 | Ga0070714_100172101 | |||
| 1879 | Ga0070714_100187955 | |||
| 1880 | Ga0070714_101001809 | |||
| 1881 | Ga0070714_101046724 | |||
| 1882 | Ga0070713_100009795 | |||
| 1883 | Ga0070713_100013303 | |||
| 1884 | Ga0070713_100016454 | |||
| 1885 | Ga0070713_100099847 | |||
| 1886 | Ga0070713_100931011 | |||
| 1887 | Ga0070713_101446220 | |||
| 1888 | Ga0070710_10006260 | |||
| 1889 | Ga0070710_10015382 | |||
| 1890 | Ga0070710_10043936 | |||
| 1891 | Ga0070710_10230229 | |||
| 1892 | Ga0070710_10455702 | |||
| 1893 | Ga0070710_10598786 | |||
| 1894 | Ga0070710_10648406 | |||
| 1895 | Ga0070710_10850946 | |||
| 1896 | Ga0070711_100019819 | |||
| 1897 | Ga0070711_100038598 | |||
| 1898 | Ga0070711_100045927 | |||
| 1899 | Ga0070711_100083601 | |||
| 1900 | Ga0070711_100117258 | |||
| 1901 | Ga0070711_100179878 | |||
| 1902 | Ga0070711_100579577 | |||
| 1903 | Ga0070711_101712159 | |||
| 1904 | Ga0070705_101006793 | |||
| 1905 | Ga0070700_100056764 | |||
| 1906 | Ga0070700_101946535 | |||
| 1907 | Ga0070694_100651404 | |||
| 1908 | Ga0070663_100053735 | |||
| 1909 | Ga0070663_100057596 | |||
| 1910 | Ga0070663_100297974 | |||
| 1911 | Ga0070663_100486186 | |||
| 1912 | Ga0070663_100732786 | |||
| 1913 | Ga0070663_102062773 | |||
| 1914 | Ga0070678_100172355 | |||
| 1915 | Ga0070678_100388036 | |||
| 1916 | Ga0070678_100499506 | |||
| 1917 | Ga0070678_100856078 | |||
| 1918 | Ga0070662_100184538 | |||
| 1919 | Ga0070662_100307962 | |||
| 1920 | Ga0070662_101069398 | |||
| 1921 | Ga0070662_101287692 | |||
| 1922 | Ga0070681_10015887 | |||
| 1923 | Ga0070681_10024393 | |||
| 1924 | Ga0070681_10108764 | |||
| 1925 | Ga0070681_10406727 | |||
| 1926 | Ga0070681_11250672 | |||
| 1927 | Ga0070685_10235074 | |||
| 1928 | Ga0070685_10625187 | |||
| 1929 | Ga0070685_10908482 | |||
| 1930 | Ga0070706_100559633 | |||
| 1931 | Ga0070706_100714804 | |||
| 1932 | Ga0070706_100782188 | |||
| 1933 | Ga0070707_100066943 | |||
| 1934 | Ga0070707_101487963 | |||
| 1935 | Ga0070698_100078989 | |||
| 1936 | Ga0070698_100337454 | |||
| 1937 | Ga0070698_100504663 | |||
| 1938 | Ga0070698_101128762 | |||
| 1939 | Ga0070699_100912368 | |||
| 1940 | Ga0070699_101106803 | |||
| 1941 | Ga0070679_100047533 | |||
| 1942 | Ga0070679_100088927 | |||
| 1943 | Ga0070679_100091402 | |||
| 1944 | Ga0070679_100496444 | |||
| 1945 | Ga0070679_100716012 | |||
| 1946 | Ga0070684_100018307 | |||
| 1947 | Ga0070684_100019711 | |||
| 1948 | Ga0070684_100070933 | |||
| 1949 | Ga0070697_100665161 | |||
| 1950 | Ga0068853_100015002 | |||
| 1951 | Ga0068853_100114236 | |||
| 1952 | Ga0068853_100167477 | |||
| 1953 | Ga0070672_100365276 | |||
| 1954 | Ga0070672_101119556 | |||
| 1955 | Ga0070686_100332212 | |||
| 1956 | Ga0070686_100981667 | |||
| 1957 | Ga0070695_101196752 | |||
| 1958 | Ga0070696_101037466 | |||
| 1959 | Ga0070696_101091012 | |||
| 1960 | Ga0070693_100130062 | |||
| 1961 | Ga0070665_100473791 | |||
| 1962 | Ga0070665_100619516 | |||
| 1963 | Ga0070665_100643163 | |||
| 1964 | Ga0070665_100689684 | |||
| 1965 | Ga0070665_101353326 | |||
| 1966 | Ga0070704_100074071 | |||
| 1967 | Ga0070704_100723180 | |||
| 1968 | Ga0070704_102180459 | |||
| 1969 | Ga0068855_100115160 | |||
| 1970 | Ga0068855_100172088 | |||
| 1971 | Ga0068855_100287225 | |||
| 1972 | Ga0068855_100303265 | |||
| 1973 | Ga0068855_100443398 | |||
| 1974 | Ga0068855_100471582 | |||
| 1975 | Ga0068855_100543251 | |||
| 1976 | Ga0068855_102056495 | |||
| 1977 | Ga0070664_100256517 | |||
| 1978 | Ga0070664_100330475 | |||
| 1979 | Ga0068857_100050842 | |||
| 1980 | Ga0068857_100137022 | |||
| 1981 | Ga0068857_100262384 | |||
| 1982 | Ga0068857_100458566 | |||
| 1983 | Ga0068854_100044784 | |||
| 1984 | Ga0068854_100205677 | |||
| 1985 | Ga0068854_100376562 | |||
| 1986 | Ga0068854_100785867 | |||
| 1987 | Ga0068854_100821247 | |||
| 1988 | Ga0068854_100990579 | |||
| 1989 | Ga0068854_101065639 | |||
| 1990 | Ga0068854_101071515 | |||
| 1991 | Ga0068856_100012484 | |||
| 1992 | Ga0068856_100068789 | |||
| 1993 | Ga0068856_100277470 | |||
| 1994 | Ga0068856_100356049 | |||
| 1995 | Ga0068856_100425581 | |||
| 1996 | Ga0068856_100732744 | |||
| 1997 | Ga0068856_102309127 | |||
| 1998 | Ga0070702_100798160 | |||
| 1999 | Ga0068852_100090179 | |||
| 2000 | Ga0068852_100100343 | |||
| 2001 | Ga0068852_100106181 | |||
| 2002 | Ga0068852_100173219 | |||
| 2003 | Ga0068852_100817382 | |||
| 2004 | Ga0068859_100385816 | |||
| 2005 | Ga0068859_101222746 | |||
| 2006 | Ga0068864_100133909 | |||
| 2007 | Ga0068864_100524318 | |||
| 2008 | Ga0068864_100761187 | |||
| 2009 | Ga0068866_10220054 | |||
| 2010 | Ga0068866_11081523 | |||
| 2011 | Ga0068861_100160363 | |||
| 2012 | Ga0068861_100168456 | |||
| 2013 | Ga0068861_100297953 | |||
| 2014 | Ga0068861_100365240 | |||
| 2015 | Ga0068851_10005108 | |||
| 2016 | Ga0068851_10257272 | |||
| 2017 | Ga0068870_10275921 | |||
| 2018 | Ga0068870_10290969 | |||
| 2019 | Ga0068870_10516662 | |||
| 2020 | Ga0068863_100176845 | |||
| 2021 | Ga0068863_100247083 | |||
| 2022 | Ga0068863_100699159 | |||
| 2023 | Ga0068863_100975027 | |||
| 2024 | Ga0068858_100033733 | |||
| 2025 | Ga0068858_100193136 | |||
| 2026 | Ga0068858_100210555 | |||
| 2027 | Ga0068858_100255666 | |||
| 2028 | Ga0068858_100391269 | |||
| 2029 | Ga0068858_100521331 | |||
| 2030 | Ga0068858_100749239 | |||
| 2031 | Ga0068860_100000161 | |||
| 2032 | Ga0068860_100238519 | |||
| 2033 | Ga0068860_100428901 | |||
| 2034 | Ga0068860_100672045 | |||
| 2035 | Ga0068860_100789017 | |||
| 2036 | Ga0068862_100118043 | |||
| 2037 | Ga0068862_100167431 | |||
| 2038 | Ga0068862_100367413 | |||
| 2039 | Ga0068862_100833940 | |||
| 2040 | Ga0068862_100978952 | |||
| 2041 | Ga0068862_102590875 | |||
| 2042 | Ga0081455_10011653 | |||
| 2043 | Ga0081455_10025146 | |||
| 2044 | Ga0081455_10033819 | |||
| 2045 | Ga0081455_10124483 | |||
| 2046 | Ga0081540_1000533 | |||
| 2047 | Ga0081540_1008405 | |||
| 2048 | Ga0081540_1008486 | |||
| 2049 | Ga0081540_1014919 | |||
| 2050 | Ga0081540_1018724 | |||
| 2051 | Ga0081540_1021152 | |||
| 2052 | Ga0081540_1024938 | |||
| 2053 | Ga0081540_1097380 | |||
| 2054 | Ga0081540_1108410 | |||
| 2055 | Ga0081540_1109766 | |||
| 2056 | Ga0081540_1158287 | |||
| 2057 | Ga0081540_1193830 | |||
| 2058 | Ga0081539_10000008 | |||
| 2059 | Ga0081539_10000319 | |||
| 2060 | Ga0081539_10051298 | |||
| 2061 | Ga0070717_10010806 | |||
| 2062 | Ga0070717_10011078 | |||
| 2063 | Ga0070717_10093601 | |||
| 2064 | Ga0070717_10146777 | |||
| 2065 | Ga0070717_10732411 | |||
| 2066 | Ga0070717_10936103 | |||
| 2067 | Ga0070717_10987235 | |||
| 2068 | Ga0070717_11385236 | |||
| 2069 | Ga0075365_10170429 | |||
| 2070 | Ga0075365_10266966 | |||
| 2071 | Ga0075365_10275562 | |||
| 2072 | Ga0075365_10745657 | |||
| 2073 | Ga0075368_10057566 | |||
| 2074 | Ga0075368_10126101 | |||
| 2075 | Ga0075363_100434923 | |||
| 2076 | Ga0075364_10498452 | |||
| 2077 | Ga0075432_10154891 | |||
| 2078 | Ga0070715_10054998 | |||
| 2079 | Ga0070715_11093669 | |||
| 2080 | Ga0070716_100005426 | |||
| 2081 | Ga0070716_100036012 | |||
| 2082 | Ga0070716_100073640 | |||
| 2083 | Ga0070716_100397944 | |||
| 2084 | Ga0070716_100654825 | |||
| 2085 | Ga0070716_100844024 | |||
| 2086 | Ga0070716_100918555 | |||
| 2087 | Ga0070716_101763030 | |||
| 2088 | Ga0070712_100031648 | |||
| 2089 | Ga0070712_100149458 | |||
| 2090 | Ga0070712_100249535 | |||
| 2091 | Ga0070712_100319096 | |||
| 2092 | Ga0070712_100401046 | |||
| 2093 | Ga0070712_100782561 | |||
| 2094 | Ga0075362_10044251 | |||
| 2095 | Ga0075362_10475899 | |||
| 2096 | Ga0075367_10179634 | |||
| 2097 | Ga0075367_10359999 | |||
| 2098 | Ga0075367_10678756 | |||
| 2099 | Ga0075369_10028743 | |||
| 2100 | Ga0075369_10145108 | |||
| 2101 | Ga0075369_10360163 | |||
| 2102 | Ga0075366_10496499 | |||
| 2103 | Ga0097621_100540451 | |||
| 2104 | Ga0097621_100576082 | |||
| 2105 | Ga0097621_100806756 | |||
| 2106 | Ga0097621_101336351 | |||
| 2107 | Ga0075370_10095230 | |||
| 2108 | Ga0075370_10103519 | |||
| 2109 | Ga0075370_10537320 | |||
| 2110 | Ga0068871_100170257 | |||
| 2111 | Ga0068871_100204319 | |||
| 2112 | Ga0068871_100369542 | |||
| 2113 | Ga0068871_101128277 | |||
| 2114 | Ga0068871_101422156 | |||
| 2115 | Ga0068871_102088589 | |||
| 2116 | Ga0068871_102156303 | |||
| 2117 | Ga0075428_101045257 | |||
| 2118 | Ga0075430_100647269 | |||
| 2119 | Ga0075431_101726346 | |||
| 2120 | Ga0075434_100207420 | |||
| 2121 | Ga0075434_100342945 | |||
| 2122 | Ga0068865_100686583 | |||
| 2123 | Ga0068865_100902238 | |||
| 2124 | Ga0075436_100074879 | |||
| 2125 | Ga0075436_101390907 | |||
| 2126 | Ga0097620_100385840 | |||
| 2127 | Ga0097620_101222756 | |||
| 2128 | Ga0099825_1025798 | |||
| 2129 | Ga0099824_1002235 | |||
| 2130 | Ga0099822_1006882 | |||
| 2131 | Ga0075435_100575742 | |||
| 2132 | Ga0075435_101201063 | |||
| 2133 | Ga0075435_101333737 | |||
| 2134 | Ga0099794_10026969 | |||
| 2135 | Ga0099794_10110647 | |||
| 2136 | Ga0099794_10227749 | |||
| 2137 | Ga0099794_10775838 | |||
| 2138 | Ga0099795_10055193 | |||
| 2139 | Ga0099795_10096048 | |||
| 2140 | Ga0099795_10152514 | |||
| 2141 | Ga0099795_10328200 | |||
| 2142 | Ga0099795_10357315 | |||
| 2143 | Ga0105251_10539554 | |||
| 2144 | Ga0105250_10469832 | |||
| 2145 | Ga0105240_10074299 | |||
| 2146 | Ga0105240_10108370 | |||
| 2147 | Ga0105240_10132523 | |||
| 2148 | Ga0105240_10174911 | |||
| 2149 | Ga0105240_10273738 | |||
| 2150 | Ga0105240_10276477 | |||
| 2151 | Ga0105240_10750917 | |||
| 2152 | Ga0105240_10906311 | |||
| 2153 | Ga0105240_11406332 | |||
| 2154 | Ga0105240_11517282 | |||
| 2155 | Ga0105240_11563359 | |||
| 2156 | Ga0111539_12268288 | |||
| 2157 | Ga0111539_12432873 | |||
| 2158 | Ga0105245_10113770 | |||
| 2159 | Ga0105245_10165372 | |||
| 2160 | Ga0105245_10550704 | |||
| 2161 | Ga0105245_10860058 | |||
| 2162 | Ga0105245_10932570 | |||
| 2163 | Ga0105245_11067005 | |||
| 2164 | Ga0105247_10033343 | |||
| 2165 | Ga0105247_10079482 | |||
| 2166 | Ga0105247_10127166 | |||
| 2167 | Ga0105247_10144790 | |||
| 2168 | Ga0105247_10152058 | |||
| 2169 | Ga0105247_10366853 | |||
| 2170 | Ga0105247_10711033 | |||
| 2171 | Ga0114129_10226285 | |||
| 2172 | Ga0105243_10389767 | |||
| 2173 | Ga0105243_10815473 | |||
| 2174 | Ga0105243_10901638 | |||
| 2175 | Ga0105243_11013930 | |||
| 2176 | Ga0105241_10001465 | |||
| 2177 | Ga0105241_10049278 | |||
| 2178 | Ga0105241_10132093 | |||
| 2179 | Ga0105241_11148235 | |||
| 2180 | Ga0105241_12638700 | |||
| 2181 | Ga0105242_10298121 | |||
| 2182 | Ga0105242_10780212 | |||
| 2183 | Ga0105242_10958571 | |||
| 2184 | Ga0105242_12479757 | |||
| 2185 | Ga0105242_12737101 | |||
| 2186 | Ga0105248_10079208 | |||
| 2187 | Ga0105248_10180846 | |||
| 2188 | Ga0105248_10443094 | |||
| 2189 | Ga0105248_11481593 | |||
| 2190 | Ga0105248_13041081 | |||
| 2191 | Ga0105237_10082775 | |||
| 2192 | Ga0105237_10160602 | |||
| 2193 | Ga0105237_10162256 | |||
| 2194 | Ga0105237_10233768 | |||
| 2195 | Ga0105237_10509940 | |||
| 2196 | Ga0105237_10609634 | |||
| 2197 | Ga0105237_10614061 | |||
| 2198 | Ga0105237_11183166 | |||
| 2199 | Ga0105237_11443767 | |||
| 2200 | Ga0105238_10061520 | |||
| 2201 | Ga0105238_10082122 | |||
| 2202 | Ga0105238_10267973 | |||
| 2203 | Ga0105238_10291187 | |||
| 2204 | Ga0105238_10483474 | |||
| 2205 | Ga0105238_10602130 | |||
| 2206 | Ga0105238_11838552 | |||
| 2207 | Ga0105238_12020289 | |||
| 2208 | Ga0105238_13059924 | |||
| 2209 | Ga0105249_10068182 | |||
| 2210 | Ga0105249_10410318 | |||
| 2211 | Ga0105249_10577193 | |||
| 2212 | Ga0105249_12026154 | |||
| 2213 | Ga0105249_12991147 | |||
| 2214 | Ga0099796_10115466 | |||
| 2215 | Ga0099796_10296990 | |||
| 2216 | Ga0099796_10320592 | |||
| 2217 | Ga0105239_10088062 | |||
| 2218 | Ga0105239_10101265 | |||
| 2219 | Ga0105239_10131659 | |||
| 2220 | Ga0105239_10220159 | |||
| 2221 | Ga0105239_10226651 | |||
| 2222 | Ga0105239_10260778 | |||
| 2223 | Ga0105239_10339626 | |||
| 2224 | Ga0105239_10597532 | |||
| 2225 | Ga0105239_10700420 | |||
| 2226 | Ga0105239_11293569 | |||
| 2227 | Ga0105239_12007311 | |||
| 2228 | Ga0105239_12450229 | |||
| 2229 | Ga0105246_10241362 | |||
| 2230 | Ga0105246_10371949 | |||
| 2231 | Ga0105246_10760957 | |||
| 2232 | Ga0105246_11145659 | |||
| 2233 | Ga0157371_10284552 | |||
| 2234 | Ga0157370_10160379 | |||
| 2235 | Ga0157370_10173993 | |||
| 2236 | Ga0157369_10008049 | |||
| 2237 | Ga0157369_10213310 | |||
| 2238 | Ga0157369_10247375 | |||
| 2239 | Ga0157369_10778389 | |||
| 2240 | Ga0157369_12451210 | |||
| 2241 | Ga0157374_10096142 | |||
| 2242 | Ga0157374_11022102 | |||
| 2243 | Ga0157374_11298936 | |||
| 2244 | Ga0157378_10269866 | |||
| 2245 | Ga0157378_10414848 | |||
| 2246 | Ga0157378_11454845 | |||
| 2247 | Ga0157378_11577077 | |||
| 2248 | Ga0163162_10058369 | |||
| 2249 | Ga0163162_10309215 | |||
| 2250 | Ga0163162_10321723 | |||
| 2251 | Ga0163162_10367943 | |||
| 2252 | Ga0163162_10398679 | |||
| 2253 | Ga0163162_11222532 | |||
| 2254 | Ga0157372_10319813 | |||
| 2255 | Ga0157372_10579081 | |||
| 2256 | Ga0157372_10759731 | |||
| 2257 | Ga0157372_11165745 | |||
| 2258 | Ga0157372_12136808 | |||
| 2259 | Ga0157375_10150857 | |||
| 2260 | Ga0157375_10250632 | |||
| 2261 | Ga0157375_10678966 | |||
| 2262 | Ga0157375_13474794 | |||
| 2263 | Ga0163163_10041903 | |||
| 2264 | Ga0163163_10162927 | |||
| 2265 | Ga0163163_10216026 | |||
| 2266 | Ga0163163_11372685 | |||
| 2267 | Ga0163163_11520999 | |||
| 2268 | Ga0163163_11618380 | |||
| 2269 | Ga0157380_10380529 | |||
| 2270 | Ga0157380_10725191 | |||
| 2271 | Ga0157380_11824342 | |||
| 2272 | Ga0157380_11953605 | |||
| 2273 | Ga0182008_10196178 | |||
| 2274 | Ga0157379_10144727 | |||
| 2275 | Ga0157379_10248801 | |||
| 2276 | Ga0157379_10329119 | |||
| 2277 | Ga0157379_10398734 | |||
| 2278 | Ga0157379_11027200 | |||
| 2279 | Ga0157379_11241282 | |||
| 2280 | Ga0157379_11784923 | |||
| 2281 | Ga0157376_10046774 | |||
| 2282 | Ga0157376_10267297 | |||
| 2283 | Ga0157376_12623663 | |||
| 2284 | Ga0182007_10073559 | |||
| 2285 | Ga0163161_10149277 | |||
| 2286 | Ga0163161_10348488 | |||
| 2287 | Ga0163161_11194055 | |||
| 2288 | Ga0163161_11272012 | |||
| 2289 | Ga0213873_10008342 | |||
| 2290 | Ga0213872_10147300 | |||
| 2291 | Ga0213872_10247740 | |||
| 2292 | Ga0213872_10338979 | |||
| 2293 | Ga0213874_10027137 | |||
| 2294 | Ga0213876_10001294 | |||
| 2295 | Ga0213876_10190064 | |||
| 2296 | Ga0213876_10712441 | |||
| 2297 | Ga0213875_10014183 | |||
| 2298 | Ga0213871_10027908 | |||
| 2299 | Ga0224570_105443 | |||
| 2300 | Ga0209563_104166 | |||
| 2301 | Ga0209677_101183 | |||
| 2302 | Ga0209677_126603 | |||
| 2303 | Ga0209148_1014592 | |||
| 2304 | Ga0209148_1035414 | |||
| 2305 | Ga0209233_1002172 | |||
| 2306 | Ga0209233_1014836 | |||
| 2307 | Ga0207666_1076584 | |||
| 2308 | Ga0209455_1005408 | |||
| 2309 | Ga0209758_1002105 | |||
| 2310 | Ga0209758_1011397 | |||
| 2311 | Ga0209758_1011463 | |||
| 2312 | Ga0207697_10095122 | |||
| 2313 | Ga0207697_10383970 | |||
| 2314 | Ga0207656_10012398 | |||
| 2315 | Ga0207692_10002007 | |||
| 2316 | Ga0207692_10062420 | |||
| 2317 | Ga0207692_10129499 | |||
| 2318 | Ga0207692_10214961 | |||
| 2319 | Ga0207692_10269141 | |||
| 2320 | Ga0207692_10292578 | |||
| 2321 | Ga0207692_10874660 | |||
| 2322 | Ga0207642_10250547 | |||
| 2323 | Ga0207710_10011777 | |||
| 2324 | Ga0207710_10137033 | |||
| 2325 | Ga0207710_10192100 | |||
| 2326 | Ga0207688_10393371 | |||
| 2327 | Ga0207688_10599482 | |||
| 2328 | Ga0207680_11050146 | |||
| 2329 | Ga0207647_10087783 | |||
| 2330 | Ga0207685_10069066 | |||
| 2331 | Ga0207685_10092936 | |||
| 2332 | Ga0207699_10002233 | |||
| 2333 | Ga0207699_10024823 | |||
| 2334 | Ga0207699_10107078 | |||
| 2335 | Ga0207699_10125076 | |||
| 2336 | Ga0207699_10264414 | |||
| 2337 | Ga0207699_10543321 | |||
| 2338 | Ga0207699_10691817 | |||
| 2339 | Ga0207645_10075012 | |||
| 2340 | Ga0207645_10727170 | |||
| 2341 | Ga0207643_10101240 | |||
| 2342 | Ga0207643_10135766 | |||
| 2343 | Ga0207705_10127476 | |||
| 2344 | Ga0207705_10215223 | |||
| 2345 | Ga0207684_10128732 | |||
| 2346 | Ga0207684_10740532 | |||
| 2347 | Ga0207684_10948995 | |||
| 2348 | Ga0207654_10090759 | |||
| 2349 | Ga0207654_10721163 | |||
| 2350 | Ga0207654_11421404 | |||
| 2351 | Ga0207707_10006493 | |||
| 2352 | Ga0207707_10116161 | |||
| 2353 | Ga0207707_10158160 | |||
| 2354 | Ga0207707_10336641 | |||
| 2355 | Ga0207695_10001299 | |||
| 2356 | Ga0207695_10086044 | |||
| 2357 | Ga0207695_10090236 | |||
| 2358 | Ga0207695_10161353 | |||
| 2359 | Ga0207695_10228138 | |||
| 2360 | Ga0207695_10596445 | |||
| 2361 | Ga0207695_10853344 | |||
| 2362 | Ga0207695_11147792 | |||
| 2363 | Ga0207695_11172626 | |||
| 2364 | Ga0207671_10044178 | |||
| 2365 | Ga0207671_10083902 | |||
| 2366 | Ga0207671_10154578 | |||
| 2367 | Ga0207671_10217149 | |||
| 2368 | Ga0207671_10503011 | |||
| 2369 | Ga0207671_10642607 | |||
| 2370 | Ga0207671_11053644 | |||
| 2371 | Ga0207693_10005604 | |||
| 2372 | Ga0207693_10042357 | |||
| 2373 | Ga0207693_10085535 | |||
| 2374 | Ga0207693_10127830 | |||
| 2375 | Ga0207693_10185023 | |||
| 2376 | Ga0207693_10801212 | |||
| 2377 | Ga0207663_10000136 | |||
| 2378 | Ga0207663_10041045 | |||
| 2379 | Ga0207663_10286479 | |||
| 2380 | Ga0207663_10341782 | |||
| 2381 | Ga0207663_10430954 | |||
| 2382 | Ga0207663_11707686 | |||
| 2383 | Ga0207660_10115735 | |||
| 2384 | Ga0207660_10134207 | |||
| 2385 | Ga0207660_10203717 | |||
| 2386 | Ga0207660_10208403 | |||
| 2387 | Ga0207660_10607039 | |||
| 2388 | Ga0207662_10786502 | |||
| 2389 | Ga0207657_10016940 | |||
| 2390 | Ga0207657_10105232 | |||
| 2391 | Ga0207657_10218778 | |||
| 2392 | Ga0207652_10017419 | |||
| 2393 | Ga0207652_10222982 | |||
| 2394 | Ga0207652_10229710 | |||
| 2395 | Ga0207652_10992972 | |||
| 2396 | Ga0207652_11281640 | |||
| 2397 | Ga0207681_10413143 | |||
| 2398 | Ga0207681_10512593 | |||
| 2399 | Ga0207694_10000131 | |||
| 2400 | Ga0207694_10056928 | |||
| 2401 | Ga0207694_10089914 | |||
| 2402 | Ga0207694_10127899 | |||
| 2403 | Ga0207694_11271848 | |||
| 2404 | Ga0207650_10376305 | |||
| 2405 | Ga0207659_10966195 | |||
| 2406 | Ga0207659_11080948 | |||
| 2407 | Ga0207659_11082834 | |||
| 2408 | Ga0207687_10170480 | |||
| 2409 | Ga0207687_10572476 | |||
| 2410 | Ga0207687_10738762 | |||
| 2411 | Ga0207687_11682122 | |||
| 2412 | Ga0207687_11814114 | |||
| 2413 | Ga0207700_10019504 | |||
| 2414 | Ga0207700_10044976 | |||
| 2415 | Ga0207700_10064226 | |||
| 2416 | Ga0207700_10244234 | |||
| 2417 | Ga0207700_10308406 | |||
| 2418 | Ga0207700_10536989 | |||
| 2419 | Ga0207700_10646838 | |||
| 2420 | Ga0207664_10040605 | |||
| 2421 | Ga0207664_10161604 | |||
| 2422 | Ga0207664_10163572 | |||
| 2423 | Ga0207664_10179136 | |||
| 2424 | Ga0207664_10240143 | |||
| 2425 | Ga0207664_10413338 | |||
| 2426 | Ga0207664_11259880 | |||
| 2427 | Ga0207644_10544116 | |||
| 2428 | Ga0207644_10597653 | |||
| 2429 | Ga0207690_10341449 | |||
| 2430 | Ga0207690_10344356 | |||
| 2431 | Ga0207706_10191515 | |||
| 2432 | Ga0207706_10260895 | |||
| 2433 | Ga0207706_10384613 | |||
| 2434 | Ga0207706_11135438 | |||
| 2435 | Ga0207706_11262928 | |||
| 2436 | Ga0207709_10285175 | |||
| 2437 | Ga0207709_10545443 | |||
| 2438 | Ga0207709_10646333 | |||
| 2439 | Ga0207709_10923212 | |||
| 2440 | Ga0207709_11104650 | |||
| 2441 | Ga0207709_11686995 | |||
| 2442 | Ga0207670_10369137 | |||
| 2443 | Ga0207669_10029295 | |||
| 2444 | Ga0207669_10557795 | |||
| 2445 | Ga0207704_11166233 | |||
| 2446 | Ga0207665_10003171 | |||
| 2447 | Ga0207665_10082081 | |||
| 2448 | Ga0207665_10435712 | |||
| 2449 | Ga0207665_10483197 | |||
| 2450 | Ga0207665_10725983 | |||
| 2451 | Ga0207665_10911030 | |||
| 2452 | Ga0207665_11467003 | |||
| 2453 | Ga0207691_10131807 | |||
| 2454 | Ga0207691_10241472 | |||
| 2455 | Ga0207691_10756432 | |||
| 2456 | Ga0207691_11292630 | |||
| 2457 | Ga0207711_10290933 | |||
| 2458 | Ga0207711_10309354 | |||
| 2459 | Ga0207711_10384237 | |||
| 2460 | Ga0207711_11619265 | |||
| 2461 | Ga0207689_10118294 | |||
| 2462 | Ga0207689_11713111 | |||
| 2463 | Ga0207661_10003939 | |||
| 2464 | Ga0207661_10131723 | |||
| 2465 | Ga0207661_10157752 | |||
| 2466 | Ga0207661_10257895 | |||
| 2467 | Ga0207679_10087005 | |||
| 2468 | Ga0207679_11252738 | |||
| 2469 | Ga0207679_11613808 | |||
| 2470 | Ga0207667_10077674 | |||
| 2471 | Ga0207667_10091938 | |||
| 2472 | Ga0207667_10134297 | |||
| 2473 | Ga0207667_10154984 | |||
| 2474 | Ga0207667_10225581 | |||
| 2475 | Ga0207667_10272462 | |||
| 2476 | Ga0207667_11074115 | |||
| 2477 | Ga0207667_11894950 | |||
| 2478 | Ga0207651_10125168 | |||
| 2479 | Ga0207651_11109452 | |||
| 2480 | Ga0207651_11166438 | |||
| 2481 | Ga0207712_10057243 | |||
| 2482 | Ga0207712_10388714 | |||
| 2483 | Ga0207712_10884699 | |||
| 2484 | Ga0207712_11914681 | |||
| 2485 | Ga0207668_10013333 | |||
| 2486 | Ga0207668_10047708 | |||
| 2487 | Ga0207668_10085181 | |||
| 2488 | Ga0207668_10374965 | |||
| 2489 | Ga0207668_10528439 | |||
| 2490 | Ga0207668_10636147 | |||
| 2491 | Ga0207668_10927951 | |||
| 2492 | Ga0207668_11147218 | |||
| 2493 | Ga0207668_11497823 | |||
| 2494 | Ga0207640_10298194 | |||
| 2495 | Ga0207640_10465812 | |||
| 2496 | Ga0207640_10531339 | |||
| 2497 | Ga0207640_10545035 | |||
| 2498 | Ga0207640_11227400 | |||
| 2499 | Ga0207640_11274829 | |||
| 2500 | Ga0207658_10193212 | |||
| 2501 | Ga0207658_10304636 | |||
| 2502 | Ga0207658_10981278 | |||
| 2503 | Ga0207658_11079085 | |||
| 2504 | Ga0207677_10015130 | |||
| 2505 | Ga0207677_10063701 | |||
| 2506 | Ga0207703_10097777 | |||
| 2507 | Ga0207703_10209413 | |||
| 2508 | Ga0207703_10251105 | |||
| 2509 | Ga0207703_10775852 | |||
| 2510 | Ga0207703_11406455 | |||
| 2511 | Ga0207639_10022677 | |||
| 2512 | Ga0207639_10071933 | |||
| 2513 | Ga0207639_10084661 | |||
| 2514 | Ga0207639_10581839 | |||
| 2515 | Ga0207639_10694494 | |||
| 2516 | Ga0207639_12187392 | |||
| 2517 | Ga0207678_10155088 | |||
| 2518 | Ga0207678_10162209 | |||
| 2519 | Ga0207678_10253588 | |||
| 2520 | Ga0207678_10674527 | |||
| 2521 | Ga0207678_11362880 | |||
| 2522 | Ga0207678_11861889 | |||
| 2523 | Ga0207708_10052763 | |||
| 2524 | Ga0207708_11470586 | |||
| 2525 | Ga0207702_10000005 | |||
| 2526 | Ga0207702_10018516 | |||
| 2527 | Ga0207702_10205301 | |||
| 2528 | Ga0207702_10360799 | |||
| 2529 | Ga0207702_11188008 | |||
| 2530 | Ga0207702_12203316 | |||
| 2531 | Ga0207641_10437414 | |||
| 2532 | Ga0207641_10638346 | |||
| 2533 | Ga0207641_10733058 | |||
| 2534 | Ga0207648_10164176 | |||
| 2535 | Ga0207648_11033849 | |||
| 2536 | Ga0207648_11041264 | |||
| 2537 | Ga0207648_11795369 | |||
| 2538 | Ga0207676_10466374 | |||
| 2539 | Ga0207676_10788454 | |||
| 2540 | Ga0207676_12228019 | |||
| 2541 | Ga0207674_10028556 | |||
| 2542 | Ga0207674_10090864 | |||
| 2543 | Ga0207674_10170416 | |||
| 2544 | Ga0207674_10348816 | |||
| 2545 | Ga0207675_100096830 | |||
| 2546 | Ga0207675_100174781 | |||
| 2547 | Ga0207675_100195761 | |||
| 2548 | Ga0207683_10095129 | |||
| 2549 | Ga0207683_10099596 | |||
| 2550 | Ga0207683_10124581 | |||
| 2551 | Ga0207683_10406819 | |||
| 2552 | Ga0207683_10833926 | |||
| 2553 | Ga0207683_11229216 | |||
| 2554 | Ga0207698_10055219 | |||
| 2555 | Ga0207698_11153787 | |||
| 2556 | Ga0207698_11299061 | |||
| 2557 | Ga0207698_11767886 | |||
| 2558 | Ga0207698_11875379 | |||
| 2559 | Ga0209589_1000018 | |||
| 2560 | Ga0209489_100026 | |||
| 2561 | Ga0209700_100035 | |||
| 2562 | Ga0209179_1059022 | |||
| 2563 | Ga0209179_1127771 | |||
| 2564 | Ga0209588_1018157 | |||
| 2565 | Ga0209588_1150638 | |||
| 2566 | Ga0209813_10242785 | |||
| 2567 | Ga0207428_10545785 | |||
| 2568 | Ga0268266_10061797 | |||
| 2569 | Ga0268266_10073425 | |||
| 2570 | Ga0268266_10074719 | |||
| 2571 | Ga0268266_10129418 | |||
| 2572 | Ga0268266_10432944 | |||
| 2573 | Ga0268266_10512564 | |||
| 2574 | Ga0268265_10218062 | |||
| 2575 | Ga0268265_10319468 | |||
| 2576 | Ga0268265_10709541 | |||
| 2577 | Ga0268265_11389090 | |||
| 2578 | Ga0268265_11437857 | |||
| 2579 | Ga0268265_12565431 | |||
| 2580 | Ga0268264_10000096 | |||
| 2581 | Ga0268264_10654995 | |||
| 2582 | Ga0268264_10666017 | |||
| 2583 | Ga0268264_10785903 | |||
| 2584 | Ga0265334_10011607 | |||
| 2585 | Ga0307517_10000049 | |||
| 2586 | Ga0307517_10497589 | |||
| 2587 | Ga0307515_10389190 | |||
| 2588 | Ga0307515_10414782 | |||
| 2589 | Ga0307515_10583891 | |||
| 2590 | Ga0307515_10779836 | |||
| 2591 | Ga0265338_10774896 | |||
| 2592 | Ga0307511_10198086 | |||
| 2593 | Ga0265763_1030814 | |||
| 2594 | Ga0265330_10003983 | |||
| 2595 | Ga0265330_10076540 | |||
| 2596 | Ga0265330_10104976 | |||
| 2597 | Ga0265330_10128906 | |||
| 2598 | Ga0265332_10093032 | |||
| 2599 | Ga0265325_10265263 | |||
| 2600 | Ga0265340_10012561 | |||
| 2601 | Ga0265340_10017348 | |||
| 2602 | Ga0265339_10008611 | |||
| 2603 | Ga0265339_10070095 | |||
| 2604 | Ga0265339_10517743 | |||
| 2605 | Ga0265331_10162904 | |||
| 2606 | Ga0265316_10537539 | |||
| 2607 | Ga0265316_10826260 | |||
| 2608 | Ga0265316_11009934 | |||
| 2609 | Ga0307513_10088523 | |||
| 2610 | Ga0307513_10155863 | |||
| 2611 | Ga0307513_10841173 | |||
| 2612 | Ga0307513_10882819 | |||
| 2613 | Ga0307509_10587857 | |||
| 2614 | Ga0307509_10613045 | |||
| 2615 | Ga0307509_10679025 | |||
| 2616 | Ga0307408_100199014 | |||
| 2617 | Ga0307408_100940495 | |||
| 2618 | Ga0307508_10000731 | |||
| 2619 | Ga0307508_10054710 | |||
| 2620 | Ga0307508_10072072 | |||
| 2621 | Ga0307508_10151659 | |||
| 2622 | Ga0307514_10307685 | |||
| 2623 | Ga0265314_10013390 | |||
| 2624 | Ga0265314_10408282 | |||
| 2625 | Ga0265342_10292805 | |||
| 2626 | Ga0265342_10450628 | |||
| 2627 | Ga0307516_10018018 | |||
| 2628 | Ga0307516_10118652 | |||
| 2629 | Ga0307516_10269504 | |||
| 2630 | Ga0307516_10280878 | |||
| 2631 | Ga0307516_10501689 | |||
| 2632 | Ga0307516_10501846 | |||
| 2633 | Ga0307405_10815430 | |||
| 2634 | Ga0307413_10547331 | |||
| 2635 | Ga0307410_11193499 | |||
| 2636 | Ga0307406_10974300 | |||
| 2637 | Ga0307406_11215635 | |||
| 2638 | Ga0307412_10424043 | |||
| 2639 | Ga0307412_10761035 | |||
| 2640 | Ga0307411_10043403 | |||
| 2641 | Ga0307411_11526294 | |||
| 2642 | Ga0307415_100233697 | |||
| 2643 | Ga0307415_101409146 | |||
| 2644 | Ga0307510_10024603 | |||
| 2645 | Ga0307510_10029438 | |||
| 2646 | Ga0307510_10059937 | |||
| 2647 | Ga0307510_10205350 | |||
| 2648 | Ga0315911_1000011 | |||
| 2649 | Ga0316214_1029407 | |||
| 2650 | Ga0316212_1031585 | |||
| 2651 | Ga0373950_0116448 | |||
| 2652 | Ga0373926_0005959 | |||
| 2653 | Ga0373926_0380901 | |||
| 2654 | Ga0373929_0006593 | |||
| 2655 | Ga0373934_0010297 | |||
| 2656 | Ga0373934_0029548 | |||
| 2657 | Ga0373940_0156661 | |||
| 2658 | Ga0373944_0040097 | |||
| 2659 | Ga0373944_0199167 | |||
| 2660 | Ga0373949_0132794 | |||
| 2661 | Ga0373951_0104252 | |||
| 2662 | Ga0373923_0020587 | |||
| 2663 | Ga0373923_0051471 | |||
| 2664 | Ga0373932_0007201 | |||
| 2665 | Ga0373932_0203447 | |||
| 2666 | Ga0373936_0004101 | |||
| 2667 | Ga0373936_0013140 | |||
| 2668 | Ga0373936_0032185 | |||
| 2669 | Ga0373936_0087161 | |||
| 2670 | Ga0373936_0104690 | |||
| 2671 | Ga0373939_0027867 | |||
| 2672 | Ga0373941_0271671 | |||
| 2673 | Ga0373941_0298140 | |||
| 2674 | Ga0373945_0021976 | |||
| 2675 | Ga0373945_0106499 | |||
| 2676 | Ga0373945_0325368 | |||
| 2677 | Ga0373953_0002102 | |||
| 2678 | Ga0373953_0032224 | |||
| 2679 | Ga0373953_0049200 | |||
| 2680 | Ga0373954_0003682 | |||
| 2681 | Ga0373954_0003903 | |||
| 2682 | Ga0373954_0064964 | |||
| 2683 | Ga0373954_0179576 | |||
| 2684 | Ga0373956_0087005 | |||
| 2685 | Ga0373956_0192506 | |||
| 2686 | Ga0373957_0050529 | |||
| 2687 | Ga0373957_0270436 | |||
| 2688 | Ga0373960_0140826 | |||
| 2689 | Ga0373943_0013515 | |||
| 2690 | Ga0373943_0019155 | |||
| 2691 | Ga0373943_0159136 | |||
| 2692 | Ga0373946_0007469 | |||
| 2693 | Ga0373946_0019231 | |||
| 2694 | Ga0373946_0033987 | |||
| 2695 | Ga0373946_0237641 | |||
| 2696 | Ga0373946_0500378 | |||
| 2697 | Ga0373955_0002813 | |||
| 2698 | Ga0373955_0004594 | |||
| 2699 | Ga0373955_0031043 | |||
| 2700 | Ga0373955_0066668 | |||
| 2701 | Ga0373955_0401979 | |||
| 2702 | Ga0373942_0383683 | |||
| 2703 | Ga0373962_0059436 | |||
| 2704 | Ga0373962_0115549 | |||
| 2705 | Ga0373924_0008710 | |||
| 2706 | Ga0373924_0038459 | |||
| 2707 | Ga0373924_0102591 | |||
| 2708 | Ga0373924_0116917 | |||
| 2709 | Ga0373931_0010082 | |||
| 2710 | Ga0373931_0107836 | |||
| 2711 | Ga0373931_0125247 | |||
| 2712 | Ga0373931_0210435 | |||
| 2713 | Ga0373931_0570184 | |||
| 2714 | Ga0373935_0033366 | |||
| 2715 | Ga0373935_0070809 | |||
| 2716 | Ga0373935_0095773 | |||
| 2717 | Ga0373935_0174430 | |||
| 2718 | Ga0373935_0261731 | |||
| 2719 | Ga0373927_0002864 | |||
| 2720 | Ga0373927_0003673 | |||
| 2721 | Ga0373927_0010232 | |||
| 2722 | Ga0373927_0010787 | |||
| 2723 | Ga0373927_0027325 | |||
| 2724 | Ga0373927_0065850 | |||
| 2725 | Ga0373927_0115311 | |||
| 2726 | Ga0373927_1007703 | |||
| 2727 | Ga0373933_0000466 | |||
| 2728 | Ga0373933_0216019 | |||
| 2729 | Ga0373933_0339166 | |||
| 2730 | Ga0373933_0354758 | |||
| 2731 | Ga0373933_0631550 | |||
| 2732 | Ga0373947_0014032 | |||
| 2733 | Ga0373947_0021300 | |||
| 2734 | Ga0373947_0066819 | |||
| 2735 | Ga0373947_0889459 | |||
| 2736 | Ga0373937_0158941 | |||
| 2737 | Ga0373937_0851548 | |||
| 2738 | Ga0373937_1025702 | |||
| 2739 | Ga0373937_1376277 | |||
| 2740 | Ga0373937_1798487 | |||
| 2741 | Ga0373925_0012681 | |||
| 2742 | Ga0373925_0021354 | |||
| 2743 | Ga0373925_0027352 | |||
| 2744 | Ga0373925_0066476 | |||
| 2745 | Ga0373925_0077878 | |||
| 2746 | Ga0373925_0232102 | |||
| 2747 | Ga0373925_0271728 | |||
| 2748 | Ga0373925_0411782 | |||
| 2749 | Ga0373925_0520156 | |||
| 2750 | Ga0395899_0502013 | |||
| 2751 | Ga0395900_0092192 | |||
| 2752 | Ga0395900_0398077 | |||
| 2753 | Ga0395900_0865802 | |||
| 2754 | Ga0395900_0955183 | |||
| 2755 | Ga0395898_0174963 | |||
| 2756 | Ga0395905_0135856 | |||
| 2757 | Ga0395905_0384353 | |||
| 2758 | Ga0395905_0622403 | |||
| 2759 | Ga0395905_1322460 | |||
| 2760 | Ga0436364_0367164 | |||
| 2761 | Ga0436364_0570855 | |||
| 2762 | Ga0436364_0710321 | |||
| 2763 | Ga0395901_0282898 | |||
| 2764 | Ga0395901_0310793 | |||
| 2765 | Ga0395901_0400732 | |||
| 2766 | Ga0436365_0063216 | |||
| 2767 | Ga0436365_0341884 | |||
| 2768 | Ga0436365_0521739 | |||
| 2769 | Ga0436365_0986223 | |||
| 2770 | Ga0436365_1184573 | |||
| 2771 | Ga0436365_1331614 | |||
| 2772 | Ga0436365_1546547 | |||
| 2773 | Ga0436365_1592603 | |||
| 2774 | Ga0436365_1707337 | |||
| 2775 | Ga0436360_0142267 | |||
| 2776 | Ga0436360_0745328 | |||
| 2777 | Ga0436360_1338677 | |||
| 2778 | Ga0436361_0236119 | |||
| 2779 | Ga0436361_0437201 | |||
| 2780 | Ga0436361_0889836 | |||
| 2781 | Ga0436361_0906525 | |||
| 2782 | Ga0436361_0993311 | |||
| 2783 | Ga0436363_0239993 | |||
| 2784 | Ga0436363_0564280 | |||
| 2785 | Ga0436363_1076737 | |||
| 2786 | Ga0436363_1285406 | |||
| 2787 | Ga0436363_1431327 | |||
| 2788 | Ga0436363_1567451 | |||
| 2789 | Ga0436363_1586010 | |||
| 2790 | Ga0436363_1718188 | |||
| 2791 | Ga0436362_0127034 | |||
| 2792 | Ga0436362_0635133 | |||
| 2793 | Ga0436362_1052023 | |||
| 2794 | Ga0439461_0126632 | |||
| 2795 | Ga0439465_0292946 | |||
| 2796 | Ga0451787_685306 | |||
| 2797 | Ga0451791_0302238 | |||
| 2798 | Ga0451793_1902718 | |||
| 2799 | Ga0451797_0178116 | |||
| 2800 | Ga0451798_0525704 | |||
| 2801 | Ga0451798_0766331 | |||
| 2802 | Ga0451806_573896 | |||
| 2803 | Ga0451804_0932924 | |||
| 2804 | Ga0451837_0039678 | |||
| 2805 | Ga0451839_0744572 | |||
| 2806 | Ga0451849_0110876 | |||
| 2807 | Ga0451853_1409169 | |||
| 2808 | Ga0439442_161171 | |||
| 2809 | Ga0439455_0066730 | |||
| 2810 | Ga0439440_0036338 | |||
| 2811 | Ga0466969_0203686 | |||
| 2812 | Ga0466969_0493348 | |||
| 2813 | Ga0466965_0209519 | |||
| 2814 | Ga0466966_0355105 | |||
| 2815 | Ga0466966_0947857 | |||
| 2816 | Ga0466961_0050554 | |||
| 2817 | Ga0466963_0066871 | |||
| 2818 | Ga0466963_0192978 | |||
| 2819 | Ga0466963_0460604 | |||
| 2820 | Ga0466964_0177002 | |||
| 2821 | Ga0466964_0184585 | |||
| 2822 | Ga0466964_0473245 | |||
| 2823 | Ga0466971_0096053 | |||
| 2824 | Ga0466968_0249357 | |||
| 2825 | Ga0466968_0302093 | |||
| 2826 | Ga0466968_0517622 | |||
| 2827 | Ga0466970_0212186 | |||
| 2828 | Ga0466957_0100830 | |||
| 2829 | Ga0466957_0100932 | |||
| 2830 | Ga0466957_0135927 | |||
| 2831 | Ga0466957_1002090 | |||
| 2832 | Ga0466959_0077576 | |||
| 2833 | Ga0466959_0122873 | |||
| 2834 | Ga0466959_0368600 | |||
| 2835 | Ga0466959_0374067 | |||
| 2836 | Ga0466959_0615049 | |||
| 2837 | Ga0466958_0497578 | |||
| 2838 | Ga0466967_0058260 | |||
| 2839 | Ga0466967_0518670 | |||
| 2840 | Ga0466967_0895125 | |||
| 2841 | Ga0466967_1121943 | |||
| 2842 | Ga0466967_1221002 | |||
| 2843 | Ga0495617_014228 | |||
| 2844 | Ga0495592_0014958 | |||
| 2845 | Ga0495592_0043583 | |||
| 2846 | Ga0495592_0065311 | |||
| 2847 | Ga0495592_0091605 | |||
| 2848 | Ga0495592_0368385 | |||
| 2849 | Ga0495603_0009404 | |||
| 2850 | Ga0495603_0014373 | |||
| 2851 | Ga0495603_0014979 | |||
| 2852 | Ga0495603_0016796 | |||
| 2853 | Ga0495603_0042944 | |||
| 2854 | Ga0495603_0113512 | |||
| 2855 | Ga0495603_0189645 | |||
| 2856 | Ga0495603_0269844 | |||
| 2857 | Ga0495590_0091217 | |||
| 2858 | Ga0495590_0242746 | |||
| 2859 | Ga0495629_0000613 | |||
| 2860 | Ga0495629_0017830 | |||
| 2861 | Ga0495629_0040867 | |||
| 2862 | Ga0495629_0111404 | |||
| 2863 | Ga0495629_0111418 | |||
| 2864 | Ga0495629_0532630 | |||
| 2865 | Ga0495629_0771007 | |||
| 2866 | Ga0495638_0042575 | |||
| 2867 | Ga0495638_0289831 | |||
| 2868 | Ga0495638_0328574 | |||
| 2869 | Ga0495641_0003482 | |||
| 2870 | Ga0495641_0169821 | |||
| 2871 | Ga0495651_0032896 | |||
| 2872 | Ga0495651_0162003 | |||
| 2873 | Ga0495651_0173806 | |||
| 2874 | Ga0495651_0339993 | |||
| 2875 | Ga0495651_0368488 | |||
| 2876 | Ga0495653_0018693 | |||
| 2877 | Ga0495653_0101477 | |||
| 2878 | Ga0495650_0192206 | |||
| 2879 | Ga0495580_0015760 | |||
| 2880 | Ga0495580_0037287 | |||
| 2881 | Ga0495580_0423702 | |||
| 2882 | Ga0495582_0000354 | |||
| 2883 | Ga0495582_0029563 | |||
| 2884 | Ga0495582_0049634 | |||
| 2885 | Ga0495582_0057451 | |||
| 2886 | Ga0495582_0216545 | |||
| 2887 | Ga0495582_0774766 | |||
| 2888 | Ga0495605_0105093 | |||
| 2889 | Ga0495605_0227067 | |||
| 2890 | Ga0495639_0000140 | |||
| 2891 | Ga0495639_0049373 | |||
| 2892 | Ga0495639_0244899 | |||
| 2893 | Ga0495639_0468958 | |||
| 2894 | Ga0495639_0604451 | |||
| 2895 | Ga0495662_0010658 | |||
| 2896 | Ga0495662_0077201 | |||
| 2897 | Ga0495662_0108703 | |||
| 2898 | Ga0495664_0045438 | |||
| 2899 | Ga0495664_0192392 | |||
| 2900 | Ga0495664_0200726 | |||
| 2901 | Ga0495664_0628833 | |||
| 2902 | Ga0495664_0955557 | |||
| 2903 | Ga0495584_0082641 | |||
| 2904 | Ga0495584_0414117 | |||
| 2905 | Ga0495585_0098194 | |||
| 2906 | Ga0495585_0137054 | |||
| 2907 | Ga0495594_0000198 | |||
| 2908 | Ga0495594_0174150 | |||
| 2909 | Ga0495596_0178342 | |||
| 2910 | Ga0495606_0002687 | |||
| 2911 | Ga0495606_0136669 | |||
| 2912 | Ga0495606_0355431 | |||
| 2913 | Ga0495608_0105818 | |||
| 2914 | Ga0495608_0151351 | |||
| 2915 | Ga0495608_0580030 | |||
| 2916 | Ga0495610_0062565 | |||
| 2917 | Ga0495610_0131844 | |||
| 2918 | Ga0495610_0213145 | |||
| 2919 | Ga0495610_0222809 | |||
| 2920 | Ga0495616_0117900 | |||
| 2921 | Ga0495616_0176797 | |||
| 2922 | Ga0495616_0203889 | |||
| 2923 | Ga0495618_0065533 | |||
| 2924 | Ga0495618_0102863 | |||
| 2925 | Ga0495618_0138628 | |||
| 2926 | Ga0495618_0183687 | |||
| 2927 | Ga0495618_0323491 | |||
| 2928 | Ga0495620_0140670 | |||
| 2929 | Ga0495628_0018107 | |||
| 2930 | Ga0495628_0022236 | |||
| 2931 | Ga0495628_0041672 | |||
| 2932 | Ga0495628_0065353 | |||
| 2933 | Ga0495630_0020468 | |||
| 2934 | Ga0495630_0052250 | |||
| 2935 | Ga0495630_0186619 | |||
| 2936 | Ga0495631_0050891 | |||
| 2937 | Ga0495631_0068928 | |||
| 2938 | Ga0495631_0518398 | |||
| 2939 | Ga0495632_0166879 | |||
| 2940 | Ga0495632_0241351 | |||
| 2941 | Ga0495643_0504646 | |||
| 2942 | Ga0495644_0421631 | |||
| 2943 | Ga0495648_0078089 | |||
| 2944 | Ga0495648_0186538 | |||
| 2945 | Ga0495663_0190439 | |||
| 2946 | Ga0495666_0018838 | |||
| 2947 | Ga0495666_0112865 | |||
| 2948 | Ga0495666_0115885 | |||
| 2949 | Ga0495652_0032645 | |||
| 2950 | Ga0495652_0049225 | |||
| 2951 | Ga0495652_0203923 | |||
| 2952 | Ga0495652_0208934 | |||
| 2953 | Ga0495652_0708619 | |||
| 2954 | Ga0495665_0021456 | |||
| 2955 | Ga0495665_0112957 | |||
| 2956 | Ga0495640_0024235 | |||
| 2957 | Ga0495640_0025557 | |||
| 2958 | Ga0495640_0025627 | |||
| 2959 | Ga0495640_0118037 | |||
| 2960 | Ga0495640_0255291 | |||
| 2961 | Ga0495640_0289683 | |||
| 2962 | Ga0495586_0037796 | |||
| 2963 | Ga0495586_0317554 | |||
| 2964 | Ga0495587_0035917 | |||
| 2965 | Ga0495587_0059128 | |||
| 2966 | Ga0495587_0200679 | |||
| 2967 | Ga0495598_0113678 | |||
| 2968 | Ga0495609_0035099 | |||
| 2969 | Ga0495597_0166257 | |||
| 2970 | Ga0495645_0163967 | |||
| 2971 | Ga0495645_0264314 | |||
| 2972 | Ga0495645_0689287 | |||
| 2973 | Ga0495645_0808773 | |||
| 2974 | Ga0495622_0016759 | |||
| 2975 | Ga0495622_0163687 | |||
| 2976 | Ga0495622_0224576 | |||
| 2977 | Ga0495667_0003356 | |||
| 2978 | Ga0495667_0019293 | |||
| 2979 | Ga0495667_0052675 | |||
| 2980 | Ga0495667_0176474 | |||
| 2981 | Ga0495667_0280803 | |||
| 2982 | Ga0495656_0005814 | |||
| 2983 | Ga0495656_0171849 | |||
| 2984 | Ga0495668_0078445 | |||
| 2985 | Ga0495668_0530980 | |||
| 2986 | Ga0495634_0004959 | |||
| 2987 | Ga0495634_0011642 | |||
| 2988 | Ga0495634_0042389 | |||
| 2989 | Ga0495634_0246183 | |||
| 2990 | Ga0495611_0200268 | |||
| 2991 | Ga0495625_0728227 | |||
| 2992 | Ga0495635_0003204 | |||
| 2993 | Ga0495635_0123500 | |||
| 2994 | Ga0495635_0124409 | |||
| 2995 | Ga0495661_0183860 | |||
| 2996 | Ga0495661_0422600 | |||
| 2997 | Ga0495588_0005521 | |||
| 2998 | Ga0495588_0240579 | |||
| 2999 | Ga0495588_0290350 | |||
| 3000 | Ga0495657_0016048 | |||
| 3001 | Ga0495657_0063091 | |||
| 3002 | Ga0495599_0004470 | |||
| 3003 | Ga0495599_0038853 | |||
| 3004 | Ga0495599_0052626 | |||
| 3005 | Ga0495599_0236615 | |||
| 3006 | Ga0495623_0101004 | |||
| 3007 | Ga0495623_0116121 | |||
| 3008 | Ga0495623_0142086 | |||
| 3009 | Ga0495646_0012855 | |||
| 3010 | Ga0495646_0018662 | |||
| 3011 | Ga0495646_0023205 | |||
| 3012 | Ga0495647_0024985 | |||
| 3013 | Ga0495647_0035229 | |||
| 3014 | Ga0495647_0106711 | |||
| 3015 | Ga0495658_0000888 | |||
| 3016 | Ga0495658_0024311 | |||
| 3017 | Ga0495658_0242565 | |||
| 3018 | Ga0495658_0259464 | |||
| 3019 | Ga0495669_0011937 | |||
| 3020 | Ga0495669_0016724 | |||
| 3021 | Ga0495669_0516119 | |||
| 3022 | Ga0495669_0591347 | |||
| 3023 | Ga0495669_0626707 | |||
| 3024 | Ga0495613_0004930 | |||
| 3025 | Ga0495613_0026647 | |||
| 3026 | Ga0495613_0049642 | |||
| 3027 | Ga0495613_0228106 | |||
| 3028 | Ga0495624_0014296 | |||
| 3029 | Ga0495624_0031976 | |||
| 3030 | Ga0495624_0514485 | |||
| 3031 | Ga0495670_0289113 | |||
| 3032 | Ga0495670_0705379 | |||
| 3033 | Ga0495670_0816391 | |||
| 3034 | Ga0495671_0069276 | |||
| 3035 | Ga0495671_0258088 | |||
| 3036 | Ga0495649_0183835 | |||
| 3037 | Ga0495589_0198788 | |||
| 3038 | Ga0495589_0258357 | |||
| 3039 | Ga0495600_0010040 | |||
| 3040 | Ga0495600_0014804 | |||
| 3041 | Ga0495600_0134365 | |||
| 3042 | Ga0495600_0383849 | |||
| 3043 | Ga0495600_0548353 | |||
| 3044 | Ga0495600_0619142 | |||
| 3045 | Ga0495600_0636127 | |||
| 3046 | Ga0495581_0000600 | |||
| 3047 | Ga0495581_0180415 | |||
| 3048 | Ga0495581_0227293 | |||
| 3049 | Ga0495581_0478735 | |||
| 3050 | Ga0495581_0494080 | |||
| 3051 | Ga0495581_0722645 | |||
| 3052 | Ga0495604_0032194 | |||
| 3053 | Ga0495604_0293465 | |||
| 3054 | Ga0495604_0449014 | |||
| 3055 | Ga0495604_0731819 | |||
| 3056 | Ga0495674_0000559 | |||
| 3057 | Ga0495674_0027226 | |||
| 3058 | Ga0495674_0036979 | |||
| 3059 | Ga0495674_0307235 | |||
| 3060 | Ga0495674_0720517 | |||
| 3061 | Ga0495674_0736584 | |||
| 3062 | Ga0495674_0935523 | |||
| 3063 | Ga0495672_0006823 | |||
| 3064 | Ga0495672_0185064 | |||
| 3065 | Ga0495672_0189842 | |||
| 3066 | Ga0495676_0063084 | |||
| 3067 | Ga0495676_0077323 | |||
| 3068 | Ga0495676_1115302 | |||
| 3069 | Ga0495680_0023759 | |||
| 3070 | Ga0495680_0216291 | |||
| 3071 | Ga0495675_0200553 | |||
| 3072 | Ga0495675_0225460 | |||
| 3073 | Ga0495685_065541 | |||
| 3074 | Ga0495673_0022015 | |||
| 3075 | Ga0495673_0169106 | |||
| 3076 | Ga0495684_0004169 | |||
| 3077 | Ga0495684_0018085 | |||
| 3078 | Ga0495684_0025746 | |||
| 3079 | Ga0495684_0136491 | |||
| 3080 | Ga0495686_0201235 | |||
| 3081 | Ga0495686_0474691 | |||
| 3082 | Ga0495593_0010511 | |||
| 3083 | Ga0495593_0015108 | |||
| 3084 | Ga0495593_0112655 | |||
| 3085 | Ga0495593_0118269 | |||
| 3086 | Ga0495602_0048612 | |||
| 3087 | Ga0495602_0119490 | |||
| 3088 | Ga0495602_0121856 | |||
| 3089 | Ga0495614_0120054 | |||
| 3090 | Ga0495614_0482762 | |||
| 3091 | Ga0496100_0046021 | |||
| 3092 | Ga0496100_0050707 | |||
| 3093 | Ga0496100_0052796 | |||
| 3094 | Ga0496100_0071267 | |||
| 3095 | Ga0496100_0316437 | |||
| 3096 | Ga0496100_0557560 | |||
| 3097 | Ga0496100_0615096 | |||
| 3098 | Ga0496100_0621164 | |||
| 3099 | Ga0496101_0031805 | |||
| 3100 | Ga0496101_0038658 | |||
| 3101 | Ga0496101_0081744 | |||
| 3102 | Ga0496101_0087255 | |||
| 3103 | Ga0496101_0115840 | |||
| 3104 | Ga0496101_0205977 | |||
| 3105 | Ga0496101_0297279 | |||
| 3106 | Ga0496101_0335861 | |||
| 3107 | Ga0496102_0040369 | |||
| 3108 | Ga0496102_0235381 | |||
| 3109 | Ga0496102_0261400 | |||
| 3110 | Ga0496102_0711138 | |||
| 3111 | Ga0496103_0045684 | |||
| 3112 | Ga0496103_0375969 | |||
| 3113 | Ga0496103_0483396 | |||
| 3114 | Ga0496103_0498542 | |||
| 3115 | Ga0496103_0663955 | |||
| 3116 | Ga0496104_0028279 | |||
| 3117 | Ga0496104_0034259 | |||
| 3118 | Ga0496104_0051847 | |||
| 3119 | Ga0496104_0515383 | |||
| 3120 | Ga0496104_0790186 | |||
| 3121 | Ga0496104_0824417 | |||
| 3122 | Ga0496105_0008852 | |||
| 3123 | Ga0496105_0025832 | |||
| 3124 | Ga0496105_0036011 | |||
| 3125 | Ga0496105_0522331 | |||
| 3126 | Ga0496106_0034402 | |||
| 3127 | Ga0496106_0035026 | |||
| 3128 | Ga0496106_0047123 | |||
| 3129 | Ga0496106_0055110 | |||
| 3130 | Ga0496106_0059950 | |||
| 3131 | Ga0496106_0288994 | |||
| 3132 | Ga0496106_0311545 | |||
| 3133 | Ga0496106_0526078 | |||
| 3134 | Ga0496106_0565297 | |||
| 3135 | Ga0496106_0626290 | |||
| 3136 | Ga0496107_0098614 | |||
| 3137 | Ga0496107_0283617 | |||
| 3138 | Ga0496108_0003043 | |||
| 3139 | Ga0496108_0197454 | |||
| 3140 | Ga0496108_0198549 | |||
| 3141 | Ga0496108_0332468 | |||
| 3142 | Ga0496108_0533638 | |||
| 3143 | Ga0496108_0778245 | |||
| 3144 | Ga0496108_0831821 | |||
| 3145 | Ga0496109_0009711 | |||
| 3146 | Ga0496109_0149407 | |||
| 3147 | Ga0496109_0191019 | |||
| 3148 | Ga0496109_0198648 | |||
| 3149 | Ga0496109_0581071 | |||
| 3150 | Ga0496109_1662183 | |||
| 3151 | Ga0496109_1919558 | |||
| 3152 | Ga0496110_0004491 | |||
| 3153 | Ga0496110_0005229 | |||
| 3154 | Ga0496110_0088768 | |||
| 3155 | Ga0496110_0339977 | |||
| 3156 | Ga0496110_0367549 | |||
| 3157 | Ga0496110_0411415 | |||
| 3158 | Ga0496110_1314802 | |||
| 3159 | Ga0496110_1709304 | |||
| 3160 | Ga0496111_0009814 | |||
| 3161 | Ga0496111_0031327 | |||
| 3162 | Ga0496111_0172410 | |||
| 3163 | Ga0496111_0267541 | |||
| 3164 | Ga0496111_0551614 | |||
| 3165 | Ga0496111_0632185 | |||
| 3166 | Ga0496112_0000046 | |||
| 3167 | Ga0496112_0012428 | |||
| 3168 | Ga0496112_0023031 | |||
| 3169 | Ga0496112_0071634 | |||
| 3170 | Ga0496112_0099111 | |||
| 3171 | Ga0496112_0112577 | |||
| 3172 | Ga0496112_0163689 | |||
| 3173 | Ga0496112_0312861 | |||
| 3174 | Ga0496112_0387308 | |||
| 3175 | Ga0496112_0556686 | |||
| 3176 | Ga0496112_1241505 | |||
| 3177 | Ga0496113_0044643 | |||
| 3178 | Ga0496113_0048018 | |||
| 3179 | Ga0496113_0131622 | |||
| 3180 | Ga0496113_0147516 | |||
| 3181 | Ga0496113_0267909 | |||
| 3182 | Ga0496113_1370963 | |||
| 3183 | Ga0496114_0099620 | |||
| 3184 | Ga0496114_0196415 | |||
| 3185 | Ga0496114_0205692 | |||
| 3186 | Ga0496114_0368535 | |||
| 3187 | Ga0496114_0586261 | |||
| 3188 | Ga0496114_0596970 | |||
| 3189 | Ga0496114_0965475 | |||
| 3190 | Ga0496114_1470854 | |||
| 3191 | Ga0496115_0002909 | |||
| 3192 | Ga0496115_0066846 | |||
| 3193 | Ga0496115_0066985 | |||
| 3194 | Ga0496115_0069623 | |||
| 3195 | Ga0496115_0098350 | |||
| 3196 | Ga0496115_0212681 | |||
| 3197 | Ga0496115_0540473 | |||
| 3198 | Ga0496115_0665980 | |||
| 3199 | Ga0496117_0070896 | |||
| 3200 | Ga0496117_0138996 | |||
| 3201 | Ga0496117_0373243 | |||
| 3202 | Ga0496118_0006802 | |||
| 3203 | Ga0496118_0011822 | |||
| 3204 | Ga0496118_0066857 | |||
| 3205 | Ga0496118_0128508 | |||
| 3206 | Ga0496118_0251502 | |||
| 3207 | Ga0496119_0034242 | |||
| 3208 | Ga0496119_0111350 | |||
| 3209 | Ga0496120_0155353 | |||
| 3210 | Ga0496121_0001986 | |||
| 3211 | Ga0496121_0018240 | |||
| 3212 | Ga0496121_0018643 | |||
| 3213 | Ga0496121_0036041 | |||
| 3214 | Ga0496121_0166631 | |||
| 3215 | Ga0496121_0201014 | |||
| 3216 | Ga0496121_0462043 | |||
| 3217 | Ga0496121_0521909 | |||
| 3218 | Ga0496121_0554476 | |||
| 3219 | Ga0496122_0226298 | |||
| 3220 | Ga0496122_0306329 | |||
| 3221 | Ga0496123_0254621 | |||
| 3222 | Ga0496124_0006608 | |||
| 3223 | Ga0496124_0080396 | |||
| 3224 | Ga0496124_0123368 | |||
| 3225 | Ga0496124_0144217 | |||
| 3226 | Ga0496124_0303222 | |||
| 3227 | Ga0496124_0358801 | |||
| 3228 | Ga0496124_0667052 | |||
| 3229 | Ga0496125_0000063 | |||
| 3230 | Ga0496125_0006261 | |||
| 3231 | Ga0496125_0019586 | |||
| 3232 | Ga0496125_0061100 | |||
| 3233 | Ga0496125_0077973 | |||
| 3234 | Ga0496125_0252591 | |||
| 3235 | Ga0496125_0412207 | |||
| 3236 | Ga0496126_0010555 | |||
| 3237 | Ga0496126_0066644 | |||
| 3238 | Ga0496126_0106374 | |||
| 3239 | Ga0496126_0109200 | |||
| 3240 | Ga0496126_0135669 | |||
| 3241 | Ga0496126_0180108 | |||
| 3242 | Ga0496126_0212877 | |||
| 3243 | Ga0496126_0232991 | |||
| 3244 | Ga0496126_0342455 | |||
| 3245 | Ga0496126_0397278 | |||
| 3246 | Ga0496126_0502674 | |||
| 3247 | Ga0496126_0612854 | |||
| 3248 | Ga0496126_0682209 | |||
| 3249 | Ga0496126_0872275 | |||
| 3250 | Ga0496126_0884853 | |||
| 3251 | Ga0496126_1008170 | |||
| 3252 | Ga0495682_0160041 | |||
| 3253 | Ga0495682_0204573 | |||
| 3254 | Ga0495682_0340248 | |||
| 3255 | Ga0501031_0006400 | |||
| 3256 | Ga0501031_0012001 | |||
| 3257 | Ga0501031_0028674 | |||
| 3258 | Ga0501031_0116400 | |||
| 3259 | Ga0501032_0001803 | |||
| 3260 | Ga0501032_0004911 | |||
| 3261 | Ga0501032_0239594 | |||
| 3262 | Ga0501033_0000523 | |||
| 3263 | Ga0501033_0001240 | |||
| 3264 | Ga0501033_0004826 | |||
| 3265 | Ga0501033_0024599 | |||
| 3266 | Ga0501033_0289234 | |||
| 3267 | Ga0501033_0880398 | |||
| 3268 | Ga0501034_0000717 | |||
| 3269 | Ga0501034_0051314 | |||
| 3270 | Ga0501034_0082701 | |||
| 3271 | Ga0501034_0088722 | |||
| 3272 | Ga0501034_0231883 | |||
| 3273 | Ga0501034_0809119 | |||
| 3274 | Ga0501036_0000027 | |||
| 3275 | Ga0501036_0022965 | |||
| 3276 | Ga0501036_0253831 | |||
| 3277 | Ga0501036_0418554 | |||
| 3278 | Ga0501036_0487067 | |||
| 3279 | Ga0501036_1523264 | |||
| 3280 | Ga0501037_0000104 | |||
| 3281 | Ga0501037_0001986 | |||
| 3282 | Ga0501037_0026399 | |||
| 3283 | Ga0501037_0029042 | |||
| 3284 | Ga0501037_0067887 | |||
| 3285 | Ga0501038_0000477 | |||
| 3286 | Ga0501038_0011478 | |||
| 3287 | Ga0501038_0019478 | |||
| 3288 | Ga0501038_0100633 | |||
| 3289 | Ga0501038_0361996 | |||
| 3290 | Ga0501039_0001050 | |||
| 3291 | Ga0501039_0036741 | |||
| 3292 | Ga0501039_0325226 | |||
| 3293 | Ga0501039_0334264 | |||
| 3294 | Ga0501039_0833716 | |||
| 3295 | Ga0501040_0006915 | |||
| 3296 | Ga0501040_0123072 | |||
| 3297 | Ga0501042_0026182 | |||
| 3298 | Ga0501042_0042559 | |||
| 3299 | Ga0501042_0249237 | |||
| 3300 | Ga0501043_0000076 | |||
| 3301 | Ga0501043_0005019 | |||
| 3302 | Ga0501043_0012465 | |||
| 3303 | Ga0501043_0085138 | |||
| 3304 | Ga0501043_0186687 | |||
| 3305 | Ga0501043_0192722 | |||
| 3306 | Ga0501046_0001785 | |||
| 3307 | Ga0501046_0008324 | |||
| 3308 | Ga0501046_0213911 | |||
| 3309 | Ga0501047_0000123 | |||
| 3310 | Ga0501047_0027982 | |||
| 3311 | Ga0501047_0063198 | |||
| 3312 | Ga0501047_0105537 | |||
| 3313 | Ga0501047_0527750 | |||
| 3314 | Ga0501047_1134197 | |||
| 3315 | Ga0501048_0001197 | |||
| 3316 | Ga0501048_0009900 | |||
| 3317 | Ga0501067_0003629 | |||
| 3318 | Ga0501067_0012611 | |||
| 3319 | Ga0501068_0005455 | |||
| 3320 | Ga0501068_0198448 | |||
| 3321 | Ga0501069_0029662 | |||
| 3322 | Ga0501070_0003948 | |||
| 3323 | Ga0501070_0019003 | |||
| 3324 | Ga0501070_0029926 | |||
| 3325 | Ga0501070_0411142 | |||
| 3326 | Ga0501070_0713467 | |||
| 3327 | Ga0501071_0016328 | |||
| 3328 | Ga0501071_0036287 | |||
| 3329 | Ga0501071_0300531 | |||
| 3330 | Ga0501072_0009992 | |||
| 3331 | Ga0501072_0011011 | |||
| 3332 | Ga0501072_0051068 | |||
| 3333 | Ga0501073_0000014 | |||
| 3334 | Ga0501073_0048823 | |||
| 3335 | Ga0501073_0050698 | |||
| 3336 | Ga0501073_0172707 | |||
| 3337 | Ga0501074_0000615 | |||
| 3338 | Ga0501074_0019020 | |||
| 3339 | Ga0501075_0117688 | |||
| 3340 | Ga0501075_1396422 | |||
| 3341 | Ga0501076_0470144 | |||
| 3342 | Ga0501079_0000830 | |||
| 3343 | Ga0501079_0009379 | |||
| 3344 | Ga0501079_1049956 | |||
| 3345 | Ga0501079_1348852 | |||
| 3346 | Ga0501080_0000547 | |||
| 3347 | Ga0501080_0080707 | |||
| 3348 | Ga0501080_0291576 | |||
| 3349 | Ga0501081_0306248 | |||
| 3350 | Ga0501081_1221894 | |||
| 3351 | Ga0501083_0000174 | |||
| 3352 | Ga0501083_0043137 | |||
| 3353 | Ga0501035_0001320 | |||
| 3354 | Ga0501035_0001597 | |||
| 3355 | Ga0501035_0024312 | |||
| 3356 | Ga0501035_0034283 | |||
| 3357 | Ga0501035_0061445 | |||
| 3358 | Ga0501035_0110858 | |||
| 3359 | Ga0501035_0255463 | |||
| 3360 | Ga0501035_0336441 | |||
| 3361 | Ga0501044_0012380 | |||
| 3362 | Ga0501044_0013936 | |||
| 3363 | Ga0501044_0034011 | |||
| 3364 | Ga0501044_0055534 | |||
| 3365 | Ga0501044_0070448 | |||
| 3366 | Ga0501044_0086977 | |||
| 3367 | Ga0501044_0201252 | |||
| 3368 | Ga0501044_0408151 | |||
| 3369 | Ga0501045_0013305 | |||
| 3370 | Ga0501045_0174546 | |||
| 3371 | Ga0501045_0426907 | |||
| 3372 | nmdc:mga03683_161160_c1 | |||
| 3373 | nmdc:mga03683_31811_c1 | |||
| 3374 | nmdc:mga03n38_298928_c1 | |||
| 3375 | nmdc:mga03n38_450763_c1 | |||
| 3376 | nmdc:mga00v17_392786_c1 | |||
| 3377 | nmdc:mga00v17_47772_c1 | |||
| 3378 | nmdc:mga0yw44_189421_c1 | |||
| 3379 | nmdc:mga0yw44_37742_c1 | |||
| 3380 | nmdc:mga0yw44_481599_c1 | |||
| 3381 | nmdc:mga0yw44_610969_c1 | |||
| 3382 | nmdc:mga0k408_174724_c1 | |||
| 3383 | nmdc:mga0k408_341720_c1 | |||
| 3384 | nmdc:mga06z11_158583_c1 | |||
| 3385 | nmdc:mga06z11_478689_c1 | |||
| 3386 | nmdc:mga06z11_552963_c1 | |||
| 3387 | nmdc:mga06z11_692515_c1 | |||
| 3388 | nmdc:mga04h51_313894_c1 | |||
| 3389 | nmdc:mga07m45_128548_c1 | |||
| 3390 | nmdc:mga07m45_222870_c1 | |||
| 3391 | nmdc:mga05p37_671762_c1 | |||
| 3392 | nmdc:mga05p37_75721_c1 | |||
| 3393 | nmdc:mga08y16_1139274_c1 | |||
| 3394 | nmdc:mga08y16_549393_c1 | |||
| 3395 | nmdc:mga0n895_211449_c1 | |||
| 3396 | nmdc:mga0rr50_1057741_c1 | |||
| 3397 | nmdc:mga0rr50_505013_c1 | |||
| 3398 | nmdc:mga08x19_113391_c1 | |||
| 3399 | nmdc:mga08x19_1230309_c1 | |||
| 3400 | nmdc:mga08x19_837281_c1 | |||
| 3401 | nmdc:mga0a205_723618_c1 | |||
| 3402 | nmdc:mga0sz30_46403_c1 | |||
| 3403 | Ga0495601_0032181 | |||
| 3404 | Ga0495601_0126922 | |||
| 3405 | Ga0495601_0133917 | |||
| 3406 | Ga0495601_0198588 | |||
| 3407 | Ga0495601_0284115 | |||
| 3408 | Ga0495612_0043479 | |||
| 3409 | Ga0495612_0050233 | |||
| 3410 | Ga0495612_0222109 | |||
| 3411 | Ga0495612_0233479 | |||
| 3412 | Ga0495612_0255290 | |||
| 3413 | Ga0500635_0058336 | |||
| 3414 | Ga0500635_0059408 | |||
| 3415 | Ga0495655_0211203 | |||
| 3416 | Ga0495595_0009446 | |||
| 3417 | Ga0495595_0148261 | |||
| 3418 | Ga0495595_0404740 | |||
| 3419 | Ga0495619_0014450 | |||
| 3420 | Ga0495619_0080719 | |||
| 3421 | Ga0495619_0393790 | |||
| 3422 | Ga0495619_0673392 | |||
| 3423 | Ga0500643_089644 | |||
| 3424 | Ga0500644_0136437 | |||
| 3425 | Ga0500647_0178692 | |||
| 3426 | Ga0500647_0266953 | |||
| 3427 | Ga0500651_0070589 | |||
| 3428 | Ga0500566_0000254 | |||
| 3429 | Ga0500566_0003600 | |||
| 3430 | Ga0500566_0211549 | |||
| 3431 | Ga0500566_0303082 | |||
| 3432 | Ga0500640_051642 | |||
| 3433 | Ga0500641_0021282 | |||
| 3434 | Ga0500641_0165216 | |||
| 3435 | Ga0500641_0369353 | |||
| 3436 | Ga0500554_004284 | |||
| 3437 | Ga0500554_006809 | |||
| 3438 | Ga0500555_171278 | |||
| 3439 | Ga0500556_0042140 | |||
| 3440 | Ga0500562_120112 | |||
| 3441 | Ga0500569_158403 | |||
| 3442 | Ga0500572_000178 | |||
| 3443 | Ga0500572_005818 | |||
| 3444 | Ga0500591_073827 | |||
| 3445 | Ga0500594_0258797 | |||
| 3446 | Ga0500595_002259 | |||
| 3447 | Ga0500595_003316 | |||
| 3448 | Ga0500595_008308 | |||
| 3449 | Ga0500595_023364 | |||
| 3450 | Ga0500595_025393 | |||
| 3451 | Ga0500607_258411 | |||
| 3452 | Ga0500608_045172 | |||
| 3453 | Ga0500614_015435 | |||
| 3454 | Ga0500614_111579 | |||
| 3455 | Ga0500617_219617 | |||
| 3456 | Ga0500621_214738 | |||
| 3457 | Ga0500642_0067899 | |||
| 3458 | Ga0500658_0529480 | |||
| 3459 | Ga0500658_0573983 | |||
| 3460 | Ga0500559_0002150 | |||
| 3461 | Ga0500559_0002386 | |||
| 3462 | Ga0500559_0103041 | |||
| 3463 | Ga0500561_0285191 | |||
| 3464 | Ga0500568_0010703 | |||
| 3465 | Ga0500568_0020007 | |||
| 3466 | Ga0500568_0150436 | |||
| 3467 | Ga0500573_0083630 | |||
| 3468 | Ga0500577_0365448 | |||
| 3469 | Ga0500588_0234075 | |||
| 3470 | Ga0500588_0386986 | |||
| 3471 | Ga0500590_059871 | |||
| 3472 | Ga0500590_182781 | |||
| 3473 | Ga0500590_200691 | |||
| 3474 | Ga0500603_000282 | |||
| 3475 | Ga0500603_001384 | |||
| 3476 | Ga0500603_011894 | |||
| 3477 | Ga0500603_182662 | |||
| 3478 | Ga0500604_0236855 | |||
| 3479 | Ga0500616_0000084 | |||
| 3480 | Ga0500616_0076717 | |||
| 3481 | Ga0500622_0006086 | |||
| 3482 | Ga0500627_0137977 | |||
| 3483 | Ga0500630_001999 | |||
| 3484 | Ga0500638_019089 | |||
| 3485 | Ga0500638_051677 | |||
| 3486 | Ga0500638_186828 | |||
| 3487 | Ga0500638_193729 | |||
| 3488 | Ga0500639_000025 | |||
| 3489 | Ga0500639_169843 | |||
| 3490 | Ga0500639_197028 | |||
| 3491 | Ga0500636_0017152 | |||
| 3492 | Ga0500636_0033663 | |||
| 3493 | Ga0500636_0078103 | |||
| 3494 | Ga0500636_0096663 | |||
| 3495 | Ga0500636_0539956 | |||
| 3496 | Ga0500637_0000520 | |||
| 3497 | Ga0500637_0005157 | |||
| 3498 | Ga0500637_0060228 | |||
| 3499 | Ga0500637_0110048 | |||
| 3500 | Ga0500576_010807 | |||
| 3501 | Ga0500611_135833 | |||
| 3502 | Ga0500656_015674 | |||
| 3503 | Ga0500552_004980 | |||
| 3504 | Ga0500596_001469 | |||
| 3505 | Ga0500596_002457 | |||
| 3506 | Ga0500596_003890 | |||
| 3507 | Ga0500601_044126 | |||
| 3508 | Ga0501084_0003729 | |||
| 3509 | Ga0501084_0034764 | |||
| 3510 | Ga0501084_0524440 | |||
| 3511 | Ga0500661_004207 | |||
| 3512 | Ga0500661_095768 | |||
| 3513 | Ga0587073_0218694 | |||
| 3514 | Ga0587090_024678 | |||
| 3515 | Ga0587091_202700 | |||
| 3516 | Ga0587129_014690 | |||
| 3517 | Ga0587128_033317 | |||
| 3518 | Ga0587078_054878 | |||
| 3519 | Ga0501082_0002368 | |||
| 3520 | Ga0501082_0043704 | |||
| 3521 | Ga0501082_0575236 | |||
| 3522 | Ga0466962_0135371 | |||
| 3523 | 2513661279 | |||
| 3524 | 2513673107 | |||
| 3525 | 2513697034 | |||
| 3526 | 2513723768 | |||
| 3527 | 2513858172 | |||
| 3528 | 2513891991 | |||
| 3529 | 2513923000 | |||
| 3530 | 2517893937 | |||
| 3531 | 2524540707 | |||
| 3532 | 2671122927 | |||
| 3533 | 2723846475 | |||
| 3534 | 2728748055 | |||
| 3535 | 2793072820 | |||
| 3536 | 2793076856 | |||
| 3537 | 2856325746 | |||
| 3538 | 2869279364 | |||
| 3539 | 2874145111 | |||
| 3540 | 2874610557 | |||
| 3541 | 2876810242 | |||
| 3542 | 2878743310 | |||
| 3543 | 2879111751 | |||
| 3544 | 2885379964 | |||
| 3545 | 2885389021 | |||
| 3546 | 2888340039 | |||
| 3547 | 2888388333 | |||
| 3548 | 2889039006 | |||
| 3549 | 2903451935 | |||
| 3550 | 2903749544 | |||
| 3551 | 2903774649 | |||
| 3552 | 2904693415 | |||
| 3553 | 2906610830 | |||
| 3554 | 2906636018 | |||
| 3555 | 2906663914 | |||
| 3556 | 2908744340 | |||
| 3557 | 2908761932 | |||
| 3558 | 2922428499 | |||
| 3559 | 2924723301 | |||
| 3560 | 2924739515 | |||
| 3561 | 2924781121 | |||
| 3562 | 2935634483 | |||
| 3563 | 2937877545 | |||
| 3564 | 2937975372 | |||
| 3565 | 2941508969 | |||
| 3566 | 2941516798 | |||
| 3567 | 2941525107 | |||
| 3568 | 2958035504 | |||
| 3569 | 2958043691 | |||
| 3570 | 2958084652 | |||
| 3571 | 2958152120 | |||
| 3572 | 2968017948 | |||
| 3573 | 2968087635 | |||
| 3574 | 2970471877 | |||
| 3575 | 2970593960 | |||
| 3576 | 2996350805 | |||
| 3577 | 3004169468 | |||
| 3578 | 3004277503 | |||
| 3579 | 3004295265 | |||
| 3580 | 3005478624 | |||
| 3581 | 8006942737 | |||
| 3582 | 8006964874 | |||
| 3583 | 8006982460 | |||
| 3584 | 8006995599 | |||
| 3585 | 8019558502 | |||
| 3586 | 8019566796 | |||
| 3587 | 8056685029 | |||
| 3588 | 8056691815 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zko-assembly1.cif.gz_A | crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution | 0.9937 | 2 | 119 |
| 3wdn-assembly1.cif.gz_A | high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method | 0.9793 | 1 | 120 |
| 1htp-assembly1.cif.gz_A | refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex | 0.9726 | 2 | 118 |
| 1onl-assembly3.cif.gz_C | crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system | 0.9709 | 2 | 120 |
| 3a7a-assembly2.cif.gz_D | crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein | 0.966 | 2 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q20634_6_139_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9881 | 3 | 119 | 2.40.50.100 |
| 3wdnA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9792 | 1 | 120 | 2.40.50.100 |
| af_Q54JU3_2_142_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9745 | 2 | 121 | 2.40.50.100 |
| af_Q54JV8_6_144_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9742 | 2 | 121 | 2.40.50.100 |
| af_Q9U616_24_160_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9728 | 2 | 121 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0N0KIH5-F1-model_v4 | Glycine cleavage system H protein | 0.9995 | 1 | 121 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A0S3PS46-F1-model_v4 | Glycine cleavage system H protein | 0.9946 | 1 | 120 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0NV99-F1-model_v4 | Glycine cleavage system H protein | 0.9943 | 1 | 120 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A6M1YG53-F1-model_v4 | Glycine cleavage system H protein | 0.994 | 3 | 120 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A7M5XMK7-F1-model_v4 | Glycine cleavage system H protein | 0.994 | 2 | 120 |
GO:0005739
GO:0005960 GO:0019464 |