F495663

General Info

Members Datasets Scaffolds Average Seq Length
1776 626 1676 228

Family's Representative Sequence

Representative Sequence 3300003659|JGI25404J52841_10030344|JGI25404J52841_100303441
Length 281
Sequence MLRVPVMTRLFRYAPDFALRVINRLLCRTGSVLLIPRPDSGGHFKTSIDMAKDTTGRLHVTVKTGGKRKLSSKLWLERQLNDPYVAKAKRDGYRSRAAYKLIEMDDKYRFLKPGIAVVDLGAAPGGWSQIAAKRVGAVNGKGKVAAIDLLEMPEIPGVDFAQLDFLAEDAPEKLIAMMGGRADVVMSDMAANTTGHRKTDQLRIIGLVESAAAFAADVLNPGGTFLAKVFQSGADAELVAQLKRDFASVRHVKPASSRQDSSERYVLAMGFRGQPDRPIEP

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
6 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
7 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
8 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
9 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
10 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
11 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
12 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
13 2643221651 Afipia sp. Root123D2 Isolate Unclassified
14 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
15 2791355199
16 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
17 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
18 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
19 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
20 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
21 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
22 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
23 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
24 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
25 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
26 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
27 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
28 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
29 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
30 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
31 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
32 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
33 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
34 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
35 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
36 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
37 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
38 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
39 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
40 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
41 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
42 2904699407
43 2906610324
44 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
45 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
46 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
47 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
48 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
49 2922368715
50 2922425934
51 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
52 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
53 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
54 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
55 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
56 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
57 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
58 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
59 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
60 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
61 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
62 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
63 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
64 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
65 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
66 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
67 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
68 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
69 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
70 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
71 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
72 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
73 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
74 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
75 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
76 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
77 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
78 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
79 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
80 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
81 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
82 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
83 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
84 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
85 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
86 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
87 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
88 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
89 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
90 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
91 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
92 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
94 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
95 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
97 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
98 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
99 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
100 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
101 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
102 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
103 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
104 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
105 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
106 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
107 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
108 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
109 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
110 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
111 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
112 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
113 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
114 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
115 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
116 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
117 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
118 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
119 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
120 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
121 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
122 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
123 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
124 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
125 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
126 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
127 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
128 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
129 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
130 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
131 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
132 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
133 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
134 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
135 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
136 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
137 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
138 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
139 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
140 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
141 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
142 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
143 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
144 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
145 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
146 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
147 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
148 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
149 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
150 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
151 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
152 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
153 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
154 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
155 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
156 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
157 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
158 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
159 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
160 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
161 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
162 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
163 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
164 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
165 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
166 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
167 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
168 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
169 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
170 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
171 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
172 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
173 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
174 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
175 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
176 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
177 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
178 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
179 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
180 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
181 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
182 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
183 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
184 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
185 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
186 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
187 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
188 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
189 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
190 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
191 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
192 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
193 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
194 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
195 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
196 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
197 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
198 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
199 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
200 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
201 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
202 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
203 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
204 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
205 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
206 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
207 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
208 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
209 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
210 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
211 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
212 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
213 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
214 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
215 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
216 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
217 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
218 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
219 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
220 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
221 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
222 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
223 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
224 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
225 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
226 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
227 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
228 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
229 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
230 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
231 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
232 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
236 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
238 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
239 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
240 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
241 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
307 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
308 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
309 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
310 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
311 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
312 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
316 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
317 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
318 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
319 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
320 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
321 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
322 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
323 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
324 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
325 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
326 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
327 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
328 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
329 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
330 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
331 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
332 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
333 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
334 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
335 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
336 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
337 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
338 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
339 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
340 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
341 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
342 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
343 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
344 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
345 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
346 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
347 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
348 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
349 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
350 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
351 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
352 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
353 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
354 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
355 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
356 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
357 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
358 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
359 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
360 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
361 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
362 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
363 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
364 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
365 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
366 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
367 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
368 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
369 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
370 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
371 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
372 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
373 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
374 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
375 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
376 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
377 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
378 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
379 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
380 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
381 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
382 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
383 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
384 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
385 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
386 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
387 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
388 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
389 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
390 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
391 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
392 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
393 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
394 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
395 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
396 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
397 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
398 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
399 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
400 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
401 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
402 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
403 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
404 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
405 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
406 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
407 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
408 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
409 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
410 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
411 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
412 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
413 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
414 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
415 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
416 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
417 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
418 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
419 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
420 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
421 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
422 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
423 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
424 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
425 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
426 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
427 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
428 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
429 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
430 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
431 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
432 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
433 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
434 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
435 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
436 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
437 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
438 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
439 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
440 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
441 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
442 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
443 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
444 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
445 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
446 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
447 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
448 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
449 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
450 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
451 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
452 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
453 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
454 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
455 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
456 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
457 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
458 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
459 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
460 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
461 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
462 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
463 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
464 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
465 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
466 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
467 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
468 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
469 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
470 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
471 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
472 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
473 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
474 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
475 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
476 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
477 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
478 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
479 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
480 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
481 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
482 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
483 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
484 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
485 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
486 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
487 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
488 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
489 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
490 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
491 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
492 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
493 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
494 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
495 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
496 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
497 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
498 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
499 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
500 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
501 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
502 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
503 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
504 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
505 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
506 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
507 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
508 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
509 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
510 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
511 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
512 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
513 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
514 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
515 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
516 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
517 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
518 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
519 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
520 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
521 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
522 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
523 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
524 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
525 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
526 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
527 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
528 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
529 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
530 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
531 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
532 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
533 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
534 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
535 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
536 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
537 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
538 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
539 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
540 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
541 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
542 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
543 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
544 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
545 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
546 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
547 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
548 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
549 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
550 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
551 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
552 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
553 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
554 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
555 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
556 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
557 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
558 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
559 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
560 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
561 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
562 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
563 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
564 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
565 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
566 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
567 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
568 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
569 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
570 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
571 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
572 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
573 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
574 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
575 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
576 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
577 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
578 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
579 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
580 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
581 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
582 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
583 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
584 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
585 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
586 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
587 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
588 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
589 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
590 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
591 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
592 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
593 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
594 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
595 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
596 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
597 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
598 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
599 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
600 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
601 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
602 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
603 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
604 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
605 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
606 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
607 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
608 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
609 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
610 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
611 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
612 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
613 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
614 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
615 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
616 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
617 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
618 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
619 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
620 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
621 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
622 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
623 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
624 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
625 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
626 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.58
Metatranscriptomes 0.06
Isolates 5.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.09
Nodule 5.18
Rhizoplane 6.19
Rhizosphere 70.44
Stem 0
Stem Tuber 0
Unclassified 7.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C9014 2010549000 Bacteria 1771
2 MBSR1b_contig_11443562 2162886012 Bacteria 983
3 MBSR1b_contig_12173630 2162886012 Bacteria 998
4 CNAas_1004010 3300000532 Bacteria 955
5 JGI24740J21852_10015785 3300001979 Bacteria 2746
6 JGI24739J22299_10029215 3300001989 Bacteria 1918
7 JGI24737J22298_10006476 3300001990 Bacteria 3998
8 JGI24735J21928_10007461 3300002067 Bacteria 3566
9 JGI24744J21845_10042665 3300002077 Bacteria 846
10 JGI25406J46586_10000047 3300003203 Bacteria 54770
11 JGI25153J46596_10001251 3300003215 Bacteria 15286
12 JGI25153J46596_10002613 3300003215 Bacteria 10304
13 JGI25153J46596_10002759 3300003215 Bacteria 9992
14 JGI25153J46596_10005940 3300003215 Bacteria 6291
15 JGI25160J50197_1002757 3300003354 Bacteria 8051
16 JGI25160J50197_1032891 3300003354 Bacteria 1312
17 JGI25404J52841_10010459 3300003659 Bacteria 1995
18 JGI25404J52841_10019235 3300003659 Bacteria 1479
19 JGI25404J52841_10030344 3300003659 Bacteria 1158
20 Ga0055531_10022839 3300003794 Bacteria 2368
21 Ga0065165_1000231 3300005262 Bacteria 97237
22 Ga0065165_1001895 3300005262 Bacteria 20125
23 Ga0065712_10231883 3300005290 Bacteria 991
24 Ga0065715_10160419 3300005293 Bacteria 1635
25 Ga0070658_10165438 3300005327 Bacteria 1857
26 Ga0070658_10194684 3300005327 Bacteria 1709
27 Ga0070658_10207247 3300005327 Bacteria 1655
28 Ga0070658_10344647 3300005327 Bacteria 1275
29 Ga0070658_10370198 3300005327 Bacteria 1228
30 Ga0070658_10637307 3300005327 Bacteria 924
31 Ga0070676_10114075 3300005328 Bacteria 1687
32 Ga0070676_10124974 3300005328 Bacteria 1620
33 Ga0070676_10169066 3300005328 Bacteria 1412
34 Ga0070676_10216748 3300005328 Bacteria 1262
35 Ga0070676_10245939 3300005328 Bacteria 1192
36 Ga0070683_100015898 3300005329 Bacteria 6621
37 Ga0070683_100087298 3300005329 Bacteria 2925
38 Ga0070683_100090477 3300005329 Bacteria 2873
39 Ga0070670_100002084 3300005331 Bacteria 16387
40 Ga0070670_100018067 3300005331 Bacteria 6052
41 Ga0070670_100113796 3300005331 Bacteria 2333
42 Ga0070670_100127870 3300005331 Bacteria 2193
43 Ga0070670_100153040 3300005331 Bacteria 1996
44 Ga0070670_100171499 3300005331 Bacteria 1882
45 Ga0070677_10060360 3300005333 Bacteria 1562
46 Ga0070677_10086571 3300005333 Bacteria 1354
47 Ga0068869_100022270 3300005334 Bacteria 4364
48 Ga0068869_100030572 3300005334 Bacteria 3782
49 Ga0068869_100055456 3300005334 Bacteria 2888
50 Ga0068869_100119055 3300005334 Bacteria 2017
51 Ga0070666_10001973 3300005335 Bacteria 12500
52 Ga0070680_100055713 3300005336 Bacteria 3231
53 Ga0070680_100125785 3300005336 Bacteria 2142
54 Ga0070680_100169644 3300005336 Bacteria 1836
55 Ga0070680_100477499 3300005336 Bacteria 1065
56 Ga0070682_100617722 3300005337 Bacteria 858
57 Ga0068868_100025524 3300005338 Bacteria 4496
58 Ga0068868_100109714 3300005338 Bacteria 2241
59 Ga0068868_100197211 3300005338 Bacteria 1677
60 Ga0068868_100254272 3300005338 Bacteria 1479
61 Ga0068868_100590422 3300005338 Bacteria 983
62 Ga0070689_100055865 3300005340 Bacteria 3060
63 Ga0070689_100311686 3300005340 Bacteria 1312
64 Ga0070687_100262463 3300005343 Bacteria 1079
65 Ga0070661_100017395 3300005344 Bacteria 5100
66 Ga0070661_100357733 3300005344 Bacteria 1147
67 Ga0070661_100521967 3300005344 Bacteria 953
68 Ga0070668_100002309 3300005347 Bacteria 14048
69 Ga0070668_100048482 3300005347 Bacteria 3267
70 Ga0070668_100051684 3300005347 Bacteria 3167
71 Ga0070668_100054079 3300005347 Bacteria 3096
72 Ga0070668_100066405 3300005347 Bacteria 2799
73 Ga0070668_100086847 3300005347 Bacteria 2460
74 Ga0070668_100138652 3300005347 Bacteria 1958
75 Ga0070668_100154631 3300005347 Bacteria 1857
76 Ga0070668_100194541 3300005347 Bacteria 1662
77 Ga0070669_100012022 3300005353 Bacteria 6141
78 Ga0070669_100086727 3300005353 Bacteria 2339
79 Ga0070669_100305981 3300005353 Bacteria 1280
80 Ga0070669_100309468 3300005353 Bacteria 1273
81 Ga0070669_100727184 3300005353 Bacteria 840
82 Ga0070675_100012309 3300005354 Bacteria 6704
83 Ga0070675_100171402 3300005354 Bacteria 1872
84 Ga0070675_100394506 3300005354 Bacteria 1234
85 Ga0070675_100616539 3300005354 Bacteria 985
86 Ga0070671_100081489 3300005355 Bacteria 2706
87 Ga0070671_100256534 3300005355 Bacteria 1486
88 Ga0070674_100058334 3300005356 Bacteria 2683
89 Ga0070674_100066308 3300005356 Bacteria 2536
90 Ga0070674_100093562 3300005356 Bacteria 2175
91 Ga0070673_100033023 3300005364 Bacteria 3903
92 Ga0070688_100042310 3300005365 Bacteria 2801
93 Ga0070688_100089017 3300005365 Bacteria 2014
94 Ga0070688_100345454 3300005365 Bacteria 1088
95 Ga0070688_100347563 3300005365 Bacteria 1085
96 Ga0070659_100053564 3300005366 Bacteria 3176
97 Ga0070659_100086855 3300005366 Bacteria 2504
98 Ga0070659_100173060 3300005366 Bacteria 1769
99 Ga0070659_100248514 3300005366 Bacteria 1474
100 Ga0070667_100000717 3300005367 Bacteria 31904
101 Ga0070667_100002487 3300005367 Bacteria 16080
102 Ga0070667_100066866 3300005367 Bacteria 3055
103 Ga0070667_100123547 3300005367 Bacteria 2254
104 Ga0070667_100243371 3300005367 Bacteria 1607
105 Ga0070709_10022117 3300005434 Bacteria 3715
106 Ga0070709_10073503 3300005434 Bacteria 2213
107 Ga0070714_100094761 3300005435 Bacteria 2621
108 Ga0070714_100119588 3300005435 Bacteria 2342
109 Ga0070714_100134340 3300005435 Bacteria 2214
110 Ga0070714_100269266 3300005435 Bacteria 1579
111 Ga0070713_100012226 3300005436 Bacteria 6288
112 Ga0070713_100017595 3300005436 Bacteria 5410
113 Ga0070713_100031275 3300005436 Bacteria 4239
114 Ga0070713_100056841 3300005436 Bacteria 3255
115 Ga0070713_100322617 3300005436 Bacteria 1427
116 Ga0070713_100438726 3300005436 Bacteria 1225
117 Ga0070713_100439077 3300005436 Bacteria 1224
118 Ga0070710_10001119 3300005437 Bacteria 12688
119 Ga0070710_10008886 3300005437 Bacteria 4903
120 Ga0070711_100002712 3300005439 Bacteria 10159
121 Ga0070711_100009524 3300005439 Bacteria 5989
122 Ga0070711_100010921 3300005439 Bacteria 5631
123 Ga0070711_100011141 3300005439 Bacteria 5578
124 Ga0070711_100745116 3300005439 Bacteria 827
125 Ga0070711_100855811 3300005439 Bacteria 774
126 Ga0070705_100232952 3300005440 Bacteria 1282
127 Ga0070663_100015227 3300005455 Bacteria 4958
128 Ga0070663_100051820 3300005455 Bacteria 2926
129 Ga0070663_100062227 3300005455 Bacteria 2690
130 Ga0070663_100152888 3300005455 Bacteria 1771
131 Ga0070663_100164430 3300005455 Bacteria 1710
132 Ga0070663_100213032 3300005455 Bacteria 1513
133 Ga0070663_100324666 3300005455 Bacteria 1239
134 Ga0070663_100357832 3300005455 Bacteria 1183
135 Ga0070663_100383908 3300005455 Bacteria 1145
136 Ga0070663_100569587 3300005455 Bacteria 949
137 Ga0070678_100063529 3300005456 Bacteria 2732
138 Ga0070678_100064365 3300005456 Bacteria 2717
139 Ga0070678_100089137 3300005456 Bacteria 2360
140 Ga0070678_100122526 3300005456 Bacteria 2053
141 Ga0070678_100600104 3300005456 Bacteria 983
142 Ga0070678_100609639 3300005456 Bacteria 975
143 Ga0070662_100209541 3300005457 Bacteria 1550
144 Ga0070662_100287692 3300005457 Bacteria 1331
145 Ga0070662_100303939 3300005457 Bacteria 1297
146 Ga0070662_100392978 3300005457 Bacteria 1143
147 Ga0070662_100767566 3300005457 Bacteria 818
148 Ga0070681_10042518 3300005458 Bacteria 4553
149 Ga0070681_10520516 3300005458 Bacteria 1103
150 Ga0068867_100002382 3300005459 Bacteria 13218
151 Ga0068867_100106659 3300005459 Bacteria 2146
152 Ga0068867_100110721 3300005459 Bacteria 2110
153 Ga0068867_100184555 3300005459 Bacteria 1660
154 Ga0068867_100497686 3300005459 Bacteria 1047
155 Ga0070685_10058405 3300005466 Bacteria 2249
156 Ga0070685_10263209 3300005466 Bacteria 1147
157 Ga0070698_100299253 3300005471 Bacteria 1539
158 Ga0070699_100064968 3300005518 Bacteria 3165
159 Ga0070679_100691351 3300005530 Bacteria 963
160 Ga0070684_100009002 3300005535 Bacteria 7843
161 Ga0070684_100094774 3300005535 Bacteria 2659
162 Ga0070684_100098651 3300005535 Bacteria 2606
163 Ga0068853_100008769 3300005539 Bacteria 8134
164 Ga0068853_100093792 3300005539 Bacteria 2643
165 Ga0068853_100113245 3300005539 Bacteria 2412
166 Ga0068853_100372887 3300005539 Bacteria 1332
167 Ga0068853_100462143 3300005539 Bacteria 1195
168 Ga0070672_100002140 3300005543 Bacteria 12464
169 Ga0070672_100018833 3300005543 Bacteria 4999
170 Ga0070672_100084879 3300005543 Bacteria 2544
171 Ga0070672_100223410 3300005543 Bacteria 1580
172 Ga0070672_100248799 3300005543 Bacteria 1497
173 Ga0070695_100161572 3300005545 Bacteria 1573
174 Ga0070693_100070672 3300005547 Bacteria 2054
175 Ga0070693_100092518 3300005547 Bacteria 1826
176 Ga0070693_100509863 3300005547 Bacteria 855
177 Ga0070665_100010979 3300005548 Bacteria 9158
178 Ga0070665_100025000 3300005548 Bacteria 6021
179 Ga0070665_100033934 3300005548 Bacteria 5133
180 Ga0070665_100051133 3300005548 Bacteria 4145
181 Ga0070665_100116171 3300005548 Bacteria 2678
182 Ga0070665_100290413 3300005548 Bacteria 1637
183 Ga0070665_100902553 3300005548 Bacteria 896
184 Ga0070704_100508401 3300005549 Bacteria 1047
185 Ga0068855_100018065 3300005563 Bacteria 8475
186 Ga0068855_100033896 3300005563 Bacteria 6091
187 Ga0068855_100058388 3300005563 Bacteria 4519
188 Ga0068855_100110620 3300005563 Bacteria 3153
189 Ga0068855_100134302 3300005563 Bacteria 2823
190 Ga0068855_100150475 3300005563 Bacteria 2647
191 Ga0068855_100235716 3300005563 Bacteria 2047
192 Ga0068855_100240817 3300005563 Bacteria 2022
193 Ga0068855_100384354 3300005563 Bacteria 1541
194 Ga0070664_100012841 3300005564 Bacteria 6813
195 Ga0070664_100479462 3300005564 Bacteria 1144
196 Ga0070664_100492018 3300005564 Bacteria 1130
197 Ga0068857_100007461 3300005577 Bacteria 9412
198 Ga0068857_100011475 3300005577 Bacteria 7708
199 Ga0068857_100017624 3300005577 Bacteria 6261
200 Ga0068857_100028310 3300005577 Bacteria 4944
201 Ga0068854_100027763 3300005578 Bacteria 3904
202 Ga0068854_100036078 3300005578 Bacteria 3464
203 Ga0068854_100160752 3300005578 Bacteria 1739
204 Ga0068854_100184747 3300005578 Bacteria 1630
205 Ga0068854_100881687 3300005578 Bacteria 785
206 Ga0068856_100000020 3300005614 Bacteria 146775
207 Ga0068856_100018098 3300005614 Bacteria 6831
208 Ga0068856_100026301 3300005614 Bacteria 5674
209 Ga0068856_100040303 3300005614 Bacteria 4587
210 Ga0068856_100077346 3300005614 Bacteria 3297
211 Ga0068856_100146436 3300005614 Bacteria 2369
212 Ga0068856_100242967 3300005614 Bacteria 1816
213 Ga0068856_100469858 3300005614 Bacteria 1278
214 Ga0068856_100861800 3300005614 Bacteria 925
215 Ga0068856_100880146 3300005614 Bacteria 915
216 Ga0070702_100132032 3300005615 Bacteria 1579
217 Ga0068852_100013378 3300005616 Bacteria 6280
218 Ga0068852_100031347 3300005616 Bacteria 4386
219 Ga0068852_100038673 3300005616 Bacteria 4011
220 Ga0068852_100180689 3300005616 Bacteria 1984
221 Ga0068852_100184449 3300005616 Bacteria 1964
222 Ga0068852_100733175 3300005616 Bacteria 1000
223 Ga0068859_100003527 3300005617 Bacteria 15930
224 Ga0068859_100006173 3300005617 Bacteria 12177
225 Ga0068859_100072923 3300005617 Bacteria 3471
226 Ga0068859_100144919 3300005617 Bacteria 2449
227 Ga0068859_100306737 3300005617 Bacteria 1681
228 Ga0068859_100351852 3300005617 Bacteria 1568
229 Ga0068864_100004761 3300005618 Bacteria 11119
230 Ga0068864_100150503 3300005618 Bacteria 2108
231 Ga0068864_100261260 3300005618 Bacteria 1611
232 Ga0068864_100629097 3300005618 Bacteria 1044
233 Ga0068866_10122401 3300005718 Bacteria 1468
234 Ga0068866_10122460 3300005718 Bacteria 1467
235 Ga0068861_100016661 3300005719 Bacteria 5204
236 Ga0068861_100038919 3300005719 Bacteria 3546
237 Ga0068861_100196324 3300005719 Bacteria 1691
238 Ga0068861_100387494 3300005719 Bacteria 1236
239 Ga0068861_100433784 3300005719 Bacteria 1173
240 Ga0068861_100741319 3300005719 Bacteria 917
241 Ga0068851_10064709 3300005834 Bacteria 1880
242 Ga0068870_10035764 3300005840 Bacteria 2551
243 Ga0068863_100002512 3300005841 Bacteria 18221
244 Ga0068863_100141628 3300005841 Bacteria 2298
245 Ga0068863_100154091 3300005841 Bacteria 2200
246 Ga0068863_100627486 3300005841 Bacteria 1065
247 Ga0068863_100747614 3300005841 Bacteria 974
248 Ga0068858_100015036 3300005842 Bacteria 7281
249 Ga0068858_100015457 3300005842 Bacteria 7178
250 Ga0068858_100071113 3300005842 Bacteria 3226
251 Ga0068858_100238546 3300005842 Bacteria 1725
252 Ga0068858_100314077 3300005842 Bacteria 1497
253 Ga0068860_100004964 3300005843 Bacteria 13559
254 Ga0068860_100016614 3300005843 Bacteria 7177
255 Ga0068860_100134343 3300005843 Bacteria 2376
256 Ga0068860_100186064 3300005843 Bacteria 2008
257 Ga0068862_100053426 3300005844 Bacteria 3458
258 Ga0068862_100136416 3300005844 Bacteria 2174
259 Ga0068862_100151638 3300005844 Bacteria 2063
260 Ga0068862_100281455 3300005844 Bacteria 1524
261 Ga0068862_100622576 3300005844 Bacteria 1038
262 Ga0081455_10011418 3300005937 Bacteria 8927
263 Ga0081455_10015893 3300005937 Bacteria 7286
264 Ga0081455_10019603 3300005937 Bacteria 6391
265 Ga0081455_10107769 3300005937 Bacteria 2220
266 Ga0081455_10185143 3300005937 Bacteria 1573
267 Ga0081455_10256787 3300005937 Bacteria 1275
268 Ga0081538_10020678 3300005981 Bacteria 4833
269 Ga0081538_10035977 3300005981 Bacteria 3241
270 Ga0081538_10088860 3300005981 Bacteria 1606
271 Ga0081540_1002344 3300005983 Bacteria 15503
272 Ga0081540_1002625 3300005983 Bacteria 14612
273 Ga0081540_1002868 3300005983 Bacteria 13938
274 Ga0081540_1003998 3300005983 Bacteria 11431
275 Ga0081540_1004409 3300005983 Bacteria 10741
276 Ga0081540_1009104 3300005983 Bacteria 6859
277 Ga0081540_1011513 3300005983 Bacteria 5910
278 Ga0081540_1011628 3300005983 Bacteria 5870
279 Ga0081540_1079725 3300005983 Bacteria 1479
280 Ga0081539_10000140 3300005985 Bacteria 166746
281 Ga0081539_10002339 3300005985 Bacteria 27248
282 Ga0081539_10013499 3300005985 Bacteria 6149
283 Ga0081539_10216929 3300005985 Bacteria 873
284 Ga0070717_10006527 3300006028 Bacteria 8585
285 Ga0070717_10006998 3300006028 Bacteria 8347
286 Ga0070717_10186429 3300006028 Bacteria 1811
287 Ga0070717_10339744 3300006028 Bacteria 1341
288 Ga0070717_10650840 3300006028 Bacteria 956
289 Ga0075365_10011414 3300006038 Bacteria 5223
290 Ga0075365_10029922 3300006038 Bacteria 3484
291 Ga0075365_10130201 3300006038 Bacteria 1741
292 Ga0075365_10157299 3300006038 Bacteria 1582
293 Ga0075365_10163822 3300006038 Bacteria 1550
294 Ga0075365_10383542 3300006038 Bacteria 991
295 Ga0075368_10028834 3300006042 Bacteria 2145
296 Ga0075363_100036824 3300006048 Bacteria 2567
297 Ga0075364_10003703 3300006051 Bacteria 8724
298 Ga0075364_10072947 3300006051 Bacteria 2262
299 Ga0075364_10119027 3300006051 Bacteria 1767
300 Ga0075364_10180568 3300006051 Bacteria 1428
301 Ga0070715_10008241 3300006163 Bacteria 3625
302 Ga0070716_100008528 3300006173 Bacteria 5090
303 Ga0070716_100023937 3300006173 Bacteria 3246
304 Ga0070716_100041086 3300006173 Bacteria 2575
305 Ga0070716_100288551 3300006173 Bacteria 1136
306 Ga0070712_100046680 3300006175 Bacteria 2995
307 Ga0070712_100306568 3300006175 Bacteria 1287
308 Ga0075362_10000936 3300006177 Bacteria 8910
309 Ga0075362_10010211 3300006177 Bacteria 3659
310 Ga0075367_10032354 3300006178 Bacteria 3009
311 Ga0075367_10054501 3300006178 Bacteria 2371
312 Ga0075367_10168671 3300006178 Bacteria 1363
313 Ga0075367_10300260 3300006178 Bacteria 1011
314 Ga0075367_10321027 3300006178 Bacteria 976
315 Ga0075369_10027395 3300006186 Bacteria 2382
316 Ga0075369_10042391 3300006186 Bacteria 1951
317 Ga0075369_10103873 3300006186 Bacteria 1277
318 Ga0075369_10124081 3300006186 Bacteria 1170
319 Ga0075366_10018977 3300006195 Bacteria 3975
320 Ga0075366_10083204 3300006195 Bacteria 1913
321 Ga0075366_10084065 3300006195 Bacteria 1903
322 Ga0097621_100005789 3300006237 Bacteria 8727
323 Ga0075370_10040001 3300006353 Bacteria 2643
324 Ga0075370_10053825 3300006353 Bacteria 2284
325 Ga0075370_10166004 3300006353 Bacteria 1297
326 Ga0075370_10234330 3300006353 Bacteria 1086
327 Ga0068871_100000813 3300006358 Bacteria 20955
328 Ga0068871_100130759 3300006358 Bacteria 2128
329 Ga0068871_100219261 3300006358 Bacteria 1647
330 Ga0068871_100272918 3300006358 Bacteria 1478
331 Ga0075428_100703330 3300006844 Bacteria 1076
332 Ga0075428_100833846 3300006844 Bacteria 979
333 Ga0075430_100037645 3300006846 Bacteria 4100
334 Ga0075431_100000053 3300006847 Bacteria 62977
335 Ga0075431_100077710 3300006847 Bacteria 3426
336 Ga0075433_10931035 3300006852 Bacteria 758
337 Ga0075434_100008412 3300006871 Bacteria 9595
338 Ga0075434_100443215 3300006871 Bacteria 1320
339 Ga0075434_100487130 3300006871 Bacteria 1254
340 Ga0075429_100004405 3300006880 Bacteria 12101
341 Ga0068865_100055402 3300006881 Bacteria 2758
342 Ga0068865_100079979 3300006881 Bacteria 2342
343 Ga0068865_100136475 3300006881 Bacteria 1844
344 Ga0068865_100220517 3300006881 Bacteria 1482
345 Ga0097620_100003527 3300006931 Bacteria 15930
346 Ga0097620_100006173 3300006931 Bacteria 12177
347 Ga0097620_100072924 3300006931 Bacteria 3471
348 Ga0097620_100144929 3300006931 Bacteria 2449
349 Ga0097620_100306733 3300006931 Bacteria 1681
350 Ga0097620_100351852 3300006931 Bacteria 1568
351 Ga0097620_100369142 3300006931 Bacteria 1530
352 Ga0099824_1027583 3300006942 Bacteria 2718
353 Ga0099822_1018498 3300006943 Bacteria 7243
354 Ga0099823_1041378 3300006944 Bacteria 3281
355 Ga0075435_100106719 3300007076 Bacteria 2326
356 Ga0075435_100175049 3300007076 Bacteria 1812
357 Ga0075435_100592884 3300007076 Bacteria 961
358 Ga0099795_10001696 3300007788 Bacteria 4893
359 Ga0099795_10024080 3300007788 Bacteria 2026
360 Ga0105244_10168463 3300009036 Bacteria 1043
361 Ga0105250_10178674 3300009092 Bacteria 890
362 Ga0105240_10024133 3300009093 Bacteria 8026
363 Ga0105240_10024314 3300009093 Bacteria 7990
364 Ga0105240_10036283 3300009093 Bacteria 6343
365 Ga0105240_10056335 3300009093 Bacteria 4919
366 Ga0105240_10259071 3300009093 Bacteria 2007
367 Ga0105240_10477877 3300009093 Bacteria 1390
368 Ga0105240_10719906 3300009093 Bacteria 1088
369 Ga0111539_10001519 3300009094 Bacteria 30945
370 Ga0111539_10482233 3300009094 Bacteria 1444
371 Ga0105245_10127220 3300009098 Bacteria 2386
372 Ga0105245_10206696 3300009098 Bacteria 1888
373 Ga0105245_10268159 3300009098 Bacteria 1664
374 Ga0105245_10449482 3300009098 Bacteria 1297
375 Ga0105247_10047475 3300009101 Bacteria 2636
376 Ga0105247_10068755 3300009101 Bacteria 2209
377 Ga0105247_10085701 3300009101 Bacteria 1992
378 Ga0105247_10270735 3300009101 Bacteria 1168
379 Ga0105247_10349675 3300009101 Bacteria 1039
380 Ga0105247_10448956 3300009101 Bacteria 929
381 Ga0114129_10000237 3300009147 Bacteria 61463
382 Ga0114129_10115255 3300009147 Bacteria 3704
383 Ga0114129_10649821 3300009147 Bacteria 1361
384 Ga0105243_10215572 3300009148 Bacteria 1693
385 Ga0105243_10288253 3300009148 Bacteria 1482
386 Ga0105243_10574995 3300009148 Bacteria 1081
387 Ga0105243_10759037 3300009148 Bacteria 952
388 Ga0105241_10005393 3300009174 Bacteria 9454
389 Ga0105242_10415613 3300009176 Bacteria 1259
390 Ga0105242_10910606 3300009176 Bacteria 880
391 Ga0105248_10031493 3300009177 Bacteria 5928
392 Ga0105248_10040960 3300009177 Bacteria 5194
393 Ga0105248_10138684 3300009177 Bacteria 2743
394 Ga0105248_10161950 3300009177 Bacteria 2523
395 Ga0105248_10530924 3300009177 Bacteria 1327
396 Ga0105248_10724907 3300009177 Bacteria 1122
397 Ga0105248_10966468 3300009177 Bacteria 962
398 Ga0105237_10032997 3300009545 Bacteria 5244
399 Ga0105237_10039060 3300009545 Bacteria 4792
400 Ga0105237_10049678 3300009545 Bacteria 4215
401 Ga0105237_10060279 3300009545 Bacteria 3797
402 Ga0105237_10131130 3300009545 Bacteria 2501
403 Ga0105237_10326674 3300009545 Bacteria 1538
404 Ga0105237_10544309 3300009545 Bacteria 1167
405 Ga0105237_11291647 3300009545 Bacteria 736
406 Ga0105238_10024393 3300009551 Bacteria 6165
407 Ga0105238_10029388 3300009551 Bacteria 5600
408 Ga0105238_10033691 3300009551 Bacteria 5211
409 Ga0105238_10042528 3300009551 Bacteria 4600
410 Ga0105238_11320721 3300009551 Bacteria 747
411 Ga0105249_10104490 3300009553 Bacteria 2669
412 Ga0105249_10177895 3300009553 Bacteria 2068
413 Ga0105249_10572356 3300009553 Bacteria 1182
414 Ga0099796_10098601 3300010159 Bacteria 1096
415 Ga0099796_10165123 3300010159 Bacteria 880
416 Ga0105239_10022985 3300010375 Bacteria 6874
417 Ga0105239_10058272 3300010375 Bacteria 4238
418 Ga0105239_10113597 3300010375 Bacteria 3003
419 Ga0105239_10147331 3300010375 Bacteria 2626
420 Ga0105239_10367642 3300010375 Bacteria 1625
421 Ga0105239_10454692 3300010375 Bacteria 1453
422 Ga0105239_10768292 3300010375 Bacteria 1103
423 Ga0105239_11390993 3300010375 Bacteria 810
424 Ga0105246_10045034 3300011119 Bacteria 3002
425 Ga0105246_10501460 3300011119 Bacteria 1031
426 Ga0105246_10734930 3300011119 Bacteria 869
427 Ga0157373_10028400 3300013100 Bacteria 4035
428 Ga0157370_10024117 3300013104 Bacteria 6030
429 Ga0157370_10035604 3300013104 Bacteria 4836
430 Ga0157370_10163274 3300013104 Bacteria 2072
431 Ga0157369_10066878 3300013105 Bacteria 3866
432 Ga0157369_10121671 3300013105 Bacteria 2769
433 Ga0157369_10133599 3300013105 Bacteria 2628
434 Ga0157369_10161906 3300013105 Bacteria 2362
435 Ga0157374_10015540 3300013296 Bacteria 6677
436 Ga0157374_10055850 3300013296 Bacteria 3686
437 Ga0157374_10477331 3300013296 Bacteria 1250
438 Ga0157374_11113050 3300013296 Bacteria 810
439 Ga0157378_10040048 3300013297 Bacteria 4156
440 Ga0157378_10222369 3300013297 Bacteria 1795
441 Ga0157378_10223517 3300013297 Bacteria 1791
442 Ga0163162_10010727 3300013306 Bacteria 8913
443 Ga0163162_10099437 3300013306 Bacteria 3000
444 Ga0163162_10207523 3300013306 Bacteria 2088
445 Ga0163162_10321889 3300013306 Bacteria 1679
446 Ga0163162_10464215 3300013306 Bacteria 1398
447 Ga0163162_10828920 3300013306 Bacteria 1041
448 Ga0157372_10021376 3300013307 Bacteria 6991
449 Ga0157372_10051549 3300013307 Bacteria 4580
450 Ga0157372_10140535 3300013307 Bacteria 2781
451 Ga0157375_10013707 3300013308 Bacteria 7227
452 Ga0157375_10087749 3300013308 Bacteria 3164
453 Ga0157375_10225401 3300013308 Bacteria 2033
454 Ga0157375_10298186 3300013308 Bacteria 1775
455 Ga0157375_10367945 3300013308 Bacteria 1604
456 Ga0157375_10373696 3300013308 Bacteria 1592
457 Ga0163163_10044076 3300014325 Bacteria 4375
458 Ga0163163_10056151 3300014325 Bacteria 3892
459 Ga0163163_10202275 3300014325 Bacteria 2035
460 Ga0163163_10453639 3300014325 Bacteria 1342
461 Ga0163163_10629086 3300014325 Bacteria 1137
462 Ga0163163_10672981 3300014325 Bacteria 1098
463 Ga0157380_10035710 3300014326 Bacteria 3840
464 Ga0157380_10136705 3300014326 Bacteria 2099
465 Ga0157380_10143174 3300014326 Bacteria 2057
466 Ga0157380_11240002 3300014326 Bacteria 791
467 Ga0182008_10036255 3300014497 Bacteria 2468
468 Ga0157377_10060620 3300014745 Bacteria 2160
469 Ga0157377_10118916 3300014745 Bacteria 1599
470 Ga0157379_10002865 3300014968 Bacteria 14544
471 Ga0157379_10186976 3300014968 Bacteria 1872
472 Ga0157376_10122766 3300014969 Bacteria 2305
473 Ga0157376_10129606 3300014969 Bacteria 2249
474 Ga0157376_11176721 3300014969 Bacteria 794
475 Ga0163161_10025727 3300017792 Bacteria 4167
476 Ga0163161_10026722 3300017792 Bacteria 4090
477 Ga0163161_10125701 3300017792 Bacteria 1931
478 Ga0214544_1000002 3300021320 Bacteria 753857
479 Ga0214544_1034706 3300021320 Bacteria 1398
480 Ga0214542_1000001 3300021321 Bacteria 1018696
481 Ga0214542_1029424 3300021321 Bacteria 2249
482 Ga0214545_1000001 3300021324 Bacteria 1092817
483 Ga0214545_1021309 3300021324 Bacteria 4892
484 Ga0214543_1000001 3300021327 Bacteria 776921
485 Ga0214543_1038078 3300021327 Bacteria 1397
486 Ga0213874_10022314 3300021377 Bacteria 1755
487 Ga0213876_10073813 3300021384 Bacteria 1802
488 Ga0213876_10252523 3300021384 Bacteria 937
489 Ga0213871_10067354 3300021441 Bacteria 1006
490 Ga0209563_101475 3300025230 Bacteria 6206
491 Ga0209677_100463 3300025253 Bacteria 23384
492 Ga0209148_1000428 3300025254 Bacteria 46613
493 Ga0209233_1010958 3300025261 Bacteria 2689
494 Ga0209233_1031691 3300025261 Bacteria 1231
495 Ga0209455_1004564 3300025272 Bacteria 4493
496 Ga0209455_1006717 3300025272 Bacteria 3360
497 Ga0209564_1001578 3300025295 Bacteria 22285
498 Ga0209564_1023388 3300025295 Bacteria 2149
499 Ga0209564_1052192 3300025295 Bacteria 985
500 Ga0209758_1000140 3300025297 Bacteria 174267
501 Ga0209758_1000321 3300025297 Bacteria 92591
502 Ga0209758_1001092 3300025297 Bacteria 35145
503 Ga0209758_1002051 3300025297 Bacteria 21595
504 Ga0209758_1002659 3300025297 Bacteria 17684
505 Ga0209758_1003492 3300025297 Bacteria 14221
506 Ga0209758_1003969 3300025297 Bacteria 12828
507 Ga0209758_1094196 3300025297 Bacteria 869
508 Ga0209256_1009946 3300025299 Bacteria 4075
509 Ga0209256_1022829 3300025299 Bacteria 1883
510 Ga0207426_1000278 3300025302 Bacteria 105775
511 Ga0207426_1000378 3300025302 Bacteria 76958
512 Ga0207426_1056124 3300025302 Bacteria 1151
513 Ga0209257_1000522 3300025304 Bacteria 66723
514 Ga0209257_1021097 3300025304 Bacteria 2379
515 Ga0207697_10206400 3300025315 Bacteria 865
516 Ga0207656_10010200 3300025321 Bacteria 3510
517 Ga0207656_10058367 3300025321 Bacteria 1685
518 Ga0207656_10295025 3300025321 Bacteria 802
519 Ga0207682_10038991 3300025893 Bacteria 1930
520 Ga0207692_10003515 3300025898 Bacteria 6131
521 Ga0207692_10008195 3300025898 Bacteria 4318
522 Ga0207692_10118299 3300025898 Bacteria 1480
523 Ga0207692_10213076 3300025898 Bacteria 1142
524 Ga0207642_10251749 3300025899 Bacteria 1003
525 Ga0207710_10058668 3300025900 Bacteria 1741
526 Ga0207710_10076259 3300025900 Bacteria 1547
527 Ga0207710_10175442 3300025900 Bacteria 1049
528 Ga0207710_10209946 3300025900 Bacteria 964
529 Ga0207688_10046398 3300025901 Bacteria 2426
530 Ga0207688_10133821 3300025901 Bacteria 1455
531 Ga0207688_10292657 3300025901 Bacteria 994
532 Ga0207680_10246835 3300025903 Bacteria 1232
533 Ga0207647_10002921 3300025904 Bacteria 12870
534 Ga0207647_10006624 3300025904 Bacteria 8415
535 Ga0207647_10259957 3300025904 Bacteria 994
536 Ga0207685_10000377 3300025905 Bacteria 7344
537 Ga0207685_10008143 3300025905 Bacteria 2966
538 Ga0207699_10003114 3300025906 Bacteria 7880
539 Ga0207699_10012803 3300025906 Bacteria 4273
540 Ga0207699_10038453 3300025906 Bacteria 2742
541 Ga0207699_10111562 3300025906 Bacteria 1753
542 Ga0207699_10301358 3300025906 Bacteria 1119
543 Ga0207699_10422641 3300025906 Bacteria 952
544 Ga0207645_10000286 3300025907 Bacteria 42134
545 Ga0207645_10065338 3300025907 Bacteria 2325
546 Ga0207645_10140801 3300025907 Bacteria 1572
547 Ga0207645_10234887 3300025907 Bacteria 1211
548 Ga0207645_10415922 3300025907 Bacteria 905
549 Ga0207643_10054603 3300025908 Bacteria 2271
550 Ga0207705_10056618 3300025909 Bacteria 2827
551 Ga0207705_10195348 3300025909 Bacteria 1532
552 Ga0207705_10212413 3300025909 Bacteria 1468
553 Ga0207654_10001513 3300025911 Bacteria 12241
554 Ga0207654_10037938 3300025911 Bacteria 2700
555 Ga0207707_10031128 3300025912 Bacteria 4668
556 Ga0207707_10165809 3300025912 Bacteria 1930
557 Ga0207695_10000008 3300025913 Bacteria 1058268
558 Ga0207695_10008039 3300025913 Bacteria 13279
559 Ga0207695_10032881 3300025913 Bacteria 5670
560 Ga0207695_10103578 3300025913 Bacteria 2837
561 Ga0207695_10238633 3300025913 Bacteria 1720
562 Ga0207695_10494828 3300025913 Bacteria 1105
563 Ga0207671_10059849 3300025914 Bacteria 2825
564 Ga0207671_10143691 3300025914 Bacteria 1840
565 Ga0207671_10192469 3300025914 Bacteria 1591
566 Ga0207671_10286962 3300025914 Bacteria 1299
567 Ga0207693_10001875 3300025915 Bacteria 18415
568 Ga0207693_10062244 3300025915 Bacteria 2924
569 Ga0207663_10000347 3300025916 Bacteria 20128
570 Ga0207663_10006159 3300025916 Bacteria 6109
571 Ga0207663_10040094 3300025916 Bacteria 2844
572 Ga0207663_10552055 3300025916 Bacteria 901
573 Ga0207660_10047484 3300025917 Bacteria 3035
574 Ga0207660_10145935 3300025917 Bacteria 1813
575 Ga0207660_10251113 3300025917 Bacteria 1396
576 Ga0207662_10247037 3300025918 Bacteria 1170
577 Ga0207657_10005077 3300025919 Bacteria 13808
578 Ga0207657_10106780 3300025919 Bacteria 2316
579 Ga0207649_10028404 3300025920 Bacteria 3293
580 Ga0207652_10062632 3300025921 Bacteria 3214
581 Ga0207646_10158788 3300025922 Bacteria 2040
582 Ga0207681_10139509 3300025923 Bacteria 1804
583 Ga0207681_10233693 3300025923 Bacteria 1428
584 Ga0207681_10629705 3300025923 Bacteria 888
585 Ga0207694_10000050 3300025924 Bacteria 159920
586 Ga0207694_10051007 3300025924 Bacteria 3207
587 Ga0207694_10265609 3300025924 Bacteria 1407
588 Ga0207694_10609281 3300025924 Bacteria 919
589 Ga0207694_10688494 3300025924 Bacteria 862
590 Ga0207650_10003178 3300025925 Bacteria 11313
591 Ga0207650_10012180 3300025925 Bacteria 5930
592 Ga0207650_10156021 3300025925 Bacteria 1805
593 Ga0207659_10267604 3300025926 Bacteria 1393
594 Ga0207659_10290995 3300025926 Bacteria 1338
595 Ga0207659_10480952 3300025926 Bacteria 1049
596 Ga0207659_10842822 3300025926 Bacteria 788
597 Ga0207687_10014409 3300025927 Bacteria 5173
598 Ga0207700_10050010 3300025928 Bacteria 3112
599 Ga0207700_10085205 3300025928 Bacteria 2480
600 Ga0207700_10108427 3300025928 Bacteria 2230
601 Ga0207700_10197910 3300025928 Bacteria 1692
602 Ga0207700_10258410 3300025928 Bacteria 1490
603 Ga0207700_10382050 3300025928 Bacteria 1232
604 Ga0207700_10616896 3300025928 Bacteria 966
605 Ga0207664_10038049 3300025929 Bacteria 3728
606 Ga0207664_10042856 3300025929 Bacteria 3536
607 Ga0207664_10055666 3300025929 Bacteria 3139
608 Ga0207664_10381822 3300025929 Bacteria 1251
609 Ga0207664_10454659 3300025929 Bacteria 1143
610 Ga0207664_10456802 3300025929 Bacteria 1140
611 Ga0207644_10329061 3300025931 Bacteria 1237
612 Ga0207644_10357530 3300025931 Bacteria 1187
613 Ga0207644_10565787 3300025931 Bacteria 942
614 Ga0207690_10017715 3300025932 Bacteria 4355
615 Ga0207706_10153092 3300025933 Bacteria 2028
616 Ga0207706_10184354 3300025933 Bacteria 1833
617 Ga0207706_10199144 3300025933 Bacteria 1757
618 Ga0207686_10117767 3300025934 Bacteria 1803
619 Ga0207686_10209320 3300025934 Bacteria 1401
620 Ga0207686_10581283 3300025934 Bacteria 879
621 Ga0207709_10046579 3300025935 Bacteria 2632
622 Ga0207709_10068250 3300025935 Bacteria 2247
623 Ga0207709_10119999 3300025935 Bacteria 1774
624 Ga0207709_10302752 3300025935 Bacteria 1189
625 Ga0207669_10041586 3300025937 Bacteria 2676
626 Ga0207669_10045750 3300025937 Bacteria 2581
627 Ga0207704_10048167 3300025938 Bacteria 2553
628 Ga0207704_10071978 3300025938 Bacteria 2196
629 Ga0207704_10221602 3300025938 Bacteria 1400
630 Ga0207665_10004695 3300025939 Bacteria 9077
631 Ga0207665_10045722 3300025939 Bacteria 2932
632 Ga0207665_10046684 3300025939 Bacteria 2902
633 Ga0207665_10050708 3300025939 Bacteria 2791
634 Ga0207665_10251103 3300025939 Bacteria 1307
635 Ga0207691_10002154 3300025940 Bacteria 19269
636 Ga0207691_10029841 3300025940 Bacteria 5100
637 Ga0207691_10058642 3300025940 Bacteria 3501
638 Ga0207691_10084522 3300025940 Bacteria 2849
639 Ga0207711_10010545 3300025941 Bacteria 7679
640 Ga0207711_10140089 3300025941 Bacteria 2175
641 Ga0207689_10002835 3300025942 Bacteria 15995
642 Ga0207689_10020120 3300025942 Bacteria 5621
643 Ga0207689_10113433 3300025942 Bacteria 2228
644 Ga0207689_10211358 3300025942 Bacteria 1603
645 Ga0207661_10006587 3300025944 Bacteria 8212
646 Ga0207661_10028199 3300025944 Bacteria 4297
647 Ga0207679_10546139 3300025945 Bacteria 1039
648 Ga0207667_10010367 3300025949 Bacteria 10892
649 Ga0207667_10027376 3300025949 Bacteria 6206
650 Ga0207667_10218483 3300025949 Bacteria 1953
651 Ga0207667_10218581 3300025949 Bacteria 1952
652 Ga0207667_10326769 3300025949 Bacteria 1566
653 Ga0207667_10471107 3300025949 Bacteria 1275
654 Ga0207667_10505540 3300025949 Bacteria 1225
655 Ga0207651_10199118 3300025960 Bacteria 1604
656 Ga0207651_10207367 3300025960 Bacteria 1575
657 Ga0207651_10623584 3300025960 Bacteria 945
658 Ga0207712_10019146 3300025961 Bacteria 4466
659 Ga0207712_10083820 3300025961 Bacteria 2327
660 Ga0207712_10087629 3300025961 Bacteria 2284
661 Ga0207712_10122121 3300025961 Bacteria 1972
662 Ga0207712_10395822 3300025961 Bacteria 1160
663 Ga0207668_10014231 3300025972 Bacteria 4921
664 Ga0207668_10019014 3300025972 Bacteria 4333
665 Ga0207668_10039902 3300025972 Bacteria 3164
666 Ga0207668_10067796 3300025972 Bacteria 2534
667 Ga0207668_10122389 3300025972 Bacteria 1972
668 Ga0207668_10137263 3300025972 Bacteria 1875
669 Ga0207668_10249951 3300025972 Bacteria 1439
670 Ga0207640_10014363 3300025981 Bacteria 4557
671 Ga0207640_10037061 3300025981 Bacteria 3066
672 Ga0207640_10154867 3300025981 Bacteria 1688
673 Ga0207640_10218286 3300025981 Bacteria 1458
674 Ga0207640_10384554 3300025981 Bacteria 1138
675 Ga0207640_10534182 3300025981 Bacteria 982
676 Ga0207640_10713744 3300025981 Bacteria 861
677 Ga0207640_10766068 3300025981 Bacteria 833
678 Ga0207640_10838526 3300025981 Bacteria 799
679 Ga0207640_10840084 3300025981 Bacteria 798
680 Ga0207658_10268735 3300025986 Bacteria 1456
681 Ga0207658_10305149 3300025986 Bacteria 1373
682 Ga0207658_10414578 3300025986 Bacteria 1186
683 Ga0207658_10534524 3300025986 Bacteria 1048
684 Ga0207677_10031302 3300026023 Bacteria 3407
685 Ga0207677_10116413 3300026023 Bacteria 2001
686 Ga0207677_10198274 3300026023 Bacteria 1593
687 Ga0207677_10403231 3300026023 Bacteria 1160
688 Ga0207703_10002330 3300026035 Bacteria 16564
689 Ga0207703_10004196 3300026035 Bacteria 11883
690 Ga0207703_10156350 3300026035 Bacteria 1993
691 Ga0207703_10268096 3300026035 Bacteria 1546
692 Ga0207703_10457078 3300026035 Bacteria 1194
693 Ga0207703_10847928 3300026035 Bacteria 874
694 Ga0207639_10061853 3300026041 Bacteria 2893
695 Ga0207639_10132912 3300026041 Bacteria 2062
696 Ga0207639_10146951 3300026041 Bacteria 1970
697 Ga0207639_10327623 3300026041 Bacteria 1362
698 Ga0207639_10355708 3300026041 Bacteria 1309
699 Ga0207639_10396720 3300026041 Bacteria 1242
700 Ga0207639_10817342 3300026041 Bacteria 869
701 Ga0207678_10021023 3300026067 Bacteria 5720
702 Ga0207678_10023027 3300026067 Bacteria 5451
703 Ga0207678_10035512 3300026067 Bacteria 4340
704 Ga0207678_10039077 3300026067 Bacteria 4119
705 Ga0207678_10041697 3300026067 Bacteria 3979
706 Ga0207678_10071839 3300026067 Bacteria 2967
707 Ga0207678_10105366 3300026067 Bacteria 2406
708 Ga0207678_10110819 3300026067 Bacteria 2341
709 Ga0207678_10118932 3300026067 Bacteria 2255
710 Ga0207678_10210459 3300026067 Bacteria 1663
711 Ga0207678_10211814 3300026067 Bacteria 1658
712 Ga0207708_10093201 3300026075 Bacteria 2325
713 Ga0207708_10657469 3300026075 Bacteria 893
714 Ga0207702_10000002 3300026078 Bacteria 491507
715 Ga0207702_10000748 3300026078 Bacteria 34672
716 Ga0207702_10031381 3300026078 Bacteria 4428
717 Ga0207702_10049144 3300026078 Bacteria 3559
718 Ga0207702_10394613 3300026078 Bacteria 1333
719 Ga0207702_10570530 3300026078 Bacteria 1108
720 Ga0207641_10003597 3300026088 Bacteria 13687
721 Ga0207641_10007624 3300026088 Bacteria 8999
722 Ga0207641_10138175 3300026088 Bacteria 2195
723 Ga0207641_10235148 3300026088 Bacteria 1705
724 Ga0207641_10507466 3300026088 Bacteria 1172
725 Ga0207648_10023816 3300026089 Bacteria 5477
726 Ga0207648_10059062 3300026089 Bacteria 3345
727 Ga0207648_10116985 3300026089 Bacteria 2343
728 Ga0207674_10000489 3300026116 Bacteria 52346
729 Ga0207674_10003205 3300026116 Bacteria 20153
730 Ga0207674_10003611 3300026116 Bacteria 18863
731 Ga0207674_10014760 3300026116 Bacteria 8617
732 Ga0207674_10023871 3300026116 Bacteria 6541
733 Ga0207674_10729084 3300026116 Bacteria 957
734 Ga0207675_100003215 3300026118 Bacteria 16023
735 Ga0207675_100075023 3300026118 Bacteria 3165
736 Ga0207675_100133243 3300026118 Bacteria 2357
737 Ga0207675_100234843 3300026118 Bacteria 1770
738 Ga0207675_100244660 3300026118 Bacteria 1734
739 Ga0207675_100347420 3300026118 Bacteria 1453
740 Ga0207675_100789871 3300026118 Bacteria 962
741 Ga0207683_10002147 3300026121 Bacteria 17329
742 Ga0207683_10007176 3300026121 Bacteria 9551
743 Ga0207683_10014348 3300026121 Bacteria 6751
744 Ga0207683_10018400 3300026121 Bacteria 5961
745 Ga0207683_10195356 3300026121 Bacteria 1838
746 Ga0207683_10321172 3300026121 Bacteria 1418
747 Ga0207683_10367452 3300026121 Bacteria 1321
748 Ga0207698_10022804 3300026142 Bacteria 4361
749 Ga0207698_10047597 3300026142 Bacteria 3250
750 Ga0207698_10104339 3300026142 Bacteria 2358
751 Ga0207698_10138517 3300026142 Bacteria 2092
752 Ga0207698_10220585 3300026142 Bacteria 1713
753 Ga0209389_1000040 3300027296 Bacteria 124256
754 Ga0209389_1000995 3300027296 Bacteria 18828
755 Ga0209589_1000001 3300027357 Bacteria 794224
756 Ga0209589_1000211 3300027357 Bacteria 69316
757 Ga0209489_100001 3300027361 Bacteria 794224
758 Ga0209489_100006 3300027361 Bacteria 475698
759 Ga0209489_110930 3300027361 Bacteria 9725
760 Ga0209700_100001 3300027363 Bacteria 794224
761 Ga0209700_100005 3300027363 Bacteria 573969
762 Ga0209813_10008974 3300027866 Bacteria 2543
763 Ga0207428_10036206 3300027907 Bacteria 4028
764 Ga0207428_10039542 3300027907 Bacteria 3830
765 Ga0207428_10104190 3300027907 Bacteria 2190
766 Ga0268266_10002320 3300028379 Bacteria 20625
767 Ga0268266_10009271 3300028379 Bacteria 8682
768 Ga0268266_10024042 3300028379 Bacteria 5185
769 Ga0268266_10028180 3300028379 Bacteria 4775
770 Ga0268266_10050458 3300028379 Bacteria 3570
771 Ga0268266_10065849 3300028379 Bacteria 3132
772 Ga0268266_10065947 3300028379 Bacteria 3130
773 Ga0268266_10172149 3300028379 Bacteria 1966
774 Ga0268266_10343609 3300028379 Bacteria 1401
775 Ga0268266_10564449 3300028379 Bacteria 1091
776 Ga0268266_10830937 3300028379 Bacteria 893
777 Ga0268265_10036410 3300028380 Bacteria 3604
778 Ga0268265_10209777 3300028380 Bacteria 1696
779 Ga0268265_10472323 3300028380 Bacteria 1176
780 Ga0268265_10746325 3300028380 Bacteria 949
781 Ga0268264_10002930 3300028381 Bacteria 14828
782 Ga0268264_10005853 3300028381 Bacteria 10411
783 Ga0268264_10017488 3300028381 Bacteria 5871
784 Ga0268264_10158642 3300028381 Bacteria 2035
785 Ga0268264_10249367 3300028381 Bacteria 1648
786 Ga0265337_1006749 3300028556 Bacteria 4374
787 Ga0265334_10006955 3300028573 Bacteria 4858
788 Ga0265323_10004409 3300028653 Bacteria 6068
789 Ga0265322_10060032 3300028654 Bacteria 1079
790 Ga0265336_10000763 3300028666 Bacteria 17052
791 Ga0307517_10000249 3300028786 Bacteria 91911
792 Ga0307517_10119002 3300028786 Bacteria 1963
793 Ga0307515_10314902 3300028794 Bacteria 1236
794 Ga0265338_10000665 3300028800 Bacteria 59449
795 Ga0307511_10110325 3300030521 Bacteria 1754
796 Ga0265330_10124828 3300031235 Bacteria 1096
797 Ga0265332_10001409 3300031238 Bacteria 13560
798 Ga0265332_10168113 3300031238 Bacteria 915
799 Ga0265325_10012262 3300031241 Bacteria 4905
800 Ga0265325_10030711 3300031241 Bacteria 2880
801 Ga0265325_10165341 3300031241 Bacteria 1038
802 Ga0265329_10071967 3300031242 Bacteria 1094
803 Ga0265340_10005726 3300031247 Bacteria 6865
804 Ga0265340_10008625 3300031247 Bacteria 5494
805 Ga0265339_10003832 3300031249 Bacteria 10446
806 Ga0265339_10052640 3300031249 Bacteria 2217
807 Ga0265331_10062535 3300031250 Bacteria 1755
808 Ga0265316_10061807 3300031344 Bacteria 2908
809 Ga0265316_10087120 3300031344 Bacteria 2386
810 Ga0307509_10125888 3300031507 Bacteria 2528
811 Ga0307408_100318538 3300031548 Bacteria 1309
812 Ga0307408_100779255 3300031548 Bacteria 866
813 Ga0307508_10000018 3300031616 Bacteria 202701
814 Ga0307508_10043906 3300031616 Bacteria 4002
815 Ga0307508_10311566 3300031616 Bacteria 1166
816 Ga0316575_10025725 3300031665 Bacteria 2284
817 Ga0316579_10037283 3300031691 Bacteria 2246
818 Ga0265314_10002567 3300031711 Bacteria 18413
819 Ga0265314_10160306 3300031711 Bacteria 1370
820 Ga0265314_10181164 3300031711 Bacteria 1262
821 Ga0265342_10002171 3300031712 Bacteria 17254
822 Ga0265342_10174163 3300031712 Bacteria 1182
823 Ga0265342_10211170 3300031712 Bacteria 1049
824 Ga0316576_10033029 3300031727 Bacteria 3681
825 Ga0316578_10016515 3300031728 Bacteria 3997
826 Ga0307516_10011331 3300031730 Bacteria 9703
827 Ga0307516_10038640 3300031730 Bacteria 4761
828 Ga0307516_10200912 3300031730 Bacteria 1713
829 Ga0307516_10224017 3300031730 Bacteria 1588
830 Ga0307405_10631678 3300031731 Bacteria 878
831 Ga0307413_10031350 3300031824 Bacteria 2999
832 Ga0307413_10800187 3300031824 Bacteria 792
833 Ga0307410_10682828 3300031852 Bacteria 864
834 Ga0307406_10255867 3300031901 Bacteria 1322
835 Ga0307412_10429143 3300031911 Bacteria 1083
836 Ga0307412_10595978 3300031911 Bacteria 935
837 Ga0307416_100409035 3300032002 Bacteria 1397
838 Ga0307415_100042679 3300032126 Bacteria 3020
839 Ga0307507_10008461 3300033179 Bacteria 14216
840 Ga0307510_10005775 3300033180 Bacteria 14749
841 Ga0315911_1000006 3300033442 Bacteria 414563
842 Ga0373950_0036482 3300034818 Bacteria 927
843 Ga0373926_0034351 3300035083 Bacteria 1794
844 Ga0373926_0069346 3300035083 Bacteria 1294
845 Ga0373926_0089882 3300035083 Bacteria 1141
846 Ga0373928_0021938 3300035084 Bacteria 1351
847 Ga0373934_0024742 3300035086 Bacteria 2322
848 Ga0373944_0027109 3300035089 Bacteria 1697
849 Ga0373949_0069780 3300035090 Bacteria 919
850 Ga0373932_0012711 3300035112 Bacteria 2079
851 Ga0373936_0009212 3300035113 Bacteria 3720
852 Ga0373936_0018528 3300035113 Bacteria 2690
853 Ga0373936_0124171 3300035113 Bacteria 1105
854 Ga0373953_0002178 3300035117 Bacteria 5860
855 Ga0373953_0007285 3300035117 Bacteria 3699
856 Ga0373953_0027450 3300035117 Bacteria 2188
857 Ga0373953_0036308 3300035117 Bacteria 1940
858 Ga0373954_0003365 3300035118 Bacteria 6768
859 Ga0373954_0008989 3300035118 Bacteria 4396
860 Ga0373954_0016863 3300035118 Bacteria 3276
861 Ga0373956_0015008 3300035119 Bacteria 3239
862 Ga0373956_0035180 3300035119 Bacteria 2208
863 Ga0373956_0046623 3300035119 Bacteria 1937
864 Ga0373956_0054647 3300035119 Bacteria 1799
865 Ga0373957_0003026 3300035120 Bacteria 4886
866 Ga0373957_0045277 3300035120 Bacteria 1667
867 Ga0373943_0005981 3300035170 Bacteria 5462
868 Ga0373943_0006361 3300035170 Bacteria 5307
869 Ga0373943_0033391 3300035170 Bacteria 2451
870 Ga0373946_0010792 3300035171 Bacteria 3392
871 Ga0373946_0146071 3300035171 Bacteria 1100
872 Ga0373955_0002466 3300035172 Bacteria 8083
873 Ga0373955_0007820 3300035172 Bacteria 4932
874 Ga0373955_0237654 3300035172 Bacteria 1091
875 Ga0373955_0341937 3300035172 Bacteria 905
876 Ga0373924_0002359 3300035410 Bacteria 6348
877 Ga0373924_0012183 3300035410 Bacteria 3210
878 Ga0373931_0007658 3300035691 Bacteria 5093
879 Ga0373931_0098484 3300035691 Bacteria 1641
880 Ga0373931_0148530 3300035691 Bacteria 1364
881 Ga0373931_0171129 3300035691 Bacteria 1280
882 Ga0373935_0001180 3300035692 Bacteria 14352
883 Ga0373935_0033363 3300035692 Bacteria 3202
884 Ga0373935_0049212 3300035692 Bacteria 2671
885 Ga0373935_0130757 3300035692 Bacteria 1686
886 Ga0373935_0382553 3300035692 Bacteria 1008
887 Ga0373935_0658773 3300035692 Bacteria 768
888 Ga0373927_0012626 3300035695 Bacteria 5619
889 Ga0373927_0033690 3300035695 Bacteria 3334
890 Ga0373927_0069279 3300035695 Bacteria 2283
891 Ga0373927_0084027 3300035695 Bacteria 2064
892 Ga0373927_0177471 3300035695 Bacteria 1397
893 Ga0373927_0187584 3300035695 Bacteria 1356
894 Ga0373933_0000787 3300035724 Bacteria 19357
895 Ga0373933_0005811 3300035724 Bacteria 6711
896 Ga0373933_0036459 3300035724 Bacteria 2878
897 Ga0373933_0045514 3300035724 Bacteria 2602
898 Ga0373947_0012125 3300035725 Bacteria 4935
899 Ga0373947_0022984 3300035725 Bacteria 3623
900 Ga0373947_0089676 3300035725 Bacteria 1915
901 Ga0373937_0001814 3300036401 Bacteria 17923
902 Ga0373937_0007938 3300036401 Bacteria 9201
903 Ga0373937_0140323 3300036401 Bacteria 2260
904 Ga0373937_0170675 3300036401 Bacteria 2041
905 Ga0373937_0472782 3300036401 Bacteria 1190
906 Ga0373937_0797525 3300036401 Bacteria 892
907 Ga0372808_000933 3300036459 Bacteria 2749
908 Ga0373925_0000353 3300037068 Bacteria 47782
909 Ga0373925_0003087 3300037068 Bacteria 13072
910 Ga0373925_0010490 3300037068 Bacteria 6720
911 Ga0373925_0076221 3300037068 Bacteria 2543
912 Ga0373925_0579725 3300037068 Bacteria 923
913 Ga0395900_0023857 3300037418 Bacteria 6259
914 Ga0395900_0169289 3300037418 Bacteria 2225
915 Ga0395898_0019988 3300037466 Bacteria 6809
916 Ga0395898_0192806 3300037466 Bacteria 1947
917 Ga0395898_0275800 3300037466 Bacteria 1604
918 Ga0395898_0417270 3300037466 Bacteria 1279
919 Ga0395905_0008616 3300037471 Bacteria 10049
920 Ga0395905_0014968 3300037471 Bacteria 7397
921 Ga0395905_0030507 3300037471 Bacteria 5080
922 Ga0436364_0479367 3300037853 Bacteria 1846
923 Ga0395901_0002662 3300038443 Bacteria 18025
924 Ga0395901_0183555 3300038443 Bacteria 2194
925 Ga0395901_0353861 3300038443 Bacteria 1515
926 Ga0436365_0174244 3300039437 Bacteria 1774
927 Ga0436365_0647195 3300039437 Bacteria 1061
928 Ga0436365_1394673 3300039437 Bacteria 3628
929 Ga0436360_0136997 3300039438 Bacteria 1457
930 Ga0436360_0173425 3300039438 Bacteria 5331
931 Ga0436360_0809633 3300039438 Bacteria 1801
932 Ga0436360_0865201 3300039438 Bacteria 1468
933 Ga0436361_0265785 3300039447 Bacteria 1023
934 Ga0436361_0314733 3300039447 Bacteria 864
935 Ga0436361_0632415 3300039447 Bacteria 3816
936 Ga0436363_1258628 3300039450 Bacteria 2108
937 Ga0439461_0020278 3300041410 Bacteria 1315
938 Ga0451793_0046002 3300041452 Bacteria 1678
939 Ga0451807_2283239 3300041486 Bacteria 1089
940 Ga0451843_0321225 3300041509 Bacteria 1232
941 Ga0466972_0125525 3300044658 Bacteria 1209
942 Ga0466965_0086603 3300044683 Bacteria 1589
943 Ga0466966_0000426 3300044684 Bacteria 27052
944 Ga0466961_0000208 3300044693 Bacteria 39439
945 Ga0466961_0462223 3300044693 Bacteria 768
946 Ga0466963_0137055 3300044694 Bacteria 1694
947 Ga0466964_0141621 3300044706 Bacteria 1106
948 Ga0466957_0364882 3300044842 Bacteria 982
949 Ga0466957_0502789 3300044842 Bacteria 840
950 Ga0466957_0621834 3300044842 Bacteria 757
951 Ga0466960_0074350 3300044901 Bacteria 1698
952 Ga0466959_0045855 3300045049 Bacteria 3218
953 Ga0466959_0098879 3300045049 Bacteria 2090
954 Ga0466959_0101222 3300045049 Bacteria 2062
955 Ga0466959_0482341 3300045049 Bacteria 839
956 Ga0451576_1590618 3300045051 Bacteria 678
957 Ga0466967_0075695 3300045976 Bacteria 3026
958 Ga0466967_0139641 3300045976 Bacteria 2256
959 Ga0466967_0177573 3300045976 Bacteria 2006
960 Ga0466967_0235164 3300045976 Bacteria 1746
961 Ga0466967_0514130 3300045976 Bacteria 1176
962 Ga0495617_024593 3300046452 Bacteria 2032
963 Ga0495617_086636 3300046452 Bacteria 1024
964 Ga0495592_0000284 3300046454 Bacteria 43567
965 Ga0495592_0007940 3300046454 Bacteria 7959
966 Ga0495592_0011449 3300046454 Bacteria 6712
967 Ga0495592_0030145 3300046454 Bacteria 4102
968 Ga0495592_0044849 3300046454 Bacteria 3302
969 Ga0495603_0113001 3300046455 Bacteria 1583
970 Ga0495603_0151587 3300046455 Bacteria 1346
971 Ga0495590_0066882 3300046457 Bacteria 1259
972 Ga0495629_0001471 3300046459 Bacteria 18583
973 Ga0495629_0009818 3300046459 Bacteria 6983
974 Ga0495629_0362317 3300046459 Bacteria 988
975 Ga0495629_0418101 3300046459 Bacteria 910
976 Ga0495638_0007580 3300046460 Bacteria 7764
977 Ga0495638_0024650 3300046460 Bacteria 3918
978 Ga0495638_0077447 3300046460 Bacteria 2024
979 Ga0495641_0027053 3300046461 Bacteria 2793
980 Ga0495651_0000528 3300046462 Bacteria 29605
981 Ga0495651_0001055 3300046462 Bacteria 21307
982 Ga0495651_0004953 3300046462 Bacteria 10171
983 Ga0495651_0033861 3300046462 Bacteria 3983
984 Ga0495651_0045105 3300046462 Bacteria 3416
985 Ga0495651_0119535 3300046462 Bacteria 1938
986 Ga0495651_0239621 3300046462 Bacteria 1245
987 Ga0495653_0000330 3300046463 Bacteria 38640
988 Ga0495653_0012854 3300046463 Bacteria 6833
989 Ga0495653_0051880 3300046463 Bacteria 3146
990 Ga0495653_0205184 3300046463 Bacteria 1335
991 Ga0495650_0035581 3300046471 Bacteria 2191
992 Ga0495650_0074621 3300046471 Bacteria 1322
993 Ga0495580_0017647 3300046472 Bacteria 5331
994 Ga0495580_0064783 3300046472 Bacteria 2561
995 Ga0495582_0008676 3300046473 Bacteria 5606
996 Ga0495582_0115587 3300046473 Bacteria 1509
997 Ga0495582_0321055 3300046473 Bacteria 891
998 Ga0495605_0079390 3300046474 Bacteria 1537
999 Ga0495605_0123152 3300046474 Bacteria 1174
1000 Ga0495639_0046055 3300046475 Bacteria 1974
1001 Ga0495639_0197439 3300046475 Bacteria 984
1002 Ga0495639_0207986 3300046475 Bacteria 959
1003 Ga0495639_0261230 3300046475 Bacteria 858
1004 Ga0495662_0003004 3300046476 Bacteria 8512
1005 Ga0495662_0053996 3300046476 Bacteria 1941
1006 Ga0495664_0000098 3300046477 Bacteria 43069
1007 Ga0495664_0014192 3300046477 Bacteria 4513
1008 Ga0495664_0026168 3300046477 Bacteria 3398
1009 Ga0495664_0027596 3300046477 Bacteria 3311
1010 Ga0495664_0326016 3300046477 Bacteria 926
1011 Ga0495584_0108882 3300046491 Bacteria 1401
1012 Ga0495585_0042306 3300046492 Bacteria 2552
1013 Ga0495585_0042422 3300046492 Bacteria 2548
1014 Ga0495594_0049107 3300046499 Bacteria 2319
1015 Ga0495594_0127910 3300046499 Bacteria 1438
1016 Ga0495607_0024171 3300046501 Bacteria 3792
1017 Ga0495583_0063625 3300046506 Bacteria 1639
1018 Ga0495606_0001663 3300046507 Bacteria 28893
1019 Ga0495606_0078359 3300046507 Bacteria 2061
1020 Ga0495606_0108452 3300046507 Bacteria 1678
1021 Ga0495606_0111700 3300046507 Bacteria 1647
1022 Ga0495606_0147278 3300046507 Bacteria 1385
1023 Ga0495608_0000318 3300046511 Bacteria 33912
1024 Ga0495608_0007280 3300046511 Bacteria 7824
1025 Ga0495608_0007748 3300046511 Bacteria 7561
1026 Ga0495608_0113918 3300046511 Bacteria 1737
1027 Ga0495610_0028158 3300046512 Bacteria 2975
1028 Ga0495616_0036121 3300046513 Bacteria 2552
1029 Ga0495616_0065445 3300046513 Bacteria 1771
1030 Ga0495618_0000235 3300046514 Bacteria 40243
1031 Ga0495618_0005313 3300046514 Bacteria 7864
1032 Ga0495618_0128394 3300046514 Bacteria 1623
1033 Ga0495618_0308007 3300046514 Bacteria 983
1034 Ga0495620_0024389 3300046515 Bacteria 2877
1035 Ga0495620_0036962 3300046515 Bacteria 2180
1036 Ga0495628_0001752 3300046516 Bacteria 19728
1037 Ga0495628_0008728 3300046516 Bacteria 8672
1038 Ga0495628_0123321 3300046516 Bacteria 1986
1039 Ga0495628_0156019 3300046516 Bacteria 1736
1040 Ga0495630_0002403 3300046517 Bacteria 12996
1041 Ga0495630_0007077 3300046517 Bacteria 7992
1042 Ga0495630_0535953 3300046517 Bacteria 898
1043 Ga0495630_0574089 3300046517 Bacteria 865
1044 Ga0495631_0047682 3300046518 Bacteria 1880
1045 Ga0495632_0041732 3300046519 Bacteria 2304
1046 Ga0495632_0047359 3300046519 Bacteria 2132
1047 Ga0495637_0156129 3300046520 Bacteria 858
1048 Ga0495643_0039228 3300046522 Bacteria 2590
1049 Ga0495643_0091448 3300046522 Bacteria 1569
1050 Ga0495643_0155892 3300046522 Bacteria 1127
1051 Ga0495644_0134568 3300046523 Bacteria 942
1052 Ga0495644_0221403 3300046523 Bacteria 732
1053 Ga0495648_0002078 3300046524 Bacteria 18952
1054 Ga0495648_0047321 3300046524 Bacteria 2659
1055 Ga0495648_0057044 3300046524 Bacteria 2345
1056 Ga0495648_0063629 3300046524 Bacteria 2177
1057 Ga0495648_0099715 3300046524 Bacteria 1606
1058 Ga0495666_0062522 3300046526 Bacteria 1778
1059 Ga0495652_0000305 3300046529 Bacteria 58441
1060 Ga0495652_0002427 3300046529 Bacteria 19218
1061 Ga0495652_0007898 3300046529 Bacteria 9769
1062 Ga0495652_0030776 3300046529 Bacteria 4704
1063 Ga0495652_0071606 3300046529 Bacteria 2892
1064 Ga0495652_0092860 3300046529 Bacteria 2465
1065 Ga0495652_0112414 3300046529 Bacteria 2188
1066 Ga0495654_0019069 3300046530 Bacteria 3589
1067 Ga0495665_0083069 3300046531 Bacteria 1684
1068 Ga0495665_0170711 3300046531 Bacteria 1132
1069 Ga0495640_0000388 3300046533 Bacteria 31270
1070 Ga0495640_0012229 3300046533 Bacteria 6568
1071 Ga0495640_0020152 3300046533 Bacteria 4913
1072 Ga0495640_0041579 3300046533 Bacteria 3211
1073 Ga0495586_0146090 3300046535 Bacteria 1329
1074 Ga0495587_0000249 3300046536 Bacteria 39283
1075 Ga0495587_0018684 3300046536 Bacteria 4297
1076 Ga0495587_0045874 3300046536 Bacteria 2596
1077 Ga0495587_0068307 3300046536 Bacteria 2070
1078 Ga0495609_0074972 3300046538 Bacteria 1483
1079 Ga0495609_0121791 3300046538 Bacteria 1121
1080 Ga0495597_0085522 3300046542 Bacteria 1344
1081 Ga0495597_0235764 3300046542 Bacteria 723
1082 Ga0495645_0007880 3300046543 Bacteria 7410
1083 Ga0495645_0024231 3300046543 Bacteria 4402
1084 Ga0495645_0164214 3300046543 Bacteria 1533
1085 Ga0495622_0031960 3300046557 Bacteria 2458
1086 Ga0495622_0057875 3300046557 Bacteria 1796
1087 Ga0495622_0065013 3300046557 Bacteria 1686
1088 Ga0495633_0022894 3300046558 Bacteria 3100
1089 Ga0495667_0000195 3300046559 Bacteria 40983
1090 Ga0495667_0005712 3300046559 Bacteria 8423
1091 Ga0495667_0032617 3300046559 Bacteria 3489
1092 Ga0495667_0123438 3300046559 Bacteria 1672
1093 Ga0495656_0001218 3300046615 Bacteria 8383
1094 Ga0495656_0008671 3300046615 Bacteria 3637
1095 Ga0495668_0055643 3300046616 Bacteria 2184
1096 Ga0495634_0003325 3300046642 Bacteria 12937
1097 Ga0495634_0021235 3300046642 Bacteria 4592
1098 Ga0495634_0135922 3300046642 Bacteria 1564
1099 Ga0495611_0027315 3300046648 Bacteria 2494
1100 Ga0495625_0088037 3300046660 Bacteria 2152
1101 Ga0495625_0089466 3300046660 Bacteria 2131
1102 Ga0495625_0122276 3300046660 Bacteria 1770
1103 Ga0495625_0152008 3300046660 Bacteria 1556
1104 Ga0495625_0446987 3300046660 Bacteria 799
1105 Ga0495635_0000185 3300046663 Bacteria 39314
1106 Ga0495635_0000873 3300046663 Bacteria 19766
1107 Ga0495635_0001696 3300046663 Bacteria 14837
1108 Ga0495635_0044031 3300046663 Bacteria 3079
1109 Ga0495635_0056629 3300046663 Bacteria 2698
1110 Ga0495659_0019391 3300046664 Bacteria 2276
1111 Ga0495661_0280131 3300046665 Bacteria 841
1112 Ga0495588_0013827 3300046674 Bacteria 3851
1113 Ga0495588_0048497 3300046674 Bacteria 2182
1114 Ga0495588_0068228 3300046674 Bacteria 1847
1115 Ga0495588_0250205 3300046674 Bacteria 934
1116 Ga0495657_0001331 3300046675 Bacteria 21493
1117 Ga0495657_0011291 3300046675 Bacteria 6685
1118 Ga0495657_0018550 3300046675 Bacteria 5029
1119 Ga0495657_0047169 3300046675 Bacteria 2913
1120 Ga0495599_0000168 3300046678 Bacteria 43232
1121 Ga0495599_0102140 3300046678 Bacteria 1787
1122 Ga0495623_0000586 3300046679 Bacteria 24285
1123 Ga0495623_0001768 3300046679 Bacteria 14509
1124 Ga0495623_0019551 3300046679 Bacteria 4376
1125 Ga0495623_0262791 3300046679 Bacteria 966
1126 Ga0495646_0000269 3300046680 Bacteria 26349
1127 Ga0495646_0026347 3300046680 Bacteria 3651
1128 Ga0495646_0056845 3300046680 Bacteria 2344
1129 Ga0495646_0079456 3300046680 Bacteria 1915
1130 Ga0495646_0131853 3300046680 Bacteria 1406
1131 Ga0495647_0169018 3300046681 Bacteria 946
1132 Ga0495658_0023364 3300046683 Bacteria 3281
1133 Ga0495658_0378762 3300046683 Bacteria 901
1134 Ga0495669_0015157 3300046684 Bacteria 3298
1135 Ga0495669_0064405 3300046684 Bacteria 1663
1136 Ga0495613_0030170 3300046689 Bacteria 4028
1137 Ga0495613_0038119 3300046689 Bacteria 3563
1138 Ga0495613_0062881 3300046689 Bacteria 2716
1139 Ga0495624_0115553 3300046690 Bacteria 1649
1140 Ga0495670_0072322 3300046691 Bacteria 1746
1141 Ga0495671_0094426 3300046692 Bacteria 1463
1142 Ga0495649_0005458 3300046694 Bacteria 8079
1143 Ga0495600_0000210 3300046809 Bacteria 33567
1144 Ga0495600_0001526 3300046809 Bacteria 12864
1145 Ga0495600_0005587 3300046809 Bacteria 7594
1146 Ga0495600_0021059 3300046809 Bacteria 4172
1147 Ga0495600_0104375 3300046809 Bacteria 1847
1148 Ga0495581_0031203 3300047315 Bacteria 3088
1149 Ga0495581_0041352 3300047315 Bacteria 2668
1150 Ga0495581_0075569 3300047315 Bacteria 1949
1151 Ga0495604_0000003 3300047317 Bacteria 464246
1152 Ga0495604_0002479 3300047317 Bacteria 14734
1153 Ga0495604_0007137 3300047317 Bacteria 8852
1154 Ga0495604_0009567 3300047317 Bacteria 7666
1155 Ga0495674_0000006 3300047319 Bacteria 341772
1156 Ga0495674_0016182 3300047319 Bacteria 6958
1157 Ga0495674_0017727 3300047319 Bacteria 6630
1158 Ga0495674_0029040 3300047319 Bacteria 5037
1159 Ga0495674_0164354 3300047319 Bacteria 1856
1160 Ga0495672_0028302 3300047320 Bacteria 3547
1161 Ga0495672_0039931 3300047320 Bacteria 2850
1162 Ga0495672_0125201 3300047320 Bacteria 1360
1163 Ga0495672_0182365 3300047320 Bacteria 1062
1164 Ga0495676_0035714 3300047321 Bacteria 4156
1165 Ga0495676_0060030 3300047321 Bacteria 2983
1166 Ga0495676_0190803 3300047321 Bacteria 1429
1167 Ga0495680_0001799 3300047322 Bacteria 22686
1168 Ga0495680_0005630 3300047322 Bacteria 11739
1169 Ga0495680_0018123 3300047322 Bacteria 5987
1170 Ga0495683_0047664 3300047323 Bacteria 2149
1171 Ga0495683_0127160 3300047323 Bacteria 1205
1172 Ga0495675_0000336 3300047444 Bacteria 33140
1173 Ga0495675_0249065 3300047444 Bacteria 1067
1174 Ga0495685_015331 3300047447 Bacteria 2613
1175 Ga0495684_0000287 3300047471 Bacteria 40835
1176 Ga0495684_0003082 3300047471 Bacteria 13101
1177 Ga0495684_0008230 3300047471 Bacteria 8073
1178 Ga0495684_0015851 3300047471 Bacteria 5801
1179 Ga0495686_0048054 3300047472 Bacteria 2692
1180 Ga0495686_0124666 3300047472 Bacteria 1532
1181 Ga0495686_0128036 3300047472 Bacteria 1508
1182 Ga0495593_0001718 3300047673 Bacteria 12967
1183 Ga0495593_0009416 3300047673 Bacteria 5668
1184 Ga0495593_0035007 3300047673 Bacteria 2728
1185 Ga0495593_0146138 3300047673 Bacteria 1196
1186 Ga0495593_0180805 3300047673 Bacteria 1062
1187 Ga0495593_0274359 3300047673 Bacteria 844
1188 Ga0495602_0000805 3300048088 Bacteria 29994
1189 Ga0495602_0018072 3300048088 Bacteria 7052
1190 Ga0495602_0020674 3300048088 Bacteria 6501
1191 Ga0495602_0058307 3300048088 Bacteria 3380
1192 Ga0495602_0378188 3300048088 Bacteria 1015
1193 Ga0495626_0067186 3300048091 Bacteria 1620
1194 Ga0496100_0002779 3300048903 Bacteria 8952
1195 Ga0496100_0029522 3300048903 Bacteria 3393
1196 Ga0496100_0258192 3300048903 Bacteria 1291
1197 Ga0496100_0486855 3300048903 Bacteria 949
1198 Ga0496100_0560611 3300048903 Bacteria 884
1199 Ga0496101_0001894 3300048904 Bacteria 12631
1200 Ga0496101_0054385 3300048904 Bacteria 2890
1201 Ga0496101_0056797 3300048904 Bacteria 2830
1202 Ga0496101_0093616 3300048904 Bacteria 2238
1203 Ga0496102_0002765 3300048905 Bacteria 14959
1204 Ga0496102_0040716 3300048905 Bacteria 4205
1205 Ga0496102_0065153 3300048905 Bacteria 3339
1206 Ga0496102_0081657 3300048905 Bacteria 2980
1207 Ga0496102_0377152 3300048905 Bacteria 1335
1208 Ga0496102_0689565 3300048905 Bacteria 944
1209 Ga0496103_0052822 3300048906 Bacteria 2517
1210 Ga0496103_0079512 3300048906 Bacteria 2060
1211 Ga0496103_0408764 3300048906 Bacteria 872
1212 Ga0496104_0005950 3300048907 Bacteria 10682
1213 Ga0496104_0039293 3300048907 Bacteria 4430
1214 Ga0496104_0194817 3300048907 Bacteria 1938
1215 Ga0496104_0200572 3300048907 Bacteria 1907
1216 Ga0496104_0400700 3300048907 Bacteria 1284
1217 Ga0496104_0636854 3300048907 Bacteria 975
1218 Ga0496104_0821197 3300048907 Bacteria 835
1219 Ga0496105_0004948 3300048908 Bacteria 10075
1220 Ga0496105_0014178 3300048908 Bacteria 6343
1221 Ga0496105_0038159 3300048908 Bacteria 3957
1222 Ga0496105_0041386 3300048908 Bacteria 3797
1223 Ga0496105_0053835 3300048908 Bacteria 3324
1224 Ga0496105_0082441 3300048908 Bacteria 2656
1225 Ga0496105_0201843 3300048908 Bacteria 1623
1226 Ga0496106_0000587 3300048909 Bacteria 25963
1227 Ga0496106_0005552 3300048909 Bacteria 9339
1228 Ga0496106_0019620 3300048909 Bacteria 5015
1229 Ga0496106_0051907 3300048909 Bacteria 3092
1230 Ga0496106_0053721 3300048909 Bacteria 3043
1231 Ga0496106_0219417 3300048909 Bacteria 1516
1232 Ga0496106_0649360 3300048909 Bacteria 843
1233 Ga0496107_0003023 3300048910 Bacteria 11146
1234 Ga0496107_0021695 3300048910 Bacteria 4538
1235 Ga0496107_0024155 3300048910 Bacteria 4299
1236 Ga0496107_0024903 3300048910 Bacteria 4235
1237 Ga0496107_0074497 3300048910 Bacteria 2470
1238 Ga0496107_0080438 3300048910 Bacteria 2376
1239 Ga0496107_0209770 3300048910 Bacteria 1448
1240 Ga0496107_0564105 3300048910 Bacteria 843
1241 Ga0496108_0000517 3300048911 Bacteria 30206
1242 Ga0496108_0002253 3300048911 Bacteria 15443
1243 Ga0496108_0034446 3300048911 Bacteria 4208
1244 Ga0496108_0044050 3300048911 Bacteria 3726
1245 Ga0496108_0046015 3300048911 Bacteria 3645
1246 Ga0496108_0132909 3300048911 Bacteria 2139
1247 Ga0496108_0457925 3300048911 Bacteria 1114
1248 Ga0496109_0000814 3300048912 Bacteria 26012
1249 Ga0496109_0049567 3300048912 Bacteria 3823
1250 Ga0496109_0066388 3300048912 Bacteria 3303
1251 Ga0496109_0159112 3300048912 Bacteria 2116
1252 Ga0496109_0368696 3300048912 Bacteria 1356
1253 Ga0496109_0537074 3300048912 Bacteria 1103
1254 Ga0496109_0644880 3300048912 Bacteria 996
1255 Ga0496109_0774993 3300048912 Bacteria 897
1256 Ga0496110_0016915 3300048913 Bacteria 6096
1257 Ga0496110_0026206 3300048913 Bacteria 4986
1258 Ga0496110_0053094 3300048913 Bacteria 3562
1259 Ga0496110_0067178 3300048913 Bacteria 3172
1260 Ga0496110_0149899 3300048913 Bacteria 2111
1261 Ga0496110_0177020 3300048913 Bacteria 1936
1262 Ga0496111_0009126 3300048914 Bacteria 6601
1263 Ga0496111_0046808 3300048914 Bacteria 3115
1264 Ga0496111_0123406 3300048914 Bacteria 1914
1265 Ga0496111_0139025 3300048914 Bacteria 1799
1266 Ga0496111_0175646 3300048914 Bacteria 1592
1267 Ga0496111_0367624 3300048914 Bacteria 1064
1268 Ga0496112_0000004 3300048915 Bacteria 553294
1269 Ga0496112_0000218 3300048915 Bacteria 37059
1270 Ga0496112_0016917 3300048915 Bacteria 6843
1271 Ga0496112_0037102 3300048915 Bacteria 4758
1272 Ga0496112_0043290 3300048915 Bacteria 4408
1273 Ga0496112_0044258 3300048915 Bacteria 4362
1274 Ga0496112_0068208 3300048915 Bacteria 3512
1275 Ga0496112_0128423 3300048915 Bacteria 2505
1276 Ga0496112_0145582 3300048915 Bacteria 2338
1277 Ga0496112_0163031 3300048915 Bacteria 2195
1278 Ga0496112_0286820 3300048915 Bacteria 1592
1279 Ga0496112_0655136 3300048915 Bacteria 979
1280 Ga0496113_0003899 3300048916 Bacteria 9040
1281 Ga0496113_0025279 3300048916 Bacteria 4231
1282 Ga0496113_0029742 3300048916 Bacteria 3948
1283 Ga0496113_0058245 3300048916 Bacteria 2906
1284 Ga0496113_0060028 3300048916 Bacteria 2866
1285 Ga0496113_0163310 3300048916 Bacteria 1761
1286 Ga0496113_0275455 3300048916 Bacteria 1345
1287 Ga0496113_0305047 3300048916 Bacteria 1275
1288 Ga0496113_0612111 3300048916 Bacteria 872
1289 Ga0496114_0009279 3300048917 Bacteria 7805
1290 Ga0496114_0035386 3300048917 Bacteria 4123
1291 Ga0496114_0100069 3300048917 Bacteria 2473
1292 Ga0496114_0191204 3300048917 Bacteria 1791
1293 Ga0496114_0210520 3300048917 Bacteria 1705
1294 Ga0496114_0308589 3300048917 Bacteria 1397
1295 Ga0496115_0018582 3300048918 Bacteria 5341
1296 Ga0496115_0023272 3300048918 Bacteria 4806
1297 Ga0496115_0155365 3300048918 Bacteria 1890
1298 Ga0496115_0347336 3300048918 Bacteria 1210
1299 Ga0496115_0410117 3300048918 Bacteria 1098
1300 Ga0496115_0540866 3300048918 Bacteria 932
1301 Ga0496116_0017544 3300048919 Bacteria 5549
1302 Ga0496116_0023210 3300048919 Bacteria 4626
1303 Ga0496116_0040863 3300048919 Bacteria 3188
1304 Ga0496117_0011613 3300048920 Bacteria 7871
1305 Ga0496117_0103657 3300048920 Bacteria 1792
1306 Ga0496117_0214359 3300048920 Bacteria 1077
1307 Ga0496117_0295281 3300048920 Bacteria 861
1308 Ga0496118_0004793 3300048921 Bacteria 15797
1309 Ga0496118_0045464 3300048921 Bacteria 3427
1310 Ga0496118_0056547 3300048921 Bacteria 2948
1311 Ga0496118_0062107 3300048921 Bacteria 2761
1312 Ga0496118_0070914 3300048921 Bacteria 2512
1313 Ga0496118_0071819 3300048921 Bacteria 2489
1314 Ga0496118_0265931 3300048921 Bacteria 964
1315 Ga0496119_0002647 3300048922 Bacteria 19399
1316 Ga0496119_0009808 3300048922 Bacteria 8146
1317 Ga0496119_0028133 3300048922 Bacteria 3845
1318 Ga0496119_0125808 3300048922 Bacteria 1403
1319 Ga0496120_0019815 3300048923 Bacteria 4291
1320 Ga0496120_0038353 3300048923 Bacteria 2835
1321 Ga0496120_0187901 3300048923 Bacteria 1009
1322 Ga0496120_0199312 3300048923 Bacteria 970
1323 Ga0496121_0000458 3300048924 Bacteria 80207
1324 Ga0496121_0001749 3300048924 Bacteria 35439
1325 Ga0496121_0002564 3300048924 Bacteria 27512
1326 Ga0496121_0006706 3300048924 Bacteria 14144
1327 Ga0496121_0019210 3300048924 Bacteria 6845
1328 Ga0496121_0030046 3300048924 Bacteria 5002
1329 Ga0496121_0037369 3300048924 Bacteria 4314
1330 Ga0496121_0039959 3300048924 Bacteria 4124
1331 Ga0496121_0060123 3300048924 Bacteria 3128
1332 Ga0496121_0100872 3300048924 Bacteria 2227
1333 Ga0496121_0102319 3300048924 Bacteria 2207
1334 Ga0496121_0110683 3300048924 Bacteria 2095
1335 Ga0496121_0137910 3300048924 Bacteria 1814
1336 Ga0496121_0143496 3300048924 Bacteria 1768
1337 Ga0496121_0461321 3300048924 Bacteria 816
1338 Ga0496122_0005205 3300048925 Bacteria 15617
1339 Ga0496122_0089726 3300048925 Bacteria 2100
1340 Ga0496122_0151155 3300048925 Bacteria 1433
1341 Ga0496123_0001216 3300048926 Bacteria 37600
1342 Ga0496123_0056943 3300048926 Bacteria 2549
1343 Ga0496123_0136293 3300048926 Bacteria 1350
1344 Ga0496124_0004472 3300048927 Bacteria 16313
1345 Ga0496124_0049471 3300048927 Bacteria 3586
1346 Ga0496124_0135267 3300048927 Bacteria 1952
1347 Ga0496124_0318172 3300048927 Bacteria 1115
1348 Ga0496124_0331410 3300048927 Bacteria 1085
1349 Ga0496124_0401643 3300048927 Bacteria 951
1350 Ga0496125_0007066 3300048928 Bacteria 11990
1351 Ga0496125_0028317 3300048928 Bacteria 5064
1352 Ga0496125_0035050 3300048928 Bacteria 4411
1353 Ga0496125_0063116 3300048928 Bacteria 2956
1354 Ga0496125_0130191 3300048928 Bacteria 1773
1355 Ga0496125_0163747 3300048928 Bacteria 1506
1356 Ga0496125_0347958 3300048928 Bacteria 886
1357 Ga0496125_0379986 3300048928 Bacteria 833
1358 Ga0496126_0003477 3300048929 Bacteria 19884
1359 Ga0496126_0009236 3300048929 Bacteria 10511
1360 Ga0496126_0014283 3300048929 Bacteria 8034
1361 Ga0496126_0022627 3300048929 Bacteria 6109
1362 Ga0496126_0022855 3300048929 Bacteria 6071
1363 Ga0496126_0031475 3300048929 Bacteria 5011
1364 Ga0496126_0039174 3300048929 Bacteria 4400
1365 Ga0496126_0082444 3300048929 Bacteria 2841
1366 Ga0496126_0083970 3300048929 Bacteria 2810
1367 Ga0496126_0091207 3300048929 Bacteria 2680
1368 Ga0496126_0161207 3300048929 Bacteria 1916
1369 Ga0496126_0170985 3300048929 Bacteria 1851
1370 Ga0496126_0178540 3300048929 Bacteria 1805
1371 Ga0496126_0273764 3300048929 Bacteria 1400
1372 Ga0496126_0396835 3300048929 Bacteria 1120
1373 Ga0496126_0729716 3300048929 Bacteria 767
1374 Ga0496126_0737877 3300048929 Bacteria 762
1375 Ga0496126_0739013 3300048929 Bacteria 761
1376 Ga0495682_0103925 3300049460 Bacteria 1019
1377 Ga0501031_0002252 3300049568 Bacteria 12217
1378 Ga0501031_0004417 3300049568 Bacteria 9113
1379 Ga0501031_0104072 3300049568 Bacteria 1852
1380 Ga0501032_0001822 3300049569 Bacteria 16845
1381 Ga0501032_0010877 3300049569 Bacteria 6545
1382 Ga0501032_0048106 3300049569 Bacteria 2879
1383 Ga0501032_0073698 3300049569 Bacteria 2274
1384 Ga0501033_0000108 3300049570 Bacteria 79903
1385 Ga0501033_0000827 3300049570 Bacteria 28243
1386 Ga0501033_0005609 3300049570 Bacteria 9915
1387 Ga0501033_0008341 3300049570 Bacteria 8023
1388 Ga0501033_0020768 3300049570 Bacteria 4961
1389 Ga0501033_0192451 3300049570 Bacteria 1459
1390 Ga0501034_0002449 3300049571 Bacteria 22384
1391 Ga0501034_0041720 3300049571 Bacteria 4643
1392 Ga0501034_0050134 3300049571 Bacteria 4211
1393 Ga0501034_0097719 3300049571 Bacteria 2932
1394 Ga0501034_0107244 3300049571 Bacteria 2785
1395 Ga0501034_0251907 3300049571 Bacteria 1710
1396 Ga0501036_0000149 3300049572 Bacteria 45598
1397 Ga0501036_0017788 3300049572 Bacteria 5952
1398 Ga0501036_0020595 3300049572 Bacteria 5539
1399 Ga0501036_0025415 3300049572 Bacteria 4995
1400 Ga0501036_0159903 3300049572 Bacteria 1899
1401 Ga0501036_0281244 3300049572 Bacteria 1392
1402 Ga0501037_0000153 3300049573 Bacteria 64239
1403 Ga0501037_0000888 3300049573 Bacteria 22320
1404 Ga0501037_0023604 3300049573 Bacteria 4547
1405 Ga0501037_0039773 3300049573 Bacteria 3460
1406 Ga0501037_0043447 3300049573 Bacteria 3302
1407 Ga0501038_0000138 3300049574 Bacteria 62493
1408 Ga0501038_0000999 3300049574 Bacteria 25463
1409 Ga0501038_0001121 3300049574 Bacteria 24319
1410 Ga0501038_0012358 3300049574 Bacteria 7802
1411 Ga0501038_0026754 3300049574 Bacteria 5135
1412 Ga0501038_0028683 3300049574 Bacteria 4943
1413 Ga0501038_0041649 3300049574 Bacteria 4004
1414 Ga0501038_0054303 3300049574 Bacteria 3446
1415 Ga0501038_0378460 3300049574 Bacteria 1098
1416 Ga0501039_0000842 3300049575 Bacteria 22166
1417 Ga0501039_0006162 3300049575 Bacteria 9108
1418 Ga0501039_0050475 3300049575 Bacteria 3218
1419 Ga0501039_0343199 3300049575 Bacteria 1173
1420 Ga0501040_0015506 3300049576 Bacteria 5036
1421 Ga0501041_0120074 3300049577 Bacteria 1633
1422 Ga0501041_0287448 3300049577 Bacteria 1035
1423 Ga0501042_0001932 3300049578 Bacteria 12476
1424 Ga0501042_0088976 3300049578 Bacteria 2215
1425 Ga0501043_0000085 3300049579 Bacteria 83544
1426 Ga0501043_0013390 3300049579 Bacteria 6414
1427 Ga0501043_0019654 3300049579 Bacteria 5303
1428 Ga0501043_0081607 3300049579 Bacteria 2541
1429 Ga0501043_0170027 3300049579 Bacteria 1700
1430 Ga0501046_0000267 3300049580 Bacteria 53185
1431 Ga0501046_0003985 3300049580 Bacteria 13484
1432 Ga0501046_0033529 3300049580 Bacteria 4147
1433 Ga0501046_0155285 3300049580 Bacteria 1724
1434 Ga0501047_0001785 3300049581 Bacteria 20809
1435 Ga0501047_0008455 3300049581 Bacteria 9713
1436 Ga0501047_0021518 3300049581 Bacteria 6194
1437 Ga0501047_0027991 3300049581 Bacteria 5431
1438 Ga0501047_0041733 3300049581 Bacteria 4432
1439 Ga0501047_0214787 3300049581 Bacteria 1780
1440 Ga0501047_0535426 3300049581 Bacteria 996
1441 Ga0501048_0000396 3300049582 Bacteria 30302
1442 Ga0501048_0012509 3300049582 Bacteria 6315
1443 Ga0501048_0111842 3300049582 Bacteria 1929
1444 Ga0501048_0182347 3300049582 Bacteria 1488
1445 Ga0501067_0000104 3300049583 Bacteria 48290
1446 Ga0501067_0006729 3300049583 Bacteria 6375
1447 Ga0501067_0048309 3300049583 Bacteria 2360
1448 Ga0501067_0147050 3300049583 Bacteria 1313
1449 Ga0501067_0244749 3300049583 Bacteria 998
1450 Ga0501068_0002865 3300049584 Bacteria 9179
1451 Ga0501068_0003450 3300049584 Bacteria 8510
1452 Ga0501068_0018698 3300049584 Bacteria 4014
1453 Ga0501069_0019419 3300049585 Bacteria 3675
1454 Ga0501069_0045971 3300049585 Bacteria 2420
1455 Ga0501069_0053275 3300049585 Bacteria 2253
1456 Ga0501070_0002230 3300049586 Bacteria 17026
1457 Ga0501070_0008793 3300049586 Bacteria 8538
1458 Ga0501070_0009392 3300049586 Bacteria 8267
1459 Ga0501070_0024791 3300049586 Bacteria 5031
1460 Ga0501070_0334147 3300049586 Bacteria 1231
1461 Ga0501071_0028989 3300049587 Bacteria 3904
1462 Ga0501071_0204566 3300049587 Bacteria 1484
1463 Ga0501071_0464840 3300049587 Bacteria 969
1464 Ga0501072_0019143 3300049588 Bacteria 5288
1465 Ga0501072_0032885 3300049588 Bacteria 4062
1466 Ga0501072_0316549 3300049588 Bacteria 1240
1467 Ga0501072_0624194 3300049588 Bacteria 849
1468 Ga0501073_0000221 3300049589 Bacteria 37338
1469 Ga0501073_0018870 3300049589 Bacteria 4985
1470 Ga0501073_0020114 3300049589 Bacteria 4813
1471 Ga0501073_0066091 3300049589 Bacteria 2521
1472 Ga0501073_0436788 3300049589 Bacteria 905
1473 Ga0501074_0001821 3300049590 Bacteria 14590
1474 Ga0501074_0008617 3300049590 Bacteria 7385
1475 Ga0501075_0038557 3300049591 Bacteria 3573
1476 Ga0501075_0304417 3300049591 Bacteria 1215
1477 Ga0501075_0369424 3300049591 Bacteria 1093
1478 Ga0501076_0011550 3300049592 Bacteria 6585
1479 Ga0501076_0037661 3300049592 Bacteria 3794
1480 Ga0501076_0617934 3300049592 Bacteria 894
1481 Ga0501077_0050144 3300049593 Bacteria 2653
1482 Ga0501079_0007983 3300049741 Bacteria 8021
1483 Ga0501079_0011689 3300049741 Bacteria 6706
1484 Ga0501079_0019790 3300049741 Bacteria 5143
1485 Ga0501079_0141817 3300049741 Bacteria 1872
1486 Ga0501080_0013906 3300049742 Bacteria 7408
1487 Ga0501080_0015912 3300049742 Bacteria 6938
1488 Ga0501080_0024958 3300049742 Bacteria 5544
1489 Ga0501080_0053279 3300049742 Bacteria 3766
1490 Ga0501080_0139921 3300049742 Bacteria 2238
1491 Ga0501080_0164236 3300049742 Bacteria 2049
1492 Ga0501083_0000087 3300049744 Bacteria 62691
1493 Ga0501083_0018512 3300049744 Bacteria 4853
1494 Ga0501083_0127008 3300049744 Bacteria 1672
1495 Ga0501083_0211671 3300049744 Bacteria 1264
1496 Ga0501035_0000223 3300049822 Bacteria 67732
1497 Ga0501035_0009850 3300049822 Bacteria 8874
1498 Ga0501035_0019488 3300049822 Bacteria 6236
1499 Ga0501035_0021012 3300049822 Bacteria 6000
1500 Ga0501035_0036839 3300049822 Bacteria 4432
1501 Ga0501035_0065366 3300049822 Bacteria 3231
1502 Ga0501035_0101224 3300049822 Bacteria 2528
1503 Ga0501044_0000369 3300049823 Bacteria 56363
1504 Ga0501044_0029450 3300049823 Bacteria 5789
1505 Ga0501044_0082994 3300049823 Bacteria 3241
1506 Ga0501044_0096443 3300049823 Bacteria 2978
1507 Ga0501044_0123956 3300049823 Bacteria 2582
1508 Ga0501044_0151796 3300049823 Bacteria 2298
1509 Ga0501044_0278393 3300049823 Bacteria 1607
1510 Ga0501044_0353486 3300049823 Bacteria 1388
1511 Ga0501045_0003158 3300049824 Bacteria 11262
1512 Ga0501045_0185869 3300049824 Bacteria 1548
1513 nmdc:mga03683_58016_c1 3300050489 Bacteria 1631
1514 nmdc:mga03n38_5599_c1 3300050490 Bacteria 4292
1515 nmdc:mga03n38_866_c1 3300050490 Bacteria 8124
1516 nmdc:mga00v17_14094_c1 3300050491 Bacteria 4456
1517 nmdc:mga00v17_167231_c1 3300050491 Bacteria 1417
1518 nmdc:mga00v17_364542_c1 3300050491 Bacteria 939
1519 nmdc:mga0yw44_156649_c1 3300050492 Bacteria 1489
1520 nmdc:mga0yw44_204888_c1 3300050492 Bacteria 1304
1521 nmdc:mga0yw44_2331_c1 3300050492 Bacteria 8037
1522 nmdc:mga0yw44_242690_c1 3300050492 Bacteria 1198
1523 nmdc:mga0yw44_331786_c1 3300050492 Bacteria 1022
1524 nmdc:mga0yw44_34263_c1 3300050492 Bacteria 2974
1525 nmdc:mga0k408_18012_c1 3300050493 Bacteria 3937
1526 nmdc:mga0k408_238953_c1 3300050493 Bacteria 1085
1527 nmdc:mga06z11_103129_c1 3300050494 Bacteria 1568
1528 nmdc:mga06z11_55066_c1 3300050494 Bacteria 2053
1529 nmdc:mga06z11_85073_c1 3300050494 Bacteria 1705
1530 nmdc:mga04h51_12842_c1 3300050495 Bacteria 2360
1531 nmdc:mga07m45_158907_c1 3300050496 Bacteria 1312
1532 nmdc:mga07m45_8361_c1 3300050496 Bacteria 5316
1533 nmdc:mga07m45_93596_c1 3300050496 Bacteria 1723
1534 nmdc:mga05p37_555_c1 3300050507 Bacteria 41098
1535 nmdc:mga05p37_63752_c1 3300050507 Bacteria 4535
1536 nmdc:mga05p37_824366_c1 3300050507 Bacteria 1011
1537 nmdc:mga09592_24376_c1 3300050508 Bacteria 5003
1538 nmdc:mga0qj67_382736_c1 3300050509 Bacteria 1136
1539 nmdc:mga06r32_187410_c1 3300050510 Bacteria 2056
1540 nmdc:mga06r32_76341_c1 3300050510 Bacteria 3254
1541 nmdc:mga08y16_134_c1 3300050511 Bacteria 64270
1542 nmdc:mga08y16_527942_c1 3300050511 Bacteria 1196
1543 nmdc:mga08y16_83711_c1 3300050511 Bacteria 3325
1544 nmdc:mga0n895_107862_c1 3300050512 Bacteria 2799
1545 nmdc:mga0n895_168242_c1 3300050512 Bacteria 2224
1546 nmdc:mga0n895_281199_c1 3300050512 Bacteria 1687
1547 nmdc:mga0n895_371837_c1 3300050512 Bacteria 1447
1548 nmdc:mga0rr50_23433_c1 3300050513 Bacteria 4257
1549 nmdc:mga0rr50_289107_c1 3300050513 Bacteria 1369
1550 nmdc:mga0sz30_176696_c1 3300050516 Bacteria 947
1551 nmdc:mga0sz30_38397_c1 3300050516 Bacteria 2006
1552 Ga0495601_0000004 3300053077 Bacteria 449178
1553 Ga0495601_0074263 3300053077 Bacteria 2175
1554 Ga0495601_0241907 3300053077 Bacteria 1178
1555 Ga0495612_0000008 3300053078 Bacteria 232633
1556 Ga0495612_0012354 3300053078 Bacteria 3442
1557 Ga0500635_0021603 3300053080 Bacteria 1984
1558 Ga0495595_0000299 3300053084 Bacteria 19235
1559 Ga0495595_0002435 3300053084 Bacteria 7270
1560 Ga0495619_0000410 3300053085 Bacteria 29131
1561 Ga0495619_0002051 3300053085 Bacteria 13376
1562 Ga0495619_0107032 3300053085 Bacteria 1907
1563 Ga0495619_0274955 3300053085 Bacteria 1167
1564 Ga0500643_000035 3300053087 Bacteria 184794
1565 Ga0500643_002043 3300053087 Bacteria 10818
1566 Ga0500643_095135 3300053087 Bacteria 810
1567 Ga0500583_0340185 3300053092 Bacteria 728
1568 Ga0500651_0014239 3300053093 Bacteria 4864
1569 Ga0500651_0019792 3300053093 Bacteria 4187
1570 Ga0500651_0089411 3300053093 Bacteria 1898
1571 Ga0500651_0097142 3300053093 Bacteria 1810
1572 Ga0500566_0000006 3300053094 Bacteria 153632
1573 Ga0500566_0003025 3300053094 Bacteria 10054
1574 Ga0500566_0007070 3300053094 Bacteria 6646
1575 Ga0500566_0020464 3300053094 Bacteria 3889
1576 Ga0500566_0050700 3300053094 Bacteria 2376
1577 Ga0500566_0122820 3300053094 Bacteria 1398
1578 Ga0500640_000606 3300053095 Bacteria 9307
1579 Ga0500641_0002166 3300053096 Bacteria 6961
1580 Ga0500641_0009735 3300053096 Bacteria 3459
1581 Ga0500641_0023876 3300053096 Bacteria 2355
1582 Ga0500641_0064774 3300053096 Bacteria 1528
1583 Ga0500650_0027948 3300053098 Bacteria 2541
1584 Ga0500650_0094324 3300053098 Bacteria 1401
1585 Ga0500555_006179 3300053103 Bacteria 3399
1586 Ga0500555_077440 3300053103 Bacteria 869
1587 Ga0500556_0000030 3300053104 Bacteria 165098
1588 Ga0500556_0000734 3300053104 Bacteria 19756
1589 Ga0500557_000004 3300053105 Bacteria 202318
1590 Ga0500569_008206 3300053109 Bacteria 2379
1591 Ga0500572_000132 3300053111 Bacteria 25301
1592 Ga0500572_000296 3300053111 Bacteria 17781
1593 Ga0500591_007207 3300053115 Bacteria 5111
1594 Ga0500592_001857 3300053116 Bacteria 3405
1595 Ga0500594_0015247 3300053118 Bacteria 1852
1596 Ga0500594_0058113 3300053118 Bacteria 1108
1597 Ga0500595_000306 3300053119 Bacteria 32239
1598 Ga0500595_001509 3300053119 Bacteria 12362
1599 Ga0500595_002915 3300053119 Bacteria 8182
1600 Ga0500595_014140 3300053119 Bacteria 3035
1601 Ga0500595_022512 3300053119 Bacteria 2229
1602 Ga0500595_025262 3300053119 Bacteria 2062
1603 Ga0500595_084980 3300053119 Bacteria 922
1604 Ga0500607_055375 3300053121 Bacteria 2097
1605 Ga0500608_045969 3300053122 Bacteria 2097
1606 Ga0500614_001796 3300053123 Bacteria 4975
1607 Ga0500614_034971 3300053123 Bacteria 1249
1608 Ga0500642_0000080 3300053130 Bacteria 52024
1609 Ga0500642_0000302 3300053130 Bacteria 17637
1610 Ga0500642_0059969 3300053130 Bacteria 1705
1611 Ga0500642_0145080 3300053130 Bacteria 1114
1612 Ga0500652_001386 3300053131 Bacteria 7563
1613 Ga0500652_061353 3300053131 Bacteria 1548
1614 Ga0500655_021935 3300053133 Bacteria 1200
1615 Ga0500658_0191389 3300053134 Bacteria 934
1616 Ga0500559_0000591 3300053136 Bacteria 24715
1617 Ga0500559_0000850 3300053136 Bacteria 19692
1618 Ga0500559_0001859 3300053136 Bacteria 11495
1619 Ga0500559_0067160 3300053136 Bacteria 1609
1620 Ga0500559_0102365 3300053136 Bacteria 1320
1621 Ga0500559_0228383 3300053136 Bacteria 877
1622 Ga0500568_0000978 3300053139 Bacteria 19672
1623 Ga0500568_0014177 3300053139 Bacteria 3608
1624 Ga0500568_0014813 3300053139 Bacteria 3508
1625 Ga0500568_0023458 3300053139 Bacteria 2624
1626 Ga0500568_0110948 3300053139 Bacteria 1025
1627 Ga0500568_0162847 3300053139 Bacteria 823
1628 Ga0500588_0059060 3300053146 Bacteria 1223
1629 Ga0500588_0060830 3300053146 Bacteria 1210
1630 Ga0500588_0128155 3300053146 Bacteria 901
1631 Ga0500603_000125 3300053150 Bacteria 18162
1632 Ga0500603_016027 3300053150 Bacteria 1773
1633 Ga0500603_021405 3300053150 Bacteria 1590
1634 Ga0500603_049058 3300053150 Bacteria 1150
1635 Ga0500604_0004650 3300053151 Bacteria 3636
1636 Ga0500604_0035375 3300053151 Bacteria 1486
1637 Ga0500604_0048977 3300053151 Bacteria 1299
1638 Ga0500616_0000252 3300053153 Bacteria 83060
1639 Ga0500616_0000696 3300053153 Bacteria 39234
1640 Ga0500616_0015478 3300053153 Bacteria 4360
1641 Ga0500616_0055865 3300053153 Bacteria 2062
1642 Ga0500620_001207 3300053155 Bacteria 4624
1643 Ga0500622_0002597 3300053156 Bacteria 12869
1644 Ga0500622_0003061 3300053156 Bacteria 11537
1645 Ga0500622_0088897 3300053156 Bacteria 1536
1646 Ga0500627_0219046 3300053158 Bacteria 850
1647 Ga0500627_0279057 3300053158 Bacteria 734
1648 Ga0500630_029525 3300053159 Bacteria 2697
1649 Ga0500634_0007858 3300053161 Bacteria 5295
1650 Ga0500634_0119245 3300053161 Bacteria 1287
1651 Ga0500638_001134 3300053162 Bacteria 7959
1652 Ga0500638_032065 3300053162 Bacteria 2536
1653 Ga0500638_045989 3300053162 Bacteria 2117
1654 Ga0500638_104409 3300053162 Bacteria 1317
1655 Ga0500639_000016 3300053163 Bacteria 118099
1656 Ga0500639_043671 3300053163 Bacteria 2349
1657 Ga0500639_197036 3300053163 Bacteria 870
1658 Ga0500636_0000066 3300053177 Bacteria 51367
1659 Ga0500636_0000534 3300053177 Bacteria 20700
1660 Ga0500636_0006053 3300053177 Bacteria 6941
1661 Ga0500636_0046789 3300053177 Bacteria 2550
1662 Ga0500637_0001307 3300053178 Bacteria 10481
1663 Ga0500637_0095998 3300053178 Bacteria 1717
1664 Ga0500576_039982 3300053725 Bacteria 2114
1665 Ga0500625_000123 3300053729 Bacteria 15150
1666 Ga0500645_015900 3300053730 Bacteria 2378
1667 Ga0500645_051528 3300053730 Bacteria 1200
1668 Ga0500599_009161 3300053736 Bacteria 1293
1669 Ga0500601_000139 3300053737 Bacteria 14822
1670 Ga0500601_002260 3300053737 Bacteria 2070
1671 Ga0501084_0005685 3300054114 Bacteria 10240
1672 Ga0501084_0020558 3300054114 Bacteria 5505
1673 Ga0501084_0220459 3300054114 Bacteria 1600
1674 Ga0501082_0000799 3300060353 Bacteria 27707
1675 Ga0501082_0028947 3300060353 Bacteria 4771
1676 Ga0501082_0797946 3300060353 Bacteria 826

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005367 Ga0070667_100243371 Ga0070667_1002433711 194
2 3300005844 Ga0068862_100053426 Ga0068862_1000534263 194
3 3300026035 Ga0207703_10457078 Ga0207703_104570781 194
4 3300028381 Ga0268264_10249367 Ga0268264_102493672 194
5 3300026067 Ga0207678_10210459 Ga0207678_102104592 195
6 3300005331 Ga0070670_100018067 Ga0070670_1000180672 208
7 3300005334 Ga0068869_100022270 Ga0068869_1000222702 208
8 3300005335 Ga0070666_10001973 Ga0070666_1000197312 208
9 3300005338 Ga0068868_100197211 Ga0068868_1001972113 208
10 3300005347 Ga0070668_100002309 Ga0070668_1000023094 208
11 3300005353 Ga0070669_100012022 Ga0070669_1000120223 208
12 3300005355 Ga0070671_100081489 Ga0070671_1000814892 208
13 3300005367 Ga0070667_100000717 Ga0070667_10000071710 208
14 3300005456 Ga0070678_100609639 Ga0070678_1006096391 208
15 3300005459 Ga0068867_100002382 Ga0068867_10000238210 208
16 3300005543 Ga0070672_100002140 Ga0070672_1000021403 208
17 3300005548 Ga0070665_100010979 Ga0070665_1000109798 208
18 3300005617 Ga0068859_100006173 Ga0068859_10000617310 208
19 3300005618 Ga0068864_100261260 Ga0068864_1002612602 208
20 3300005719 Ga0068861_100038919 Ga0068861_1000389192 208
21 3300005842 Ga0068858_100015457 Ga0068858_1000154579 208
22 3300005843 Ga0068860_100004964 Ga0068860_10000496411 208
23 3300006237 Ga0097621_100005789 Ga0097621_1000057895 208
24 3300006358 Ga0068871_100000813 Ga0068871_10000081312 208
25 3300006881 Ga0068865_100220517 Ga0068865_1002205171 208
26 3300006931 Ga0097620_100006173 Ga0097620_10000617310 208
27 3300009098 Ga0105245_10449482 Ga0105245_104494822 208
28 3300009177 Ga0105248_10040960 Ga0105248_100409601 208
29 3300009553 Ga0105249_10177895 Ga0105249_101778951 208
30 3300013296 Ga0157374_10015540 Ga0157374_100155405 208
31 3300013297 Ga0157378_10222369 Ga0157378_102223692 208
32 3300013306 Ga0163162_10010727 Ga0163162_100107271 208
33 3300014325 Ga0163163_10453639 Ga0163163_104536391 208
34 3300014326 Ga0157380_11240002 Ga0157380_112400021 208
35 3300014968 Ga0157379_10186976 Ga0157379_101869762 208
36 3300017792 Ga0163161_10026722 Ga0163161_100267221 208
37 3300025893 Ga0207682_10038991 Ga0207682_100389912 208
38 3300025907 Ga0207645_10000286 Ga0207645_1000028617 208
39 3300025925 Ga0207650_10003178 Ga0207650_100031788 208
40 3300025926 Ga0207659_10480952 Ga0207659_104809521 208
41 3300025937 Ga0207669_10045750 Ga0207669_100457502 208
42 3300025940 Ga0207691_10002154 Ga0207691_1000215410 208
43 3300025941 Ga0207711_10010545 Ga0207711_100105451 208
44 3300025942 Ga0207689_10020120 Ga0207689_100201203 208
45 3300025960 Ga0207651_10207367 Ga0207651_102073672 208
46 3300025961 Ga0207712_10083820 Ga0207712_100838202 208
47 3300025972 Ga0207668_10019014 Ga0207668_100190141 208
48 3300026023 Ga0207677_10116413 Ga0207677_101164133 208
49 3300026035 Ga0207703_10004196 Ga0207703_1000419612 208
50 3300026088 Ga0207641_10003597 Ga0207641_100035975 208
51 3300026118 Ga0207675_100075023 Ga0207675_1000750233 208
52 3300026121 Ga0207683_10002147 Ga0207683_1000214710 208
53 3300028379 Ga0268266_10024042 Ga0268266_100240421 208
54 3300036401 Ga0373937_0797525 Ga0373937_0797525_29_667 208
55 3300039438 Ga0436360_0865201 Ga0436360_0865201_431_1075 208
56 3300041486 Ga0451807_2283239 Ga0451807_2283239_242_880 208
57 3300048910 Ga0496107_0564105 Ga0496107_0564105_195_833 208
58 3300048911 Ga0496108_0132909 Ga0496108_0132909_961_1599 208
59 3300005327 Ga0070658_10370198 Ga0070658_103701981 210
60 3300005328 Ga0070676_10216748 Ga0070676_102167483 210
61 3300005329 Ga0070683_100090477 Ga0070683_1000904772 210
62 3300005331 Ga0070670_100002084 Ga0070670_1000020844 210
63 3300005331 Ga0070670_100171499 Ga0070670_1001714992 210
64 3300005334 Ga0068869_100030572 Ga0068869_1000305723 210
65 3300005337 Ga0070682_100617722 Ga0070682_1006177221 210
66 3300005340 Ga0070689_100311686 Ga0070689_1003116862 210
67 3300005344 Ga0070661_100017395 Ga0070661_1000173953 210
68 3300005347 Ga0070668_100048482 Ga0070668_1000484822 210
69 3300005347 Ga0070668_100054079 Ga0070668_1000540792 210
70 3300005353 Ga0070669_100309468 Ga0070669_1003094682 210
71 3300005364 Ga0070673_100033023 Ga0070673_1000330232 210
72 3300005366 Ga0070659_100173060 Ga0070659_1001730602 210
73 3300005367 Ga0070667_100002487 Ga0070667_10000248712 210
74 3300005436 Ga0070713_100439077 Ga0070713_1004390771 210
75 3300005440 Ga0070705_100232952 Ga0070705_1002329523 210
76 3300005459 Ga0068867_100110721 Ga0068867_1001107212 210
77 3300005459 Ga0068867_100497686 Ga0068867_1004976862 210
78 3300005535 Ga0070684_100098651 Ga0070684_1000986512 210
79 3300005539 Ga0068853_100113245 Ga0068853_1001132453 210
80 3300005539 Ga0068853_100372887 Ga0068853_1003728872 210
81 3300005543 Ga0070672_100223410 Ga0070672_1002234102 210
82 3300005547 Ga0070693_100070672 Ga0070693_1000706722 210
83 3300005563 Ga0068855_100018065 Ga0068855_1000180658 210
84 3300005564 Ga0070664_100012841 Ga0070664_1000128413 210
85 3300005577 Ga0068857_100007461 Ga0068857_1000074614 210
86 3300005577 Ga0068857_100011475 Ga0068857_1000114752 210
87 3300005578 Ga0068854_100036078 Ga0068854_1000360783 210
88 3300005614 Ga0068856_100146436 Ga0068856_1001464362 210
89 3300005616 Ga0068852_100013378 Ga0068852_1000133785 210
90 3300005617 Ga0068859_100003527 Ga0068859_1000035274 210
91 3300005617 Ga0068859_100306737 Ga0068859_1003067372 210
92 3300005617 Ga0068859_100351852 Ga0068859_1003518523 210
93 3300005618 Ga0068864_100004761 Ga0068864_1000047619 210
94 3300005618 Ga0068864_100150503 Ga0068864_1001505032 210
95 3300005718 Ga0068866_10122401 Ga0068866_101224012 210
96 3300005719 Ga0068861_100016661 Ga0068861_1000166612 210
97 3300005719 Ga0068861_100741319 Ga0068861_1007413191 210
98 3300005834 Ga0068851_10064709 Ga0068851_100647092 210
99 3300005840 Ga0068870_10035764 Ga0068870_100357643 210
100 3300005841 Ga0068863_100002512 Ga0068863_1000025124 210
101 3300005841 Ga0068863_100141628 Ga0068863_1001416281 210
102 3300005841 Ga0068863_100154091 Ga0068863_1001540913 210
103 3300005842 Ga0068858_100015036 Ga0068858_1000150366 210
104 3300005843 Ga0068860_100016614 Ga0068860_1000166144 210
105 3300005844 Ga0068862_100136416 Ga0068862_1001364163 210
106 3300006175 Ga0070712_100306568 Ga0070712_1003065682 210
107 3300006852 Ga0075433_10931035 Ga0075433_109310351 210
108 3300006871 Ga0075434_100487130 Ga0075434_1004871302 210
109 3300006931 Ga0097620_100003527 Ga0097620_1000035274 210
110 3300006931 Ga0097620_100306733 Ga0097620_1003067332 210
111 3300006931 Ga0097620_100351852 Ga0097620_1003518523 210
112 3300009093 Ga0105240_10056335 Ga0105240_100563354 210
113 3300009098 Ga0105245_10268159 Ga0105245_102681592 210
114 3300009148 Ga0105243_10574995 Ga0105243_105749952 210
115 3300009177 Ga0105248_10031493 Ga0105248_100314932 210
116 3300009551 Ga0105238_10029388 Ga0105238_100293884 210
117 3300009553 Ga0105249_10104490 Ga0105249_101044902 210
118 3300010375 Ga0105239_11390993 Ga0105239_113909931 210
119 3300011119 Ga0105246_10734930 Ga0105246_107349301 210
120 3300013100 Ga0157373_10028400 Ga0157373_100284002 210
121 3300013104 Ga0157370_10024117 Ga0157370_100241173 210
122 3300013105 Ga0157369_10121671 Ga0157369_101216712 210
123 3300013296 Ga0157374_10477331 Ga0157374_104773312 210
124 3300013297 Ga0157378_10040048 Ga0157378_100400484 210
125 3300013306 Ga0163162_10321889 Ga0163162_103218892 210
126 3300013307 Ga0157372_10021376 Ga0157372_100213765 210
127 3300013308 Ga0157375_10225401 Ga0157375_102254012 210
128 3300013308 Ga0157375_10373696 Ga0157375_103736962 210
129 3300014325 Ga0163163_10202275 Ga0163163_102022752 210
130 3300014326 Ga0157380_10143174 Ga0157380_101431743 210
131 3300014497 Ga0182008_10036255 Ga0182008_100362552 210
132 3300014968 Ga0157379_10002865 Ga0157379_100028654 210
133 3300025907 Ga0207645_10415922 Ga0207645_104159222 210
134 3300025908 Ga0207643_10054603 Ga0207643_100546033 210
135 3300025912 Ga0207707_10165809 Ga0207707_101658093 210
136 3300025913 Ga0207695_10494828 Ga0207695_104948282 210
137 3300025924 Ga0207694_10051007 Ga0207694_100510073 210
138 3300025925 Ga0207650_10012180 Ga0207650_100121802 210
139 3300025925 Ga0207650_10156021 Ga0207650_101560212 210
140 3300025926 Ga0207659_10842822 Ga0207659_108428221 210
141 3300025928 Ga0207700_10382050 Ga0207700_103820502 210
142 3300025932 Ga0207690_10017715 Ga0207690_100177152 210
143 3300025940 Ga0207691_10058642 Ga0207691_100586421 210
144 3300025941 Ga0207711_10140089 Ga0207711_101400892 210
145 3300025942 Ga0207689_10002835 Ga0207689_1000283511 210
146 3300025961 Ga0207712_10122121 Ga0207712_101221212 210
147 3300025972 Ga0207668_10039902 Ga0207668_100399022 210
148 3300025972 Ga0207668_10122389 Ga0207668_101223893 210
149 3300025981 Ga0207640_10037061 Ga0207640_100370613 210
150 3300025981 Ga0207640_10840084 Ga0207640_108400841 210
151 3300026035 Ga0207703_10002330 Ga0207703_100023304 210
152 3300026041 Ga0207639_10396720 Ga0207639_103967202 210
153 3300026078 Ga0207702_10394613 Ga0207702_103946132 210
154 3300026088 Ga0207641_10007624 Ga0207641_100076245 210
155 3300026088 Ga0207641_10138175 Ga0207641_101381752 210
156 3300026089 Ga0207648_10023816 Ga0207648_100238163 210
157 3300026116 Ga0207674_10000489 Ga0207674_1000048912 210
158 3300026116 Ga0207674_10014760 Ga0207674_100147605 210
159 3300026118 Ga0207675_100003215 Ga0207675_1000032154 210
160 3300026118 Ga0207675_100347420 Ga0207675_1003474202 210
161 3300028380 Ga0268265_10036410 Ga0268265_100364104 210
162 3300028381 Ga0268264_10005853 Ga0268264_100058536 210
163 3300028381 Ga0268264_10017488 Ga0268264_100174886 210
164 3300045051 Ga0451576_1590618 Ga0451576_1590618_22_666 210
165 3300048905 Ga0496102_0040716 Ga0496102_0040716_816_1460 210
166 3300048911 Ga0496108_0034446 Ga0496108_0034446_1200_1844 210
167 2162886012 MBSR1b_contig_11443562 MBSR1b_0934.00002680 211
168 2162886012 MBSR1b_contig_12173630 MBSR1b_0507.00007630 211
169 3300005293 Ga0065715_10160419 Ga0065715_101604192 211
170 3300005328 Ga0070676_10245939 Ga0070676_102459391 211
171 3300005347 Ga0070668_100154631 Ga0070668_1001546312 211
172 3300005354 Ga0070675_100012309 Ga0070675_1000123095 211
173 3300005354 Ga0070675_100171402 Ga0070675_1001714022 211
174 3300005356 Ga0070674_100093562 Ga0070674_1000935622 211
175 3300005367 Ga0070667_100123547 Ga0070667_1001235473 211
176 3300005455 Ga0070663_100152888 Ga0070663_1001528882 211
177 3300005455 Ga0070663_100164430 Ga0070663_1001644302 211
178 3300005456 Ga0070678_100122526 Ga0070678_1001225262 211
179 3300005459 Ga0068867_100106659 Ga0068867_1001066593 211
180 3300005543 Ga0070672_100084879 Ga0070672_1000848793 211
181 3300005543 Ga0070672_100248799 Ga0070672_1002487993 211
182 3300005548 Ga0070665_100902553 Ga0070665_1009025531 211
183 3300005564 Ga0070664_100479462 Ga0070664_1004794622 211
184 3300005578 Ga0068854_100184747 Ga0068854_1001847471 211
185 3300005578 Ga0068854_100881687 Ga0068854_1008816871 211
186 3300005616 Ga0068852_100733175 Ga0068852_1007331751 211
187 3300005719 Ga0068861_100387494 Ga0068861_1003874942 211
188 3300005843 Ga0068860_100134343 Ga0068860_1001343431 211
189 3300005937 Ga0081455_10185143 Ga0081455_101851432 211
190 3300006844 Ga0075428_100703330 Ga0075428_1007033302 211
191 3300009148 Ga0105243_10215572 Ga0105243_102155722 211
192 3300009177 Ga0105248_10724907 Ga0105248_107249072 211
193 3300013308 Ga0157375_10298186 Ga0157375_102981863 211
194 3300014325 Ga0163163_10672981 Ga0163163_106729812 211
195 3300017792 Ga0163161_10125701 Ga0163161_101257012 211
196 3300025321 Ga0207656_10058367 Ga0207656_100583672 211
197 3300025907 Ga0207645_10140801 Ga0207645_101408012 211
198 3300025907 Ga0207645_10234887 Ga0207645_102348872 211
199 3300025923 Ga0207681_10139509 Ga0207681_101395092 211
200 3300025933 Ga0207706_10199144 Ga0207706_101991442 211
201 3300025935 Ga0207709_10068250 Ga0207709_100682503 211
202 3300025940 Ga0207691_10029841 Ga0207691_100298415 211
203 3300025940 Ga0207691_10084522 Ga0207691_100845222 211
204 3300025960 Ga0207651_10199118 Ga0207651_101991182 211
205 3300025972 Ga0207668_10067796 Ga0207668_100677962 211
206 3300025981 Ga0207640_10154867 Ga0207640_101548673 211
207 3300025981 Ga0207640_10534182 Ga0207640_105341821 211
208 3300025986 Ga0207658_10268735 Ga0207658_102687353 211
209 3300026041 Ga0207639_10355708 Ga0207639_103557081 211
210 3300026067 Ga0207678_10211814 Ga0207678_102118142 211
211 3300026088 Ga0207641_10235148 Ga0207641_102351482 211
212 3300026089 Ga0207648_10059062 Ga0207648_100590622 211
213 3300026089 Ga0207648_10116985 Ga0207648_101169852 211
214 3300026118 Ga0207675_100234843 Ga0207675_1002348432 211
215 3300026121 Ga0207683_10007176 Ga0207683_100071769 211
216 3300028379 Ga0268266_10564449 Ga0268266_105644491 211
217 3300048915 Ga0496112_0000218 Ga0496112_0000218_1255_1917 212
218 3300005457 Ga0070662_100392978 Ga0070662_1003929782 213
219 3300005719 Ga0068861_100196324 Ga0068861_1001963242 213
220 3300013104 Ga0157370_10035604 Ga0157370_100356045 213
221 3300025923 Ga0207681_10233693 Ga0207681_102336932 213
222 3300025933 Ga0207706_10184354 Ga0207706_101843542 213
223 3300026118 Ga0207675_100244660 Ga0207675_1002446602 213
224 3300005937 Ga0081455_10256787 Ga0081455_102567872 218
225 iso_pu_bacteria 2515154112 2515627145 218
226 iso_pu_bacteria 2874590934 2874598281 218
227 iso_pu_bacteria 2874645413 2874652663 218
228 iso_pu_bacteria 2876771140 2876778241 218
229 iso_pu_bacteria 2876818435 2876825890 218
230 iso_pu_bacteria 2879074833 2879082035 218
231 iso_pu_bacteria 2879127579 2879135157 218
232 iso_pu_bacteria 2879142872 2879145484 218
233 iso_pu_bacteria 2935975950 2935978639 218
234 iso_pu_bacteria 8019619141 8019628436 218
235 iso_pu_bacteria 8019638758 8019645530 218
236 iso_pu_bacteria 8019668869 8019671598 218
237 iso_pu_bacteria 8019678201 8019684503 218
238 3300025961 Ga0207712_10019146 Ga0207712_100191463 219
239 3300005841 Ga0068863_100747614 Ga0068863_1007476142 220
240 3300014326 Ga0157380_10035710 Ga0157380_100357102 220
241 3300049577 Ga0501041_0120074 Ga0501041_0120074_527_1237 220
242 3300049591 Ga0501075_0038557 Ga0501075_0038557_1576_2286 220
243 3300049592 Ga0501076_0011550 Ga0501076_0011550_4412_5122 220
244 3300049593 Ga0501077_0050144 Ga0501077_0050144_1564_2274 220
245 3300049741 Ga0501079_0019790 Ga0501079_0019790_3654_4364 220
246 3300049744 Ga0501083_0127008 Ga0501083_0127008_558_1268 220
247 3300050511 nmdc:mga08y16_527942_c1 nmdc:mga08y16_527942_c1_302_1000 220
248 3300054114 Ga0501084_0020558 Ga0501084_0020558_376_1086 220
249 3300005937 Ga0081455_10107769 Ga0081455_101077692 221
250 3300005981 Ga0081538_10088860 Ga0081538_100888602 221
251 3300006038 Ga0075365_10383542 Ga0075365_103835422 221
252 3300006846 Ga0075430_100037645 Ga0075430_1000376452 221
253 3300006847 Ga0075431_100077710 Ga0075431_1000777103 221
254 3300009094 Ga0111539_10482233 Ga0111539_104822332 221
255 3300050492 nmdc:mga0yw44_34263_c1 nmdc:mga0yw44_34263_c1_805_1506 221
256 3300050510 nmdc:mga06r32_187410_c1 nmdc:mga06r32_187410_c1_582_1283 221
257 iso_pu_bacteria 2513237141 2513890243 221
258 iso_pu_bacteria 2885374607 2885382753 221
259 iso_pu_bacteria 2906610324 2906617277 221
260 iso_pu_bacteria 2908739725 2908742432 221
261 iso_pu_bacteria 2922425934 2922430550 221
262 iso_pu_bacteria 8006933436 8006940422 221
263 iso_pu_bacteria 8006973647 8006980110 221
264 iso_pu_bacteria 8019555841 8019556304 221
265 iso_pu_bacteria 8019565922 8019569011 221
266 3300005327 Ga0070658_10194684 Ga0070658_101946842 222
267 3300005344 Ga0070661_100357733 Ga0070661_1003577332 222
268 3300005455 Ga0070663_100324666 Ga0070663_1003246662 222
269 3300005614 Ga0068856_100242967 Ga0068856_1002429672 222
270 3300005616 Ga0068852_100184449 Ga0068852_1001844492 222
271 3300025909 Ga0207705_10056618 Ga0207705_100566182 222
272 3300025919 Ga0207657_10106780 Ga0207657_101067802 222
273 3300025931 Ga0207644_10565787 Ga0207644_105657872 222
274 3300026078 Ga0207702_10570530 Ga0207702_105705302 222
275 3300026142 Ga0207698_10138517 Ga0207698_101385172 222
276 3300031241 Ga0265325_10030711 Ga0265325_100307113 222
277 3300031344 Ga0265316_10087120 Ga0265316_100871202 222
278 3300035083 Ga0373926_0069346 Ga0373926_0069346_150_839 222
279 3300035113 Ga0373936_0018528 Ga0373936_0018528_40_729 222
280 3300035117 Ga0373953_0002178 Ga0373953_0002178_4015_4704 222
281 3300035118 Ga0373954_0008989 Ga0373954_0008989_2721_3410 222
282 3300035119 Ga0373956_0046623 Ga0373956_0046623_748_1437 222
283 3300035120 Ga0373957_0045277 Ga0373957_0045277_363_1052 222
284 3300035170 Ga0373943_0005981 Ga0373943_0005981_2411_3100 222
285 3300035171 Ga0373946_0010792 Ga0373946_0010792_1645_2334 222
286 3300035172 Ga0373955_0007820 Ga0373955_0007820_2684_3373 222
287 3300035410 Ga0373924_0002359 Ga0373924_0002359_4931_5620 222
288 3300035692 Ga0373935_0001180 Ga0373935_0001180_8579_9268 222
289 3300035695 Ga0373927_0033690 Ga0373927_0033690_886_1575 222
290 3300035724 Ga0373933_0000787 Ga0373933_0000787_566_1255 222
291 3300035725 Ga0373947_0022984 Ga0373947_0022984_1606_2295 222
292 3300036401 Ga0373937_0007938 Ga0373937_0007938_1876_2565 222
293 3300037068 Ga0373925_0000353 Ga0373925_0000353_22602_23291 222
294 3300041452 Ga0451793_0046002 Ga0451793_0046002_524_1210 222
295 3300041509 Ga0451843_0321225 Ga0451843_0321225_40_720 222
296 3300046454 Ga0495592_0000284 Ga0495592_0000284_19912_20601 222
297 3300046462 Ga0495651_0001055 Ga0495651_0001055_18239_18928 222
298 3300046463 Ga0495653_0000330 Ga0495653_0000330_12176_12865 222
299 3300046476 Ga0495662_0003004 Ga0495662_0003004_3262_3951 222
300 3300046477 Ga0495664_0000098 Ga0495664_0000098_15341_16030 222
301 3300046511 Ga0495608_0000318 Ga0495608_0000318_15268_15957 222
302 3300046514 Ga0495618_0000235 Ga0495618_0000235_24471_25160 222
303 3300046516 Ga0495628_0001752 Ga0495628_0001752_12139_12828 222
304 3300046517 Ga0495630_0002403 Ga0495630_0002403_220_909 222
305 3300046529 Ga0495652_0000305 Ga0495652_0000305_35136_35825 222
306 3300046531 Ga0495665_0083069 Ga0495665_0083069_611_1300 222
307 3300046533 Ga0495640_0000388 Ga0495640_0000388_7964_8653 222
308 3300046536 Ga0495587_0000249 Ga0495587_0000249_23382_24071 222
309 3300046559 Ga0495667_0000195 Ga0495667_0000195_28151_28840 222
310 3300046642 Ga0495634_0003325 Ga0495634_0003325_10981_11670 222
311 3300046663 Ga0495635_0000185 Ga0495635_0000185_23277_23966 222
312 3300046665 Ga0495661_0280131 Ga0495661_0280131_95_775 222
313 3300046675 Ga0495657_0001331 Ga0495657_0001331_15188_15877 222
314 3300046678 Ga0495599_0000168 Ga0495599_0000168_15205_15894 222
315 3300046679 Ga0495623_0000586 Ga0495623_0000586_247_936 222
316 3300046680 Ga0495646_0000269 Ga0495646_0000269_1712_2401 222
317 3300046809 Ga0495600_0000210 Ga0495600_0000210_12184_12873 222
318 3300047315 Ga0495581_0041352 Ga0495581_0041352_1346_2035 222
319 3300047317 Ga0495604_0000003 Ga0495604_0000003_440420_441109 222
320 3300047319 Ga0495674_0000006 Ga0495674_0000006_26627_27316 222
321 3300047322 Ga0495680_0001799 Ga0495680_0001799_6769_7458 222
322 3300047444 Ga0495675_0000336 Ga0495675_0000336_17090_17779 222
323 3300047471 Ga0495684_0000287 Ga0495684_0000287_12162_12851 222
324 3300047673 Ga0495593_0146138 Ga0495593_0146138_431_1120 222
325 3300048088 Ga0495602_0000805 Ga0495602_0000805_9259_9948 222
326 3300048911 Ga0496108_0457925 Ga0496108_0457925_334_1020 222
327 3300053077 Ga0495601_0000004 Ga0495601_0000004_7740_8429 222
328 3300053078 Ga0495612_0000008 Ga0495612_0000008_204833_205522 222
329 3300053084 Ga0495595_0000299 Ga0495595_0000299_2179_2868 222
330 3300053085 Ga0495619_0000410 Ga0495619_0000410_26608_27297 222
331 3300053093 Ga0500651_0097142 Ga0500651_0097142_1072_1758 222
332 3300053109 Ga0500569_008206 Ga0500569_008206_58_744 222
333 3300053134 Ga0500658_0191389 Ga0500658_0191389_233_919 222
334 3300053153 Ga0500616_0055865 Ga0500616_0055865_552_1235 222
335 iso_pu_bacteria 2513237096 2513657908 222
336 iso_pu_bacteria 2513237137 2513855604 222
337 iso_pu_bacteria 2513237145 2513919999 222
338 iso_pu_bacteria 2517572143 2517892149 222
339 iso_pu_bacteria 2524023210 2524465746 222
340 iso_pu_bacteria 2524023228 2524534250 222
341 iso_pu_bacteria 2528768022 2528853891 222
342 iso_pu_bacteria 2602042107 2603859677 222
343 iso_pu_bacteria 2643221651 2644288849 222
344 iso_pu_bacteria 2791355196 2793062744 222
345 iso_pu_bacteria 2802429603 2805915107 222
346 iso_pu_bacteria 2824600985 2824604119 222
347 iso_pu_bacteria 2824609381 2824610388 222
348 iso_pu_bacteria 2824653114 2824659417 222
349 iso_pu_bacteria 2824661429 2824668831 222
350 iso_pu_bacteria 2824696289 2824703873 222
351 iso_pu_bacteria 2824732956 2824733312 222
352 iso_pu_bacteria 2842038055 2842040035 222
353 iso_pu_bacteria 2842045827 2842047020 222
354 iso_pu_bacteria 2847939898 2847946795 222
355 iso_pu_bacteria 2857524615 2857528924 222
356 iso_pu_bacteria 2874620515 2874627570 222
357 iso_pu_bacteria 2879099564 2879104879 222
358 iso_pu_bacteria 2885383462 2885386791 222
359 iso_pu_bacteria 2888419890 2888424763 222
360 iso_pu_bacteria 2893066018 2893070381 222
361 iso_pu_bacteria 2903768456 2903771796 222
362 iso_pu_bacteria 2904666416 2904673110 222
363 iso_pu_bacteria 2904699407 2904702293 222
364 iso_pu_bacteria 2906635258 2906643332 222
365 iso_pu_bacteria 2906660503 2906662538 222
366 iso_pu_bacteria 2919073203 2919076324 222
367 iso_pu_bacteria 2922368715 2922374675 222
368 iso_pu_bacteria 2929615660 2929621765 222
369 iso_pu_bacteria 2929624759 2929629928 222
370 iso_pu_bacteria 2932784394 2932788617 222
371 iso_pu_bacteria 2932809354 2932817200 222
372 iso_pu_bacteria 2932818245 2932825211 222
373 iso_pu_bacteria 2932828146 2932830265 222
374 iso_pu_bacteria 2933577622 2933583959 222
375 iso_pu_bacteria 2935616580 2935622509 222
376 iso_pu_bacteria 2935638405 2935642114 222
377 iso_pu_bacteria 2935665750 2935672502 222
378 iso_pu_bacteria 2935675223 2935676033 222
379 iso_pu_bacteria 2935684952 2935686025 222
380 iso_pu_bacteria 2935694250 2935697731 222
381 iso_pu_bacteria 2935703347 2935705865 222
382 iso_pu_bacteria 2935713505 2935714577 222
383 iso_pu_bacteria 2935722832 2935725196 222
384 iso_pu_bacteria 2935732158 2935732444 222
385 iso_pu_bacteria 2935741537 2935741823 222
386 iso_pu_bacteria 2935750917 2935751990 222
387 iso_pu_bacteria 2935760218 2935765247 222
388 iso_pu_bacteria 2935801545 2935802862 222
389 iso_pu_bacteria 2935810662 2935813306 222
390 iso_pu_bacteria 2935827899 2935830281 222
391 iso_pu_bacteria 2935837841 2935838178 222
392 iso_pu_bacteria 2935855204 2935860758 222
393 iso_pu_bacteria 2935864058 2935872269 222
394 iso_pu_bacteria 2935873716 2935878676 222
395 iso_pu_bacteria 2935992306 2935994928 222
396 iso_pu_bacteria 2936002035 2936003571 222
397 iso_pu_bacteria 2936037263 2936042255 222
398 iso_pu_bacteria 2940556831 2940557207 222
399 iso_pu_bacteria 2941538514 2941539155 222
400 iso_pu_bacteria 3005506211 3005510550 222
401 iso_pu_bacteria 3005710791 3005715132 222
402 iso_pu_bacteria 8016511872 8016522043 222
403 iso_pu_bacteria 8017057580 8017063625 222
404 iso_pu_bacteria 8019576017 8019582951 222
405 iso_pu_bacteria 8019586578 8019590750 222
406 iso_pu_bacteria 8019597564 8019600603 222
407 iso_pu_bacteria 8019608314 8019617943 222
408 iso_pu_bacteria 8055742211 8055746069 222
409 iso_pu_bacteria 8056681323 8056687374 222
410 iso_pu_bacteria 8056689827 8056691283 222
411 3300002077 JGI24744J21845_10042665 JGI24744J21845_100426651 223
412 3300005328 Ga0070676_10124974 Ga0070676_101249742 223
413 3300005331 Ga0070670_100153040 Ga0070670_1001530402 223
414 3300005333 Ga0070677_10060360 Ga0070677_100603602 223
415 3300005340 Ga0070689_100055865 Ga0070689_1000558652 223
416 3300005353 Ga0070669_100086727 Ga0070669_1000867272 223
417 3300005355 Ga0070671_100256534 Ga0070671_1002565342 223
418 3300005365 Ga0070688_100042310 Ga0070688_1000423102 223
419 3300005456 Ga0070678_100089137 Ga0070678_1000891372 223
420 3300005457 Ga0070662_100303939 Ga0070662_1003039392 223
421 3300005458 Ga0070681_10042518 Ga0070681_100425183 223
422 3300005458 Ga0070681_10520516 Ga0070681_105205162 223
423 3300005459 Ga0068867_100184555 Ga0068867_1001845552 223
424 3300005466 Ga0070685_10058405 Ga0070685_100584052 223
425 3300005530 Ga0070679_100691351 Ga0070679_1006913511 223
426 3300005543 Ga0070672_100018833 Ga0070672_1000188333 223
427 3300005842 Ga0068858_100314077 Ga0068858_1003140772 223
428 3300006028 Ga0070717_10339744 Ga0070717_103397442 223
429 3300006358 Ga0068871_100219261 Ga0068871_1002192611 223
430 3300006871 Ga0075434_100443215 Ga0075434_1004432151 223
431 3300006881 Ga0068865_100079979 Ga0068865_1000799791 223
432 3300006931 Ga0097620_100369142 Ga0097620_1003691422 223
433 3300007076 Ga0075435_100592884 Ga0075435_1005928842 223
434 3300007788 Ga0099795_10001696 Ga0099795_100016963 223
435 3300009093 Ga0105240_10477877 Ga0105240_104778772 223
436 3300009101 Ga0105247_10270735 Ga0105247_102707352 223
437 3300010159 Ga0099796_10098601 Ga0099796_100986011 223
438 3300013297 Ga0157378_10223517 Ga0157378_102235171 223
439 3300014326 Ga0157380_10136705 Ga0157380_101367052 223
440 3300025912 Ga0207707_10031128 Ga0207707_100311283 223
441 3300025929 Ga0207664_10381822 Ga0207664_103818222 223
442 3300025939 Ga0207665_10045722 Ga0207665_100457222 223
443 3300028379 Ga0268266_10830937 Ga0268266_108309372 223
444 3300031665 Ga0316575_10025725 Ga0316575_100257252 223
445 3300031691 Ga0316579_10037283 Ga0316579_100372832 223
446 3300031727 Ga0316576_10033029 Ga0316576_100330294 223
447 3300031728 Ga0316578_10016515 Ga0316578_100165155 223
448 3300035172 Ga0373955_0237654 Ga0373955_0237654_346_1059 223
449 3300045049 Ga0466959_0098879 Ga0466959_0098879_241_939 223
450 3300048915 Ga0496112_0037102 Ga0496112_0037102_234_947 223
451 3300048916 Ga0496113_0612111 Ga0496113_0612111_44_757 223
452 3300049568 Ga0501031_0104072 Ga0501031_0104072_299_985 223
453 3300049569 Ga0501032_0010877 Ga0501032_0010877_1625_2311 223
454 3300049570 Ga0501033_0008341 Ga0501033_0008341_5431_6117 223
455 3300049571 Ga0501034_0107244 Ga0501034_0107244_1907_2593 223
456 3300049572 Ga0501036_0020595 Ga0501036_0020595_3811_4497 223
457 3300049573 Ga0501037_0039773 Ga0501037_0039773_868_1554 223
458 3300049574 Ga0501038_0041649 Ga0501038_0041649_2698_3384 223
459 3300049575 Ga0501039_0050475 Ga0501039_0050475_171_857 223
460 3300049576 Ga0501040_0015506 Ga0501040_0015506_3141_3827 223
461 3300049578 Ga0501042_0001932 Ga0501042_0001932_9617_10303 223
462 3300049579 Ga0501043_0170027 Ga0501043_0170027_816_1502 223
463 3300049580 Ga0501046_0155285 Ga0501046_0155285_171_857 223
464 3300049581 Ga0501047_0027991 Ga0501047_0027991_4575_5261 223
465 3300049582 Ga0501048_0012509 Ga0501048_0012509_4587_5273 223
466 3300049583 Ga0501067_0006729 Ga0501067_0006729_4388_5074 223
467 3300049584 Ga0501068_0018698 Ga0501068_0018698_260_946 223
468 3300049585 Ga0501069_0053275 Ga0501069_0053275_1542_2228 223
469 3300049586 Ga0501070_0009392 Ga0501070_0009392_2674_3360 223
470 3300049587 Ga0501071_0028989 Ga0501071_0028989_1153_1839 223
471 3300049588 Ga0501072_0019143 Ga0501072_0019143_1590_2276 223
472 3300049589 Ga0501073_0020114 Ga0501073_0020114_1766_2452 223
473 3300049590 Ga0501074_0008617 Ga0501074_0008617_5628_6314 223
474 3300049591 Ga0501075_0369424 Ga0501075_0369424_175_861 223
475 3300049592 Ga0501076_0037661 Ga0501076_0037661_1623_2309 223
476 3300049741 Ga0501079_0011689 Ga0501079_0011689_2576_3262 223
477 3300049742 Ga0501080_0164236 Ga0501080_0164236_1043_1729 223
478 3300049744 Ga0501083_0018512 Ga0501083_0018512_320_1006 223
479 3300049822 Ga0501035_0019488 Ga0501035_0019488_2456_3142 223
480 3300049823 Ga0501044_0096443 Ga0501044_0096443_1459_2145 223
481 3300049824 Ga0501045_0003158 Ga0501045_0003158_7232_7918 223
482 3300050512 nmdc:mga0n895_371837_c1 nmdc:mga0n895_371837_c1_675_1376 223
483 3300053139 Ga0500568_0014177 Ga0500568_0014177_790_1560 223
484 3300054114 Ga0501084_0220459 Ga0501084_0220459_851_1537 223
485 3300060353 Ga0501082_0028947 Ga0501082_0028947_3891_4577 223
486 3300005455 Ga0070663_100213032 Ga0070663_1002130322 224
487 3300005563 Ga0068855_100150475 Ga0068855_1001504752 224
488 3300006048 Ga0075363_100036824 Ga0075363_1000368242 224
489 3300006051 Ga0075364_10003703 Ga0075364_100037035 224
490 3300006173 Ga0070716_100288551 Ga0070716_1002885511 224
491 3300006177 Ga0075362_10000936 Ga0075362_100009362 224
492 3300006178 Ga0075367_10321027 Ga0075367_103210272 224
493 3300006195 Ga0075366_10018977 Ga0075366_100189772 224
494 3300006353 Ga0075370_10053825 Ga0075370_100538252 224
495 3300006871 Ga0075434_100008412 Ga0075434_1000084122 224
496 3300007076 Ga0075435_100106719 Ga0075435_1001067192 224
497 3300013105 Ga0157369_10133599 Ga0157369_101335992 224
498 3300013307 Ga0157372_10140535 Ga0157372_101405352 224
499 3300025949 Ga0207667_10218581 Ga0207667_102185811 224
500 3300026067 Ga0207678_10041697 Ga0207678_100416973 224
501 3300028380 Ga0268265_10472323 Ga0268265_104723232 224
502 3300031238 Ga0265332_10001409 Ga0265332_100014097 224
503 3300031241 Ga0265325_10165341 Ga0265325_101653412 224
504 3300031242 Ga0265329_10071967 Ga0265329_100719672 224
505 3300031247 Ga0265340_10005726 Ga0265340_100057263 224
506 3300031249 Ga0265339_10003832 Ga0265339_100038323 224
507 3300031712 Ga0265342_10002171 Ga0265342_100021715 224
508 3300046459 Ga0495629_0418101 Ga0495629_0418101_69_785 224
509 3300046511 Ga0495608_0113918 Ga0495608_0113918_1004_1720 224
510 3300048912 Ga0496109_0537074 Ga0496109_0537074_182_862 224
511 3300048917 Ga0496114_0210520 Ga0496114_0210520_769_1506 224
512 3300048924 Ga0496121_0060123 Ga0496121_0060123_2369_3070 224
513 3300049568 Ga0501031_0002252 Ga0501031_0002252_4155_4841 224
514 3300049569 Ga0501032_0001822 Ga0501032_0001822_13906_14592 224
515 3300049570 Ga0501033_0000108 Ga0501033_0000108_70067_70753 224
516 3300049571 Ga0501034_0002449 Ga0501034_0002449_14102_14788 224
517 3300049571 Ga0501034_0041720 Ga0501034_0041720_3498_4193 224
518 3300049571 Ga0501034_0251907 Ga0501034_0251907_259_957 224
519 3300049572 Ga0501036_0000149 Ga0501036_0000149_14535_15221 224
520 3300049573 Ga0501037_0000153 Ga0501037_0000153_51297_51983 224
521 3300049574 Ga0501038_0000138 Ga0501038_0000138_12491_13177 224
522 3300049575 Ga0501039_0000842 Ga0501039_0000842_8310_8996 224
523 3300049578 Ga0501042_0088976 Ga0501042_0088976_26_712 224
524 3300049579 Ga0501043_0000085 Ga0501043_0000085_8516_9202 224
525 3300049579 Ga0501043_0081607 Ga0501043_0081607_999_1697 224
526 3300049580 Ga0501046_0000267 Ga0501046_0000267_9535_10221 224
527 3300049581 Ga0501047_0001785 Ga0501047_0001785_2786_3472 224
528 3300049582 Ga0501048_0000396 Ga0501048_0000396_12491_13177 224
529 3300049583 Ga0501067_0000104 Ga0501067_0000104_38998_39684 224
530 3300049584 Ga0501068_0002865 Ga0501068_0002865_8378_9064 224
531 3300049585 Ga0501069_0019419 Ga0501069_0019419_84_770 224
532 3300049586 Ga0501070_0008793 Ga0501070_0008793_3852_4538 224
533 3300049588 Ga0501072_0032885 Ga0501072_0032885_3232_3918 224
534 3300049589 Ga0501073_0000221 Ga0501073_0000221_15879_16565 224
535 3300049589 Ga0501073_0066091 Ga0501073_0066091_431_1141 224
536 3300049590 Ga0501074_0001821 Ga0501074_0001821_8432_9118 224
537 3300049592 Ga0501076_0617934 Ga0501076_0617934_94_780 224
538 3300049741 Ga0501079_0007983 Ga0501079_0007983_3901_4587 224
539 3300049742 Ga0501080_0013906 Ga0501080_0013906_2871_3557 224
540 3300049742 Ga0501080_0053279 Ga0501080_0053279_2430_3143 224
541 3300049742 Ga0501080_0139921 Ga0501080_0139921_799_1491 224
542 3300049744 Ga0501083_0000087 Ga0501083_0000087_1897_2583 224
543 3300049822 Ga0501035_0000223 Ga0501035_0000223_2446_3132 224
544 3300049823 Ga0501044_0000369 Ga0501044_0000369_13960_14646 224
545 3300049824 Ga0501045_0185869 Ga0501045_0185869_97_783 224
546 3300050490 nmdc:mga03n38_5599_c1 nmdc:mga03n38_5599_c1_979_1659 224
547 3300050491 nmdc:mga00v17_14094_c1 nmdc:mga00v17_14094_c1_3604_4284 224
548 3300050493 nmdc:mga0k408_238953_c1 nmdc:mga0k408_238953_c1_98_778 224
549 3300050512 nmdc:mga0n895_107862_c1 nmdc:mga0n895_107862_c1_983_1678 224
550 3300050513 nmdc:mga0rr50_23433_c1 nmdc:mga0rr50_23433_c1_510_1214 224
551 3300053151 Ga0500604_0048977 Ga0500604_0048977_334_1017 224
552 3300053158 Ga0500627_0219046 Ga0500627_0219046_30_713 224
553 3300054114 Ga0501084_0005685 Ga0501084_0005685_7055_7741 224
554 3300060353 Ga0501082_0000799 Ga0501082_0000799_23043_23729 224
555 3300003659 JGI25404J52841_10010459 JGI25404J52841_100104592 225
556 3300005338 Ga0068868_100590422 Ga0068868_1005904221 225
557 3300005365 Ga0070688_100345454 Ga0070688_1003454542 225
558 3300005439 Ga0070711_100745116 Ga0070711_1007451161 225
559 3300005455 Ga0070663_100569587 Ga0070663_1005695872 225
560 3300005842 Ga0068858_100071113 Ga0068858_1000711132 225
561 3300005937 Ga0081455_10011418 Ga0081455_100114187 225
562 3300005983 Ga0081540_1002868 Ga0081540_10028685 225
563 3300005983 Ga0081540_1004409 Ga0081540_10044093 225
564 3300005983 Ga0081540_1011513 Ga0081540_10115133 225
565 3300005983 Ga0081540_1011628 Ga0081540_10116283 225
566 3300005983 Ga0081540_1079725 Ga0081540_10797252 225
567 3300005985 Ga0081539_10002339 Ga0081539_100023396 225
568 3300005985 Ga0081539_10216929 Ga0081539_102169292 225
569 3300006847 Ga0075431_100000053 Ga0075431_10000005311 225
570 3300006880 Ga0075429_100004405 Ga0075429_1000044052 225
571 3300009094 Ga0111539_10001519 Ga0111539_1000151914 225
572 3300009101 Ga0105247_10448956 Ga0105247_104489561 225
573 3300009147 Ga0114129_10000237 Ga0114129_1000023746 225
574 3300009177 Ga0105248_10966468 Ga0105248_109664682 225
575 3300009553 Ga0105249_10572356 Ga0105249_105723561 225
576 3300013296 Ga0157374_11113050 Ga0157374_111130501 225
577 3300013306 Ga0163162_10207523 Ga0163162_102075232 225
578 3300014325 Ga0163163_10629086 Ga0163163_106290862 225
579 3300021441 Ga0213871_10067354 Ga0213871_100673542 225
580 3300025900 Ga0207710_10209946 Ga0207710_102099462 225
581 3300025916 Ga0207663_10552055 Ga0207663_105520551 225
582 3300025926 Ga0207659_10267604 Ga0207659_102676042 225
583 3300025986 Ga0207658_10305149 Ga0207658_103051491 225
584 3300026035 Ga0207703_10156350 Ga0207703_101563502 225
585 3300026067 Ga0207678_10118932 Ga0207678_101189323 225
586 3300027907 Ga0207428_10039542 Ga0207428_100395422 225
587 3300031548 Ga0307408_100318538 Ga0307408_1003185382 225
588 3300035691 Ga0373931_0148530 Ga0373931_0148530_211_897 225
589 3300035691 Ga0373931_0171129 Ga0373931_0171129_498_1181 225
590 3300039438 Ga0436360_0136997 Ga0436360_0136997_312_1025 225
591 3300039438 Ga0436360_0173425 Ga0436360_0173425_4204_4899 225
592 3300039447 Ga0436361_0265785 Ga0436361_0265785_35_730 225
593 3300039447 Ga0436361_0314733 Ga0436361_0314733_31_714 225
594 3300039447 Ga0436361_0632415 Ga0436361_0632415_2497_3192 225
595 3300046475 Ga0495639_0046055 Ga0495639_0046055_818_1501 225
596 3300046660 Ga0495625_0446987 Ga0495625_0446987_79_759 225
597 3300047320 Ga0495672_0028302 Ga0495672_0028302_1808_2494 225
598 3300047320 Ga0495672_0125201 Ga0495672_0125201_422_1108 225
599 3300048910 Ga0496107_0209770 Ga0496107_0209770_192_878 225
600 3300048911 Ga0496108_0002253 Ga0496108_0002253_13171_13857 225
601 3300048913 Ga0496110_0016915 Ga0496110_0016915_1438_2124 225
602 3300048914 Ga0496111_0175646 Ga0496111_0175646_620_1306 225
603 3300048915 Ga0496112_0016917 Ga0496112_0016917_1403_2089 225
604 3300048916 Ga0496113_0275455 Ga0496113_0275455_193_879 225
605 3300048917 Ga0496114_0308589 Ga0496114_0308589_687_1373 225
606 3300048922 Ga0496119_0002647 Ga0496119_0002647_18642_19355 225
607 3300048928 Ga0496125_0007066 Ga0496125_0007066_8056_8760 225
608 3300048929 Ga0496126_0031475 Ga0496126_0031475_3374_4078 225
609 3300048929 Ga0496126_0273764 Ga0496126_0273764_477_1163 225
610 3300049586 Ga0501070_0334147 Ga0501070_0334147_185_868 225
611 3300049588 Ga0501072_0316549 Ga0501072_0316549_208_897 225
612 3300049823 Ga0501044_0123956 Ga0501044_0123956_1535_2215 225
613 3300050507 nmdc:mga05p37_555_c1 nmdc:mga05p37_555_c1_25615_26319 225
614 3300050508 nmdc:mga09592_24376_c1 nmdc:mga09592_24376_c1_1132_1836 225
615 3300050509 nmdc:mga0qj67_382736_c1 nmdc:mga0qj67_382736_c1_215_919 225
616 3300050510 nmdc:mga06r32_76341_c1 nmdc:mga06r32_76341_c1_1487_2191 225
617 3300050511 nmdc:mga08y16_134_c1 nmdc:mga08y16_134_c1_10749_11453 225
618 3300050512 nmdc:mga0n895_168242_c1 nmdc:mga0n895_168242_c1_370_1053 225
619 3300053131 Ga0500652_061353 Ga0500652_061353_72_785 225
620 3300053153 Ga0500616_0000696 Ga0500616_0000696_13228_13923 225
621 2010549000 RicEn_C9014 RicEn_157820 226
622 3300000532 CNAas_1004010 CNAas_10040102 226
623 3300001979 JGI24740J21852_10015785 JGI24740J21852_100157852 226
624 3300001989 JGI24739J22299_10029215 JGI24739J22299_100292151 226
625 3300001990 JGI24737J22298_10006476 JGI24737J22298_100064761 226
626 3300002067 JGI24735J21928_10007461 JGI24735J21928_100074612 226
627 3300003203 JGI25406J46586_10000047 JGI25406J46586_100000479 226
628 3300003215 JGI25153J46596_10001251 JGI25153J46596_100012511 226
629 3300003215 JGI25153J46596_10002613 JGI25153J46596_100026131 226
630 3300003215 JGI25153J46596_10002759 JGI25153J46596_100027592 226
631 3300003215 JGI25153J46596_10005940 JGI25153J46596_100059403 226
632 3300003354 JGI25160J50197_1002757 JGI25160J50197_10027573 226
633 3300003354 JGI25160J50197_1032891 JGI25160J50197_10328912 226
634 3300003659 JGI25404J52841_10019235 JGI25404J52841_100192352 226
635 3300003659 JGI25404J52841_10030344 JGI25404J52841_100303441 226
636 3300003794 Ga0055531_10022839 Ga0055531_100228392 226
637 3300005262 Ga0065165_1000231 Ga0065165_100023151 226
638 3300005262 Ga0065165_1001895 Ga0065165_100189520 226
639 3300005290 Ga0065712_10231883 Ga0065712_102318831 226
640 3300005327 Ga0070658_10165438 Ga0070658_101654381 226
641 3300005327 Ga0070658_10207247 Ga0070658_102072472 226
642 3300005327 Ga0070658_10344647 Ga0070658_103446472 226
643 3300005327 Ga0070658_10637307 Ga0070658_106373071 226
644 3300005328 Ga0070676_10114075 Ga0070676_101140752 226
645 3300005328 Ga0070676_10169066 Ga0070676_101690661 226
646 3300005329 Ga0070683_100015898 Ga0070683_1000158983 226
647 3300005329 Ga0070683_100087298 Ga0070683_1000872982 226
648 3300005331 Ga0070670_100113796 Ga0070670_1001137962 226
649 3300005331 Ga0070670_100127870 Ga0070670_1001278703 226
650 3300005333 Ga0070677_10086571 Ga0070677_100865712 226
651 3300005334 Ga0068869_100055456 Ga0068869_1000554562 226
652 3300005334 Ga0068869_100119055 Ga0068869_1001190552 226
653 3300005336 Ga0070680_100055713 Ga0070680_1000557132 226
654 3300005336 Ga0070680_100125785 Ga0070680_1001257851 226
655 3300005336 Ga0070680_100169644 Ga0070680_1001696441 226
656 3300005336 Ga0070680_100477499 Ga0070680_1004774991 226
657 3300005338 Ga0068868_100025524 Ga0068868_1000255243 226
658 3300005338 Ga0068868_100109714 Ga0068868_1001097142 226
659 3300005338 Ga0068868_100254272 Ga0068868_1002542722 226
660 3300005343 Ga0070687_100262463 Ga0070687_1002624631 226
661 3300005344 Ga0070661_100521967 Ga0070661_1005219671 226
662 3300005347 Ga0070668_100051684 Ga0070668_1000516843 226
663 3300005347 Ga0070668_100066405 Ga0070668_1000664052 226
664 3300005347 Ga0070668_100086847 Ga0070668_1000868471 226
665 3300005347 Ga0070668_100138652 Ga0070668_1001386522 226
666 3300005347 Ga0070668_100194541 Ga0070668_1001945411 226
667 3300005353 Ga0070669_100305981 Ga0070669_1003059811 226
668 3300005353 Ga0070669_100727184 Ga0070669_1007271841 226
669 3300005354 Ga0070675_100394506 Ga0070675_1003945062 226
670 3300005354 Ga0070675_100616539 Ga0070675_1006165391 226
671 3300005356 Ga0070674_100058334 Ga0070674_1000583342 226
672 3300005356 Ga0070674_100066308 Ga0070674_1000663081 226
673 3300005365 Ga0070688_100089017 Ga0070688_1000890173 226
674 3300005365 Ga0070688_100347563 Ga0070688_1003475632 226
675 3300005366 Ga0070659_100053564 Ga0070659_1000535642 226
676 3300005366 Ga0070659_100086855 Ga0070659_1000868553 226
677 3300005366 Ga0070659_100248514 Ga0070659_1002485142 226
678 3300005367 Ga0070667_100066866 Ga0070667_1000668663 226
679 3300005434 Ga0070709_10022117 Ga0070709_100221173 226
680 3300005434 Ga0070709_10073503 Ga0070709_100735033 226
681 3300005435 Ga0070714_100094761 Ga0070714_1000947612 226
682 3300005435 Ga0070714_100119588 Ga0070714_1001195882 226
683 3300005435 Ga0070714_100134340 Ga0070714_1001343402 226
684 3300005435 Ga0070714_100269266 Ga0070714_1002692662 226
685 3300005436 Ga0070713_100012226 Ga0070713_1000122262 226
686 3300005436 Ga0070713_100017595 Ga0070713_1000175954 226
687 3300005436 Ga0070713_100031275 Ga0070713_1000312752 226
688 3300005436 Ga0070713_100056841 Ga0070713_1000568413 226
689 3300005436 Ga0070713_100322617 Ga0070713_1003226171 226
690 3300005436 Ga0070713_100438726 Ga0070713_1004387262 226
691 3300005437 Ga0070710_10001119 Ga0070710_100011198 226
692 3300005437 Ga0070710_10008886 Ga0070710_100088863 226
693 3300005439 Ga0070711_100002712 Ga0070711_1000027128 226
694 3300005439 Ga0070711_100009524 Ga0070711_1000095247 226
695 3300005439 Ga0070711_100010921 Ga0070711_1000109211 226
696 3300005439 Ga0070711_100011141 Ga0070711_1000111413 226
697 3300005439 Ga0070711_100855811 Ga0070711_1008558111 226
698 3300005455 Ga0070663_100015227 Ga0070663_1000152272 226
699 3300005455 Ga0070663_100051820 Ga0070663_1000518202 226
700 3300005455 Ga0070663_100062227 Ga0070663_1000622273 226
701 3300005455 Ga0070663_100357832 Ga0070663_1003578321 226
702 3300005455 Ga0070663_100383908 Ga0070663_1003839081 226
703 3300005456 Ga0070678_100063529 Ga0070678_1000635292 226
704 3300005456 Ga0070678_100064365 Ga0070678_1000643652 226
705 3300005456 Ga0070678_100600104 Ga0070678_1006001042 226
706 3300005457 Ga0070662_100209541 Ga0070662_1002095412 226
707 3300005457 Ga0070662_100287692 Ga0070662_1002876921 226
708 3300005457 Ga0070662_100767566 Ga0070662_1007675661 226
709 3300005466 Ga0070685_10263209 Ga0070685_102632092 226
710 3300005471 Ga0070698_100299253 Ga0070698_1002992532 226
711 3300005518 Ga0070699_100064968 Ga0070699_1000649684 226
712 3300005535 Ga0070684_100009002 Ga0070684_1000090025 226
713 3300005535 Ga0070684_100094774 Ga0070684_1000947742 226
714 3300005539 Ga0068853_100008769 Ga0068853_1000087694 226
715 3300005539 Ga0068853_100093792 Ga0068853_1000937922 226
716 3300005539 Ga0068853_100462143 Ga0068853_1004621431 226
717 3300005545 Ga0070695_100161572 Ga0070695_1001615722 226
718 3300005547 Ga0070693_100092518 Ga0070693_1000925182 226
719 3300005547 Ga0070693_100509863 Ga0070693_1005098631 226
720 3300005548 Ga0070665_100025000 Ga0070665_1000250005 226
721 3300005548 Ga0070665_100033934 Ga0070665_1000339344 226
722 3300005548 Ga0070665_100051133 Ga0070665_1000511334 226
723 3300005548 Ga0070665_100116171 Ga0070665_1001161712 226
724 3300005548 Ga0070665_100290413 Ga0070665_1002904131 226
725 3300005549 Ga0070704_100508401 Ga0070704_1005084011 226
726 3300005563 Ga0068855_100033896 Ga0068855_1000338962 226
727 3300005563 Ga0068855_100058388 Ga0068855_1000583883 226
728 3300005563 Ga0068855_100110620 Ga0068855_1001106202 226
729 3300005563 Ga0068855_100134302 Ga0068855_1001343022 226
730 3300005563 Ga0068855_100235716 Ga0068855_1002357162 226
731 3300005563 Ga0068855_100240817 Ga0068855_1002408172 226
732 3300005563 Ga0068855_100384354 Ga0068855_1003843542 226
733 3300005564 Ga0070664_100492018 Ga0070664_1004920182 226
734 3300005577 Ga0068857_100017624 Ga0068857_1000176243 226
735 3300005577 Ga0068857_100028310 Ga0068857_1000283103 226
736 3300005578 Ga0068854_100027763 Ga0068854_1000277633 226
737 3300005578 Ga0068854_100160752 Ga0068854_1001607522 226
738 3300005614 Ga0068856_100000020 Ga0068856_10000002039 226
739 3300005614 Ga0068856_100018098 Ga0068856_1000180983 226
740 3300005614 Ga0068856_100026301 Ga0068856_1000263013 226
741 3300005614 Ga0068856_100040303 Ga0068856_1000403033 226
742 3300005614 Ga0068856_100077346 Ga0068856_1000773464 226
743 3300005614 Ga0068856_100469858 Ga0068856_1004698582 226
744 3300005614 Ga0068856_100861800 Ga0068856_1008618001 226
745 3300005614 Ga0068856_100880146 Ga0068856_1008801462 226
746 3300005615 Ga0070702_100132032 Ga0070702_1001320321 226
747 3300005616 Ga0068852_100031347 Ga0068852_1000313473 226
748 3300005616 Ga0068852_100038673 Ga0068852_1000386733 226
749 3300005616 Ga0068852_100180689 Ga0068852_1001806892 226
750 3300005617 Ga0068859_100072923 Ga0068859_1000729233 226
751 3300005617 Ga0068859_100144919 Ga0068859_1001449193 226
752 3300005618 Ga0068864_100629097 Ga0068864_1006290972 226
753 3300005718 Ga0068866_10122460 Ga0068866_101224601 226
754 3300005719 Ga0068861_100433784 Ga0068861_1004337841 226
755 3300005841 Ga0068863_100627486 Ga0068863_1006274861 226
756 3300005842 Ga0068858_100238546 Ga0068858_1002385463 226
757 3300005843 Ga0068860_100186064 Ga0068860_1001860642 226
758 3300005844 Ga0068862_100151638 Ga0068862_1001516382 226
759 3300005844 Ga0068862_100281455 Ga0068862_1002814552 226
760 3300005844 Ga0068862_100622576 Ga0068862_1006225762 226
761 3300005937 Ga0081455_10015893 Ga0081455_100158935 226
762 3300005937 Ga0081455_10019603 Ga0081455_100196033 226
763 3300005981 Ga0081538_10020678 Ga0081538_100206783 226
764 3300005981 Ga0081538_10035977 Ga0081538_100359773 226
765 3300005983 Ga0081540_1002344 Ga0081540_10023446 226
766 3300005983 Ga0081540_1002625 Ga0081540_100262513 226
767 3300005983 Ga0081540_1003998 Ga0081540_10039986 226
768 3300005983 Ga0081540_1009104 Ga0081540_10091044 226
769 3300005985 Ga0081539_10000140 Ga0081539_1000014062 226
770 3300005985 Ga0081539_10013499 Ga0081539_100134994 226
771 3300006028 Ga0070717_10006527 Ga0070717_100065276 226
772 3300006028 Ga0070717_10006998 Ga0070717_100069982 226
773 3300006028 Ga0070717_10186429 Ga0070717_101864292 226
774 3300006028 Ga0070717_10650840 Ga0070717_106508402 226
775 3300006038 Ga0075365_10011414 Ga0075365_100114143 226
776 3300006038 Ga0075365_10029922 Ga0075365_100299222 226
777 3300006038 Ga0075365_10130201 Ga0075365_101302012 226
778 3300006038 Ga0075365_10157299 Ga0075365_101572993 226
779 3300006038 Ga0075365_10163822 Ga0075365_101638222 226
780 3300006042 Ga0075368_10028834 Ga0075368_100288342 226
781 3300006051 Ga0075364_10072947 Ga0075364_100729472 226
782 3300006051 Ga0075364_10119027 Ga0075364_101190272 226
783 3300006051 Ga0075364_10180568 Ga0075364_101805681 226
784 3300006163 Ga0070715_10008241 Ga0070715_100082413 226
785 3300006173 Ga0070716_100008528 Ga0070716_1000085283 226
786 3300006173 Ga0070716_100023937 Ga0070716_1000239372 226
787 3300006173 Ga0070716_100041086 Ga0070716_1000410861 226
788 3300006175 Ga0070712_100046680 Ga0070712_1000466803 226
789 3300006177 Ga0075362_10010211 Ga0075362_100102115 226
790 3300006178 Ga0075367_10032354 Ga0075367_100323543 226
791 3300006178 Ga0075367_10054501 Ga0075367_100545012 226
792 3300006178 Ga0075367_10168671 Ga0075367_101686711 226
793 3300006178 Ga0075367_10300260 Ga0075367_103002602 226
794 3300006186 Ga0075369_10027395 Ga0075369_100273952 226
795 3300006186 Ga0075369_10042391 Ga0075369_100423912 226
796 3300006186 Ga0075369_10103873 Ga0075369_101038732 226
797 3300006186 Ga0075369_10124081 Ga0075369_101240812 226
798 3300006195 Ga0075366_10083204 Ga0075366_100832042 226
799 3300006195 Ga0075366_10084065 Ga0075366_100840652 226
800 3300006353 Ga0075370_10040001 Ga0075370_100400014 226
801 3300006353 Ga0075370_10166004 Ga0075370_101660041 226
802 3300006353 Ga0075370_10234330 Ga0075370_102343302 226
803 3300006358 Ga0068871_100130759 Ga0068871_1001307592 226
804 3300006358 Ga0068871_100272918 Ga0068871_1002729181 226
805 3300006844 Ga0075428_100833846 Ga0075428_1008338461 226
806 3300006881 Ga0068865_100055402 Ga0068865_1000554023 226
807 3300006881 Ga0068865_100136475 Ga0068865_1001364752 226
808 3300006931 Ga0097620_100072924 Ga0097620_1000729243 226
809 3300006931 Ga0097620_100144929 Ga0097620_1001449293 226
810 3300006942 Ga0099824_1027583 Ga0099824_10275832 226
811 3300006943 Ga0099822_1018498 Ga0099822_10184989 226
812 3300006944 Ga0099823_1041378 Ga0099823_10413782 226
813 3300007076 Ga0075435_100175049 Ga0075435_1001750491 226
814 3300007788 Ga0099795_10024080 Ga0099795_100240802 226
815 3300009036 Ga0105244_10168463 Ga0105244_101684631 226
816 3300009092 Ga0105250_10178674 Ga0105250_101786741 226
817 3300009093 Ga0105240_10024133 Ga0105240_100241333 226
818 3300009093 Ga0105240_10024314 Ga0105240_100243143 226
819 3300009093 Ga0105240_10036283 Ga0105240_100362833 226
820 3300009093 Ga0105240_10259071 Ga0105240_102590712 226
821 3300009093 Ga0105240_10719906 Ga0105240_107199062 226
822 3300009098 Ga0105245_10127220 Ga0105245_101272202 226
823 3300009098 Ga0105245_10206696 Ga0105245_102066962 226
824 3300009101 Ga0105247_10047475 Ga0105247_100474754 226
825 3300009101 Ga0105247_10068755 Ga0105247_100687553 226
826 3300009101 Ga0105247_10085701 Ga0105247_100857012 226
827 3300009101 Ga0105247_10349675 Ga0105247_103496751 226
828 3300009147 Ga0114129_10115255 Ga0114129_101152551 226
829 3300009147 Ga0114129_10649821 Ga0114129_106498212 226
830 3300009148 Ga0105243_10288253 Ga0105243_102882532 226
831 3300009148 Ga0105243_10759037 Ga0105243_107590372 226
832 3300009174 Ga0105241_10005393 Ga0105241_100053935 226
833 3300009176 Ga0105242_10415613 Ga0105242_104156132 226
834 3300009176 Ga0105242_10910606 Ga0105242_109106061 226
835 3300009177 Ga0105248_10138684 Ga0105248_101386842 226
836 3300009177 Ga0105248_10161950 Ga0105248_101619503 226
837 3300009177 Ga0105248_10530924 Ga0105248_105309242 226
838 3300009545 Ga0105237_10032997 Ga0105237_100329973 226
839 3300009545 Ga0105237_10039060 Ga0105237_100390603 226
840 3300009545 Ga0105237_10049678 Ga0105237_100496784 226
841 3300009545 Ga0105237_10060279 Ga0105237_100602791 226
842 3300009545 Ga0105237_10131130 Ga0105237_101311302 226
843 3300009545 Ga0105237_10326674 Ga0105237_103266742 226
844 3300009545 Ga0105237_10544309 Ga0105237_105443091 226
845 3300009545 Ga0105237_11291647 Ga0105237_112916471 226
846 3300009551 Ga0105238_10024393 Ga0105238_100243934 226
847 3300009551 Ga0105238_10033691 Ga0105238_100336913 226
848 3300009551 Ga0105238_10042528 Ga0105238_100425284 226
849 3300009551 Ga0105238_11320721 Ga0105238_113207211 226
850 3300010159 Ga0099796_10165123 Ga0099796_101651232 226
851 3300010375 Ga0105239_10022985 Ga0105239_100229854 226
852 3300010375 Ga0105239_10058272 Ga0105239_100582723 226
853 3300010375 Ga0105239_10113597 Ga0105239_101135972 226
854 3300010375 Ga0105239_10147331 Ga0105239_101473311 226
855 3300010375 Ga0105239_10367642 Ga0105239_103676422 226
856 3300010375 Ga0105239_10454692 Ga0105239_104546921 226
857 3300010375 Ga0105239_10768292 Ga0105239_107682921 226
858 3300011119 Ga0105246_10045034 Ga0105246_100450344 226
859 3300011119 Ga0105246_10501460 Ga0105246_105014602 226
860 3300013104 Ga0157370_10163274 Ga0157370_101632741 226
861 3300013105 Ga0157369_10066878 Ga0157369_100668783 226
862 3300013105 Ga0157369_10161906 Ga0157369_101619062 226
863 3300013296 Ga0157374_10055850 Ga0157374_100558503 226
864 3300013306 Ga0163162_10099437 Ga0163162_100994372 226
865 3300013306 Ga0163162_10464215 Ga0163162_104642152 226
866 3300013306 Ga0163162_10828920 Ga0163162_108289202 226
867 3300013307 Ga0157372_10051549 Ga0157372_100515494 226
868 3300013308 Ga0157375_10013707 Ga0157375_100137076 226
869 3300013308 Ga0157375_10087749 Ga0157375_100877493 226
870 3300013308 Ga0157375_10367945 Ga0157375_103679451 226
871 3300014325 Ga0163163_10044076 Ga0163163_100440765 226
872 3300014325 Ga0163163_10056151 Ga0163163_100561512 226
873 3300014745 Ga0157377_10060620 Ga0157377_100606201 226
874 3300014745 Ga0157377_10118916 Ga0157377_101189162 226
875 3300014969 Ga0157376_10122766 Ga0157376_101227661 226
876 3300014969 Ga0157376_10129606 Ga0157376_101296062 226
877 3300014969 Ga0157376_11176721 Ga0157376_111767211 226
878 3300017792 Ga0163161_10025727 Ga0163161_100257275 226
879 3300021320 Ga0214544_1000002 Ga0214544_1000002207 226
880 3300021320 Ga0214544_1034706 Ga0214544_10347062 226
881 3300021321 Ga0214542_1000001 Ga0214542_1000001557 226
882 3300021321 Ga0214542_1029424 Ga0214542_10294242 226
883 3300021324 Ga0214545_1000001 Ga0214545_1000001623 226
884 3300021324 Ga0214545_1021309 Ga0214545_10213092 226
885 3300021327 Ga0214543_1000001 Ga0214543_1000001573 226
886 3300021327 Ga0214543_1038078 Ga0214543_10380782 226
887 3300021377 Ga0213874_10022314 Ga0213874_100223142 226
888 3300021384 Ga0213876_10073813 Ga0213876_100738132 226
889 3300021384 Ga0213876_10252523 Ga0213876_102525232 226
890 3300025230 Ga0209563_101475 Ga0209563_1014753 226
891 3300025253 Ga0209677_100463 Ga0209677_1004639 226
892 3300025254 Ga0209148_1000428 Ga0209148_100042815 226
893 3300025261 Ga0209233_1010958 Ga0209233_10109583 226
894 3300025261 Ga0209233_1031691 Ga0209233_10316912 226
895 3300025272 Ga0209455_1004564 Ga0209455_10045641 226
896 3300025272 Ga0209455_1006717 Ga0209455_10067172 226
897 3300025295 Ga0209564_1001578 Ga0209564_100157813 226
898 3300025295 Ga0209564_1023388 Ga0209564_10233882 226
899 3300025295 Ga0209564_1052192 Ga0209564_10521922 226
900 3300025297 Ga0209758_1000140 Ga0209758_100014055 226
901 3300025297 Ga0209758_1000321 Ga0209758_100032168 226
902 3300025297 Ga0209758_1001092 Ga0209758_100109233 226
903 3300025297 Ga0209758_1002051 Ga0209758_100205119 226
904 3300025297 Ga0209758_1002659 Ga0209758_100265917 226
905 3300025297 Ga0209758_1003492 Ga0209758_10034923 226
906 3300025297 Ga0209758_1003969 Ga0209758_10039693 226
907 3300025297 Ga0209758_1094196 Ga0209758_10941961 226
908 3300025299 Ga0209256_1009946 Ga0209256_10099462 226
909 3300025299 Ga0209256_1022829 Ga0209256_10228292 226
910 3300025302 Ga0207426_1000278 Ga0207426_100027869 226
911 3300025302 Ga0207426_1000378 Ga0207426_100037889 226
912 3300025302 Ga0207426_1056124 Ga0207426_10561242 226
913 3300025304 Ga0209257_1000522 Ga0209257_100052234 226
914 3300025304 Ga0209257_1021097 Ga0209257_10210971 226
915 3300025315 Ga0207697_10206400 Ga0207697_102064001 226
916 3300025321 Ga0207656_10010200 Ga0207656_100102003 226
917 3300025321 Ga0207656_10295025 Ga0207656_102950251 226
918 3300025898 Ga0207692_10003515 Ga0207692_100035152 226
919 3300025898 Ga0207692_10008195 Ga0207692_100081953 226
920 3300025898 Ga0207692_10118299 Ga0207692_101182991 226
921 3300025898 Ga0207692_10213076 Ga0207692_102130762 226
922 3300025899 Ga0207642_10251749 Ga0207642_102517492 226
923 3300025900 Ga0207710_10058668 Ga0207710_100586681 226
924 3300025900 Ga0207710_10076259 Ga0207710_100762592 226
925 3300025900 Ga0207710_10175442 Ga0207710_101754421 226
926 3300025901 Ga0207688_10046398 Ga0207688_100463982 226
927 3300025901 Ga0207688_10133821 Ga0207688_101338212 226
928 3300025901 Ga0207688_10292657 Ga0207688_102926571 226
929 3300025903 Ga0207680_10246835 Ga0207680_102468351 226
930 3300025904 Ga0207647_10002921 Ga0207647_100029213 226
931 3300025904 Ga0207647_10006624 Ga0207647_100066246 226
932 3300025904 Ga0207647_10259957 Ga0207647_102599571 226
933 3300025905 Ga0207685_10000377 Ga0207685_100003772 226
934 3300025905 Ga0207685_10008143 Ga0207685_100081433 226
935 3300025906 Ga0207699_10003114 Ga0207699_100031144 226
936 3300025906 Ga0207699_10012803 Ga0207699_100128033 226
937 3300025906 Ga0207699_10038453 Ga0207699_100384534 226
938 3300025906 Ga0207699_10111562 Ga0207699_101115622 226
939 3300025906 Ga0207699_10301358 Ga0207699_103013582 226
940 3300025906 Ga0207699_10422641 Ga0207699_104226411 226
941 3300025907 Ga0207645_10065338 Ga0207645_100653381 226
942 3300025909 Ga0207705_10195348 Ga0207705_101953482 226
943 3300025909 Ga0207705_10212413 Ga0207705_102124131 226
944 3300025911 Ga0207654_10001513 Ga0207654_100015136 226
945 3300025911 Ga0207654_10037938 Ga0207654_100379382 226
946 3300025913 Ga0207695_10000008 Ga0207695_1000000813 226
947 3300025913 Ga0207695_10008039 Ga0207695_100080395 226
948 3300025913 Ga0207695_10032881 Ga0207695_100328812 226
949 3300025913 Ga0207695_10103578 Ga0207695_101035782 226
950 3300025913 Ga0207695_10238633 Ga0207695_102386331 226
951 3300025914 Ga0207671_10059849 Ga0207671_100598492 226
952 3300025914 Ga0207671_10143691 Ga0207671_101436911 226
953 3300025914 Ga0207671_10192469 Ga0207671_101924691 226
954 3300025914 Ga0207671_10286962 Ga0207671_102869622 226
955 3300025915 Ga0207693_10001875 Ga0207693_100018755 226
956 3300025915 Ga0207693_10062244 Ga0207693_100622442 226
957 3300025916 Ga0207663_10000347 Ga0207663_1000034711 226
958 3300025916 Ga0207663_10006159 Ga0207663_100061594 226
959 3300025916 Ga0207663_10040094 Ga0207663_100400941 226
960 3300025917 Ga0207660_10047484 Ga0207660_100474844 226
961 3300025917 Ga0207660_10145935 Ga0207660_101459351 226
962 3300025917 Ga0207660_10251113 Ga0207660_102511132 226
963 3300025918 Ga0207662_10247037 Ga0207662_102470372 226
964 3300025919 Ga0207657_10005077 Ga0207657_100050777 226
965 3300025920 Ga0207649_10028404 Ga0207649_100284042 226
966 3300025921 Ga0207652_10062632 Ga0207652_100626322 226
967 3300025922 Ga0207646_10158788 Ga0207646_101587882 226
968 3300025923 Ga0207681_10629705 Ga0207681_106297051 226
969 3300025924 Ga0207694_10000050 Ga0207694_10000050138 226
970 3300025924 Ga0207694_10265609 Ga0207694_102656092 226
971 3300025924 Ga0207694_10609281 Ga0207694_106092811 226
972 3300025924 Ga0207694_10688494 Ga0207694_106884942 226
973 3300025926 Ga0207659_10290995 Ga0207659_102909952 226
974 3300025927 Ga0207687_10014409 Ga0207687_100144091 226
975 3300025928 Ga0207700_10050010 Ga0207700_100500103 226
976 3300025928 Ga0207700_10085205 Ga0207700_100852052 226
977 3300025928 Ga0207700_10108427 Ga0207700_101084272 226
978 3300025928 Ga0207700_10197910 Ga0207700_101979102 226
979 3300025928 Ga0207700_10258410 Ga0207700_102584102 226
980 3300025928 Ga0207700_10616896 Ga0207700_106168961 226
981 3300025929 Ga0207664_10038049 Ga0207664_100380493 226
982 3300025929 Ga0207664_10042856 Ga0207664_100428562 226
983 3300025929 Ga0207664_10055666 Ga0207664_100556662 226
984 3300025929 Ga0207664_10454659 Ga0207664_104546591 226
985 3300025929 Ga0207664_10456802 Ga0207664_104568021 226
986 3300025931 Ga0207644_10329061 Ga0207644_103290612 226
987 3300025931 Ga0207644_10357530 Ga0207644_103575302 226
988 3300025933 Ga0207706_10153092 Ga0207706_101530922 226
989 3300025934 Ga0207686_10117767 Ga0207686_101177672 226
990 3300025934 Ga0207686_10209320 Ga0207686_102093202 226
991 3300025934 Ga0207686_10581283 Ga0207686_105812831 226
992 3300025935 Ga0207709_10046579 Ga0207709_100465793 226
993 3300025935 Ga0207709_10119999 Ga0207709_101199992 226
994 3300025935 Ga0207709_10302752 Ga0207709_103027522 226
995 3300025937 Ga0207669_10041586 Ga0207669_100415863 226
996 3300025938 Ga0207704_10048167 Ga0207704_100481672 226
997 3300025938 Ga0207704_10071978 Ga0207704_100719782 226
998 3300025938 Ga0207704_10221602 Ga0207704_102216021 226
999 3300025939 Ga0207665_10004695 Ga0207665_100046953 226
1000 3300025939 Ga0207665_10046684 Ga0207665_100466842 226
1001 3300025939 Ga0207665_10050708 Ga0207665_100507082 226
1002 3300025939 Ga0207665_10251103 Ga0207665_102511032 226
1003 3300025942 Ga0207689_10113433 Ga0207689_101134332 226
1004 3300025942 Ga0207689_10211358 Ga0207689_102113582 226
1005 3300025944 Ga0207661_10006587 Ga0207661_100065874 226
1006 3300025944 Ga0207661_10028199 Ga0207661_100281992 226
1007 3300025945 Ga0207679_10546139 Ga0207679_105461391 226
1008 3300025949 Ga0207667_10010367 Ga0207667_100103678 226
1009 3300025949 Ga0207667_10027376 Ga0207667_100273763 226
1010 3300025949 Ga0207667_10218483 Ga0207667_102184832 226
1011 3300025949 Ga0207667_10326769 Ga0207667_103267692 226
1012 3300025949 Ga0207667_10471107 Ga0207667_104711072 226
1013 3300025949 Ga0207667_10505540 Ga0207667_105055402 226
1014 3300025960 Ga0207651_10623584 Ga0207651_106235841 226
1015 3300025961 Ga0207712_10087629 Ga0207712_100876292 226
1016 3300025961 Ga0207712_10395822 Ga0207712_103958221 226
1017 3300025972 Ga0207668_10014231 Ga0207668_100142316 226
1018 3300025972 Ga0207668_10137263 Ga0207668_101372632 226
1019 3300025972 Ga0207668_10249951 Ga0207668_102499512 226
1020 3300025981 Ga0207640_10014363 Ga0207640_100143632 226
1021 3300025981 Ga0207640_10218286 Ga0207640_102182861 226
1022 3300025981 Ga0207640_10384554 Ga0207640_103845542 226
1023 3300025981 Ga0207640_10713744 Ga0207640_107137441 226
1024 3300025981 Ga0207640_10766068 Ga0207640_107660681 226
1025 3300025981 Ga0207640_10838526 Ga0207640_108385261 226
1026 3300025986 Ga0207658_10414578 Ga0207658_104145782 226
1027 3300025986 Ga0207658_10534524 Ga0207658_105345242 226
1028 3300026023 Ga0207677_10031302 Ga0207677_100313023 226
1029 3300026023 Ga0207677_10198274 Ga0207677_101982742 226
1030 3300026023 Ga0207677_10403231 Ga0207677_104032312 226
1031 3300026035 Ga0207703_10268096 Ga0207703_102680962 226
1032 3300026035 Ga0207703_10847928 Ga0207703_108479281 226
1033 3300026041 Ga0207639_10061853 Ga0207639_100618531 226
1034 3300026041 Ga0207639_10132912 Ga0207639_101329122 226
1035 3300026041 Ga0207639_10146951 Ga0207639_101469512 226
1036 3300026041 Ga0207639_10327623 Ga0207639_103276231 226
1037 3300026041 Ga0207639_10817342 Ga0207639_108173421 226
1038 3300026067 Ga0207678_10021023 Ga0207678_100210232 226
1039 3300026067 Ga0207678_10023027 Ga0207678_100230274 226
1040 3300026067 Ga0207678_10035512 Ga0207678_100355123 226
1041 3300026067 Ga0207678_10039077 Ga0207678_100390775 226
1042 3300026067 Ga0207678_10071839 Ga0207678_100718392 226
1043 3300026067 Ga0207678_10105366 Ga0207678_101053662 226
1044 3300026067 Ga0207678_10110819 Ga0207678_101108192 226
1045 3300026075 Ga0207708_10093201 Ga0207708_100932012 226
1046 3300026075 Ga0207708_10657469 Ga0207708_106574691 226
1047 3300026078 Ga0207702_10000002 Ga0207702_10000002248 226
1048 3300026078 Ga0207702_10000748 Ga0207702_1000074820 226
1049 3300026078 Ga0207702_10031381 Ga0207702_100313812 226
1050 3300026078 Ga0207702_10049144 Ga0207702_100491443 226
1051 3300026088 Ga0207641_10507466 Ga0207641_105074662 226
1052 3300026116 Ga0207674_10003205 Ga0207674_100032055 226
1053 3300026116 Ga0207674_10003611 Ga0207674_1000361110 226
1054 3300026116 Ga0207674_10023871 Ga0207674_100238716 226
1055 3300026116 Ga0207674_10729084 Ga0207674_107290841 226
1056 3300026118 Ga0207675_100133243 Ga0207675_1001332432 226
1057 3300026118 Ga0207675_100789871 Ga0207675_1007898712 226
1058 3300026121 Ga0207683_10014348 Ga0207683_100143483 226
1059 3300026121 Ga0207683_10018400 Ga0207683_100184006 226
1060 3300026121 Ga0207683_10195356 Ga0207683_101953561 226
1061 3300026121 Ga0207683_10321172 Ga0207683_103211721 226
1062 3300026121 Ga0207683_10367452 Ga0207683_103674521 226
1063 3300026142 Ga0207698_10022804 Ga0207698_100228045 226
1064 3300026142 Ga0207698_10047597 Ga0207698_100475972 226
1065 3300026142 Ga0207698_10104339 Ga0207698_101043391 226
1066 3300026142 Ga0207698_10220585 Ga0207698_102205852 226
1067 3300027296 Ga0209389_1000040 Ga0209389_1000040116 226
1068 3300027296 Ga0209389_1000995 Ga0209389_10009952 226
1069 3300027357 Ga0209589_1000001 Ga0209589_1000001154 226
1070 3300027357 Ga0209589_1000211 Ga0209589_10002112 226
1071 3300027361 Ga0209489_100001 Ga0209489_100001154 226
1072 3300027361 Ga0209489_100006 Ga0209489_100006138 226
1073 3300027361 Ga0209489_110930 Ga0209489_1109306 226
1074 3300027363 Ga0209700_100001 Ga0209700_100001154 226
1075 3300027363 Ga0209700_100005 Ga0209700_100005184 226
1076 3300027866 Ga0209813_10008974 Ga0209813_100089743 226
1077 3300027907 Ga0207428_10036206 Ga0207428_100362063 226
1078 3300027907 Ga0207428_10104190 Ga0207428_101041902 226
1079 3300028379 Ga0268266_10002320 Ga0268266_1000232011 226
1080 3300028379 Ga0268266_10009271 Ga0268266_100092712 226
1081 3300028379 Ga0268266_10028180 Ga0268266_100281802 226
1082 3300028379 Ga0268266_10050458 Ga0268266_100504581 226
1083 3300028379 Ga0268266_10065849 Ga0268266_100658493 226
1084 3300028379 Ga0268266_10065947 Ga0268266_100659471 226
1085 3300028379 Ga0268266_10172149 Ga0268266_101721493 226
1086 3300028379 Ga0268266_10343609 Ga0268266_103436092 226
1087 3300028380 Ga0268265_10209777 Ga0268265_102097772 226
1088 3300028380 Ga0268265_10746325 Ga0268265_107463251 226
1089 3300028381 Ga0268264_10002930 Ga0268264_100029304 226
1090 3300028381 Ga0268264_10158642 Ga0268264_101586422 226
1091 3300028556 Ga0265337_1006749 Ga0265337_10067493 226
1092 3300028573 Ga0265334_10006955 Ga0265334_100069554 226
1093 3300028653 Ga0265323_10004409 Ga0265323_100044097 226
1094 3300028654 Ga0265322_10060032 Ga0265322_100600322 226
1095 3300028666 Ga0265336_10000763 Ga0265336_1000076316 226
1096 3300028786 Ga0307517_10000249 Ga0307517_1000024927 226
1097 3300028786 Ga0307517_10119002 Ga0307517_101190022 226
1098 3300028794 Ga0307515_10314902 Ga0307515_103149022 226
1099 3300028800 Ga0265338_10000665 Ga0265338_1000066534 226
1100 3300030521 Ga0307511_10110325 Ga0307511_101103252 226
1101 3300031235 Ga0265330_10124828 Ga0265330_101248281 226
1102 3300031238 Ga0265332_10168113 Ga0265332_101681131 226
1103 3300031241 Ga0265325_10012262 Ga0265325_100122622 226
1104 3300031247 Ga0265340_10008625 Ga0265340_100086253 226
1105 3300031249 Ga0265339_10052640 Ga0265339_100526402 226
1106 3300031250 Ga0265331_10062535 Ga0265331_100625352 226
1107 3300031344 Ga0265316_10061807 Ga0265316_100618073 226
1108 3300031507 Ga0307509_10125888 Ga0307509_101258882 226
1109 3300031548 Ga0307408_100779255 Ga0307408_1007792551 226
1110 3300031616 Ga0307508_10000018 Ga0307508_1000001833 226
1111 3300031616 Ga0307508_10043906 Ga0307508_100439062 226
1112 3300031616 Ga0307508_10311566 Ga0307508_103115662 226
1113 3300031711 Ga0265314_10002567 Ga0265314_100025677 226
1114 3300031711 Ga0265314_10160306 Ga0265314_101603061 226
1115 3300031711 Ga0265314_10181164 Ga0265314_101811642 226
1116 3300031712 Ga0265342_10174163 Ga0265342_101741631 226
1117 3300031712 Ga0265342_10211170 Ga0265342_102111701 226
1118 3300031730 Ga0307516_10011331 Ga0307516_100113313 226
1119 3300031730 Ga0307516_10038640 Ga0307516_100386402 226
1120 3300031730 Ga0307516_10200912 Ga0307516_102009122 226
1121 3300031730 Ga0307516_10224017 Ga0307516_102240172 226
1122 3300031731 Ga0307405_10631678 Ga0307405_106316781 226
1123 3300031824 Ga0307413_10031350 Ga0307413_100313501 226
1124 3300031824 Ga0307413_10800187 Ga0307413_108001871 226
1125 3300031852 Ga0307410_10682828 Ga0307410_106828281 226
1126 3300031901 Ga0307406_10255867 Ga0307406_102558672 226
1127 3300031911 Ga0307412_10429143 Ga0307412_104291432 226
1128 3300031911 Ga0307412_10595978 Ga0307412_105959782 226
1129 3300032002 Ga0307416_100409035 Ga0307416_1004090352 226
1130 3300032126 Ga0307415_100042679 Ga0307415_1000426793 226
1131 3300033179 Ga0307507_10008461 Ga0307507_100084612 226
1132 3300033180 Ga0307510_10005775 Ga0307510_100057755 226
1133 3300033442 Ga0315911_1000006 Ga0315911_1000006268 226
1134 3300034818 Ga0373950_0036482 Ga0373950_0036482_222_917 226
1135 3300035083 Ga0373926_0034351 Ga0373926_0034351_59_748 226
1136 3300035083 Ga0373926_0089882 Ga0373926_0089882_110_790 226
1137 3300035084 Ga0373928_0021938 Ga0373928_0021938_531_1226 226
1138 3300035086 Ga0373934_0024742 Ga0373934_0024742_860_1552 226
1139 3300035089 Ga0373944_0027109 Ga0373944_0027109_722_1417 226
1140 3300035090 Ga0373949_0069780 Ga0373949_0069780_84_779 226
1141 3300035112 Ga0373932_0012711 Ga0373932_0012711_399_1094 226
1142 3300035113 Ga0373936_0009212 Ga0373936_0009212_1481_2170 226
1143 3300035113 Ga0373936_0124171 Ga0373936_0124171_75_785 226
1144 3300035117 Ga0373953_0007285 Ga0373953_0007285_983_1672 226
1145 3300035117 Ga0373953_0027450 Ga0373953_0027450_709_1401 226
1146 3300035117 Ga0373953_0036308 Ga0373953_0036308_522_1214 226
1147 3300035118 Ga0373954_0003365 Ga0373954_0003365_917_1609 226
1148 3300035118 Ga0373954_0016863 Ga0373954_0016863_667_1359 226
1149 3300035119 Ga0373956_0015008 Ga0373956_0015008_833_1525 226
1150 3300035119 Ga0373956_0035180 Ga0373956_0035180_1337_2059 226
1151 3300035119 Ga0373956_0054647 Ga0373956_0054647_85_774 226
1152 3300035120 Ga0373957_0003026 Ga0373957_0003026_833_1525 226
1153 3300035170 Ga0373943_0006361 Ga0373943_0006361_4027_4716 226
1154 3300035170 Ga0373943_0033391 Ga0373943_0033391_1318_2013 226
1155 3300035171 Ga0373946_0146071 Ga0373946_0146071_136_831 226
1156 3300035172 Ga0373955_0002466 Ga0373955_0002466_2316_3008 226
1157 3300035172 Ga0373955_0341937 Ga0373955_0341937_96_785 226
1158 3300035410 Ga0373924_0012183 Ga0373924_0012183_1293_1985 226
1159 3300035691 Ga0373931_0007658 Ga0373931_0007658_1846_2541 226
1160 3300035691 Ga0373931_0098484 Ga0373931_0098484_358_1053 226
1161 3300035692 Ga0373935_0033363 Ga0373935_0033363_658_1338 226
1162 3300035692 Ga0373935_0049212 Ga0373935_0049212_14_709 226
1163 3300035692 Ga0373935_0130757 Ga0373935_0130757_291_980 226
1164 3300035692 Ga0373935_0382553 Ga0373935_0382553_193_888 226
1165 3300035692 Ga0373935_0658773 Ga0373935_0658773_76_756 226
1166 3300035695 Ga0373927_0012626 Ga0373927_0012626_2511_3203 226
1167 3300035695 Ga0373927_0069279 Ga0373927_0069279_1453_2148 226
1168 3300035695 Ga0373927_0084027 Ga0373927_0084027_709_1398 226
1169 3300035695 Ga0373927_0177471 Ga0373927_0177471_588_1274 226
1170 3300035695 Ga0373927_0187584 Ga0373927_0187584_565_1245 226
1171 3300035724 Ga0373933_0005811 Ga0373933_0005811_918_1610 226
1172 3300035724 Ga0373933_0036459 Ga0373933_0036459_386_1078 226
1173 3300035724 Ga0373933_0045514 Ga0373933_0045514_136_825 226
1174 3300035725 Ga0373947_0012125 Ga0373947_0012125_157_852 226
1175 3300035725 Ga0373947_0089676 Ga0373947_0089676_854_1543 226
1176 3300036401 Ga0373937_0001814 Ga0373937_0001814_12072_12764 226
1177 3300036401 Ga0373937_0140323 Ga0373937_0140323_1362_2051 226
1178 3300036401 Ga0373937_0170675 Ga0373937_0170675_1270_1953 226
1179 3300036401 Ga0373937_0472782 Ga0373937_0472782_199_891 226
1180 3300036459 Ga0372808_000933 Ga0372808_000933_941_1633 226
1181 3300037068 Ga0373925_0003087 Ga0373925_0003087_7749_8429 226
1182 3300037068 Ga0373925_0010490 Ga0373925_0010490_4750_5439 226
1183 3300037068 Ga0373925_0076221 Ga0373925_0076221_1490_2185 226
1184 3300037068 Ga0373925_0579725 Ga0373925_0579725_57_755 226
1185 3300037418 Ga0395900_0023857 Ga0395900_0023857_1943_2629 226
1186 3300037418 Ga0395900_0169289 Ga0395900_0169289_1060_1752 226
1187 3300037466 Ga0395898_0019988 Ga0395898_0019988_5536_6222 226
1188 3300037466 Ga0395898_0192806 Ga0395898_0192806_874_1563 226
1189 3300037466 Ga0395898_0275800 Ga0395898_0275800_794_1474 226
1190 3300037466 Ga0395898_0417270 Ga0395898_0417270_427_1113 226
1191 3300037471 Ga0395905_0008616 Ga0395905_0008616_3813_4505 226
1192 3300037471 Ga0395905_0014968 Ga0395905_0014968_545_1234 226
1193 3300037471 Ga0395905_0030507 Ga0395905_0030507_266_952 226
1194 3300037853 Ga0436364_0479367 Ga0436364_0479367_1036_1722 226
1195 3300038443 Ga0395901_0002662 Ga0395901_0002662_12587_13273 226
1196 3300038443 Ga0395901_0183555 Ga0395901_0183555_482_1171 226
1197 3300038443 Ga0395901_0353861 Ga0395901_0353861_793_1479 226
1198 3300039437 Ga0436365_0174244 Ga0436365_0174244_412_1104 226
1199 3300039437 Ga0436365_0647195 Ga0436365_0647195_348_1040 226
1200 3300039437 Ga0436365_1394673 Ga0436365_1394673_1605_2291 226
1201 3300039438 Ga0436360_0809633 Ga0436360_0809633_768_1472 226
1202 3300039450 Ga0436363_1258628 Ga0436363_1258628_272_958 226
1203 3300041410 Ga0439461_0020278 Ga0439461_0020278_481_1170 226
1204 3300044658 Ga0466972_0125525 Ga0466972_0125525_427_1113 226
1205 3300044683 Ga0466965_0086603 Ga0466965_0086603_64_747 226
1206 3300044684 Ga0466966_0000426 Ga0466966_0000426_5150_5830 226
1207 3300044693 Ga0466961_0000208 Ga0466961_0000208_18348_19028 226
1208 3300044693 Ga0466961_0462223 Ga0466961_0462223_34_723 226
1209 3300044694 Ga0466963_0137055 Ga0466963_0137055_541_1227 226
1210 3300044706 Ga0466964_0141621 Ga0466964_0141621_302_988 226
1211 3300044842 Ga0466957_0364882 Ga0466957_0364882_253_933 226
1212 3300044842 Ga0466957_0502789 Ga0466957_0502789_37_747 226
1213 3300044842 Ga0466957_0621834 Ga0466957_0621834_49_735 226
1214 3300044901 Ga0466960_0074350 Ga0466960_0074350_906_1586 226
1215 3300045049 Ga0466959_0045855 Ga0466959_0045855_690_1370 226
1216 3300045049 Ga0466959_0101222 Ga0466959_0101222_288_968 226
1217 3300045049 Ga0466959_0482341 Ga0466959_0482341_14_703 226
1218 3300045976 Ga0466967_0075695 Ga0466967_0075695_1752_2510 226
1219 3300045976 Ga0466967_0139641 Ga0466967_0139641_695_1390 226
1220 3300045976 Ga0466967_0177573 Ga0466967_0177573_364_1050 226
1221 3300045976 Ga0466967_0235164 Ga0466967_0235164_149_844 226
1222 3300045976 Ga0466967_0514130 Ga0466967_0514130_428_1114 226
1223 3300046452 Ga0495617_024593 Ga0495617_024593_1240_1944 226
1224 3300046452 Ga0495617_086636 Ga0495617_086636_43_735 226
1225 3300046454 Ga0495592_0007940 Ga0495592_0007940_2187_2879 226
1226 3300046454 Ga0495592_0011449 Ga0495592_0011449_1624_2313 226
1227 3300046454 Ga0495592_0030145 Ga0495592_0030145_126_812 226
1228 3300046454 Ga0495592_0044849 Ga0495592_0044849_1458_2150 226
1229 3300046455 Ga0495603_0113001 Ga0495603_0113001_864_1559 226
1230 3300046455 Ga0495603_0151587 Ga0495603_0151587_647_1333 226
1231 3300046457 Ga0495590_0066882 Ga0495590_0066882_492_1196 226
1232 3300046459 Ga0495629_0001471 Ga0495629_0001471_10465_11151 226
1233 3300046459 Ga0495629_0009818 Ga0495629_0009818_2983_3675 226
1234 3300046459 Ga0495629_0362317 Ga0495629_0362317_26_712 226
1235 3300046460 Ga0495638_0007580 Ga0495638_0007580_5711_6421 226
1236 3300046460 Ga0495638_0024650 Ga0495638_0024650_2262_2966 226
1237 3300046460 Ga0495638_0077447 Ga0495638_0077447_810_1499 226
1238 3300046461 Ga0495641_0027053 Ga0495641_0027053_2041_2748 226
1239 3300046462 Ga0495651_0000528 Ga0495651_0000528_18744_19430 226
1240 3300046462 Ga0495651_0004953 Ga0495651_0004953_4434_5120 226
1241 3300046462 Ga0495651_0033861 Ga0495651_0033861_3093_3785 226
1242 3300046462 Ga0495651_0045105 Ga0495651_0045105_2701_3384 226
1243 3300046462 Ga0495651_0119535 Ga0495651_0119535_1138_1821 226
1244 3300046462 Ga0495651_0239621 Ga0495651_0239621_266_949 226
1245 3300046463 Ga0495653_0012854 Ga0495653_0012854_1205_1897 226
1246 3300046463 Ga0495653_0051880 Ga0495653_0051880_2125_2847 226
1247 3300046463 Ga0495653_0205184 Ga0495653_0205184_387_1073 226
1248 3300046471 Ga0495650_0035581 Ga0495650_0035581_27_728 226
1249 3300046471 Ga0495650_0074621 Ga0495650_0074621_250_936 226
1250 3300046472 Ga0495580_0017647 Ga0495580_0017647_1473_2162 226
1251 3300046472 Ga0495580_0064783 Ga0495580_0064783_1240_1935 226
1252 3300046473 Ga0495582_0008676 Ga0495582_0008676_3434_4225 226
1253 3300046473 Ga0495582_0115587 Ga0495582_0115587_748_1443 226
1254 3300046473 Ga0495582_0321055 Ga0495582_0321055_72_761 226
1255 3300046474 Ga0495605_0079390 Ga0495605_0079390_23_715 226
1256 3300046474 Ga0495605_0123152 Ga0495605_0123152_444_1130 226
1257 3300046475 Ga0495639_0197439 Ga0495639_0197439_267_956 226
1258 3300046475 Ga0495639_0207986 Ga0495639_0207986_160_849 226
1259 3300046475 Ga0495639_0261230 Ga0495639_0261230_83_769 226
1260 3300046476 Ga0495662_0053996 Ga0495662_0053996_127_816 226
1261 3300046477 Ga0495664_0014192 Ga0495664_0014192_106_798 226
1262 3300046477 Ga0495664_0026168 Ga0495664_0026168_361_1053 226
1263 3300046477 Ga0495664_0027596 Ga0495664_0027596_555_1241 226
1264 3300046477 Ga0495664_0326016 Ga0495664_0326016_119_811 226
1265 3300046491 Ga0495584_0108882 Ga0495584_0108882_221_910 226
1266 3300046492 Ga0495585_0042306 Ga0495585_0042306_463_1152 226
1267 3300046492 Ga0495585_0042422 Ga0495585_0042422_230_934 226
1268 3300046499 Ga0495594_0049107 Ga0495594_0049107_1075_1761 226
1269 3300046499 Ga0495594_0127910 Ga0495594_0127910_648_1343 226
1270 3300046501 Ga0495607_0024171 Ga0495607_0024171_718_1428 226
1271 3300046506 Ga0495583_0063625 Ga0495583_0063625_771_1481 226
1272 3300046507 Ga0495606_0001663 Ga0495606_0001663_13095_13775 226
1273 3300046507 Ga0495606_0078359 Ga0495606_0078359_1349_2035 226
1274 3300046507 Ga0495606_0108452 Ga0495606_0108452_802_1488 226
1275 3300046507 Ga0495606_0111700 Ga0495606_0111700_308_1018 226
1276 3300046507 Ga0495606_0147278 Ga0495606_0147278_537_1226 226
1277 3300046511 Ga0495608_0007280 Ga0495608_0007280_2059_2751 226
1278 3300046511 Ga0495608_0007748 Ga0495608_0007748_2946_3638 226
1279 3300046512 Ga0495610_0028158 Ga0495610_0028158_829_1539 226
1280 3300046513 Ga0495616_0036121 Ga0495616_0036121_1304_2014 226
1281 3300046513 Ga0495616_0065445 Ga0495616_0065445_379_1065 226
1282 3300046514 Ga0495618_0005313 Ga0495618_0005313_1553_2245 226
1283 3300046514 Ga0495618_0128394 Ga0495618_0128394_392_1078 226
1284 3300046514 Ga0495618_0308007 Ga0495618_0308007_283_972 226
1285 3300046515 Ga0495620_0024389 Ga0495620_0024389_1923_2633 226
1286 3300046515 Ga0495620_0036962 Ga0495620_0036962_1346_2035 226
1287 3300046516 Ga0495628_0008728 Ga0495628_0008728_2014_2706 226
1288 3300046516 Ga0495628_0123321 Ga0495628_0123321_785_1474 226
1289 3300046516 Ga0495628_0156019 Ga0495628_0156019_106_798 226
1290 3300046517 Ga0495630_0007077 Ga0495630_0007077_4420_5109 226
1291 3300046517 Ga0495630_0535953 Ga0495630_0535953_173_865 226
1292 3300046517 Ga0495630_0574089 Ga0495630_0574089_112_798 226
1293 3300046518 Ga0495631_0047682 Ga0495631_0047682_770_1474 226
1294 3300046519 Ga0495632_0041732 Ga0495632_0041732_1172_1876 226
1295 3300046519 Ga0495632_0047359 Ga0495632_0047359_492_1181 226
1296 3300046520 Ga0495637_0156129 Ga0495637_0156129_34_744 226
1297 3300046522 Ga0495643_0039228 Ga0495643_0039228_747_1433 226
1298 3300046522 Ga0495643_0091448 Ga0495643_0091448_850_1542 226
1299 3300046522 Ga0495643_0155892 Ga0495643_0155892_241_930 226
1300 3300046523 Ga0495644_0134568 Ga0495644_0134568_231_920 226
1301 3300046523 Ga0495644_0221403 Ga0495644_0221403_26_712 226
1302 3300046524 Ga0495648_0002078 Ga0495648_0002078_8455_9165 226
1303 3300046524 Ga0495648_0047321 Ga0495648_0047321_713_1405 226
1304 3300046524 Ga0495648_0057044 Ga0495648_0057044_1638_2327 226
1305 3300046524 Ga0495648_0063629 Ga0495648_0063629_1391_2095 226
1306 3300046524 Ga0495648_0099715 Ga0495648_0099715_80_790 226
1307 3300046526 Ga0495666_0062522 Ga0495666_0062522_766_1455 226
1308 3300046529 Ga0495652_0002427 Ga0495652_0002427_12730_13416 226
1309 3300046529 Ga0495652_0007898 Ga0495652_0007898_3783_4475 226
1310 3300046529 Ga0495652_0030776 Ga0495652_0030776_3155_3841 226
1311 3300046529 Ga0495652_0071606 Ga0495652_0071606_270_962 226
1312 3300046529 Ga0495652_0092860 Ga0495652_0092860_1650_2339 226
1313 3300046529 Ga0495652_0112414 Ga0495652_0112414_434_1120 226
1314 3300046530 Ga0495654_0019069 Ga0495654_0019069_142_852 226
1315 3300046531 Ga0495665_0170711 Ga0495665_0170711_372_1061 226
1316 3300046533 Ga0495640_0012229 Ga0495640_0012229_2141_2827 226
1317 3300046533 Ga0495640_0020152 Ga0495640_0020152_1376_2065 226
1318 3300046533 Ga0495640_0041579 Ga0495640_0041579_564_1256 226
1319 3300046535 Ga0495586_0146090 Ga0495586_0146090_143_835 226
1320 3300046536 Ga0495587_0018684 Ga0495587_0018684_3452_4174 226
1321 3300046536 Ga0495587_0045874 Ga0495587_0045874_1365_2051 226
1322 3300046536 Ga0495587_0068307 Ga0495587_0068307_1199_1888 226
1323 3300046538 Ga0495609_0074972 Ga0495609_0074972_784_1470 226
1324 3300046538 Ga0495609_0121791 Ga0495609_0121791_362_1054 226
1325 3300046542 Ga0495597_0085522 Ga0495597_0085522_548_1258 226
1326 3300046542 Ga0495597_0235764 Ga0495597_0235764_19_711 226
1327 3300046543 Ga0495645_0007880 Ga0495645_0007880_4114_4806 226
1328 3300046543 Ga0495645_0024231 Ga0495645_0024231_1398_2090 226
1329 3300046543 Ga0495645_0164214 Ga0495645_0164214_358_1044 226
1330 3300046557 Ga0495622_0031960 Ga0495622_0031960_1737_2417 226
1331 3300046557 Ga0495622_0057875 Ga0495622_0057875_158_868 226
1332 3300046557 Ga0495622_0065013 Ga0495622_0065013_53_739 226
1333 3300046558 Ga0495633_0022894 Ga0495633_0022894_2178_2867 226
1334 3300046559 Ga0495667_0005712 Ga0495667_0005712_6849_7535 226
1335 3300046559 Ga0495667_0032617 Ga0495667_0032617_846_1568 226
1336 3300046559 Ga0495667_0123438 Ga0495667_0123438_45_731 226
1337 3300046615 Ga0495656_0001218 Ga0495656_0001218_4347_5036 226
1338 3300046615 Ga0495656_0008671 Ga0495656_0008671_2214_2903 226
1339 3300046616 Ga0495668_0055643 Ga0495668_0055643_608_1312 226
1340 3300046642 Ga0495634_0021235 Ga0495634_0021235_3156_3845 226
1341 3300046642 Ga0495634_0135922 Ga0495634_0135922_631_1323 226
1342 3300046648 Ga0495611_0027315 Ga0495611_0027315_1645_2334 226
1343 3300046660 Ga0495625_0088037 Ga0495625_0088037_372_1061 226
1344 3300046660 Ga0495625_0089466 Ga0495625_0089466_79_771 226
1345 3300046660 Ga0495625_0122276 Ga0495625_0122276_679_1362 226
1346 3300046660 Ga0495625_0152008 Ga0495625_0152008_833_1537 226
1347 3300046663 Ga0495635_0000873 Ga0495635_0000873_13915_14607 226
1348 3300046663 Ga0495635_0001696 Ga0495635_0001696_10536_11222 226
1349 3300046663 Ga0495635_0044031 Ga0495635_0044031_2361_3050 226
1350 3300046663 Ga0495635_0056629 Ga0495635_0056629_658_1344 226
1351 3300046664 Ga0495659_0019391 Ga0495659_0019391_1268_1957 226
1352 3300046674 Ga0495588_0013827 Ga0495588_0013827_627_1316 226
1353 3300046674 Ga0495588_0048497 Ga0495588_0048497_1231_1941 226
1354 3300046674 Ga0495588_0068228 Ga0495588_0068228_837_1529 226
1355 3300046674 Ga0495588_0250205 Ga0495588_0250205_38_727 226
1356 3300046675 Ga0495657_0011291 Ga0495657_0011291_918_1610 226
1357 3300046675 Ga0495657_0018550 Ga0495657_0018550_3219_3905 226
1358 3300046675 Ga0495657_0047169 Ga0495657_0047169_100_786 226
1359 3300046678 Ga0495599_0102140 Ga0495599_0102140_337_1029 226
1360 3300046679 Ga0495623_0001768 Ga0495623_0001768_8723_9415 226
1361 3300046679 Ga0495623_0019551 Ga0495623_0019551_771_1463 226
1362 3300046679 Ga0495623_0262791 Ga0495623_0262791_72_761 226
1363 3300046680 Ga0495646_0026347 Ga0495646_0026347_743_1435 226
1364 3300046680 Ga0495646_0056845 Ga0495646_0056845_1446_2168 226
1365 3300046680 Ga0495646_0079456 Ga0495646_0079456_139_825 226
1366 3300046680 Ga0495646_0131853 Ga0495646_0131853_184_873 226
1367 3300046681 Ga0495647_0169018 Ga0495647_0169018_107_793 226
1368 3300046683 Ga0495658_0023364 Ga0495658_0023364_996_1685 226
1369 3300046683 Ga0495658_0378762 Ga0495658_0378762_57_746 226
1370 3300046684 Ga0495669_0015157 Ga0495669_0015157_1217_1906 226
1371 3300046684 Ga0495669_0064405 Ga0495669_0064405_128_817 226
1372 3300046689 Ga0495613_0030170 Ga0495613_0030170_113_802 226
1373 3300046689 Ga0495613_0038119 Ga0495613_0038119_54_746 226
1374 3300046689 Ga0495613_0062881 Ga0495613_0062881_734_1420 226
1375 3300046690 Ga0495624_0115553 Ga0495624_0115553_876_1571 226
1376 3300046691 Ga0495670_0072322 Ga0495670_0072322_795_1505 226
1377 3300046692 Ga0495671_0094426 Ga0495671_0094426_293_979 226
1378 3300046694 Ga0495649_0005458 Ga0495649_0005458_7130_7816 226
1379 3300046809 Ga0495600_0001526 Ga0495600_0001526_10619_11305 226
1380 3300046809 Ga0495600_0005587 Ga0495600_0005587_3656_4342 226
1381 3300046809 Ga0495600_0021059 Ga0495600_0021059_2602_3324 226
1382 3300046809 Ga0495600_0104375 Ga0495600_0104375_129_818 226
1383 3300047315 Ga0495581_0031203 Ga0495581_0031203_2202_2888 226
1384 3300047315 Ga0495581_0075569 Ga0495581_0075569_304_993 226
1385 3300047317 Ga0495604_0002479 Ga0495604_0002479_4397_5083 226
1386 3300047317 Ga0495604_0007137 Ga0495604_0007137_6229_6915 226
1387 3300047317 Ga0495604_0009567 Ga0495604_0009567_5104_5796 226
1388 3300047319 Ga0495674_0016182 Ga0495674_0016182_110_796 226
1389 3300047319 Ga0495674_0017727 Ga0495674_0017727_3777_4469 226
1390 3300047319 Ga0495674_0029040 Ga0495674_0029040_1872_2564 226
1391 3300047319 Ga0495674_0164354 Ga0495674_0164354_104_796 226
1392 3300047320 Ga0495672_0039931 Ga0495672_0039931_507_1202 226
1393 3300047320 Ga0495672_0182365 Ga0495672_0182365_53_742 226
1394 3300047321 Ga0495676_0035714 Ga0495676_0035714_915_1601 226
1395 3300047321 Ga0495676_0060030 Ga0495676_0060030_1507_2196 226
1396 3300047321 Ga0495676_0190803 Ga0495676_0190803_592_1281 226
1397 3300047322 Ga0495680_0005630 Ga0495680_0005630_8406_9092 226
1398 3300047322 Ga0495680_0018123 Ga0495680_0018123_1541_2233 226
1399 3300047323 Ga0495683_0047664 Ga0495683_0047664_55_759 226
1400 3300047323 Ga0495683_0127160 Ga0495683_0127160_15_701 226
1401 3300047444 Ga0495675_0249065 Ga0495675_0249065_300_992 226
1402 3300047447 Ga0495685_015331 Ga0495685_015331_682_1371 226
1403 3300047471 Ga0495684_0003082 Ga0495684_0003082_7304_7996 226
1404 3300047471 Ga0495684_0008230 Ga0495684_0008230_4422_5111 226
1405 3300047471 Ga0495684_0015851 Ga0495684_0015851_522_1214 226
1406 3300047472 Ga0495686_0048054 Ga0495686_0048054_523_1233 226
1407 3300047472 Ga0495686_0124666 Ga0495686_0124666_605_1315 226
1408 3300047472 Ga0495686_0128036 Ga0495686_0128036_200_889 226
1409 3300047673 Ga0495593_0001718 Ga0495593_0001718_7246_7938 226
1410 3300047673 Ga0495593_0009416 Ga0495593_0009416_708_1397 226
1411 3300047673 Ga0495593_0035007 Ga0495593_0035007_11_697 226
1412 3300047673 Ga0495593_0180805 Ga0495593_0180805_298_990 226
1413 3300047673 Ga0495593_0274359 Ga0495593_0274359_41_733 226
1414 3300048088 Ga0495602_0018072 Ga0495602_0018072_2748_3434 226
1415 3300048088 Ga0495602_0020674 Ga0495602_0020674_706_1398 226
1416 3300048088 Ga0495602_0058307 Ga0495602_0058307_2057_2749 226
1417 3300048088 Ga0495602_0378188 Ga0495602_0378188_227_916 226
1418 3300048091 Ga0495626_0067186 Ga0495626_0067186_657_1343 226
1419 3300048903 Ga0496100_0002779 Ga0496100_0002779_2146_2835 226
1420 3300048903 Ga0496100_0029522 Ga0496100_0029522_648_1343 226
1421 3300048903 Ga0496100_0258192 Ga0496100_0258192_28_714 226
1422 3300048903 Ga0496100_0486855 Ga0496100_0486855_234_920 226
1423 3300048903 Ga0496100_0560611 Ga0496100_0560611_96_788 226
1424 3300048904 Ga0496101_0001894 Ga0496101_0001894_8126_8815 226
1425 3300048904 Ga0496101_0054385 Ga0496101_0054385_127_819 226
1426 3300048904 Ga0496101_0056797 Ga0496101_0056797_154_840 226
1427 3300048904 Ga0496101_0093616 Ga0496101_0093616_102_797 226
1428 3300048905 Ga0496102_0002765 Ga0496102_0002765_2185_2874 226
1429 3300048905 Ga0496102_0065153 Ga0496102_0065153_1732_2421 226
1430 3300048905 Ga0496102_0081657 Ga0496102_0081657_2081_2776 226
1431 3300048905 Ga0496102_0377152 Ga0496102_0377152_572_1264 226
1432 3300048905 Ga0496102_0689565 Ga0496102_0689565_227_916 226
1433 3300048906 Ga0496103_0052822 Ga0496103_0052822_1235_1930 226
1434 3300048906 Ga0496103_0079512 Ga0496103_0079512_303_992 226
1435 3300048906 Ga0496103_0408764 Ga0496103_0408764_71_751 226
1436 3300048907 Ga0496104_0005950 Ga0496104_0005950_4442_5137 226
1437 3300048907 Ga0496104_0039293 Ga0496104_0039293_567_1259 226
1438 3300048907 Ga0496104_0194817 Ga0496104_0194817_1227_1916 226
1439 3300048907 Ga0496104_0200572 Ga0496104_0200572_957_1652 226
1440 3300048907 Ga0496104_0400700 Ga0496104_0400700_560_1246 226
1441 3300048907 Ga0496104_0636854 Ga0496104_0636854_100_789 226
1442 3300048907 Ga0496104_0821197 Ga0496104_0821197_17_703 226
1443 3300048908 Ga0496105_0004948 Ga0496105_0004948_4461_5147 226
1444 3300048908 Ga0496105_0014178 Ga0496105_0014178_2457_3143 226
1445 3300048908 Ga0496105_0038159 Ga0496105_0038159_132_821 226
1446 3300048908 Ga0496105_0041386 Ga0496105_0041386_2817_3512 226
1447 3300048908 Ga0496105_0053835 Ga0496105_0053835_518_1207 226
1448 3300048908 Ga0496105_0082441 Ga0496105_0082441_1911_2603 226
1449 3300048908 Ga0496105_0201843 Ga0496105_0201843_782_1468 226
1450 3300048909 Ga0496106_0000587 Ga0496106_0000587_11273_11959 226
1451 3300048909 Ga0496106_0005552 Ga0496106_0005552_3499_4188 226
1452 3300048909 Ga0496106_0019620 Ga0496106_0019620_2994_3674 226
1453 3300048909 Ga0496106_0051907 Ga0496106_0051907_97_792 226
1454 3300048909 Ga0496106_0053721 Ga0496106_0053721_1536_2228 226
1455 3300048909 Ga0496106_0219417 Ga0496106_0219417_384_1079 226
1456 3300048909 Ga0496106_0649360 Ga0496106_0649360_74_763 226
1457 3300048910 Ga0496107_0003023 Ga0496107_0003023_3234_3920 226
1458 3300048910 Ga0496107_0021695 Ga0496107_0021695_2460_3149 226
1459 3300048910 Ga0496107_0024155 Ga0496107_0024155_2202_2894 226
1460 3300048910 Ga0496107_0024903 Ga0496107_0024903_2306_3001 226
1461 3300048910 Ga0496107_0074497 Ga0496107_0074497_101_790 226
1462 3300048910 Ga0496107_0080438 Ga0496107_0080438_1420_2109 226
1463 3300048911 Ga0496108_0000517 Ga0496108_0000517_12063_12749 226
1464 3300048911 Ga0496108_0044050 Ga0496108_0044050_1093_1782 226
1465 3300048911 Ga0496108_0046015 Ga0496108_0046015_2852_3547 226
1466 3300048912 Ga0496109_0000814 Ga0496109_0000814_7382_8068 226
1467 3300048912 Ga0496109_0049567 Ga0496109_0049567_425_1114 226
1468 3300048912 Ga0496109_0066388 Ga0496109_0066388_660_1349 226
1469 3300048912 Ga0496109_0159112 Ga0496109_0159112_95_790 226
1470 3300048912 Ga0496109_0368696 Ga0496109_0368696_420_1115 226
1471 3300048912 Ga0496109_0644880 Ga0496109_0644880_184_870 226
1472 3300048912 Ga0496109_0774993 Ga0496109_0774993_54_734 226
1473 3300048913 Ga0496110_0026206 Ga0496110_0026206_558_1247 226
1474 3300048913 Ga0496110_0053094 Ga0496110_0053094_2673_3359 226
1475 3300048913 Ga0496110_0067178 Ga0496110_0067178_427_1122 226
1476 3300048913 Ga0496110_0149899 Ga0496110_0149899_802_1482 226
1477 3300048913 Ga0496110_0177020 Ga0496110_0177020_479_1165 226
1478 3300048914 Ga0496111_0009126 Ga0496111_0009126_2666_3361 226
1479 3300048914 Ga0496111_0046808 Ga0496111_0046808_391_1077 226
1480 3300048914 Ga0496111_0123406 Ga0496111_0123406_1005_1697 226
1481 3300048914 Ga0496111_0139025 Ga0496111_0139025_332_1021 226
1482 3300048914 Ga0496111_0367624 Ga0496111_0367624_85_774 226
1483 3300048915 Ga0496112_0000004 Ga0496112_0000004_268403_269089 226
1484 3300048915 Ga0496112_0043290 Ga0496112_0043290_1463_2152 226
1485 3300048915 Ga0496112_0044258 Ga0496112_0044258_3336_4028 226
1486 3300048915 Ga0496112_0068208 Ga0496112_0068208_1343_2029 226
1487 3300048915 Ga0496112_0128423 Ga0496112_0128423_1375_2061 226
1488 3300048915 Ga0496112_0145582 Ga0496112_0145582_211_906 226
1489 3300048915 Ga0496112_0163031 Ga0496112_0163031_1235_1930 226
1490 3300048915 Ga0496112_0286820 Ga0496112_0286820_13_702 226
1491 3300048915 Ga0496112_0655136 Ga0496112_0655136_86_775 226
1492 3300048916 Ga0496113_0003899 Ga0496113_0003899_3310_3996 226
1493 3300048916 Ga0496113_0025279 Ga0496113_0025279_2975_3661 226
1494 3300048916 Ga0496113_0029742 Ga0496113_0029742_1086_1775 226
1495 3300048916 Ga0496113_0058245 Ga0496113_0058245_269_958 226
1496 3300048916 Ga0496113_0060028 Ga0496113_0060028_59_751 226
1497 3300048916 Ga0496113_0163310 Ga0496113_0163310_871_1566 226
1498 3300048916 Ga0496113_0305047 Ga0496113_0305047_505_1191 226
1499 3300048917 Ga0496114_0009279 Ga0496114_0009279_3647_4336 226
1500 3300048917 Ga0496114_0035386 Ga0496114_0035386_1836_2531 226
1501 3300048917 Ga0496114_0100069 Ga0496114_0100069_1680_2372 226
1502 3300048917 Ga0496114_0191204 Ga0496114_0191204_70_759 226
1503 3300048918 Ga0496115_0018582 Ga0496115_0018582_4599_5294 226
1504 3300048918 Ga0496115_0023272 Ga0496115_0023272_1226_1915 226
1505 3300048918 Ga0496115_0155365 Ga0496115_0155365_140_832 226
1506 3300048918 Ga0496115_0347336 Ga0496115_0347336_117_803 226
1507 3300048918 Ga0496115_0410117 Ga0496115_0410117_156_851 226
1508 3300048918 Ga0496115_0540866 Ga0496115_0540866_40_726 226
1509 3300048919 Ga0496116_0017544 Ga0496116_0017544_995_1705 226
1510 3300048919 Ga0496116_0023210 Ga0496116_0023210_3821_4516 226
1511 3300048919 Ga0496116_0040863 Ga0496116_0040863_2099_2791 226
1512 3300048920 Ga0496117_0011613 Ga0496117_0011613_1750_2430 226
1513 3300048920 Ga0496117_0103657 Ga0496117_0103657_734_1444 226
1514 3300048920 Ga0496117_0214359 Ga0496117_0214359_330_1019 226
1515 3300048920 Ga0496117_0295281 Ga0496117_0295281_46_732 226
1516 3300048921 Ga0496118_0004793 Ga0496118_0004793_5921_6601 226
1517 3300048921 Ga0496118_0045464 Ga0496118_0045464_633_1325 226
1518 3300048921 Ga0496118_0056547 Ga0496118_0056547_1062_1772 226
1519 3300048921 Ga0496118_0062107 Ga0496118_0062107_1682_2377 226
1520 3300048921 Ga0496118_0070914 Ga0496118_0070914_1255_1944 226
1521 3300048921 Ga0496118_0071819 Ga0496118_0071819_643_1353 226
1522 3300048921 Ga0496118_0265931 Ga0496118_0265931_27_725 226
1523 3300048922 Ga0496119_0009808 Ga0496119_0009808_460_1146 226
1524 3300048922 Ga0496119_0028133 Ga0496119_0028133_1876_2562 226
1525 3300048922 Ga0496119_0125808 Ga0496119_0125808_185_877 226
1526 3300048923 Ga0496120_0019815 Ga0496120_0019815_2192_2878 226
1527 3300048923 Ga0496120_0038353 Ga0496120_0038353_448_1158 226
1528 3300048923 Ga0496120_0187901 Ga0496120_0187901_139_828 226
1529 3300048923 Ga0496120_0199312 Ga0496120_0199312_103_795 226
1530 3300048924 Ga0496121_0000458 Ga0496121_0000458_25097_25792 226
1531 3300048924 Ga0496121_0001749 Ga0496121_0001749_1547_2227 226
1532 3300048924 Ga0496121_0002564 Ga0496121_0002564_11178_11867 226
1533 3300048924 Ga0496121_0006706 Ga0496121_0006706_9256_9966 226
1534 3300048924 Ga0496121_0019210 Ga0496121_0019210_813_1502 226
1535 3300048924 Ga0496121_0030046 Ga0496121_0030046_3024_3719 226
1536 3300048924 Ga0496121_0037369 Ga0496121_0037369_1042_1728 226
1537 3300048924 Ga0496121_0039959 Ga0496121_0039959_2946_3638 226
1538 3300048924 Ga0496121_0100872 Ga0496121_0100872_19_711 226
1539 3300048924 Ga0496121_0102319 Ga0496121_0102319_933_1622 226
1540 3300048924 Ga0496121_0110683 Ga0496121_0110683_1161_1841 226
1541 3300048924 Ga0496121_0137910 Ga0496121_0137910_249_947 226
1542 3300048924 Ga0496121_0143496 Ga0496121_0143496_1040_1726 226
1543 3300048924 Ga0496121_0461321 Ga0496121_0461321_12_701 226
1544 3300048925 Ga0496122_0005205 Ga0496122_0005205_5433_6152 226
1545 3300048925 Ga0496122_0089726 Ga0496122_0089726_383_1093 226
1546 3300048925 Ga0496122_0151155 Ga0496122_0151155_709_1416 226
1547 3300048926 Ga0496123_0001216 Ga0496123_0001216_21381_22100 226
1548 3300048926 Ga0496123_0056943 Ga0496123_0056943_548_1258 226
1549 3300048926 Ga0496123_0136293 Ga0496123_0136293_284_988 226
1550 3300048927 Ga0496124_0004472 Ga0496124_0004472_7166_7846 226
1551 3300048927 Ga0496124_0049471 Ga0496124_0049471_1366_2070 226
1552 3300048927 Ga0496124_0135267 Ga0496124_0135267_1147_1842 226
1553 3300048927 Ga0496124_0318172 Ga0496124_0318172_293_1003 226
1554 3300048927 Ga0496124_0331410 Ga0496124_0331410_282_968 226
1555 3300048927 Ga0496124_0401643 Ga0496124_0401643_114_806 226
1556 3300048928 Ga0496125_0028317 Ga0496125_0028317_3207_3893 226
1557 3300048928 Ga0496125_0035050 Ga0496125_0035050_3660_4370 226
1558 3300048928 Ga0496125_0063116 Ga0496125_0063116_1984_2694 226
1559 3300048928 Ga0496125_0130191 Ga0496125_0130191_365_1045 226
1560 3300048928 Ga0496125_0163747 Ga0496125_0163747_59_745 226
1561 3300048928 Ga0496125_0347958 Ga0496125_0347958_54_749 226
1562 3300048928 Ga0496125_0379986 Ga0496125_0379986_30_710 226
1563 3300048929 Ga0496126_0003477 Ga0496126_0003477_14486_15178 226
1564 3300048929 Ga0496126_0009236 Ga0496126_0009236_9542_10225 226
1565 3300048929 Ga0496126_0014283 Ga0496126_0014283_4245_4931 226
1566 3300048929 Ga0496126_0022627 Ga0496126_0022627_77_766 226
1567 3300048929 Ga0496126_0022855 Ga0496126_0022855_4679_5368 226
1568 3300048929 Ga0496126_0039174 Ga0496126_0039174_1026_1727 226
1569 3300048929 Ga0496126_0082444 Ga0496126_0082444_1803_2489 226
1570 3300048929 Ga0496126_0083970 Ga0496126_0083970_1399_2088 226
1571 3300048929 Ga0496126_0091207 Ga0496126_0091207_1718_2413 226
1572 3300048929 Ga0496126_0161207 Ga0496126_0161207_1211_1903 226
1573 3300048929 Ga0496126_0170985 Ga0496126_0170985_929_1621 226
1574 3300048929 Ga0496126_0178540 Ga0496126_0178540_579_1352 226
1575 3300048929 Ga0496126_0396835 Ga0496126_0396835_123_809 226
1576 3300048929 Ga0496126_0729716 Ga0496126_0729716_44_754 226
1577 3300048929 Ga0496126_0737877 Ga0496126_0737877_19_723 226
1578 3300048929 Ga0496126_0739013 Ga0496126_0739013_52_747 226
1579 3300049460 Ga0495682_0103925 Ga0495682_0103925_303_989 226
1580 3300049568 Ga0501031_0004417 Ga0501031_0004417_5012_5722 226
1581 3300049569 Ga0501032_0048106 Ga0501032_0048106_224_952 226
1582 3300049569 Ga0501032_0073698 Ga0501032_0073698_301_987 226
1583 3300049570 Ga0501033_0000827 Ga0501033_0000827_26163_26873 226
1584 3300049570 Ga0501033_0005609 Ga0501033_0005609_7396_8082 226
1585 3300049570 Ga0501033_0020768 Ga0501033_0020768_420_1100 226
1586 3300049570 Ga0501033_0192451 Ga0501033_0192451_671_1357 226
1587 3300049571 Ga0501034_0050134 Ga0501034_0050134_1923_2609 226
1588 3300049571 Ga0501034_0097719 Ga0501034_0097719_2110_2796 226
1589 3300049572 Ga0501036_0017788 Ga0501036_0017788_4626_5312 226
1590 3300049572 Ga0501036_0025415 Ga0501036_0025415_390_1100 226
1591 3300049572 Ga0501036_0159903 Ga0501036_0159903_970_1650 226
1592 3300049572 Ga0501036_0281244 Ga0501036_0281244_203_931 226
1593 3300049573 Ga0501037_0000888 Ga0501037_0000888_3589_4299 226
1594 3300049573 Ga0501037_0023604 Ga0501037_0023604_3013_3741 226
1595 3300049573 Ga0501037_0043447 Ga0501037_0043447_326_1012 226
1596 3300049574 Ga0501038_0000999 Ga0501038_0000999_4621_5349 226
1597 3300049574 Ga0501038_0001121 Ga0501038_0001121_18022_18732 226
1598 3300049574 Ga0501038_0012358 Ga0501038_0012358_4576_5262 226
1599 3300049574 Ga0501038_0026754 Ga0501038_0026754_1079_1783 226
1600 3300049574 Ga0501038_0028683 Ga0501038_0028683_83_793 226
1601 3300049574 Ga0501038_0054303 Ga0501038_0054303_532_1212 226
1602 3300049574 Ga0501038_0378460 Ga0501038_0378460_361_1047 226
1603 3300049575 Ga0501039_0006162 Ga0501039_0006162_1304_1990 226
1604 3300049575 Ga0501039_0343199 Ga0501039_0343199_364_1074 226
1605 3300049577 Ga0501041_0287448 Ga0501041_0287448_252_962 226
1606 3300049579 Ga0501043_0013390 Ga0501043_0013390_364_1074 226
1607 3300049579 Ga0501043_0019654 Ga0501043_0019654_1164_1892 226
1608 3300049580 Ga0501046_0003985 Ga0501046_0003985_6702_7388 226
1609 3300049580 Ga0501046_0033529 Ga0501046_0033529_184_864 226
1610 3300049581 Ga0501047_0008455 Ga0501047_0008455_6243_6923 226
1611 3300049581 Ga0501047_0021518 Ga0501047_0021518_4224_4904 226
1612 3300049581 Ga0501047_0041733 Ga0501047_0041733_2268_2954 226
1613 3300049581 Ga0501047_0214787 Ga0501047_0214787_1016_1702 226
1614 3300049581 Ga0501047_0535426 Ga0501047_0535426_204_908 226
1615 3300049582 Ga0501048_0111842 Ga0501048_0111842_858_1547 226
1616 3300049582 Ga0501048_0182347 Ga0501048_0182347_323_1009 226
1617 3300049583 Ga0501067_0048309 Ga0501067_0048309_996_1685 226
1618 3300049583 Ga0501067_0147050 Ga0501067_0147050_280_960 226
1619 3300049583 Ga0501067_0244749 Ga0501067_0244749_153_881 226
1620 3300049584 Ga0501068_0003450 Ga0501068_0003450_1248_1934 226
1621 3300049585 Ga0501069_0045971 Ga0501069_0045971_1260_1946 226
1622 3300049586 Ga0501070_0002230 Ga0501070_0002230_6703_7389 226
1623 3300049586 Ga0501070_0024791 Ga0501070_0024791_2970_3656 226
1624 3300049587 Ga0501071_0204566 Ga0501071_0204566_418_1107 226
1625 3300049587 Ga0501071_0464840 Ga0501071_0464840_117_803 226
1626 3300049588 Ga0501072_0624194 Ga0501072_0624194_39_728 226
1627 3300049589 Ga0501073_0018870 Ga0501073_0018870_3340_4026 226
1628 3300049589 Ga0501073_0436788 Ga0501073_0436788_22_702 226
1629 3300049591 Ga0501075_0304417 Ga0501075_0304417_239_928 226
1630 3300049741 Ga0501079_0141817 Ga0501079_0141817_652_1362 226
1631 3300049742 Ga0501080_0015912 Ga0501080_0015912_6012_6698 226
1632 3300049742 Ga0501080_0024958 Ga0501080_0024958_1700_2380 226
1633 3300049744 Ga0501083_0211671 Ga0501083_0211671_355_1035 226
1634 3300049822 Ga0501035_0009850 Ga0501035_0009850_104_814 226
1635 3300049822 Ga0501035_0021012 Ga0501035_0021012_1612_2292 226
1636 3300049822 Ga0501035_0036839 Ga0501035_0036839_756_1484 226
1637 3300049822 Ga0501035_0065366 Ga0501035_0065366_1951_2637 226
1638 3300049822 Ga0501035_0101224 Ga0501035_0101224_421_1107 226
1639 3300049823 Ga0501044_0029450 Ga0501044_0029450_1780_2508 226
1640 3300049823 Ga0501044_0082994 Ga0501044_0082994_915_1625 226
1641 3300049823 Ga0501044_0151796 Ga0501044_0151796_1608_2288 226
1642 3300049823 Ga0501044_0278393 Ga0501044_0278393_520_1200 226
1643 3300049823 Ga0501044_0353486 Ga0501044_0353486_375_1061 226
1644 3300050489 nmdc:mga03683_58016_c1 nmdc:mga03683_58016_c1_600_1289 226
1645 3300050490 nmdc:mga03n38_866_c1 nmdc:mga03n38_866_c1_2416_3111 226
1646 3300050491 nmdc:mga00v17_167231_c1 nmdc:mga00v17_167231_c1_650_1345 226
1647 3300050491 nmdc:mga00v17_364542_c1 nmdc:mga00v17_364542_c1_145_834 226
1648 3300050492 nmdc:mga0yw44_156649_c1 nmdc:mga0yw44_156649_c1_420_1130 226
1649 3300050492 nmdc:mga0yw44_204888_c1 nmdc:mga0yw44_204888_c1_156_845 226
1650 3300050492 nmdc:mga0yw44_2331_c1 nmdc:mga0yw44_2331_c1_4006_4686 226
1651 3300050492 nmdc:mga0yw44_242690_c1 nmdc:mga0yw44_242690_c1_72_764 226
1652 3300050492 nmdc:mga0yw44_331786_c1 nmdc:mga0yw44_331786_c1_127_819 226
1653 3300050493 nmdc:mga0k408_18012_c1 nmdc:mga0k408_18012_c1_1430_2125 226
1654 3300050494 nmdc:mga06z11_103129_c1 nmdc:mga06z11_103129_c1_634_1338 226
1655 3300050494 nmdc:mga06z11_55066_c1 nmdc:mga06z11_55066_c1_1178_1864 226
1656 3300050494 nmdc:mga06z11_85073_c1 nmdc:mga06z11_85073_c1_924_1604 226
1657 3300050495 nmdc:mga04h51_12842_c1 nmdc:mga04h51_12842_c1_429_1115 226
1658 3300050496 nmdc:mga07m45_158907_c1 nmdc:mga07m45_158907_c1_218_922 226
1659 3300050496 nmdc:mga07m45_8361_c1 nmdc:mga07m45_8361_c1_1369_2064 226
1660 3300050496 nmdc:mga07m45_93596_c1 nmdc:mga07m45_93596_c1_400_1089 226
1661 3300050507 nmdc:mga05p37_63752_c1 nmdc:mga05p37_63752_c1_2559_3248 226
1662 3300050507 nmdc:mga05p37_824366_c1 nmdc:mga05p37_824366_c1_255_944 226
1663 3300050511 nmdc:mga08y16_83711_c1 nmdc:mga08y16_83711_c1_1437_2126 226
1664 3300050512 nmdc:mga0n895_281199_c1 nmdc:mga0n895_281199_c1_143_832 226
1665 3300050513 nmdc:mga0rr50_289107_c1 nmdc:mga0rr50_289107_c1_640_1329 226
1666 3300050516 nmdc:mga0sz30_176696_c1 nmdc:mga0sz30_176696_c1_193_873 226
1667 3300050516 nmdc:mga0sz30_38397_c1 nmdc:mga0sz30_38397_c1_158_868 226
1668 3300053077 Ga0495601_0074263 Ga0495601_0074263_969_1658 226
1669 3300053077 Ga0495601_0241907 Ga0495601_0241907_160_846 226
1670 3300053078 Ga0495612_0012354 Ga0495612_0012354_573_1262 226
1671 3300053080 Ga0500635_0021603 Ga0500635_0021603_463_1143 226
1672 3300053084 Ga0495595_0002435 Ga0495595_0002435_6483_7169 226
1673 3300053085 Ga0495619_0002051 Ga0495619_0002051_12181_12873 226
1674 3300053085 Ga0495619_0107032 Ga0495619_0107032_1129_1818 226
1675 3300053085 Ga0495619_0274955 Ga0495619_0274955_392_1078 226
1676 3300053087 Ga0500643_000035 Ga0500643_000035_10259_10948 226
1677 3300053087 Ga0500643_002043 Ga0500643_002043_646_1356 226
1678 3300053087 Ga0500643_095135 Ga0500643_095135_32_721 226
1679 3300053092 Ga0500583_0340185 Ga0500583_0340185_23_712 226
1680 3300053093 Ga0500651_0014239 Ga0500651_0014239_1997_2707 226
1681 3300053093 Ga0500651_0019792 Ga0500651_0019792_3416_4108 226
1682 3300053093 Ga0500651_0089411 Ga0500651_0089411_439_1149 226
1683 3300053094 Ga0500566_0000006 Ga0500566_0000006_32871_33581 226
1684 3300053094 Ga0500566_0003025 Ga0500566_0003025_7055_7765 226
1685 3300053094 Ga0500566_0007070 Ga0500566_0007070_3996_4685 226
1686 3300053094 Ga0500566_0020464 Ga0500566_0020464_2155_2835 226
1687 3300053094 Ga0500566_0050700 Ga0500566_0050700_1320_2000 226
1688 3300053094 Ga0500566_0122820 Ga0500566_0122820_127_825 226
1689 3300053095 Ga0500640_000606 Ga0500640_000606_8025_8735 226
1690 3300053096 Ga0500641_0002166 Ga0500641_0002166_6207_6899 226
1691 3300053096 Ga0500641_0009735 Ga0500641_0009735_1454_2143 226
1692 3300053096 Ga0500641_0023876 Ga0500641_0023876_712_1422 226
1693 3300053096 Ga0500641_0064774 Ga0500641_0064774_753_1442 226
1694 3300053098 Ga0500650_0027948 Ga0500650_0027948_1088_1798 226
1695 3300053098 Ga0500650_0094324 Ga0500650_0094324_661_1350 226
1696 3300053103 Ga0500555_006179 Ga0500555_006179_151_840 226
1697 3300053103 Ga0500555_077440 Ga0500555_077440_83_769 226
1698 3300053104 Ga0500556_0000030 Ga0500556_0000030_12808_13518 226
1699 3300053104 Ga0500556_0000734 Ga0500556_0000734_16986_17705 226
1700 3300053105 Ga0500557_000004 Ga0500557_000004_127641_128339 226
1701 3300053111 Ga0500572_000132 Ga0500572_000132_15800_16495 226
1702 3300053111 Ga0500572_000296 Ga0500572_000296_9953_10663 226
1703 3300053115 Ga0500591_007207 Ga0500591_007207_876_1586 226
1704 3300053116 Ga0500592_001857 Ga0500592_001857_1045_1755 226
1705 3300053118 Ga0500594_0015247 Ga0500594_0015247_343_1029 226
1706 3300053118 Ga0500594_0058113 Ga0500594_0058113_372_1058 226
1707 3300053119 Ga0500595_000306 Ga0500595_000306_20532_21221 226
1708 3300053119 Ga0500595_001509 Ga0500595_001509_6397_7101 226
1709 3300053119 Ga0500595_002915 Ga0500595_002915_2051_2746 226
1710 3300053119 Ga0500595_014140 Ga0500595_014140_2320_3006 226
1711 3300053119 Ga0500595_022512 Ga0500595_022512_778_1482 226
1712 3300053119 Ga0500595_025262 Ga0500595_025262_1326_2018 226
1713 3300053119 Ga0500595_084980 Ga0500595_084980_139_819 226
1714 3300053121 Ga0500607_055375 Ga0500607_055375_965_1675 226
1715 3300053122 Ga0500608_045969 Ga0500608_045969_287_985 226
1716 3300053123 Ga0500614_001796 Ga0500614_001796_3586_4296 226
1717 3300053123 Ga0500614_034971 Ga0500614_034971_476_1174 226
1718 3300053130 Ga0500642_0000080 Ga0500642_0000080_15435_16133 226
1719 3300053130 Ga0500642_0000302 Ga0500642_0000302_3222_3932 226
1720 3300053130 Ga0500642_0059969 Ga0500642_0059969_881_1657 226
1721 3300053130 Ga0500642_0145080 Ga0500642_0145080_212_901 226
1722 3300053131 Ga0500652_001386 Ga0500652_001386_6226_6936 226
1723 3300053133 Ga0500655_021935 Ga0500655_021935_306_995 226
1724 3300053136 Ga0500559_0000591 Ga0500559_0000591_4465_5160 226
1725 3300053136 Ga0500559_0000850 Ga0500559_0000850_8280_8990 226
1726 3300053136 Ga0500559_0001859 Ga0500559_0001859_7905_8615 226
1727 3300053136 Ga0500559_0067160 Ga0500559_0067160_557_1255 226
1728 3300053136 Ga0500559_0102365 Ga0500559_0102365_268_954 226
1729 3300053136 Ga0500559_0228383 Ga0500559_0228383_16_696 226
1730 3300053139 Ga0500568_0000978 Ga0500568_0000978_6915_7625 226
1731 3300053139 Ga0500568_0014813 Ga0500568_0014813_458_1153 226
1732 3300053139 Ga0500568_0023458 Ga0500568_0023458_1353_2042 226
1733 3300053139 Ga0500568_0110948 Ga0500568_0110948_56_829 226
1734 3300053139 Ga0500568_0162847 Ga0500568_0162847_86_772 226
1735 3300053146 Ga0500588_0059060 Ga0500588_0059060_176_868 226
1736 3300053146 Ga0500588_0060830 Ga0500588_0060830_239_949 226
1737 3300053146 Ga0500588_0128155 Ga0500588_0128155_146_835 226
1738 3300053150 Ga0500603_000125 Ga0500603_000125_10270_10980 226
1739 3300053150 Ga0500603_016027 Ga0500603_016027_997_1686 226
1740 3300053150 Ga0500603_021405 Ga0500603_021405_414_1124 226
1741 3300053150 Ga0500603_049058 Ga0500603_049058_410_1102 226
1742 3300053151 Ga0500604_0004650 Ga0500604_0004650_2209_2919 226
1743 3300053151 Ga0500604_0035375 Ga0500604_0035375_264_953 226
1744 3300053153 Ga0500616_0000252 Ga0500616_0000252_11946_12656 226
1745 3300053153 Ga0500616_0015478 Ga0500616_0015478_3626_4315 226
1746 3300053155 Ga0500620_001207 Ga0500620_001207_2882_3580 226
1747 3300053156 Ga0500622_0002597 Ga0500622_0002597_6670_7380 226
1748 3300053156 Ga0500622_0003061 Ga0500622_0003061_837_1526 226
1749 3300053156 Ga0500622_0088897 Ga0500622_0088897_12_716 226
1750 3300053158 Ga0500627_0279057 Ga0500627_0279057_23_703 226
1751 3300053159 Ga0500630_029525 Ga0500630_029525_1682_2392 226
1752 3300053161 Ga0500634_0007858 Ga0500634_0007858_4334_5044 226
1753 3300053161 Ga0500634_0119245 Ga0500634_0119245_478_1167 226
1754 3300053162 Ga0500638_001134 Ga0500638_001134_2667_3356 226
1755 3300053162 Ga0500638_032065 Ga0500638_032065_1707_2417 226
1756 3300053162 Ga0500638_045989 Ga0500638_045989_497_1183 226
1757 3300053162 Ga0500638_104409 Ga0500638_104409_426_1130 226
1758 3300053163 Ga0500639_000016 Ga0500639_000016_16461_17171 226
1759 3300053163 Ga0500639_043671 Ga0500639_043671_75_755 226
1760 3300053163 Ga0500639_197036 Ga0500639_197036_32_730 226
1761 3300053177 Ga0500636_0000066 Ga0500636_0000066_2417_3115 226
1762 3300053177 Ga0500636_0000534 Ga0500636_0000534_8986_9696 226
1763 3300053177 Ga0500636_0006053 Ga0500636_0006053_6169_6867 226
1764 3300053177 Ga0500636_0046789 Ga0500636_0046789_1528_2226 226
1765 3300053178 Ga0500637_0001307 Ga0500637_0001307_8586_9275 226
1766 3300053178 Ga0500637_0095998 Ga0500637_0095998_904_1584 226
1767 3300053725 Ga0500576_039982 Ga0500576_039982_544_1239 226
1768 3300053729 Ga0500625_000123 Ga0500625_000123_3914_4612 226
1769 3300053730 Ga0500645_015900 Ga0500645_015900_1172_1861 226
1770 3300053730 Ga0500645_051528 Ga0500645_051528_297_1016 226
1771 3300053736 Ga0500599_009161 Ga0500599_009161_31_720 226
1772 3300053737 Ga0500601_000139 Ga0500601_000139_6609_7310 226
1773 3300053737 Ga0500601_002260 Ga0500601_002260_1004_1714 226
1774 3300060353 Ga0501082_0797946 Ga0501082_0797946_97_786 226
1775 iso_pu_bacteria 2791355199 2793082406 226
1776 iso_pu_bacteria 2919450847 2919454503 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01728

FtsJ

FtsJ-like methyltransferase

93

271

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o9m-assembly1.cif.gz_n human mitochondrial ribosome large subunit assembly intermediate with mterf4-nsun4, mrm2, mtg1 and the malsu module 0.9571 17 223
7o9k-assembly1.cif.gz_n human mitochondrial ribosome large subunit assembly intermediate with mterf4-nsun4, mrm2, mtg1, the malsu module, gtpbp5 and mtef-tu 0.9528 44 223
8ia0-assembly1.cif.gz_CS cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state puf6 0.9274 33 226
8i9v-assembly1.cif.gz_CS cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state dbp10-2 0.9261 33 226
1ej0-assembly1.cif.gz_A ftsj rna methyltransferase complexed with s-adenosylmethionine, mercury derivative 0.9235 45 223
ID Description Score Start End Superfamily
af_P78860_27_218_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9389 44 223 3.40.50.150
af_Q58771_22_215_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9382 44 226 3.40.50.150
af_Q9VDT6_58_249_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9376 44 226 3.40.50.150
af_Q4CQP4_20_264_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9286 44 222 3.40.50.150
af_O62251_31_214_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9268 44 223 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3S5IZV3-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.9755 48 223 GO:0008650
AF-A0A1B3NIC8-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.9732 9 226 GO:0005737
GO:0008650
AF-A0A0K6HEM9-F1-model_v4 deleted 0.9731 8 226
AF-E0THU5-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.9726 9 225 GO:0005737
GO:0008650
AF-Q0AQH3-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.9724 9 223 GO:0005737
GO:0008650

Feature Viewer

pLDDT pTM Quality
89.65 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map