F495613
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1761 | 1273 | 928 | 246 |
Family's Representative Sequence
| Representative Sequence | 3300012513|Ga0157326_1003319|Ga0157326_10033193 |
| Length | 241 |
| Sequence | MADLRNYQSRAQTGEMIDQGLRAYMLKVYNLMALGLAITGVAAYLGFNFAVQDGQLTQFGVLLFQSPLRWVVILAPLAAVFFLSFRINSMSVAAAQTTFWVYAGLVGLSLSSIFLVYTGQSVVQTFFVTAFFGALSLYGYTTKRDLSAMGSFLVMGLFGLIIASIVNVFLASSAMQFAISVIGVLIFAGLTAYDTQRIKELYLEADDVAVAGRKAIMGALTLYLDFINLFMFLLQFMGNRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 6 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 7 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 8 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 9 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 10 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 11 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 12 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 13 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 14 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 15 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 16 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 17 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 18 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 19 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 20 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 21 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 22 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 23 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 24 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 25 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 26 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 27 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 28 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 29 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 30 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 31 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 32 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 33 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 34 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 35 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 36 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 37 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 38 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 39 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 40 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 41 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 42 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 43 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 44 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 45 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 46 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 47 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 48 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 49 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 50 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 51 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 52 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 53 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 54 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 55 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 56 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 57 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 58 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 59 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 60 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 61 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 62 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 63 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 64 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 65 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 66 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 67 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 68 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 69 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 70 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 71 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 72 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 73 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 74 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 75 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 76 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 77 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 78 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 79 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 80 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 81 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 82 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 83 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 84 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 85 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 86 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 87 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 88 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 89 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 90 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 91 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 92 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 93 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 94 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 95 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 96 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 97 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 98 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 99 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 100 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 101 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 102 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 103 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 104 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 105 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 106 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 107 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 108 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 109 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 110 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 111 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 112 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 113 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 114 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 115 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 116 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 117 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 118 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 119 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 120 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 121 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 122 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 123 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 124 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 125 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 126 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 127 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 128 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 129 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 130 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 131 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 132 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 133 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 134 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 135 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 136 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 137 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 138 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 139 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 140 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 141 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 142 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 143 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 144 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 145 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 146 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 147 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 148 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 149 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 150 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 151 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 152 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 153 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 154 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 155 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 156 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 157 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 158 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 159 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 160 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 161 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 162 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 163 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 164 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 165 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 166 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 167 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 168 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 169 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 170 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 171 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 172 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 173 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 174 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 175 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 176 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 177 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 178 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 179 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 180 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 181 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 182 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 183 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 184 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 185 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 186 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 187 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 188 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 189 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 190 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 191 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 192 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 193 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 194 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 195 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 196 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 197 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 198 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 199 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 200 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 201 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 202 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 203 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 204 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 205 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 206 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 207 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 208 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 209 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 210 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 211 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 212 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 213 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 214 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 215 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 216 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 217 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 218 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 219 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 220 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 221 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 222 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 223 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 224 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 225 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 226 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 227 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 228 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 229 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 230 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 231 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 232 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 233 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 234 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 235 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 236 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 237 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 238 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 239 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 240 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 241 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 242 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 243 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 244 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 245 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 246 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 247 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 248 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 249 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 250 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 251 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 252 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 253 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 254 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 255 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 256 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 257 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 258 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 259 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 260 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 261 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 262 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 263 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 264 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 265 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 266 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 267 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 268 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 269 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 270 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 271 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 272 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 273 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 274 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 275 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 276 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 277 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 278 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 279 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 280 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 281 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 282 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 283 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 284 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 285 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 286 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 287 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 288 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 289 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 290 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 291 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 292 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 293 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 294 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 295 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 296 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 297 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 298 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 299 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 300 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 301 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 302 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 303 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 304 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 305 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 306 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 307 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 308 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 309 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 310 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 311 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 312 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 313 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 314 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 315 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 316 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 317 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 318 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 319 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 320 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 321 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 322 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 323 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 324 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 325 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 326 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 327 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 328 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 329 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 330 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 331 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 332 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 333 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 334 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 335 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 336 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 337 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 338 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 339 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 340 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 341 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 342 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 343 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 344 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 345 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 346 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 347 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 348 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 349 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 350 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 351 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 352 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 353 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 354 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 355 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 356 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 357 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 358 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 359 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 360 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 361 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 362 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 363 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 364 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 365 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 366 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 367 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 368 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 369 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 370 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 371 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 372 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 373 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 374 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 375 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 376 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 377 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 378 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 379 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 380 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 381 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 382 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 383 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 384 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 385 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 386 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 387 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 388 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 389 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 390 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 391 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 392 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 393 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 394 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 395 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 396 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 397 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 398 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 399 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 400 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 401 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 402 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 403 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 404 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 405 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 406 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 407 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 408 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 409 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 410 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 411 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 412 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 413 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 414 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 415 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 416 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 417 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 418 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 419 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 420 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 421 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 422 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 423 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 424 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 425 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 426 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 427 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 428 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 429 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 430 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 431 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 432 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 433 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 434 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 435 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 436 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 437 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 438 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 439 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 440 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 441 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 442 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 443 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 444 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 445 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 446 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 447 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 448 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 449 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 450 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 451 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 452 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 453 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 454 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 455 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 456 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 457 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 458 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 459 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 460 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 461 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 462 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 463 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 464 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 465 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 466 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 467 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 468 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 469 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 470 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 471 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 472 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 473 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 474 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 475 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 476 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 477 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 478 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 479 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 480 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 481 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 482 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 483 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 484 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 485 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 486 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 487 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 488 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 489 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 490 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 491 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 492 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 493 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 494 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 495 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 496 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 497 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 498 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 499 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 500 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 501 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 502 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 503 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 504 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 505 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 506 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 507 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 508 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 509 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 510 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 511 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 512 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 513 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 514 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 515 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 516 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 517 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 518 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 519 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 520 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 521 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 522 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 523 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 524 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 525 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 526 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 527 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 528 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 529 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 530 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 531 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 532 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 533 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 534 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 535 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 536 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 537 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 538 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 539 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 540 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 541 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 542 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 543 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 544 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 545 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 546 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 547 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 548 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 549 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 550 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 551 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 552 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 553 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 554 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 555 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 556 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 557 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 558 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 559 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 560 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 561 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 562 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 563 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 564 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 565 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 566 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 567 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 568 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 569 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 570 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 571 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 572 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 573 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 574 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 575 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 576 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 577 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 578 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 579 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 580 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 581 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 582 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 583 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 584 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 585 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 586 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 587 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 588 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 589 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 590 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 591 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 592 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 593 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 594 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 595 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 596 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 597 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 598 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 599 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 600 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 601 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 602 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 603 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 604 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 605 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 606 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 607 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 608 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 609 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 610 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 611 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 612 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 613 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 614 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 615 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 616 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 617 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 618 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 619 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 620 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 621 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 622 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 623 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 624 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 625 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 626 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 627 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 628 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 629 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 630 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 631 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 632 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 633 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 634 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 635 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 636 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 637 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 638 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 639 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 640 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 641 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 642 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 643 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 644 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 645 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 646 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 647 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 648 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 649 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 650 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 651 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 652 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 653 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 654 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 655 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 656 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 657 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 658 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 659 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 660 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 661 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 662 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 663 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 664 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 665 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 666 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 667 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 668 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 669 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 670 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 671 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 672 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 673 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 674 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 675 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 676 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 677 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 678 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 679 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 680 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 681 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 682 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 683 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 684 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 685 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 686 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 687 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 688 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 689 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 690 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 691 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 692 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 693 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 694 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 695 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 696 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 697 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 698 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 699 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 700 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 701 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 702 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 703 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 704 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 705 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 706 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 707 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 708 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 709 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 710 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 711 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 712 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 713 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 714 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 715 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 716 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 717 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 718 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 719 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 720 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 721 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 722 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 723 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 724 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 725 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 726 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 727 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 728 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 729 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 730 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 731 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 732 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 733 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 734 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 735 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 736 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 737 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 738 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 739 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 740 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 741 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 742 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 743 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 744 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 745 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 746 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 747 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 748 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 749 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 750 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 751 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 752 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 753 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 754 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 755 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 756 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 757 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 758 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 759 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 760 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 761 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 762 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 763 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 764 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 765 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 766 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 767 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 768 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 769 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 770 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 771 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 772 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 773 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 774 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 775 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 776 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 777 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 778 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 779 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 780 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 781 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 782 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 783 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 784 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 785 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 786 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 787 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 788 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 789 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 790 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 791 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 792 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 793 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 794 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 795 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 796 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 797 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 798 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 799 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 800 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 801 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 802 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 803 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 804 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 805 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 806 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 807 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 808 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 809 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 810 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 811 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 812 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 813 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 814 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 815 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 816 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 817 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 818 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 819 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 820 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 821 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 822 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 823 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 824 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 825 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 826 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 827 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 828 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 829 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 830 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 831 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 832 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 833 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 834 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 835 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 836 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 837 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 838 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 839 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 840 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 841 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 842 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 843 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 844 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 845 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 846 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 847 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 848 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 849 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 850 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 851 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 852 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 853 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 854 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 855 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 856 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 857 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 858 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 859 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 860 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 861 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 862 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 863 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 864 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 865 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 866 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 867 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 868 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 869 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 870 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 871 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 872 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 873 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 874 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 875 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 876 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 877 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 878 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 879 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 880 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 881 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 882 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 883 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 884 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 885 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 886 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 887 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 888 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 889 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 890 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 891 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 892 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 893 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 894 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 895 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 896 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 897 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 898 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 899 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 900 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 901 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 902 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 903 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 904 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 905 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 906 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 907 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 908 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 909 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 910 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 911 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 912 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 913 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 914 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 915 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 916 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 917 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 918 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 919 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 920 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 921 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 922 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 923 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 924 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 925 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 926 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 927 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 928 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 929 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 930 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 931 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 932 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 933 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 934 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 935 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 936 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 937 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 938 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 939 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 940 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 941 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 942 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 943 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 944 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 945 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 946 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 947 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 948 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 949 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 950 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 951 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 952 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 953 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 954 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 955 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 956 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 957 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 958 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 959 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 960 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 961 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 962 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 963 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 964 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 965 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 966 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 967 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 968 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 969 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 970 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 971 | 3300029283 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 | Metatranscriptome | Rhizosphere |
| 972 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 973 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 974 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 975 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 976 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 977 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 978 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 979 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 980 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 981 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 982 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 983 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 984 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 985 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 986 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 987 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 988 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 989 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 990 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 991 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 992 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 993 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 994 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 995 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 996 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 997 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 998 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 999 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 1000 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 1001 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 1002 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 1003 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 1004 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 1005 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 1006 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 1007 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 1008 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 1009 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 1010 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 1011 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 1012 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 1013 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 1014 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 1015 | 3300041454 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT | Metatranscriptome | Rhizoplane |
| 1016 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 1017 | 3300041464 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT | Metatranscriptome | Rhizoplane |
| 1018 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 1019 | 3300041499 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaT | Metatranscriptome | Unclassified |
| 1020 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 1021 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 1022 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 1023 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 1024 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 1025 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 1026 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 1027 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 1028 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 1029 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 1030 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 1031 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 1032 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 1033 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 1034 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 1035 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 1036 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 1037 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 1038 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 1039 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 1040 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 1041 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 1042 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 1043 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 1044 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 1045 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 1046 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 1047 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 1048 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 1049 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 1050 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 1051 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 1052 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 1053 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 1054 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 1055 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 1056 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 1057 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 1058 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 1059 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 1060 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 1061 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 1062 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 1063 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 1064 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 1065 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 1066 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 1067 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 1068 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 1069 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 1070 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 1071 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 1072 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 1073 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 1074 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 1075 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 1076 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 1077 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 1078 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 1079 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 1080 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 1081 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 1082 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 1083 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 1084 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 1085 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 1086 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 1087 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 1088 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 1089 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 1090 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 1091 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 1092 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 1093 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 1094 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 1095 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 1096 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1097 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1098 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1099 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1100 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1101 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1102 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1103 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1104 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1105 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1106 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1107 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1108 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1109 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1110 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1111 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1112 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1113 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1114 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1115 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1116 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1117 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1118 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1119 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1120 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1121 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1122 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1123 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1124 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1125 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1126 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1127 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1128 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1129 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1130 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1131 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1132 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1133 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1134 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1135 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1136 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1137 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 1138 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 1139 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 1140 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 1141 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 1142 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 1143 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 1144 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 1145 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 1146 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 1147 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 1148 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 1149 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 1150 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 1151 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 1152 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 1153 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 1154 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 1155 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 1156 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 1157 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 1158 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 1159 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 1160 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 1161 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 1162 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 1163 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1164 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 1165 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 1166 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 1167 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1168 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1169 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 1170 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 1171 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 1172 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 1173 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1174 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1175 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1176 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1177 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1178 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1179 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1180 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1181 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1182 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1183 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1184 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1185 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1186 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1187 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1188 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1189 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1190 | 3300059609 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1191 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1192 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1193 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1194 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1195 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1196 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1197 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1198 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1199 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1200 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1201 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1202 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1203 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1204 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1205 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 1206 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1207 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1208 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1209 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1210 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1211 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1212 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 1213 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1214 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1215 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1216 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1217 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1218 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1219 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1220 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1221 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 1222 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1223 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1224 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1225 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1226 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1227 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1228 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1229 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1230 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1231 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1232 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1233 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1234 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1235 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1236 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1237 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1238 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1239 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1240 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1241 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1242 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1243 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1244 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1245 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1246 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1247 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1248 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1249 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1250 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 1251 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1252 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1253 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1254 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1255 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1256 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1257 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1258 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1259 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 1260 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1261 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1262 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1263 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1264 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1265 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1266 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 1267 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 1268 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1269 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1270 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1271 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1272 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1273 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 48.1 |
| Metatranscriptomes | 4.6 |
| Isolates | 47.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.28 |
| Bulb | 0 |
| Endosphere | 9.6 |
| Nodule | 36.74 |
| Rhizoplane | 1.93 |
| Rhizosphere | 39.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10038081 | 3300001979 | Bacteria | 1478 |
| 2 | JGI24740J21852_10077057 | 3300001979 | Bacteria | 880 |
| 3 | JGI24739J22299_10055633 | 3300001989 | Bacteria | 1264 |
| 4 | JGI24743J22301_10037076 | 3300001991 | Bacteria | 971 |
| 5 | JGI24735J21928_10035258 | 3300002067 | Bacteria | 1472 |
| 6 | JGI24735J21928_10095477 | 3300002067 | Bacteria | 853 |
| 7 | JGI25155J39150_1000010 | 3300002704 | Bacteria | 207717 |
| 8 | JGI25156J39149_1000102 | 3300002705 | Bacteria | 62463 |
| 9 | JGI25156J39149_1009778 | 3300002705 | Bacteria | 2303 |
| 10 | JGI25162J39368_1001052 | 3300002737 | Bacteria | 16925 |
| 11 | JGI25162J39368_1001061 | 3300002737 | Bacteria | 16807 |
| 12 | JGI25154J39366_1000184 | 3300002738 | Bacteria | 48243 |
| 13 | JGI25158J39367_1000061 | 3300002739 | Bacteria | 24434 |
| 14 | JGI25157J39369_1000009 | 3300002741 | Bacteria | 207868 |
| 15 | JGI25157J39369_1001314 | 3300002741 | Bacteria | 9892 |
| 16 | JGI25152J39213_1002753 | 3300002773 | Bacteria | 6388 |
| 17 | JGI25152J39213_1002993 | 3300002773 | Bacteria | 5984 |
| 18 | JGI25152J39213_1004278 | 3300002773 | Bacteria | 4555 |
| 19 | JGI25150J39212_1000037 | 3300002774 | Bacteria | 88885 |
| 20 | JGI25150J39212_1021423 | 3300002774 | Bacteria | 983 |
| 21 | JGI25159J45721_1012147 | 3300002987 | Bacteria | 2070 |
| 22 | JGI25151J46595_10000220 | 3300003187 | Bacteria | 67327 |
| 23 | JGI25151J46595_10068304 | 3300003187 | Bacteria | 1091 |
| 24 | JGI25165J46597_1001126 | 3300003214 | Bacteria | 16807 |
| 25 | JGI25160J50197_1005889 | 3300003354 | Bacteria | 5038 |
| 26 | JGI25160J50197_1035580 | 3300003354 | Bacteria | 1220 |
| 27 | JGI25161J50226_1000137 | 3300003374 | Bacteria | 50627 |
| 28 | Ga0007427J51700_109799 | 3300003559 | Bacteria | 845 |
| 29 | Ga0006562J51391_1002937 | 3300003578 | Bacteria | 3750 |
| 30 | Ga0006562J51391_1003164 | 3300003578 | Bacteria | 843 |
| 31 | Ga0006562J51391_1003372 | 3300003578 | Bacteria | 1020 |
| 32 | Ga0032354_1026988 | 3300003693 | Bacteria | 856 |
| 33 | Ga0055539_1004440 | 3300003752 | Bacteria | 1869 |
| 34 | Ga0055529_1004728 | 3300003763 | Bacteria | 2044 |
| 35 | Ga0055526_1003979 | 3300003771 | Bacteria | 9100 |
| 36 | Ga0055526_1008345 | 3300003771 | Bacteria | 5191 |
| 37 | Ga0055526_1013997 | 3300003771 | Bacteria | 3341 |
| 38 | Ga0055524_1001868 | 3300003775 | Bacteria | 11508 |
| 39 | Ga0055524_1005075 | 3300003775 | Bacteria | 5955 |
| 40 | Ga0055524_1032827 | 3300003775 | Bacteria | 1464 |
| 41 | Ga0055528_1002500 | 3300003790 | Bacteria | 9814 |
| 42 | Ga0055528_1004711 | 3300003790 | Bacteria | 6509 |
| 43 | Ga0055528_1005546 | 3300003790 | Bacteria | 5848 |
| 44 | Ga0055528_1006903 | 3300003790 | Bacteria | 5091 |
| 45 | Ga0055528_1017730 | 3300003790 | Bacteria | 2452 |
| 46 | Ga0055540_1001660 | 3300003792 | Bacteria | 12897 |
| 47 | Ga0055540_1003634 | 3300003792 | Bacteria | 7353 |
| 48 | Ga0055531_10018117 | 3300003794 | Bacteria | 2927 |
| 49 | Ga0058692_1002779 | 3300003856 | Bacteria | 5755 |
| 50 | Ga0058692_1005607 | 3300003856 | Bacteria | 3557 |
| 51 | Ga0055543_1000433 | 3300004625 | Bacteria | 25933 |
| 52 | Ga0065165_1003519 | 3300005262 | Bacteria | 10867 |
| 53 | Ga0065165_1007334 | 3300005262 | Bacteria | 5460 |
| 54 | Ga0070670_100000116 | 3300005331 | Bacteria | 74586 |
| 55 | Ga0070680_100006198 | 3300005336 | Bacteria | 9071 |
| 56 | Ga0070680_100027023 | 3300005336 | Bacteria | 4595 |
| 57 | Ga0070682_100601182 | 3300005337 | Bacteria | 868 |
| 58 | Ga0068868_100141002 | 3300005338 | Bacteria | 1979 |
| 59 | Ga0070660_100000020 | 3300005339 | Bacteria | 98286 |
| 60 | Ga0070668_100015601 | 3300005347 | Bacteria | 5679 |
| 61 | Ga0070668_100434563 | 3300005347 | Bacteria | 1126 |
| 62 | Ga0070669_100057569 | 3300005353 | Bacteria | 2852 |
| 63 | Ga0070669_100115407 | 3300005353 | Bacteria | 2043 |
| 64 | Ga0070669_100173302 | 3300005353 | Bacteria | 1683 |
| 65 | Ga0070671_100012277 | 3300005355 | Bacteria | 6894 |
| 66 | Ga0070673_100034031 | 3300005364 | Bacteria | 3852 |
| 67 | Ga0070659_100000047 | 3300005366 | Bacteria | 98286 |
| 68 | Ga0070659_100140961 | 3300005366 | Bacteria | 1963 |
| 69 | Ga0070667_100418151 | 3300005367 | Bacteria | 1222 |
| 70 | Ga0070713_100209208 | 3300005436 | Bacteria | 1765 |
| 71 | Ga0070705_100399940 | 3300005440 | Bacteria | 1017 |
| 72 | Ga0070663_100005665 | 3300005455 | Bacteria | 7441 |
| 73 | Ga0070663_100114662 | 3300005455 | Bacteria | 2029 |
| 74 | Ga0070662_100648312 | 3300005457 | Bacteria | 891 |
| 75 | Ga0070681_10000010 | 3300005458 | Bacteria | 140126 |
| 76 | Ga0070681_10005513 | 3300005458 | Bacteria | 12226 |
| 77 | Ga0070681_10056435 | 3300005458 | Bacteria | 3908 |
| 78 | Ga0068867_100365757 | 3300005459 | Bacteria | 1208 |
| 79 | Ga0070679_100001075 | 3300005530 | Bacteria | 23895 |
| 80 | Ga0070679_100031668 | 3300005530 | Bacteria | 5227 |
| 81 | Ga0070679_100086982 | 3300005530 | Bacteria | 3112 |
| 82 | Ga0070697_100408525 | 3300005536 | Bacteria | 1179 |
| 83 | Ga0068853_100005537 | 3300005539 | Bacteria | 9905 |
| 84 | Ga0070696_100008510 | 3300005546 | Bacteria | 6870 |
| 85 | Ga0070696_100030767 | 3300005546 | Bacteria | 3677 |
| 86 | Ga0070665_100004011 | 3300005548 | Bacteria | 15524 |
| 87 | Ga0070665_100021286 | 3300005548 | Bacteria | 6521 |
| 88 | Ga0070704_100017621 | 3300005549 | Bacteria | 4547 |
| 89 | Ga0068855_100027087 | 3300005563 | Bacteria | 6858 |
| 90 | Ga0068855_100113501 | 3300005563 | Bacteria | 3108 |
| 91 | Ga0068855_100305394 | 3300005563 | Bacteria | 1761 |
| 92 | Ga0068855_100715821 | 3300005563 | Bacteria | 1070 |
| 93 | Ga0068857_100181861 | 3300005577 | Bacteria | 1913 |
| 94 | Ga0068854_100101418 | 3300005578 | Bacteria | 2158 |
| 95 | Ga0068854_100182740 | 3300005578 | Bacteria | 1639 |
| 96 | Ga0068856_100252543 | 3300005614 | Bacteria | 1778 |
| 97 | Ga0068856_100444889 | 3300005614 | Bacteria | 1316 |
| 98 | Ga0068852_100212449 | 3300005616 | Bacteria | 1836 |
| 99 | Ga0068852_100491483 | 3300005616 | Bacteria | 1221 |
| 100 | Ga0068851_10096773 | 3300005834 | Bacteria | 1561 |
| 101 | Ga0068863_100521021 | 3300005841 | Bacteria | 1172 |
| 102 | Ga0068858_100117226 | 3300005842 | Bacteria | 2489 |
| 103 | Ga0068858_100157053 | 3300005842 | Bacteria | 2140 |
| 104 | Ga0068860_100145567 | 3300005843 | Bacteria | 2280 |
| 105 | Ga0068862_100195314 | 3300005844 | Bacteria | 1823 |
| 106 | Ga0068862_100199410 | 3300005844 | Bacteria | 1804 |
| 107 | Ga0081538_10050330 | 3300005981 | Bacteria | 2517 |
| 108 | Ga0081539_10000690 | 3300005985 | Bacteria | 67656 |
| 109 | Ga0081539_10004943 | 3300005985 | Bacteria | 14171 |
| 110 | Ga0075365_10000270 | 3300006038 | Bacteria | 17782 |
| 111 | Ga0075365_10026456 | 3300006038 | Bacteria | 3684 |
| 112 | Ga0075365_10089590 | 3300006038 | Bacteria | 2094 |
| 113 | Ga0075365_10362224 | 3300006038 | Bacteria | 1022 |
| 114 | Ga0075368_10030823 | 3300006042 | Bacteria | 2078 |
| 115 | Ga0075364_10146058 | 3300006051 | Bacteria | 1592 |
| 116 | Ga0075364_10256754 | 3300006051 | Bacteria | 1188 |
| 117 | Ga0075362_10014524 | 3300006177 | Bacteria | 3180 |
| 118 | Ga0075362_10117247 | 3300006177 | Bacteria | 1257 |
| 119 | Ga0075367_10000078 | 3300006178 | Bacteria | 25393 |
| 120 | Ga0075367_10029691 | 3300006178 | Bacteria | 3130 |
| 121 | Ga0075367_10045738 | 3300006178 | Bacteria | 2569 |
| 122 | Ga0075367_10169485 | 3300006178 | Bacteria | 1360 |
| 123 | Ga0075369_10067768 | 3300006186 | Bacteria | 1567 |
| 124 | Ga0075366_10085787 | 3300006195 | Bacteria | 1883 |
| 125 | Ga0075366_10233095 | 3300006195 | Bacteria | 1122 |
| 126 | Ga0075370_10076142 | 3300006353 | Bacteria | 1924 |
| 127 | Ga0075370_10079154 | 3300006353 | Bacteria | 1888 |
| 128 | Ga0075370_10079900 | 3300006353 | Bacteria | 1879 |
| 129 | Ga0075370_10174540 | 3300006353 | Bacteria | 1264 |
| 130 | Ga0075428_100740915 | 3300006844 | Bacteria | 1046 |
| 131 | Ga0075431_100020391 | 3300006847 | Bacteria | 6773 |
| 132 | Ga0075433_10320624 | 3300006852 | Bacteria | 1371 |
| 133 | Ga0075434_100084518 | 3300006871 | Bacteria | 3172 |
| 134 | Ga0075434_100098722 | 3300006871 | Bacteria | 2926 |
| 135 | Ga0075434_100103423 | 3300006871 | Bacteria | 2856 |
| 136 | Ga0068865_100269196 | 3300006881 | Bacteria | 1352 |
| 137 | Ga0075436_100012045 | 3300006914 | Bacteria | 5931 |
| 138 | Ga0075436_100076116 | 3300006914 | Bacteria | 2324 |
| 139 | Ga0075435_100141712 | 3300007076 | Bacteria | 2017 |
| 140 | Ga0105250_10004360 | 3300009092 | Bacteria | 6519 |
| 141 | Ga0105250_10021237 | 3300009092 | Bacteria | 2621 |
| 142 | Ga0105240_10000013 | 3300009093 | Bacteria | 483458 |
| 143 | Ga0105240_10011135 | 3300009093 | Bacteria | 12566 |
| 144 | Ga0105240_10250829 | 3300009093 | Bacteria | 2047 |
| 145 | Ga0105240_10501254 | 3300009093 | Bacteria | 1350 |
| 146 | Ga0105240_10654649 | 3300009093 | Bacteria | 1151 |
| 147 | Ga0105247_10075884 | 3300009101 | Bacteria | 2110 |
| 148 | Ga0105247_10076292 | 3300009101 | Bacteria | 2104 |
| 149 | Ga0114129_10011337 | 3300009147 | Bacteria | 12697 |
| 150 | Ga0105243_10079313 | 3300009148 | Bacteria | 2676 |
| 151 | Ga0105243_10123484 | 3300009148 | Bacteria | 2187 |
| 152 | Ga0105243_10213017 | 3300009148 | Bacteria | 1702 |
| 153 | Ga0105243_10595485 | 3300009148 | Bacteria | 1064 |
| 154 | Ga0105243_10623038 | 3300009148 | Bacteria | 1042 |
| 155 | Ga0105241_10849041 | 3300009174 | Bacteria | 844 |
| 156 | Ga0105248_10013921 | 3300009177 | Bacteria | 8851 |
| 157 | Ga0105237_10034241 | 3300009545 | Bacteria | 5144 |
| 158 | Ga0105237_10038473 | 3300009545 | Bacteria | 4830 |
| 159 | Ga0105237_10140495 | 3300009545 | Bacteria | 2409 |
| 160 | Ga0105237_10168486 | 3300009545 | Bacteria | 2190 |
| 161 | Ga0105238_10005332 | 3300009551 | Bacteria | 12703 |
| 162 | Ga0105238_10009792 | 3300009551 | Bacteria | 9593 |
| 163 | Ga0105238_10344342 | 3300009551 | Bacteria | 1479 |
| 164 | Ga0105249_10178565 | 3300009553 | Bacteria | 2064 |
| 165 | Ga0123340_1040891 | 3300009763 | Bacteria | 2157 |
| 166 | Ga0123341_1000009 | 3300009765 | Bacteria | 122597 |
| 167 | Ga0123341_1055213 | 3300009765 | Bacteria | 2108 |
| 168 | Ga0123342_1009724 | 3300009766 | Bacteria | 11342 |
| 169 | Ga0123342_1034152 | 3300009766 | Bacteria | 2259 |
| 170 | Ga0105239_10000820 | 3300010375 | Bacteria | 44190 |
| 171 | Ga0105239_10002698 | 3300010375 | Bacteria | 22316 |
| 172 | Ga0105239_10010060 | 3300010375 | Bacteria | 10602 |
| 173 | Ga0105239_10035669 | 3300010375 | Bacteria | 5461 |
| 174 | Ga0105239_10246399 | 3300010375 | Bacteria | 2006 |
| 175 | Ga0105239_10386213 | 3300010375 | Bacteria | 1583 |
| 176 | Ga0105246_10179528 | 3300011119 | Bacteria | 1629 |
| 177 | Ga0157344_1001511 | 3300012476 | Bacteria | 1119 |
| 178 | Ga0157326_1003319 | 3300012513 | Bacteria | 1695 |
| 179 | Ga0157373_10003539 | 3300013100 | Bacteria | 11797 |
| 180 | Ga0157373_10013897 | 3300013100 | Bacteria | 5904 |
| 181 | Ga0157373_10015389 | 3300013100 | Bacteria | 5592 |
| 182 | Ga0157371_10000108 | 3300013102 | Bacteria | 126288 |
| 183 | Ga0157371_10018609 | 3300013102 | Bacteria | 5132 |
| 184 | Ga0157370_10002495 | 3300013104 | Bacteria | 22179 |
| 185 | Ga0157370_10004314 | 3300013104 | Bacteria | 16344 |
| 186 | Ga0157370_10008875 | 3300013104 | Bacteria | 10805 |
| 187 | Ga0157370_10062213 | 3300013104 | Bacteria | 3541 |
| 188 | Ga0157370_10104424 | 3300013104 | Bacteria | 2652 |
| 189 | Ga0157370_10308314 | 3300013104 | Bacteria | 1461 |
| 190 | Ga0157369_10025178 | 3300013105 | Bacteria | 6606 |
| 191 | Ga0157369_10028357 | 3300013105 | Bacteria | 6197 |
| 192 | Ga0157369_10126588 | 3300013105 | Bacteria | 2708 |
| 193 | Ga0157369_10172253 | 3300013105 | Bacteria | 2280 |
| 194 | Ga0157378_10243186 | 3300013297 | Bacteria | 1720 |
| 195 | Ga0163162_10117870 | 3300013306 | Bacteria | 2757 |
| 196 | Ga0163162_10442404 | 3300013306 | Bacteria | 1432 |
| 197 | Ga0157372_10001645 | 3300013307 | Bacteria | 24280 |
| 198 | Ga0157372_10759888 | 3300013307 | Bacteria | 1127 |
| 199 | Ga0157375_10605948 | 3300013308 | Bacteria | 1254 |
| 200 | Ga0163163_10261064 | 3300014325 | Bacteria | 1783 |
| 201 | Ga0182008_10119652 | 3300014497 | Bacteria | 1309 |
| 202 | Ga0157379_10018880 | 3300014968 | Bacteria | 6084 |
| 203 | Ga0157376_10226366 | 3300014969 | Bacteria | 1735 |
| 204 | Ga0182006_1048187 | 3300015261 | Bacteria | 1649 |
| 205 | Ga0182007_10003160 | 3300015262 | Bacteria | 7893 |
| 206 | Ga0182005_1001581 | 3300015265 | Bacteria | 8979 |
| 207 | Ga0182005_1009966 | 3300015265 | Bacteria | 2744 |
| 208 | Ga0163161_10005528 | 3300017792 | Bacteria | 8755 |
| 209 | Ga0206356_10905856 | 3300020070 | Bacteria | 914 |
| 210 | Ga0206349_1464035 | 3300020075 | Bacteria | 898 |
| 211 | Ga0206355_1532750 | 3300020076 | Bacteria | 883 |
| 212 | Ga0206351_10295174 | 3300020077 | Bacteria | 1052 |
| 213 | Ga0206351_10386933 | 3300020077 | Bacteria | 928 |
| 214 | Ga0206352_11134782 | 3300020078 | Bacteria | 820 |
| 215 | Ga0206350_10165189 | 3300020080 | Bacteria | 943 |
| 216 | Ga0206350_10789658 | 3300020080 | Bacteria | 905 |
| 217 | Ga0206350_10800904 | 3300020080 | Bacteria | 951 |
| 218 | Ga0206354_10281947 | 3300020081 | Bacteria | 833 |
| 219 | Ga0206353_10082534 | 3300020082 | Bacteria | 822 |
| 220 | Ga0154015_1345373 | 3300020610 | Bacteria | 936 |
| 221 | Ga0213875_10000033 | 3300021388 | Bacteria | 170944 |
| 222 | Ga0209435_100009 | 3300025206 | Bacteria | 476614 |
| 223 | Ga0209436_100018 | 3300025208 | Bacteria | 113499 |
| 224 | Ga0209437_100057 | 3300025233 | Bacteria | 362922 |
| 225 | Ga0209437_100107 | 3300025233 | Bacteria | 218656 |
| 226 | Ga0207425_1000034 | 3300025245 | Bacteria | 227886 |
| 227 | Ga0207425_1002129 | 3300025245 | Bacteria | 7274 |
| 228 | Ga0209646_1000018 | 3300025246 | Bacteria | 476716 |
| 229 | Ga0209026_1000032 | 3300025250 | Bacteria | 322378 |
| 230 | Ga0209026_1000068 | 3300025250 | Bacteria | 207601 |
| 231 | Ga0209677_100199 | 3300025253 | Bacteria | 48030 |
| 232 | Ga0209148_1000111 | 3300025254 | Bacteria | 198095 |
| 233 | Ga0209759_1000007 | 3300025256 | Bacteria | 476614 |
| 234 | Ga0209759_1000142 | 3300025256 | Bacteria | 124090 |
| 235 | Ga0209759_1004146 | 3300025256 | Bacteria | 5523 |
| 236 | Ga0209129_1000118 | 3300025258 | Bacteria | 139972 |
| 237 | Ga0209129_1000253 | 3300025258 | Bacteria | 55709 |
| 238 | Ga0209129_1000971 | 3300025258 | Bacteria | 17232 |
| 239 | Ga0209129_1003727 | 3300025258 | Bacteria | 6451 |
| 240 | Ga0209129_1003990 | 3300025258 | Bacteria | 6073 |
| 241 | Ga0209129_1004733 | 3300025258 | Bacteria | 5161 |
| 242 | Ga0209129_1009453 | 3300025258 | Bacteria | 2568 |
| 243 | Ga0209233_1000072 | 3300025261 | Bacteria | 363074 |
| 244 | Ga0209233_1000118 | 3300025261 | Bacteria | 236172 |
| 245 | Ga0209233_1000134 | 3300025261 | Bacteria | 202535 |
| 246 | Ga0209233_1000479 | 3300025261 | Bacteria | 24402 |
| 247 | Ga0207666_1000023 | 3300025271 | Bacteria | 37093 |
| 248 | Ga0209455_1000223 | 3300025272 | Bacteria | 77481 |
| 249 | Ga0209455_1018745 | 3300025272 | Bacteria | 1413 |
| 250 | Ga0209673_1000033 | 3300025273 | Bacteria | 335369 |
| 251 | Ga0209673_1000052 | 3300025273 | Bacteria | 279795 |
| 252 | Ga0209673_1000953 | 3300025273 | Bacteria | 36121 |
| 253 | Ga0209673_1000975 | 3300025273 | Bacteria | 35311 |
| 254 | Ga0209673_1001533 | 3300025273 | Bacteria | 21036 |
| 255 | Ga0209673_1006503 | 3300025273 | Bacteria | 5628 |
| 256 | Ga0209673_1012482 | 3300025273 | Bacteria | 3418 |
| 257 | Ga0209130_1000009 | 3300025284 | Bacteria | 498952 |
| 258 | Ga0209130_1025277 | 3300025284 | Bacteria | 1287 |
| 259 | Ga0209676_1015445 | 3300025292 | Bacteria | 2810 |
| 260 | Ga0209025_1000487 | 3300025294 | Bacteria | 76541 |
| 261 | Ga0209025_1000533 | 3300025294 | Bacteria | 72404 |
| 262 | Ga0209025_1002217 | 3300025294 | Bacteria | 21448 |
| 263 | Ga0209025_1003035 | 3300025294 | Bacteria | 16560 |
| 264 | Ga0209025_1005459 | 3300025294 | Bacteria | 10359 |
| 265 | Ga0209025_1017317 | 3300025294 | Bacteria | 4169 |
| 266 | Ga0209025_1024298 | 3300025294 | Bacteria | 3132 |
| 267 | Ga0209025_1065855 | 3300025294 | Bacteria | 1320 |
| 268 | Ga0209564_1000782 | 3300025295 | Bacteria | 44138 |
| 269 | Ga0209564_1001043 | 3300025295 | Bacteria | 33899 |
| 270 | Ga0209564_1002280 | 3300025295 | Bacteria | 15659 |
| 271 | Ga0209564_1003771 | 3300025295 | Bacteria | 9865 |
| 272 | Ga0209564_1009145 | 3300025295 | Bacteria | 4765 |
| 273 | Ga0209564_1031739 | 3300025295 | Bacteria | 1607 |
| 274 | Ga0209564_1041321 | 3300025295 | Bacteria | 1238 |
| 275 | Ga0209758_1000415 | 3300025297 | Bacteria | 72404 |
| 276 | Ga0209758_1001085 | 3300025297 | Bacteria | 35309 |
| 277 | Ga0209758_1001086 | 3300025297 | Bacteria | 35300 |
| 278 | Ga0209758_1002520 | 3300025297 | Bacteria | 18534 |
| 279 | Ga0209758_1009917 | 3300025297 | Bacteria | 5806 |
| 280 | Ga0209758_1016800 | 3300025297 | Bacteria | 3692 |
| 281 | Ga0209758_1050098 | 3300025297 | Bacteria | 1467 |
| 282 | Ga0209256_1000510 | 3300025299 | Bacteria | 57080 |
| 283 | Ga0209256_1002945 | 3300025299 | Bacteria | 12778 |
| 284 | Ga0209256_1003900 | 3300025299 | Bacteria | 9866 |
| 285 | Ga0209256_1007141 | 3300025299 | Bacteria | 5627 |
| 286 | Ga0209256_1011065 | 3300025299 | Bacteria | 3667 |
| 287 | Ga0207426_1000041 | 3300025302 | Bacteria | 433536 |
| 288 | Ga0207426_1000348 | 3300025302 | Bacteria | 85294 |
| 289 | Ga0207426_1003830 | 3300025302 | Bacteria | 7773 |
| 290 | Ga0209051_1002527 | 3300025303 | Bacteria | 12957 |
| 291 | Ga0209051_1006376 | 3300025303 | Bacteria | 6669 |
| 292 | Ga0209051_1039543 | 3300025303 | Bacteria | 1701 |
| 293 | Ga0209257_1003532 | 3300025304 | Bacteria | 13296 |
| 294 | Ga0207696_1011005 | 3300025711 | Bacteria | 3284 |
| 295 | Ga0207713_1051466 | 3300025735 | Bacteria | 1637 |
| 296 | Ga0207653_10020764 | 3300025885 | Bacteria | 2081 |
| 297 | Ga0207682_10000011 | 3300025893 | Bacteria | 85533 |
| 298 | Ga0207642_10000936 | 3300025899 | Bacteria | 9137 |
| 299 | Ga0207710_10283127 | 3300025900 | Bacteria | 835 |
| 300 | Ga0207688_10000212 | 3300025901 | Bacteria | 25999 |
| 301 | Ga0207680_10021218 | 3300025903 | Bacteria | 3512 |
| 302 | Ga0207647_10008981 | 3300025904 | Bacteria | 7120 |
| 303 | Ga0207647_10101029 | 3300025904 | Bacteria | 1711 |
| 304 | Ga0207647_10101197 | 3300025904 | Bacteria | 1709 |
| 305 | Ga0207647_10124683 | 3300025904 | Bacteria | 1516 |
| 306 | Ga0207645_10000788 | 3300025907 | Bacteria | 26477 |
| 307 | Ga0207643_10000284 | 3300025908 | Bacteria | 35172 |
| 308 | Ga0207705_10471583 | 3300025909 | Bacteria | 974 |
| 309 | Ga0207654_10026416 | 3300025911 | Bacteria | 3144 |
| 310 | Ga0207654_10039900 | 3300025911 | Bacteria | 2643 |
| 311 | Ga0207654_10185994 | 3300025911 | Bacteria | 1358 |
| 312 | Ga0207707_10000005 | 3300025912 | Bacteria | 382024 |
| 313 | Ga0207707_10001938 | 3300025912 | Bacteria | 18823 |
| 314 | Ga0207707_10004935 | 3300025912 | Bacteria | 11731 |
| 315 | Ga0207707_10604232 | 3300025912 | Bacteria | 928 |
| 316 | Ga0207695_10000044 | 3300025913 | Bacteria | 440819 |
| 317 | Ga0207695_10051370 | 3300025913 | Bacteria | 4329 |
| 318 | Ga0207695_10085396 | 3300025913 | Bacteria | 3185 |
| 319 | Ga0207695_10191320 | 3300025913 | Bacteria | 1964 |
| 320 | Ga0207671_10000400 | 3300025914 | Bacteria | 60604 |
| 321 | Ga0207671_10017490 | 3300025914 | Bacteria | 5525 |
| 322 | Ga0207671_10019417 | 3300025914 | Bacteria | 5196 |
| 323 | Ga0207671_10060555 | 3300025914 | Bacteria | 2809 |
| 324 | Ga0207660_10002390 | 3300025917 | Bacteria | 12338 |
| 325 | Ga0207660_10013909 | 3300025917 | Bacteria | 5281 |
| 326 | Ga0207660_10027643 | 3300025917 | Bacteria | 3874 |
| 327 | Ga0207657_10000390 | 3300025919 | Bacteria | 46278 |
| 328 | Ga0207657_10074718 | 3300025919 | Bacteria | 2861 |
| 329 | Ga0207649_10000057 | 3300025920 | Bacteria | 102314 |
| 330 | Ga0207649_10000822 | 3300025920 | Bacteria | 19938 |
| 331 | Ga0207649_10231881 | 3300025920 | Bacteria | 1321 |
| 332 | Ga0207652_10000068 | 3300025921 | Bacteria | 110287 |
| 333 | Ga0207652_10035039 | 3300025921 | Bacteria | 4234 |
| 334 | Ga0207681_10000181 | 3300025923 | Bacteria | 51755 |
| 335 | Ga0207681_10007620 | 3300025923 | Bacteria | 6635 |
| 336 | Ga0207681_10040141 | 3300025923 | Bacteria | 3112 |
| 337 | Ga0207681_10183113 | 3300025923 | Bacteria | 1597 |
| 338 | Ga0207681_10399421 | 3300025923 | Bacteria | 1110 |
| 339 | Ga0207694_10008165 | 3300025924 | Bacteria | 7910 |
| 340 | Ga0207694_10484140 | 3300025924 | Bacteria | 1035 |
| 341 | Ga0207650_10000691 | 3300025925 | Bacteria | 26420 |
| 342 | Ga0207650_10001418 | 3300025925 | Bacteria | 17264 |
| 343 | Ga0207659_10000028 | 3300025926 | Bacteria | 130804 |
| 344 | Ga0207687_10000061 | 3300025927 | Bacteria | 84113 |
| 345 | Ga0207700_10168542 | 3300025928 | Bacteria | 1825 |
| 346 | Ga0207644_10004970 | 3300025931 | Bacteria | 8672 |
| 347 | Ga0207644_10082811 | 3300025931 | Bacteria | 2374 |
| 348 | Ga0207690_10000037 | 3300025932 | Bacteria | 142658 |
| 349 | Ga0207690_10090157 | 3300025932 | Bacteria | 2164 |
| 350 | Ga0207690_10239966 | 3300025932 | Bacteria | 1395 |
| 351 | Ga0207706_10008724 | 3300025933 | Bacteria | 9338 |
| 352 | Ga0207706_10121395 | 3300025933 | Bacteria | 2298 |
| 353 | Ga0207709_10000539 | 3300025935 | Bacteria | 32486 |
| 354 | Ga0207709_10049806 | 3300025935 | Bacteria | 2559 |
| 355 | Ga0207709_10378626 | 3300025935 | Bacteria | 1076 |
| 356 | Ga0207669_10000290 | 3300025937 | Bacteria | 23055 |
| 357 | Ga0207669_10137732 | 3300025937 | Bacteria | 1689 |
| 358 | Ga0207704_10000767 | 3300025938 | Bacteria | 14133 |
| 359 | Ga0207704_10053675 | 3300025938 | Bacteria | 2452 |
| 360 | Ga0207704_10301885 | 3300025938 | Bacteria | 1227 |
| 361 | Ga0207711_10015022 | 3300025941 | Bacteria | 6431 |
| 362 | Ga0207711_10036003 | 3300025941 | Bacteria | 4198 |
| 363 | Ga0207689_10009011 | 3300025942 | Bacteria | 8641 |
| 364 | Ga0207661_10000215 | 3300025944 | Bacteria | 37435 |
| 365 | Ga0207679_10000026 | 3300025945 | Bacteria | 200073 |
| 366 | Ga0207667_10008668 | 3300025949 | Bacteria | 12055 |
| 367 | Ga0207667_10056380 | 3300025949 | Bacteria | 4128 |
| 368 | Ga0207667_10105936 | 3300025949 | Bacteria | 2901 |
| 369 | Ga0207667_10668146 | 3300025949 | Bacteria | 1043 |
| 370 | Ga0207651_10000173 | 3300025960 | Bacteria | 27970 |
| 371 | Ga0207651_10176714 | 3300025960 | Bacteria | 1689 |
| 372 | Ga0207712_10002375 | 3300025961 | Bacteria | 12203 |
| 373 | Ga0207712_10435544 | 3300025961 | Bacteria | 1109 |
| 374 | Ga0207668_10000474 | 3300025972 | Bacteria | 25172 |
| 375 | Ga0207668_10014369 | 3300025972 | Bacteria | 4900 |
| 376 | Ga0207668_10488147 | 3300025972 | Bacteria | 1058 |
| 377 | Ga0207640_10000711 | 3300025981 | Bacteria | 19295 |
| 378 | Ga0207640_10087541 | 3300025981 | Bacteria | 2147 |
| 379 | Ga0207640_10183110 | 3300025981 | Bacteria | 1572 |
| 380 | Ga0207640_10552868 | 3300025981 | Bacteria | 967 |
| 381 | Ga0207658_10001541 | 3300025986 | Bacteria | 17874 |
| 382 | Ga0207658_10345059 | 3300025986 | Bacteria | 1295 |
| 383 | Ga0207658_10368762 | 3300025986 | Bacteria | 1255 |
| 384 | Ga0207658_10391025 | 3300025986 | Bacteria | 1220 |
| 385 | Ga0207677_10001215 | 3300026023 | Bacteria | 13903 |
| 386 | Ga0207677_10132357 | 3300026023 | Bacteria | 1896 |
| 387 | Ga0207703_10457427 | 3300026035 | Bacteria | 1193 |
| 388 | Ga0207639_10697687 | 3300026041 | Bacteria | 941 |
| 389 | Ga0207678_10002696 | 3300026067 | Bacteria | 16099 |
| 390 | Ga0207678_10120431 | 3300026067 | Bacteria | 2240 |
| 391 | Ga0207678_10231988 | 3300026067 | Bacteria | 1580 |
| 392 | Ga0207678_10418061 | 3300026067 | Bacteria | 1162 |
| 393 | Ga0207702_10136128 | 3300026078 | Bacteria | 2216 |
| 394 | Ga0207702_10211582 | 3300026078 | Bacteria | 1803 |
| 395 | Ga0207702_10850325 | 3300026078 | Bacteria | 903 |
| 396 | Ga0207648_10023516 | 3300026089 | Bacteria | 5518 |
| 397 | Ga0207648_10045791 | 3300026089 | Bacteria | 3836 |
| 398 | Ga0207648_10334193 | 3300026089 | Bacteria | 1363 |
| 399 | Ga0207676_10005845 | 3300026095 | Bacteria | 8692 |
| 400 | Ga0207674_10026646 | 3300026116 | Bacteria | 6133 |
| 401 | Ga0207674_10096921 | 3300026116 | Bacteria | 2934 |
| 402 | Ga0207675_100023660 | 3300026118 | Bacteria | 5714 |
| 403 | Ga0207675_100108076 | 3300026118 | Bacteria | 2623 |
| 404 | Ga0207675_100881346 | 3300026118 | Bacteria | 911 |
| 405 | Ga0207683_10000034 | 3300026121 | Bacteria | 101817 |
| 406 | Ga0207698_10226456 | 3300026142 | Bacteria | 1694 |
| 407 | Ga0209371_1000037 | 3300027312 | Bacteria | 367074 |
| 408 | Ga0209371_1002109 | 3300027312 | Bacteria | 11760 |
| 409 | Ga0209371_1002474 | 3300027312 | Bacteria | 10284 |
| 410 | Ga0209998_10005453 | 3300027717 | Bacteria | 2662 |
| 411 | Ga0209813_10021294 | 3300027866 | Bacteria | 1821 |
| 412 | Ga0209974_10025784 | 3300027876 | Bacteria | 1946 |
| 413 | Ga0207428_10000440 | 3300027907 | Bacteria | 50907 |
| 414 | Ga0207428_10001235 | 3300027907 | Bacteria | 27417 |
| 415 | Ga0207428_10156798 | 3300027907 | Bacteria | 1731 |
| 416 | Ga0268266_10015172 | 3300028379 | Bacteria | 6615 |
| 417 | Ga0268266_10233666 | 3300028379 | Bacteria | 1694 |
| 418 | Ga0268266_10271030 | 3300028379 | Bacteria | 1576 |
| 419 | Ga0268266_10302678 | 3300028379 | Bacteria | 1492 |
| 420 | Ga0268265_10001023 | 3300028380 | Bacteria | 25231 |
| 421 | Ga0268265_10266988 | 3300028380 | Bacteria | 1524 |
| 422 | Ga0268264_10001465 | 3300028381 | Bacteria | 22046 |
| 423 | Ga0268264_10447985 | 3300028381 | Bacteria | 1250 |
| 424 | Ga0307515_10001330 | 3300028794 | Bacteria | 55993 |
| 425 | Ga0307515_10290965 | 3300028794 | Bacteria | 1329 |
| 426 | Ga0310982_132715 | 3300029283 | Bacteria | 1018 |
| 427 | Ga0268256_1000039 | 3300030500 | Bacteria | 354969 |
| 428 | Ga0268256_1001864 | 3300030500 | Bacteria | 11667 |
| 429 | Ga0268256_1036812 | 3300030500 | Bacteria | 1125 |
| 430 | Ga0316181_1198006 | 3300030744 | Bacteria | 6176 |
| 431 | Ga0265331_10000625 | 3300031250 | Bacteria | 30747 |
| 432 | Ga0265327_10001092 | 3300031251 | Bacteria | 37637 |
| 433 | Ga0265327_10003920 | 3300031251 | Bacteria | 13663 |
| 434 | Ga0265327_10016822 | 3300031251 | Bacteria | 4624 |
| 435 | Ga0265316_10148817 | 3300031344 | Bacteria | 1755 |
| 436 | Ga0307513_10000463 | 3300031456 | Bacteria | 58389 |
| 437 | Ga0307513_10015877 | 3300031456 | Bacteria | 9106 |
| 438 | Ga0307408_100492954 | 3300031548 | Bacteria | 1071 |
| 439 | Ga0265313_10001402 | 3300031595 | Bacteria | 22597 |
| 440 | Ga0265314_10018826 | 3300031711 | Bacteria | 5365 |
| 441 | Ga0307405_10001569 | 3300031731 | Bacteria | 9698 |
| 442 | Ga0307405_10234530 | 3300031731 | Bacteria | 1355 |
| 443 | Ga0307413_10114192 | 3300031824 | Bacteria | 1815 |
| 444 | Ga0307413_10231357 | 3300031824 | Bacteria | 1358 |
| 445 | Ga0307410_10178930 | 3300031852 | Bacteria | 1604 |
| 446 | Ga0307412_10002170 | 3300031911 | Bacteria | 10894 |
| 447 | Ga0307409_100045667 | 3300031995 | Bacteria | 3309 |
| 448 | Ga0307409_100871771 | 3300031995 | Bacteria | 912 |
| 449 | Ga0316593_10165967 | 3300032168 | Bacteria | 808 |
| 450 | Ga0307510_10157736 | 3300033180 | Bacteria | 1873 |
| 451 | Ga0316592_1058377 | 3300033524 | Bacteria | 865 |
| 452 | Ga0316586_1038278 | 3300033527 | Bacteria | 838 |
| 453 | Ga0316596_1079334 | 3300033541 | Bacteria | 882 |
| 454 | Ga0373958_0000962 | 3300034819 | Bacteria | 3738 |
| 455 | Ga0373959_0006254 | 3300034820 | Bacteria | 1970 |
| 456 | Ga0373938_0045057 | 3300034957 | Bacteria | 992 |
| 457 | Ga0373951_0002104 | 3300035091 | Bacteria | 5096 |
| 458 | Ga0373952_0001391 | 3300035092 | Bacteria | 4420 |
| 459 | Ga0373952_0033990 | 3300035092 | Bacteria | 1147 |
| 460 | Ga0373932_0002140 | 3300035112 | Bacteria | 5132 |
| 461 | Ga0373939_0002351 | 3300035114 | Bacteria | 4472 |
| 462 | Ga0373960_0003014 | 3300035121 | Bacteria | 3803 |
| 463 | Ga0373960_0044953 | 3300035121 | Bacteria | 1291 |
| 464 | Ga0373962_0000385 | 3300035242 | Bacteria | 9627 |
| 465 | Ga0373962_0009108 | 3300035242 | Bacteria | 2453 |
| 466 | Ga0373931_0000254 | 3300035691 | Bacteria | 22696 |
| 467 | Ga0373937_0001845 | 3300036401 | Bacteria | 17802 |
| 468 | Ga0316582_0116711 | 3300036647 | Bacteria | 1782 |
| 469 | Ga0316584_0243521 | 3300036712 | Bacteria | 1315 |
| 470 | Ga0395899_0007406 | 3300037312 | Bacteria | 8482 |
| 471 | Ga0395900_0000056 | 3300037418 | Bacteria | 213077 |
| 472 | Ga0395900_0008711 | 3300037418 | Bacteria | 10420 |
| 473 | Ga0395900_0028708 | 3300037418 | Bacteria | 5703 |
| 474 | Ga0395900_0031790 | 3300037418 | Bacteria | 5425 |
| 475 | Ga0395900_0084320 | 3300037418 | Bacteria | 3265 |
| 476 | Ga0395900_0321935 | 3300037418 | Bacteria | 1526 |
| 477 | Ga0395898_0000114 | 3300037466 | Bacteria | 213068 |
| 478 | Ga0395898_0033165 | 3300037466 | Bacteria | 5154 |
| 479 | Ga0395905_0000053 | 3300037471 | Bacteria | 213077 |
| 480 | Ga0395905_0020139 | 3300037471 | Bacteria | 6319 |
| 481 | Ga0395901_0000037 | 3300038443 | Bacteria | 213059 |
| 482 | Ga0395901_0079118 | 3300038443 | Bacteria | 3432 |
| 483 | Ga0395901_0120745 | 3300038443 | Bacteria | 2754 |
| 484 | Ga0395901_0223550 | 3300038443 | Bacteria | 1967 |
| 485 | Ga0395901_0277792 | 3300038443 | Bacteria | 1741 |
| 486 | Ga0400483_039327 | 3300039062 | Bacteria | 5442 |
| 487 | Ga0400483_125138 | 3300039062 | Bacteria | 1424 |
| 488 | Ga0400483_252775 | 3300039062 | Bacteria | 17955 |
| 489 | Ga0439436_0006561 | 3300041404 | Bacteria | 3574 |
| 490 | Ga0439436_0012216 | 3300041404 | Bacteria | 2606 |
| 491 | Ga0439436_0039541 | 3300041404 | Bacteria | 1354 |
| 492 | Ga0439438_009534 | 3300041405 | Bacteria | 3136 |
| 493 | Ga0439439_0047919 | 3300041406 | Bacteria | 1117 |
| 494 | Ga0439447_065989 | 3300041407 | Bacteria | 846 |
| 495 | Ga0439465_0002262 | 3300041413 | Bacteria | 6326 |
| 496 | Ga0439465_0003401 | 3300041413 | Bacteria | 5189 |
| 497 | Ga0439465_0009497 | 3300041413 | Bacteria | 3064 |
| 498 | Ga0451799_13591 | 3300041454 | Bacteria | 960 |
| 499 | Ga0451801_39182 | 3300041455 | Bacteria | 787 |
| 500 | Ga0451808_28627 | 3300041464 | Bacteria | 803 |
| 501 | Ga0451841_0178587 | 3300041498 | Bacteria | 3957 |
| 502 | Ga0451842_1121 | 3300041499 | Bacteria | 824 |
| 503 | Ga0451851_1096957 | 3300041507 | Bacteria | 2171 |
| 504 | Ga0451854_02560 | 3300041510 | Bacteria | 1556 |
| 505 | Ga0452268_06253 | 3300041907 | Bacteria | 969 |
| 506 | Ga0439442_018773 | 3300042002 | Bacteria | 1430 |
| 507 | Ga0439432_061694 | 3300042006 | Bacteria | 1155 |
| 508 | Ga0439449_0122416 | 3300042007 | Bacteria | 966 |
| 509 | Ga0450920_003459 | 3300042122 | Bacteria | 2735 |
| 510 | Ga0439434_0033961 | 3300042435 | Bacteria | 1557 |
| 511 | Ga0450918_005441 | 3300042531 | Bacteria | 2289 |
| 512 | Ga0466972_0037303 | 3300044658 | Bacteria | 2376 |
| 513 | Ga0466972_0124009 | 3300044658 | Bacteria | 1217 |
| 514 | Ga0453684_0000015 | 3300044712 | Bacteria | 969198 |
| 515 | Ga0453684_0000020 | 3300044712 | Bacteria | 879938 |
| 516 | Ga0466960_0023442 | 3300044901 | Bacteria | 2771 |
| 517 | Ga0466959_0072685 | 3300045049 | Bacteria | 2489 |
| 518 | Ga0466958_0232688 | 3300045836 | Bacteria | 1177 |
| 519 | Ga0495603_0000026 | 3300046455 | Bacteria | 61348 |
| 520 | Ga0495629_0096213 | 3300046459 | Bacteria | 2065 |
| 521 | Ga0495605_0045144 | 3300046474 | Bacteria | 2173 |
| 522 | Ga0495584_0023947 | 3300046491 | Bacteria | 3095 |
| 523 | Ga0495585_0042999 | 3300046492 | Bacteria | 2528 |
| 524 | Ga0495585_0089241 | 3300046492 | Bacteria | 1662 |
| 525 | Ga0495585_0302012 | 3300046492 | Bacteria | 786 |
| 526 | Ga0495607_0011406 | 3300046501 | Bacteria | 5917 |
| 527 | Ga0495583_0017655 | 3300046506 | Bacteria | 3781 |
| 528 | Ga0495583_0196796 | 3300046506 | Bacteria | 820 |
| 529 | Ga0495606_0009969 | 3300046507 | Bacteria | 7946 |
| 530 | Ga0495606_0041105 | 3300046507 | Bacteria | 3102 |
| 531 | Ga0495610_0002478 | 3300046512 | Bacteria | 15473 |
| 532 | Ga0495610_0021369 | 3300046512 | Bacteria | 3561 |
| 533 | Ga0495616_0055676 | 3300046513 | Bacteria | 1957 |
| 534 | Ga0495620_0011516 | 3300046515 | Bacteria | 4614 |
| 535 | Ga0495632_0002387 | 3300046519 | Bacteria | 14346 |
| 536 | Ga0495632_0126415 | 3300046519 | Bacteria | 1192 |
| 537 | Ga0495637_0045872 | 3300046520 | Bacteria | 1851 |
| 538 | Ga0495643_0080657 | 3300046522 | Bacteria | 1693 |
| 539 | Ga0495654_0161120 | 3300046530 | Bacteria | 985 |
| 540 | Ga0495587_0125894 | 3300046536 | Bacteria | 1466 |
| 541 | Ga0495597_0021206 | 3300046542 | Bacteria | 3022 |
| 542 | Ga0495633_0020355 | 3300046558 | Bacteria | 3338 |
| 543 | Ga0495656_0117104 | 3300046615 | Bacteria | 1253 |
| 544 | Ga0495668_0042577 | 3300046616 | Bacteria | 2528 |
| 545 | Ga0495634_0120675 | 3300046642 | Bacteria | 1679 |
| 546 | Ga0495625_0011675 | 3300046660 | Bacteria | 7145 |
| 547 | Ga0495625_0060527 | 3300046660 | Bacteria | 2682 |
| 548 | Ga0495659_0043452 | 3300046664 | Bacteria | 1612 |
| 549 | Ga0495661_0102391 | 3300046665 | Bacteria | 1610 |
| 550 | Ga0495661_0210090 | 3300046665 | Bacteria | 1014 |
| 551 | Ga0495588_0038007 | 3300046674 | Bacteria | 2448 |
| 552 | Ga0495624_0130607 | 3300046690 | Bacteria | 1540 |
| 553 | Ga0495670_0038451 | 3300046691 | Bacteria | 2385 |
| 554 | Ga0495670_0116322 | 3300046691 | Bacteria | 1387 |
| 555 | Ga0495671_0098250 | 3300046692 | Bacteria | 1432 |
| 556 | Ga0495649_0020798 | 3300046694 | Bacteria | 3678 |
| 557 | Ga0495649_0060369 | 3300046694 | Bacteria | 2040 |
| 558 | Ga0495589_0034844 | 3300046794 | Bacteria | 2525 |
| 559 | Ga0495604_0035060 | 3300047317 | Bacteria | 3964 |
| 560 | Ga0495636_0045205 | 3300047318 | Bacteria | 1835 |
| 561 | Ga0495674_0218363 | 3300047319 | Bacteria | 1577 |
| 562 | Ga0495683_0078014 | 3300047323 | Bacteria | 1619 |
| 563 | Ga0495681_0046168 | 3300047470 | Bacteria | 2079 |
| 564 | Ga0495615_0049660 | 3300048090 | Bacteria | 1076 |
| 565 | Ga0495626_0031946 | 3300048091 | Bacteria | 2531 |
| 566 | Ga0496100_0019710 | 3300048903 | Bacteria | 4029 |
| 567 | Ga0496101_0012868 | 3300048904 | Bacteria | 5596 |
| 568 | Ga0496102_0004000 | 3300048905 | Bacteria | 12481 |
| 569 | Ga0496102_0462299 | 3300048905 | Bacteria | 1190 |
| 570 | Ga0496103_0006985 | 3300048906 | Bacteria | 6736 |
| 571 | Ga0496104_0009450 | 3300048907 | Bacteria | 8674 |
| 572 | Ga0496104_0280128 | 3300048907 | Bacteria | 1580 |
| 573 | Ga0496105_0041839 | 3300048908 | Bacteria | 3776 |
| 574 | Ga0496105_0624272 | 3300048908 | Bacteria | 834 |
| 575 | Ga0496106_0003568 | 3300048909 | Bacteria | 11590 |
| 576 | Ga0496106_0010947 | 3300048909 | Bacteria | 6705 |
| 577 | Ga0496106_0280746 | 3300048909 | Bacteria | 1334 |
| 578 | Ga0496107_0005476 | 3300048910 | Bacteria | 8685 |
| 579 | Ga0496108_0173192 | 3300048911 | Bacteria | 1868 |
| 580 | Ga0496109_0000984 | 3300048912 | Bacteria | 23543 |
| 581 | Ga0496110_0009931 | 3300048913 | Bacteria | 7717 |
| 582 | Ga0496110_0354148 | 3300048913 | Bacteria | 1337 |
| 583 | Ga0496112_0798778 | 3300048915 | Bacteria | 868 |
| 584 | Ga0496114_0016680 | 3300048917 | Bacteria | 5923 |
| 585 | Ga0496114_0250698 | 3300048917 | Bacteria | 1558 |
| 586 | Ga0496115_0003065 | 3300048918 | Bacteria | 12001 |
| 587 | Ga0496115_0180530 | 3300048918 | Bacteria | 1745 |
| 588 | Ga0496115_0194736 | 3300048918 | Bacteria | 1675 |
| 589 | Ga0496116_0000057 | 3300048919 | Bacteria | 281652 |
| 590 | Ga0496116_0081392 | 3300048919 | Bacteria | 2007 |
| 591 | Ga0496117_0000031 | 3300048920 | Bacteria | 381048 |
| 592 | Ga0496117_0002097 | 3300048920 | Bacteria | 26238 |
| 593 | Ga0496117_0010058 | 3300048920 | Bacteria | 8689 |
| 594 | Ga0496117_0020361 | 3300048920 | Bacteria | 5409 |
| 595 | Ga0496117_0056502 | 3300048920 | Bacteria | 2733 |
| 596 | Ga0496117_0061998 | 3300048920 | Bacteria | 2566 |
| 597 | Ga0496118_0002291 | 3300048921 | Bacteria | 26051 |
| 598 | Ga0496118_0008110 | 3300048921 | Bacteria | 10943 |
| 599 | Ga0496118_0009274 | 3300048921 | Bacteria | 9980 |
| 600 | Ga0496118_0022589 | 3300048921 | Bacteria | 5492 |
| 601 | Ga0496118_0030421 | 3300048921 | Bacteria | 4506 |
| 602 | Ga0496119_0000147 | 3300048922 | Bacteria | 98899 |
| 603 | Ga0496119_0023944 | 3300048922 | Bacteria | 4312 |
| 604 | Ga0496119_0028106 | 3300048922 | Bacteria | 3847 |
| 605 | Ga0496119_0096761 | 3300048922 | Bacteria | 1665 |
| 606 | Ga0496119_0148981 | 3300048922 | Bacteria | 1256 |
| 607 | Ga0496120_0002641 | 3300048923 | Bacteria | 17737 |
| 608 | Ga0496120_0039751 | 3300048923 | Bacteria | 2771 |
| 609 | Ga0496120_0045241 | 3300048923 | Bacteria | 2551 |
| 610 | Ga0496121_0000034 | 3300048924 | Bacteria | 377095 |
| 611 | Ga0496121_0008479 | 3300048924 | Bacteria | 12066 |
| 612 | Ga0496121_0011232 | 3300048924 | Bacteria | 9980 |
| 613 | Ga0496121_0013424 | 3300048924 | Bacteria | 8802 |
| 614 | Ga0496121_0020808 | 3300048924 | Bacteria | 6466 |
| 615 | Ga0496121_0023905 | 3300048924 | Bacteria | 5861 |
| 616 | Ga0496121_0135242 | 3300048924 | Bacteria | 1838 |
| 617 | Ga0496121_0178584 | 3300048924 | Bacteria | 1535 |
| 618 | Ga0496122_0000023 | 3300048925 | Bacteria | 381035 |
| 619 | Ga0496122_0008748 | 3300048925 | Bacteria | 10832 |
| 620 | Ga0496122_0017928 | 3300048925 | Bacteria | 6573 |
| 621 | Ga0496122_0018012 | 3300048925 | Bacteria | 6550 |
| 622 | Ga0496122_0043273 | 3300048925 | Bacteria | 3530 |
| 623 | Ga0496123_0000027 | 3300048926 | Bacteria | 306773 |
| 624 | Ga0496123_0002376 | 3300048926 | Bacteria | 23589 |
| 625 | Ga0496123_0014122 | 3300048926 | Bacteria | 6642 |
| 626 | Ga0496123_0019242 | 3300048926 | Bacteria | 5387 |
| 627 | Ga0496123_0071680 | 3300048926 | Bacteria | 2160 |
| 628 | Ga0496123_0125085 | 3300048926 | Bacteria | 1437 |
| 629 | Ga0496124_0000174 | 3300048927 | Bacteria | 129228 |
| 630 | Ga0496124_0002248 | 3300048927 | Bacteria | 25664 |
| 631 | Ga0496124_0005858 | 3300048927 | Bacteria | 13630 |
| 632 | Ga0496124_0011409 | 3300048927 | Bacteria | 8883 |
| 633 | Ga0496124_0067125 | 3300048927 | Bacteria | 2985 |
| 634 | Ga0496124_0096090 | 3300048927 | Bacteria | 2407 |
| 635 | Ga0496124_0153424 | 3300048927 | Bacteria | 1804 |
| 636 | Ga0496124_0222685 | 3300048927 | Bacteria | 1417 |
| 637 | Ga0496125_0000030 | 3300048928 | Bacteria | 375023 |
| 638 | Ga0496125_0004309 | 3300048928 | Bacteria | 16518 |
| 639 | Ga0496125_0006873 | 3300048928 | Bacteria | 12189 |
| 640 | Ga0496125_0126996 | 3300048928 | Bacteria | 1805 |
| 641 | Ga0496125_0136094 | 3300048928 | Bacteria | 1718 |
| 642 | Ga0496125_0189741 | 3300048928 | Bacteria | 1359 |
| 643 | Ga0496126_0005711 | 3300048929 | Bacteria | 14100 |
| 644 | Ga0496126_0031438 | 3300048929 | Bacteria | 5016 |
| 645 | Ga0496126_0058103 | 3300048929 | Bacteria | 3488 |
| 646 | Ga0496126_0094014 | 3300048929 | Bacteria | 2631 |
| 647 | Ga0496126_0132120 | 3300048929 | Bacteria | 2156 |
| 648 | Ga0496126_0193912 | 3300048929 | Bacteria | 1719 |
| 649 | Ga0496126_0214460 | 3300048929 | Bacteria | 1619 |
| 650 | Ga0496126_0223749 | 3300048929 | Bacteria | 1579 |
| 651 | Ga0496126_0303763 | 3300048929 | Bacteria | 1315 |
| 652 | Ga0501308_017966 | 3300049128 | Bacteria | 861 |
| 653 | Ga0501307_028324 | 3300049162 | Bacteria | 765 |
| 654 | Ga0501311_024221 | 3300049527 | Bacteria | 844 |
| 655 | Ga0501315_027457 | 3300049531 | Bacteria | 804 |
| 656 | Ga0501318_016002 | 3300049534 | Bacteria | 901 |
| 657 | Ga0501335_016323 | 3300049551 | Bacteria | 764 |
| 658 | Ga0501337_007142 | 3300049553 | Bacteria | 775 |
| 659 | Ga0501340_007485 | 3300049556 | Bacteria | 754 |
| 660 | Ga0501031_0204605 | 3300049568 | Bacteria | 1287 |
| 661 | Ga0501031_0279736 | 3300049568 | Bacteria | 1082 |
| 662 | Ga0501032_0000006 | 3300049569 | Bacteria | 261727 |
| 663 | Ga0501032_0046093 | 3300049569 | Bacteria | 2946 |
| 664 | Ga0501033_0000053 | 3300049570 | Bacteria | 109042 |
| 665 | Ga0501033_0000477 | 3300049570 | Bacteria | 37842 |
| 666 | Ga0501033_0103766 | 3300049570 | Bacteria | 2073 |
| 667 | Ga0501033_0169802 | 3300049570 | Bacteria | 1567 |
| 668 | Ga0501033_0318653 | 3300049570 | Bacteria | 1092 |
| 669 | Ga0501034_0000023 | 3300049571 | Bacteria | 263892 |
| 670 | Ga0501034_0000030 | 3300049571 | Bacteria | 248180 |
| 671 | Ga0501034_0002652 | 3300049571 | Bacteria | 21172 |
| 672 | Ga0501034_0007485 | 3300049571 | Bacteria | 11615 |
| 673 | Ga0501034_0042799 | 3300049571 | Bacteria | 4584 |
| 674 | Ga0501034_0044944 | 3300049571 | Bacteria | 4464 |
| 675 | Ga0501034_0050536 | 3300049571 | Bacteria | 4193 |
| 676 | Ga0501034_0102580 | 3300049571 | Bacteria | 2854 |
| 677 | Ga0501034_0232959 | 3300049571 | Bacteria | 1790 |
| 678 | Ga0501036_0000003 | 3300049572 | Bacteria | 261545 |
| 679 | Ga0501036_0002249 | 3300049572 | Bacteria | 15079 |
| 680 | Ga0501036_0011045 | 3300049572 | Bacteria | 7468 |
| 681 | Ga0501036_0098239 | 3300049572 | Bacteria | 2475 |
| 682 | Ga0501036_0156857 | 3300049572 | Bacteria | 1919 |
| 683 | Ga0501036_0331910 | 3300049572 | Bacteria | 1270 |
| 684 | Ga0501037_0000003 | 3300049573 | Bacteria | 261548 |
| 685 | Ga0501037_0000269 | 3300049573 | Bacteria | 44747 |
| 686 | Ga0501037_0037047 | 3300049573 | Bacteria | 3595 |
| 687 | Ga0501037_0052558 | 3300049573 | Bacteria | 2980 |
| 688 | Ga0501037_0150970 | 3300049573 | Bacteria | 1660 |
| 689 | Ga0501038_0000004 | 3300049574 | Bacteria | 261289 |
| 690 | Ga0501038_0000040 | 3300049574 | Bacteria | 121177 |
| 691 | Ga0501038_0028880 | 3300049574 | Bacteria | 4923 |
| 692 | Ga0501038_0075791 | 3300049574 | Bacteria | 2842 |
| 693 | Ga0501038_0155929 | 3300049574 | Bacteria | 1859 |
| 694 | Ga0501038_0268377 | 3300049574 | Bacteria | 1346 |
| 695 | Ga0501038_0396686 | 3300049574 | Bacteria | 1068 |
| 696 | Ga0501039_0000008 | 3300049575 | Bacteria | 274778 |
| 697 | Ga0501039_0000089 | 3300049575 | Bacteria | 68136 |
| 698 | Ga0501039_0023552 | 3300049575 | Bacteria | 4725 |
| 699 | Ga0501039_0188427 | 3300049575 | Bacteria | 1622 |
| 700 | Ga0501039_0190127 | 3300049575 | Bacteria | 1614 |
| 701 | Ga0501039_0235604 | 3300049575 | Bacteria | 1439 |
| 702 | Ga0501040_0008431 | 3300049576 | Bacteria | 6697 |
| 703 | Ga0501040_0046579 | 3300049576 | Bacteria | 2960 |
| 704 | Ga0501040_0062010 | 3300049576 | Bacteria | 2572 |
| 705 | Ga0501040_0104897 | 3300049576 | Bacteria | 1974 |
| 706 | Ga0501041_0018246 | 3300049577 | Bacteria | 4179 |
| 707 | Ga0501041_0054907 | 3300049577 | Bacteria | 2430 |
| 708 | Ga0501041_0060730 | 3300049577 | Bacteria | 2313 |
| 709 | Ga0501042_0005598 | 3300049578 | Bacteria | 8098 |
| 710 | Ga0501042_0126387 | 3300049578 | Bacteria | 1841 |
| 711 | Ga0501043_0000019 | 3300049579 | Bacteria | 155347 |
| 712 | Ga0501043_0000365 | 3300049579 | Bacteria | 40969 |
| 713 | Ga0501043_0248947 | 3300049579 | Bacteria | 1369 |
| 714 | Ga0501043_0368580 | 3300049579 | Bacteria | 1089 |
| 715 | Ga0501046_0018273 | 3300049580 | Bacteria | 5837 |
| 716 | Ga0501046_0018481 | 3300049580 | Bacteria | 5799 |
| 717 | Ga0501046_0030285 | 3300049580 | Bacteria | 4393 |
| 718 | Ga0501046_0034838 | 3300049580 | Bacteria | 4060 |
| 719 | Ga0501046_0048839 | 3300049580 | Bacteria | 3349 |
| 720 | Ga0501046_0060051 | 3300049580 | Bacteria | 2976 |
| 721 | Ga0501047_0001197 | 3300049581 | Bacteria | 25699 |
| 722 | Ga0501047_0246874 | 3300049581 | Bacteria | 1634 |
| 723 | Ga0501047_0349477 | 3300049581 | Bacteria | 1315 |
| 724 | Ga0501048_0008179 | 3300049582 | Bacteria | 7912 |
| 725 | Ga0501048_0021393 | 3300049582 | Bacteria | 4736 |
| 726 | Ga0501048_0046877 | 3300049582 | Bacteria | 3085 |
| 727 | Ga0501048_0105263 | 3300049582 | Bacteria | 1991 |
| 728 | Ga0501067_0081299 | 3300049583 | Bacteria | 1796 |
| 729 | Ga0501068_0015949 | 3300049584 | Bacteria | 4327 |
| 730 | Ga0501068_0018147 | 3300049584 | Bacteria | 4073 |
| 731 | Ga0501068_0030274 | 3300049584 | Bacteria | 3210 |
| 732 | Ga0501068_0209137 | 3300049584 | Bacteria | 1239 |
| 733 | Ga0501068_0222795 | 3300049584 | Bacteria | 1199 |
| 734 | Ga0501069_0167197 | 3300049585 | Bacteria | 1268 |
| 735 | Ga0501070_0086535 | 3300049586 | Bacteria | 2594 |
| 736 | Ga0501070_0181061 | 3300049586 | Bacteria | 1734 |
| 737 | Ga0501071_0027577 | 3300049587 | Bacteria | 3997 |
| 738 | Ga0501071_0037374 | 3300049587 | Bacteria | 3467 |
| 739 | Ga0501071_0149415 | 3300049587 | Bacteria | 1742 |
| 740 | Ga0501071_0268483 | 3300049587 | Bacteria | 1289 |
| 741 | Ga0501072_0010915 | 3300049588 | Bacteria | 6930 |
| 742 | Ga0501072_0030130 | 3300049588 | Bacteria | 4241 |
| 743 | Ga0501072_0037701 | 3300049588 | Bacteria | 3792 |
| 744 | Ga0501073_0002812 | 3300049589 | Bacteria | 13028 |
| 745 | Ga0501073_0116994 | 3300049589 | Bacteria | 1847 |
| 746 | Ga0501074_0060176 | 3300049590 | Bacteria | 2736 |
| 747 | Ga0501074_0185995 | 3300049590 | Bacteria | 1481 |
| 748 | Ga0501074_0244023 | 3300049590 | Bacteria | 1277 |
| 749 | Ga0501074_0453288 | 3300049590 | Bacteria | 909 |
| 750 | Ga0501075_0004606 | 3300049591 | Bacteria | 9355 |
| 751 | Ga0501075_0072070 | 3300049591 | Bacteria | 2611 |
| 752 | Ga0501075_0088069 | 3300049591 | Bacteria | 2353 |
| 753 | Ga0501076_0004436 | 3300049592 | Bacteria | 9983 |
| 754 | Ga0501076_0044976 | 3300049592 | Bacteria | 3484 |
| 755 | Ga0501076_0110378 | 3300049592 | Bacteria | 2223 |
| 756 | Ga0501076_0435976 | 3300049592 | Bacteria | 1079 |
| 757 | Ga0501076_0436776 | 3300049592 | Bacteria | 1077 |
| 758 | Ga0501077_0000896 | 3300049593 | Bacteria | 17896 |
| 759 | Ga0501077_0038231 | 3300049593 | Bacteria | 3055 |
| 760 | Ga0501077_0042622 | 3300049593 | Bacteria | 2885 |
| 761 | Ga0501077_0115784 | 3300049593 | Bacteria | 1699 |
| 762 | Ga0501079_0007738 | 3300049741 | Bacteria | 8135 |
| 763 | Ga0501079_0009536 | 3300049741 | Bacteria | 7361 |
| 764 | Ga0501079_0023397 | 3300049741 | Bacteria | 4741 |
| 765 | Ga0501079_0142116 | 3300049741 | Bacteria | 1869 |
| 766 | Ga0501079_0197499 | 3300049741 | Bacteria | 1570 |
| 767 | Ga0501080_0033256 | 3300049742 | Bacteria | 4812 |
| 768 | Ga0501080_0048854 | 3300049742 | Bacteria | 3937 |
| 769 | Ga0501080_0111403 | 3300049742 | Bacteria | 2537 |
| 770 | Ga0501080_0451461 | 3300049742 | Bacteria | 1152 |
| 771 | Ga0501080_0586822 | 3300049742 | Bacteria | 990 |
| 772 | Ga0501081_0002638 | 3300049743 | Bacteria | 11336 |
| 773 | Ga0501081_0054363 | 3300049743 | Bacteria | 2766 |
| 774 | Ga0501081_0075277 | 3300049743 | Bacteria | 2356 |
| 775 | Ga0501083_0019610 | 3300049744 | Bacteria | 4710 |
| 776 | Ga0501083_0020023 | 3300049744 | Bacteria | 4656 |
| 777 | Ga0501083_0059804 | 3300049744 | Bacteria | 2548 |
| 778 | Ga0501083_0069508 | 3300049744 | Bacteria | 2343 |
| 779 | Ga0501035_0000031 | 3300049822 | Bacteria | 175591 |
| 780 | Ga0501035_0000434 | 3300049822 | Bacteria | 47060 |
| 781 | Ga0501035_0034682 | 3300049822 | Bacteria | 4583 |
| 782 | Ga0501035_0048680 | 3300049822 | Bacteria | 3801 |
| 783 | Ga0501035_0346898 | 3300049822 | Bacteria | 1243 |
| 784 | Ga0501035_0446086 | 3300049822 | Bacteria | 1071 |
| 785 | Ga0501044_0000008 | 3300049823 | Bacteria | 274778 |
| 786 | Ga0501044_0017484 | 3300049823 | Bacteria | 7697 |
| 787 | Ga0501044_0056269 | 3300049823 | Bacteria | 4038 |
| 788 | Ga0501044_0086497 | 3300049823 | Bacteria | 3166 |
| 789 | Ga0501044_0327500 | 3300049823 | Bacteria | 1455 |
| 790 | Ga0501044_0347256 | 3300049823 | Bacteria | 1404 |
| 791 | Ga0501044_0643058 | 3300049823 | Bacteria | 950 |
| 792 | Ga0501045_0002264 | 3300049824 | Bacteria | 13063 |
| 793 | Ga0501045_0069019 | 3300049824 | Bacteria | 2597 |
| 794 | Ga0501045_0216790 | 3300049824 | Bacteria | 1425 |
| 795 | nmdc:mga03683_90896_c1 | 3300050489 | Bacteria | 1331 |
| 796 | nmdc:mga00v17_151_c1 | 3300050491 | Bacteria | 40348 |
| 797 | nmdc:mga00v17_172266_c1 | 3300050491 | Bacteria | 1396 |
| 798 | nmdc:mga00v17_20304_c1 | 3300050491 | Bacteria | 3804 |
| 799 | nmdc:mga00v17_240018_c1 | 3300050491 | Bacteria | 1175 |
| 800 | nmdc:mga00v17_240312_c1 | 3300050491 | Bacteria | 1174 |
| 801 | nmdc:mga0yw44_109607_c1 | 3300050492 | Bacteria | 1768 |
| 802 | nmdc:mga0yw44_20329_c1 | 3300050492 | Bacteria | 3683 |
| 803 | nmdc:mga0yw44_273955_c1 | 3300050492 | Bacteria | 1127 |
| 804 | nmdc:mga0yw44_359767_c1 | 3300050492 | Bacteria | 981 |
| 805 | nmdc:mga0yw44_398542_c1 | 3300050492 | Bacteria | 930 |
| 806 | nmdc:mga0yw44_4983_c1 | 3300050492 | Bacteria | 6197 |
| 807 | nmdc:mga0k408_156037_c1 | 3300050493 | Bacteria | 1360 |
| 808 | nmdc:mga0k408_253397_c1 | 3300050493 | Bacteria | 1051 |
| 809 | nmdc:mga06z11_200613_c1 | 3300050494 | Bacteria | 1159 |
| 810 | nmdc:mga06z11_259719_c1 | 3300050494 | Bacteria | 1025 |
| 811 | nmdc:mga06z11_266120_c1 | 3300050494 | Bacteria | 1013 |
| 812 | nmdc:mga06z11_275005_c1 | 3300050494 | Bacteria | 997 |
| 813 | nmdc:mga06z11_53830_c1 | 3300050494 | Bacteria | 2071 |
| 814 | nmdc:mga04h51_12766_c1 | 3300050495 | Bacteria | 2366 |
| 815 | nmdc:mga07m45_210135_c1 | 3300050496 | Bacteria | 1132 |
| 816 | nmdc:mga07m45_246996_c1 | 3300050496 | Bacteria | 1038 |
| 817 | nmdc:mga05p37_1046553_c1 | 3300050507 | Bacteria | 861 |
| 818 | nmdc:mga05p37_17400_c1 | 3300050507 | Bacteria | 8674 |
| 819 | nmdc:mga05p37_97560_c1 | 3300050507 | Bacteria | 3620 |
| 820 | nmdc:mga09592_137341_c1 | 3300050508 | Bacteria | 2106 |
| 821 | nmdc:mga06r32_14807_c1 | 3300050510 | Bacteria | 7077 |
| 822 | nmdc:mga08y16_118606_c1 | 3300050511 | Bacteria | 2754 |
| 823 | nmdc:mga08y16_513707_c1 | 3300050511 | Bacteria | 1216 |
| 824 | nmdc:mga08y16_68203_c1 | 3300050511 | Bacteria | 3709 |
| 825 | nmdc:mga0n895_101779_c1 | 3300050512 | Bacteria | 2883 |
| 826 | nmdc:mga0n895_11694_c1 | 3300050512 | Bacteria | 7844 |
| 827 | nmdc:mga0n895_117208_c1 | 3300050512 | Bacteria | 2682 |
| 828 | nmdc:mga0n895_86336_c1 | 3300050512 | Bacteria | 3134 |
| 829 | nmdc:mga0rr50_366844_c1 | 3300050513 | Bacteria | 1213 |
| 830 | nmdc:mga08x19_170205_c1 | 3300050514 | Bacteria | 1483 |
| 831 | nmdc:mga08x19_362373_c1 | 3300050514 | Bacteria | 1013 |
| 832 | nmdc:mga08x19_55954_c2 | 3300050514 | Bacteria | 2185 |
| 833 | nmdc:mga08x19_8993_c2 | 3300050514 | Bacteria | 2644 |
| 834 | nmdc:mga0a205_36894_c1 | 3300050515 | Bacteria | 4699 |
| 835 | nmdc:mga0a205_60343_c1 | 3300050515 | Bacteria | 3663 |
| 836 | nmdc:mga0sz30_107_c1 | 3300050516 | Bacteria | 31264 |
| 837 | nmdc:mga0sz30_108616_c1 | 3300050516 | Bacteria | 1215 |
| 838 | nmdc:mga0sz30_33980_c1 | 3300050516 | Bacteria | 2121 |
| 839 | nmdc:mga0sz30_78283_c1 | 3300050516 | Bacteria | 1429 |
| 840 | nmdc:mga0sz30_8253_c2 | 3300050516 | Bacteria | 2598 |
| 841 | Ga0495601_0033194 | 3300053077 | Bacteria | 3215 |
| 842 | Ga0495612_0012291 | 3300053078 | Bacteria | 3451 |
| 843 | Ga0500610_0017821 | 3300053079 | Bacteria | 3420 |
| 844 | Ga0495595_0147946 | 3300053084 | Bacteria | 1155 |
| 845 | Ga0495619_0027909 | 3300053085 | Bacteria | 3640 |
| 846 | Ga0495619_0058253 | 3300053085 | Bacteria | 2564 |
| 847 | Ga0495619_0262615 | 3300053085 | Bacteria | 1196 |
| 848 | Ga0500578_0033329 | 3300053086 | Bacteria | 3309 |
| 849 | Ga0500556_0000142 | 3300053104 | Bacteria | 59905 |
| 850 | Ga0500560_001253 | 3300053107 | Bacteria | 4277 |
| 851 | Ga0500562_011866 | 3300053108 | Bacteria | 2214 |
| 852 | Ga0500618_001280 | 3300053125 | Bacteria | 11596 |
| 853 | Ga0500618_007068 | 3300053125 | Bacteria | 3234 |
| 854 | Ga0500658_0000309 | 3300053134 | Bacteria | 21891 |
| 855 | Ga0500561_0004680 | 3300053137 | Bacteria | 2487 |
| 856 | Ga0500573_0000334 | 3300053140 | Bacteria | 19960 |
| 857 | Ga0500590_001183 | 3300053148 | Bacteria | 10347 |
| 858 | Ga0500616_0003388 | 3300053153 | Bacteria | 12230 |
| 859 | Ga0500616_0045185 | 3300053153 | Bacteria | 2347 |
| 860 | Ga0500622_0000343 | 3300053156 | Bacteria | 45668 |
| 861 | Ga0500622_0002162 | 3300053156 | Bacteria | 14566 |
| 862 | Ga0500627_0075957 | 3300053158 | Bacteria | 1494 |
| 863 | Ga0500627_0082713 | 3300053158 | Bacteria | 1432 |
| 864 | Ga0500627_0127987 | 3300053158 | Bacteria | 1146 |
| 865 | Ga0500633_0008199 | 3300053160 | Bacteria | 2679 |
| 866 | Ga0500634_0000028 | 3300053161 | Bacteria | 80877 |
| 867 | Ga0500634_0018742 | 3300053161 | Bacteria | 3721 |
| 868 | Ga0500636_0000040 | 3300053177 | Bacteria | 69881 |
| 869 | Ga0500636_0002588 | 3300053177 | Bacteria | 10040 |
| 870 | Ga0501084_0000488 | 3300054114 | Bacteria | 30370 |
| 871 | Ga0501084_0023099 | 3300054114 | Bacteria | 5191 |
| 872 | Ga0501084_0072325 | 3300054114 | Bacteria | 2888 |
| 873 | Ga0501084_0124632 | 3300054114 | Bacteria | 2167 |
| 874 | Ga0501084_0251041 | 3300054114 | Bacteria | 1493 |
| 875 | Ga0587084_012964 | 3300059477 | Bacteria | 1138 |
| 876 | Ga0587066_008862 | 3300059490 | Bacteria | 1409 |
| 877 | Ga0587066_051258 | 3300059490 | Bacteria | 813 |
| 878 | Ga0587073_0037104 | 3300059492 | Bacteria | 1042 |
| 879 | Ga0587077_058795 | 3300059493 | Bacteria | 827 |
| 880 | Ga0587082_030751 | 3300059504 | Bacteria | 934 |
| 881 | Ga0587082_047957 | 3300059504 | Bacteria | 806 |
| 882 | Ga0587083_0062428 | 3300059505 | Bacteria | 844 |
| 883 | Ga0587085_008191 | 3300059506 | Bacteria | 1326 |
| 884 | Ga0587088_014040 | 3300059508 | Bacteria | 1240 |
| 885 | Ga0587088_025879 | 3300059508 | Bacteria | 1015 |
| 886 | Ga0587088_036020 | 3300059508 | Bacteria | 910 |
| 887 | Ga0587088_038458 | 3300059508 | Bacteria | 891 |
| 888 | Ga0587088_045251 | 3300059508 | Bacteria | 843 |
| 889 | Ga0587088_050095 | 3300059508 | Bacteria | 815 |
| 890 | Ga0587089_016140 | 3300059509 | Bacteria | 992 |
| 891 | Ga0587090_000942 | 3300059510 | Bacteria | 2737 |
| 892 | Ga0587091_028679 | 3300059511 | Bacteria | 1029 |
| 893 | Ga0587091_057629 | 3300059511 | Bacteria | 816 |
| 894 | Ga0587092_039632 | 3300059512 | Bacteria | 815 |
| 895 | Ga0587094_028773 | 3300059513 | Bacteria | 850 |
| 896 | Ga0587094_029811 | 3300059513 | Bacteria | 840 |
| 897 | Ga0587098_010749 | 3300059604 | Bacteria | 1018 |
| 898 | Ga0587098_020948 | 3300059604 | Bacteria | 830 |
| 899 | Ga0587106_035629 | 3300059605 | Bacteria | 821 |
| 900 | Ga0587129_004592 | 3300059608 | Bacteria | 914 |
| 901 | Ga0587131_004979 | 3300059609 | Bacteria | 819 |
| 902 | Ga0587109_031993 | 3300059624 | Bacteria | 1003 |
| 903 | Ga0587128_031643 | 3300059630 | Bacteria | 880 |
| 904 | Ga0587062_005423 | 3300059639 | Bacteria | 1408 |
| 905 | Ga0587067_010337 | 3300059640 | Bacteria | 1412 |
| 906 | Ga0587067_040453 | 3300059640 | Bacteria | 904 |
| 907 | Ga0587072_000182 | 3300059643 | Bacteria | 5539 |
| 908 | Ga0587072_037083 | 3300059643 | Bacteria | 934 |
| 909 | Ga0587072_052909 | 3300059643 | Bacteria | 818 |
| 910 | Ga0587075_035666 | 3300059644 | Bacteria | 812 |
| 911 | Ga0587076_010905 | 3300059645 | Bacteria | 1324 |
| 912 | Ga0587078_020968 | 3300059646 | Bacteria | 825 |
| 913 | Ga0587105_005868 | 3300059651 | Bacteria | 828 |
| 914 | Ga0587107_024049 | 3300059652 | Bacteria | 875 |
| 915 | Ga0587108_010063 | 3300059653 | Bacteria | 789 |
| 916 | Ga0587071_046356 | 3300060344 | Bacteria | 887 |
| 917 | Ga0587071_051619 | 3300060344 | Bacteria | 852 |
| 918 | Ga0587071_057491 | 3300060344 | Bacteria | 819 |
| 919 | Ga0587111_0063867 | 3300060346 | Bacteria | 844 |
| 920 | Ga0501082_0012395 | 3300060353 | Bacteria | 7327 |
| 921 | Ga0501082_0022657 | 3300060353 | Bacteria | 5409 |
| 922 | Ga0501082_0070245 | 3300060353 | Bacteria | 3015 |
| 923 | Ga0501082_0205576 | 3300060353 | Bacteria | 1713 |
| 924 | Ga0501082_0233258 | 3300060353 | Bacteria | 1602 |
| 925 | Ga0501082_0247295 | 3300060353 | Bacteria | 1552 |
| 926 | Ga0530510_0018710 | 3300061734 | Bacteria | 4913 |
| 927 | Ga0530510_0033636 | 3300061734 | Bacteria | 3689 |
| 928 | Ga0530510_0038261 | 3300061734 | Bacteria | 3463 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046501 | Ga0495607_0011406 | Ga0495607_0011406_2038_2820 | 217 |
| 2 | 3300053125 | Ga0500618_007068 | Ga0500618_007068_87_869 | 217 |
| 3 | 3300033524 | Ga0316592_1058377 | Ga0316592_10583771 | 219 |
| 4 | 3300033541 | Ga0316596_1079334 | Ga0316596_10793341 | 219 |
| 5 | 3300036647 | Ga0316582_0116711 | Ga0316582_0116711_332_1108 | 219 |
| 6 | 3300036712 | Ga0316584_0243521 | Ga0316584_0243521_443_1219 | 219 |
| 7 | 3300049571 | Ga0501034_0002652 | Ga0501034_0002652_2413_3192 | 220 |
| 8 | 3300049571 | Ga0501034_0044944 | Ga0501034_0044944_3528_4379 | 220 |
| 9 | 3300053161 | Ga0500634_0018742 | Ga0500634_0018742_1494_2276 | 221 |
| 10 | 3300020080 | Ga0206350_10800904 | Ga0206350_108009041 | 222 |
| 11 | 3300041404 | Ga0439436_0039541 | Ga0439436_0039541_490_1323 | 222 |
| 12 | 3300050491 | nmdc:mga00v17_240312_c1 | nmdc:mga00v17_240312_c1_244_1083 | 223 |
| 13 | 3300005985 | Ga0081539_10000690 | Ga0081539_100006908 | 224 |
| 14 | iso_pu_bacteria | 2903513507 | 2903515779 | 224 |
| 15 | 3300039062 | Ga0400483_039327 | Ga0400483_039327_930_1640 | 226 |
| 16 | 3300048927 | Ga0496124_0096090 | Ga0496124_0096090_1667_2389 | 227 |
| 17 | 3300049568 | Ga0501031_0204605 | Ga0501031_0204605_543_1256 | 227 |
| 18 | 3300049570 | Ga0501033_0318653 | Ga0501033_0318653_65_778 | 227 |
| 19 | 3300049572 | Ga0501036_0011045 | Ga0501036_0011045_256_969 | 227 |
| 20 | 3300049574 | Ga0501038_0396686 | Ga0501038_0396686_338_1051 | 227 |
| 21 | 3300049575 | Ga0501039_0023552 | Ga0501039_0023552_256_969 | 227 |
| 22 | 3300049576 | Ga0501040_0046579 | Ga0501040_0046579_1898_2611 | 227 |
| 23 | 3300049578 | Ga0501042_0005598 | Ga0501042_0005598_6387_7100 | 227 |
| 24 | 3300049580 | Ga0501046_0018273 | Ga0501046_0018273_3663_4376 | 227 |
| 25 | 3300049582 | Ga0501048_0105263 | Ga0501048_0105263_811_1524 | 227 |
| 26 | 3300049584 | Ga0501068_0222795 | Ga0501068_0222795_308_1021 | 227 |
| 27 | 3300049587 | Ga0501071_0027577 | Ga0501071_0027577_1386_2099 | 227 |
| 28 | 3300049588 | Ga0501072_0030130 | Ga0501072_0030130_3273_3986 | 227 |
| 29 | 3300049591 | Ga0501075_0088069 | Ga0501075_0088069_514_1227 | 227 |
| 30 | 3300049592 | Ga0501076_0436776 | Ga0501076_0436776_100_813 | 227 |
| 31 | 3300049593 | Ga0501077_0115784 | Ga0501077_0115784_811_1524 | 227 |
| 32 | 3300049741 | Ga0501079_0023397 | Ga0501079_0023397_152_865 | 227 |
| 33 | 3300049822 | Ga0501035_0446086 | Ga0501035_0446086_141_854 | 227 |
| 34 | 3300049824 | Ga0501045_0216790 | Ga0501045_0216790_95_808 | 227 |
| 35 | 3300054114 | Ga0501084_0251041 | Ga0501084_0251041_226_939 | 227 |
| 36 | 3300060353 | Ga0501082_0247295 | Ga0501082_0247295_196_909 | 227 |
| 37 | 3300061734 | Ga0530510_0038261 | Ga0530510_0038261_2252_2965 | 227 |
| 38 | 3300003578 | Ga0006562J51391_1002937 | Ga0006562J51391_10029372 | 228 |
| 39 | 3300005981 | Ga0081538_10050330 | Ga0081538_100503303 | 228 |
| 40 | 3300020075 | Ga0206349_1464035 | Ga0206349_14640351 | 228 |
| 41 | 3300032168 | Ga0316593_10165967 | Ga0316593_101659671 | 228 |
| 42 | 3300049573 | Ga0501037_0052558 | Ga0501037_0052558_1967_2683 | 228 |
| 43 | 3300049742 | Ga0501080_0586822 | Ga0501080_0586822_253_969 | 228 |
| 44 | 3300050507 | nmdc:mga05p37_97560_c1 | nmdc:mga05p37_97560_c1_861_1562 | 228 |
| 45 | 3300001991 | JGI24743J22301_10037076 | JGI24743J22301_100370761 | 229 |
| 46 | 3300005338 | Ga0068868_100141002 | Ga0068868_1001410022 | 229 |
| 47 | 3300005364 | Ga0070673_100034031 | Ga0070673_1000340312 | 229 |
| 48 | 3300025960 | Ga0207651_10176714 | Ga0207651_101767141 | 229 |
| 49 | 3300025986 | Ga0207658_10368762 | Ga0207658_103687621 | 229 |
| 50 | 3300026023 | Ga0207677_10132357 | Ga0207677_101323572 | 229 |
| 51 | 3300037418 | Ga0395900_0031790 | Ga0395900_0031790_84_824 | 229 |
| 52 | 3300037471 | Ga0395905_0020139 | Ga0395905_0020139_3670_4410 | 229 |
| 53 | 3300038443 | Ga0395901_0120745 | Ga0395901_0120745_1023_1763 | 229 |
| 54 | 3300039062 | Ga0400483_125138 | Ga0400483_125138_374_1099 | 229 |
| 55 | 3300039062 | Ga0400483_252775 | Ga0400483_252775_16396_17121 | 229 |
| 56 | 3300045049 | Ga0466959_0072685 | Ga0466959_0072685_1158_1901 | 229 |
| 57 | 3300045836 | Ga0466958_0232688 | Ga0466958_0232688_406_1149 | 229 |
| 58 | iso_pu_bacteria | 8020945358 | 8020949293 | 229 |
| 59 | 3300005985 | Ga0081539_10004943 | Ga0081539_1000494313 | 230 |
| 60 | 3300006914 | Ga0075436_100076116 | Ga0075436_1000761162 | 231 |
| 61 | 3300031251 | Ga0265327_10003920 | Ga0265327_100039206 | 231 |
| 62 | 3300031595 | Ga0265313_10001402 | Ga0265313_1000140217 | 231 |
| 63 | 3300037312 | Ga0395899_0007406 | Ga0395899_0007406_3818_4540 | 231 |
| 64 | 3300037418 | Ga0395900_0008711 | Ga0395900_0008711_6131_6853 | 231 |
| 65 | 3300037418 | Ga0395900_0321935 | Ga0395900_0321935_774_1496 | 231 |
| 66 | 3300037466 | Ga0395898_0033165 | Ga0395898_0033165_914_1636 | 231 |
| 67 | 3300038443 | Ga0395901_0079118 | Ga0395901_0079118_914_1636 | 231 |
| 68 | 3300044712 | Ga0453684_0000015 | Ga0453684_0000015_366618_367331 | 231 |
| 69 | 3300044712 | Ga0453684_0000020 | Ga0453684_0000020_391818_392528 | 231 |
| 70 | 3300050514 | nmdc:mga08x19_55954_c2 | nmdc:mga08x19_55954_c2_363_1076 | 231 |
| 71 | 3300053084 | Ga0495595_0147946 | Ga0495595_0147946_54_767 | 231 |
| 72 | 3300053085 | Ga0495619_0058253 | Ga0495619_0058253_1749_2462 | 231 |
| 73 | iso_pu_bacteria | 2534681786 | 2535485706 | 231 |
| 74 | iso_pu_bacteria | 2757320392 | 2757570179 | 231 |
| 75 | iso_pu_bacteria | 2915650412 | 2915650815 | 231 |
| 76 | 3300029283 | Ga0310982_132715 | Ga0310982_1327151 | 232 |
| 77 | 3300031824 | Ga0307413_10114192 | Ga0307413_101141922 | 232 |
| 78 | 3300049128 | Ga0501308_017966 | Ga0501308_017966_23_754 | 232 |
| 79 | 3300049162 | Ga0501307_028324 | Ga0501307_028324_24_755 | 232 |
| 80 | 3300049531 | Ga0501315_027457 | Ga0501315_027457_52_783 | 232 |
| 81 | 3300049534 | Ga0501318_016002 | Ga0501318_016002_149_880 | 232 |
| 82 | 3300049551 | Ga0501335_016323 | Ga0501335_016323_18_749 | 232 |
| 83 | 3300049553 | Ga0501337_007142 | Ga0501337_007142_18_749 | 232 |
| 84 | 3300049556 | Ga0501340_007485 | Ga0501340_007485_13_744 | 232 |
| 85 | iso_pu_bacteria | 2513237094 | 2513640073 | 232 |
| 86 | iso_pu_bacteria | 2537561587 | 2537876412 | 232 |
| 87 | iso_pu_bacteria | 2554235003 | 2554248846 | 232 |
| 88 | iso_pu_bacteria | 2558860242 | 2559295934 | 232 |
| 89 | iso_pu_bacteria | 2599185210 | 2599603275 | 232 |
| 90 | iso_pu_bacteria | 2599185236 | 2599720310 | 232 |
| 91 | iso_pu_bacteria | 2643221582 | 2643921459 | 232 |
| 92 | iso_pu_bacteria | 2643221693 | 2644521512 | 232 |
| 93 | iso_pu_bacteria | 2808606387 | 2808988242 | 232 |
| 94 | iso_pu_bacteria | 2818991439 | 2819560944 | 232 |
| 95 | iso_pu_bacteria | 2821123053 | 2821128703 | 232 |
| 96 | iso_pu_bacteria | 2838675328 | 2838678694 | 232 |
| 97 | iso_pu_bacteria | 2838714209 | 2838718217 | 232 |
| 98 | iso_pu_bacteria | 2838719591 | 2838722991 | 232 |
| 99 | iso_pu_bacteria | 2838724970 | 2838728284 | 232 |
| 100 | iso_pu_bacteria | 2838736955 | 2838741719 | 232 |
| 101 | iso_pu_bacteria | 2841840854 | 2841845447 | 232 |
| 102 | iso_pu_bacteria | 2841846520 | 2841850547 | 232 |
| 103 | iso_pu_bacteria | 2841859092 | 2841863201 | 232 |
| 104 | iso_pu_bacteria | 2842124991 | 2842128943 | 232 |
| 105 | iso_pu_bacteria | 2842130223 | 2842133586 | 232 |
| 106 | iso_pu_bacteria | 2842140634 | 2842145150 | 232 |
| 107 | iso_pu_bacteria | 2842152218 | 2842155502 | 232 |
| 108 | iso_pu_bacteria | 2842170452 | 2842174541 | 232 |
| 109 | iso_pu_bacteria | 2842175837 | 2842179200 | 232 |
| 110 | iso_pu_bacteria | 2842187318 | 2842190641 | 232 |
| 111 | iso_pu_bacteria | 2842211629 | 2842215035 | 232 |
| 112 | iso_pu_bacteria | 2842224351 | 2842227756 | 232 |
| 113 | iso_pu_bacteria | 2842515876 | 2842520061 | 232 |
| 114 | iso_pu_bacteria | 2857531043 | 2857534144 | 232 |
| 115 | iso_pu_bacteria | 2899792073 | 2899795301 | 232 |
| 116 | iso_pu_bacteria | 2899845264 | 2899849281 | 232 |
| 117 | iso_pu_bacteria | 2919114240 | 2919118525 | 232 |
| 118 | iso_pu_bacteria | 2926754445 | 2926755055 | 232 |
| 119 | iso_pu_bacteria | 2926760298 | 2926762214 | 232 |
| 120 | iso_pu_bacteria | 2933006813 | 2933010648 | 232 |
| 121 | iso_pu_bacteria | 2933011516 | 2933015680 | 232 |
| 122 | iso_pu_bacteria | 2979089926 | 2979092516 | 232 |
| 123 | iso_pu_bacteria | 2979095461 | 2979100093 | 232 |
| 124 | iso_pu_bacteria | 2979100975 | 2979104488 | 232 |
| 125 | iso_pu_bacteria | 2984509177 | 2984513717 | 232 |
| 126 | iso_pu_bacteria | 2984518228 | 2984522705 | 232 |
| 127 | iso_pu_bacteria | 2984537506 | 2984542011 | 232 |
| 128 | iso_pu_bacteria | 2984587000 | 2984590841 | 232 |
| 129 | iso_pu_bacteria | 2984601300 | 2984601441 | 232 |
| 130 | iso_pu_bacteria | 650716007 | 650741147 | 232 |
| 131 | iso_pu_bacteria | 8003570095 | 8003573793 | 232 |
| 132 | 3300002067 | JGI24735J21928_10095477 | JGI24735J21928_100954771 | 233 |
| 133 | 3300005339 | Ga0070660_100000020 | Ga0070660_10000002010 | 233 |
| 134 | 3300005366 | Ga0070659_100000047 | Ga0070659_10000004710 | 233 |
| 135 | 3300005455 | Ga0070663_100005665 | Ga0070663_1000056657 | 233 |
| 136 | 3300005563 | Ga0068855_100027087 | Ga0068855_1000270876 | 233 |
| 137 | 3300005842 | Ga0068858_100157053 | Ga0068858_1001570533 | 233 |
| 138 | 3300009092 | Ga0105250_10004360 | Ga0105250_100043607 | 233 |
| 139 | 3300009093 | Ga0105240_10011135 | Ga0105240_1001113511 | 233 |
| 140 | 3300009545 | Ga0105237_10038473 | Ga0105237_100384736 | 233 |
| 141 | 3300009551 | Ga0105238_10005332 | Ga0105238_1000533210 | 233 |
| 142 | 3300009553 | Ga0105249_10178565 | Ga0105249_101785652 | 233 |
| 143 | 3300010375 | Ga0105239_10010060 | Ga0105239_100100607 | 233 |
| 144 | 3300013100 | Ga0157373_10013897 | Ga0157373_100138973 | 233 |
| 145 | 3300013104 | Ga0157370_10008875 | Ga0157370_100088758 | 233 |
| 146 | 3300013105 | Ga0157369_10025178 | Ga0157369_100251788 | 233 |
| 147 | 3300015265 | Ga0182005_1009966 | Ga0182005_10099664 | 233 |
| 148 | 3300025256 | Ga0209759_1004146 | Ga0209759_10041462 | 233 |
| 149 | 3300025711 | Ga0207696_1011005 | Ga0207696_10110053 | 233 |
| 150 | 3300025904 | Ga0207647_10101197 | Ga0207647_101011973 | 233 |
| 151 | 3300025913 | Ga0207695_10085396 | Ga0207695_100853963 | 233 |
| 152 | 3300025914 | Ga0207671_10017490 | Ga0207671_100174901 | 233 |
| 153 | 3300025919 | Ga0207657_10000390 | Ga0207657_100003909 | 233 |
| 154 | 3300025924 | Ga0207694_10008165 | Ga0207694_100081656 | 233 |
| 155 | 3300025932 | Ga0207690_10000037 | Ga0207690_1000003796 | 233 |
| 156 | 3300025949 | Ga0207667_10008668 | Ga0207667_100086688 | 233 |
| 157 | 3300025961 | Ga0207712_10435544 | Ga0207712_104355441 | 233 |
| 158 | 3300026067 | Ga0207678_10002696 | Ga0207678_1000269611 | 233 |
| 159 | 3300031824 | Ga0307413_10231357 | Ga0307413_102313572 | 233 |
| 160 | 3300031995 | Ga0307409_100871771 | Ga0307409_1008717711 | 233 |
| 161 | 3300048907 | Ga0496104_0009450 | Ga0496104_0009450_5682_6401 | 233 |
| 162 | 3300048908 | Ga0496105_0041839 | Ga0496105_0041839_1243_1962 | 233 |
| 163 | 3300048920 | Ga0496117_0061998 | Ga0496117_0061998_1223_1942 | 233 |
| 164 | 3300048924 | Ga0496121_0008479 | Ga0496121_0008479_4826_5545 | 233 |
| 165 | 3300048925 | Ga0496122_0043273 | Ga0496122_0043273_1968_2687 | 233 |
| 166 | 3300048926 | Ga0496123_0071680 | Ga0496123_0071680_377_1096 | 233 |
| 167 | 3300048928 | Ga0496125_0136094 | Ga0496125_0136094_700_1419 | 233 |
| 168 | 3300049593 | Ga0501077_0042622 | Ga0501077_0042622_920_1675 | 233 |
| 169 | 3300049744 | Ga0501083_0059804 | Ga0501083_0059804_116_871 | 233 |
| 170 | 3300059646 | Ga0587078_020968 | Ga0587078_020968_84_803 | 233 |
| 171 | iso_pu_bacteria | 2932818245 | 2932824960 | 233 |
| 172 | 3300005336 | Ga0070680_100006198 | Ga0070680_1000061985 | 234 |
| 173 | 3300005336 | Ga0070680_100027023 | Ga0070680_1000270234 | 234 |
| 174 | 3300005337 | Ga0070682_100601182 | Ga0070682_1006011821 | 234 |
| 175 | 3300005347 | Ga0070668_100434563 | Ga0070668_1004345631 | 234 |
| 176 | 3300005366 | Ga0070659_100140961 | Ga0070659_1001409611 | 234 |
| 177 | 3300005440 | Ga0070705_100399940 | Ga0070705_1003999401 | 234 |
| 178 | 3300005457 | Ga0070662_100648312 | Ga0070662_1006483121 | 234 |
| 179 | 3300005458 | Ga0070681_10005513 | Ga0070681_1000551312 | 234 |
| 180 | 3300005458 | Ga0070681_10056435 | Ga0070681_100564354 | 234 |
| 181 | 3300005459 | Ga0068867_100365757 | Ga0068867_1003657572 | 234 |
| 182 | 3300005530 | Ga0070679_100031668 | Ga0070679_1000316682 | 234 |
| 183 | 3300005536 | Ga0070697_100408525 | Ga0070697_1004085251 | 234 |
| 184 | 3300005539 | Ga0068853_100005537 | Ga0068853_1000055379 | 234 |
| 185 | 3300005546 | Ga0070696_100030767 | Ga0070696_1000307672 | 234 |
| 186 | 3300005549 | Ga0070704_100017621 | Ga0070704_1000176215 | 234 |
| 187 | 3300005563 | Ga0068855_100715821 | Ga0068855_1007158211 | 234 |
| 188 | 3300005578 | Ga0068854_100101418 | Ga0068854_1001014182 | 234 |
| 189 | 3300005842 | Ga0068858_100117226 | Ga0068858_1001172262 | 234 |
| 190 | 3300005843 | Ga0068860_100145567 | Ga0068860_1001455672 | 234 |
| 191 | 3300005844 | Ga0068862_100195314 | Ga0068862_1001953142 | 234 |
| 192 | 3300006871 | Ga0075434_100084518 | Ga0075434_1000845181 | 234 |
| 193 | 3300009093 | Ga0105240_10501254 | Ga0105240_105012541 | 234 |
| 194 | 3300009101 | Ga0105247_10076292 | Ga0105247_100762923 | 234 |
| 195 | 3300009148 | Ga0105243_10079313 | Ga0105243_100793133 | 234 |
| 196 | 3300009545 | Ga0105237_10168486 | Ga0105237_101684861 | 234 |
| 197 | 3300010375 | Ga0105239_10035669 | Ga0105239_100356696 | 234 |
| 198 | 3300012476 | Ga0157344_1001511 | Ga0157344_10015112 | 234 |
| 199 | 3300013100 | Ga0157373_10015389 | Ga0157373_100153895 | 234 |
| 200 | 3300013104 | Ga0157370_10004314 | Ga0157370_1000431411 | 234 |
| 201 | 3300013104 | Ga0157370_10104424 | Ga0157370_101044241 | 234 |
| 202 | 3300013307 | Ga0157372_10001645 | Ga0157372_1000164525 | 234 |
| 203 | 3300013308 | Ga0157375_10605948 | Ga0157375_106059481 | 234 |
| 204 | 3300014968 | Ga0157379_10018880 | Ga0157379_100188805 | 234 |
| 205 | 3300020080 | Ga0206350_10789658 | Ga0206350_107896581 | 234 |
| 206 | 3300025911 | Ga0207654_10185994 | Ga0207654_101859942 | 234 |
| 207 | 3300025912 | Ga0207707_10004935 | Ga0207707_100049353 | 234 |
| 208 | 3300025917 | Ga0207660_10027643 | Ga0207660_100276435 | 234 |
| 209 | 3300025921 | Ga0207652_10035039 | Ga0207652_100350394 | 234 |
| 210 | 3300025932 | Ga0207690_10090157 | Ga0207690_100901571 | 234 |
| 211 | 3300025932 | Ga0207690_10239966 | Ga0207690_102399662 | 234 |
| 212 | 3300025933 | Ga0207706_10121395 | Ga0207706_101213951 | 234 |
| 213 | 3300025981 | Ga0207640_10183110 | Ga0207640_101831102 | 234 |
| 214 | 3300025981 | Ga0207640_10552868 | Ga0207640_105528681 | 234 |
| 215 | 3300026035 | Ga0207703_10457427 | Ga0207703_104574271 | 234 |
| 216 | 3300026089 | Ga0207648_10334193 | Ga0207648_103341931 | 234 |
| 217 | 3300026118 | Ga0207675_100108076 | Ga0207675_1001080762 | 234 |
| 218 | 3300027717 | Ga0209998_10005453 | Ga0209998_100054532 | 234 |
| 219 | 3300027876 | Ga0209974_10025784 | Ga0209974_100257842 | 234 |
| 220 | 3300027907 | Ga0207428_10156798 | Ga0207428_101567981 | 234 |
| 221 | 3300028381 | Ga0268264_10447985 | Ga0268264_104479851 | 234 |
| 222 | 3300031344 | Ga0265316_10148817 | Ga0265316_101488172 | 234 |
| 223 | 3300034957 | Ga0373938_0045057 | Ga0373938_0045057_122_877 | 234 |
| 224 | 3300035092 | Ga0373952_0033990 | Ga0373952_0033990_92_847 | 234 |
| 225 | 3300035121 | Ga0373960_0044953 | Ga0373960_0044953_181_936 | 234 |
| 226 | 3300035242 | Ga0373962_0009108 | Ga0373962_0009108_1552_2307 | 234 |
| 227 | 3300036401 | Ga0373937_0001845 | Ga0373937_0001845_10786_11511 | 234 |
| 228 | 3300046491 | Ga0495584_0023947 | Ga0495584_0023947_1938_2693 | 234 |
| 229 | 3300046492 | Ga0495585_0089241 | Ga0495585_0089241_472_1227 | 234 |
| 230 | 3300046506 | Ga0495583_0196796 | Ga0495583_0196796_50_805 | 234 |
| 231 | 3300046520 | Ga0495637_0045872 | Ga0495637_0045872_1037_1792 | 234 |
| 232 | 3300046536 | Ga0495587_0125894 | Ga0495587_0125894_14_769 | 234 |
| 233 | 3300046615 | Ga0495656_0117104 | Ga0495656_0117104_317_1072 | 234 |
| 234 | 3300046664 | Ga0495659_0043452 | Ga0495659_0043452_47_802 | 234 |
| 235 | 3300046691 | Ga0495670_0116322 | Ga0495670_0116322_576_1331 | 234 |
| 236 | 3300047318 | Ga0495636_0045205 | Ga0495636_0045205_699_1454 | 234 |
| 237 | 3300047319 | Ga0495674_0218363 | Ga0495674_0218363_571_1326 | 234 |
| 238 | 3300048909 | Ga0496106_0280746 | Ga0496106_0280746_272_1027 | 234 |
| 239 | 3300048911 | Ga0496108_0173192 | Ga0496108_0173192_495_1250 | 234 |
| 240 | 3300048913 | Ga0496110_0354148 | Ga0496110_0354148_180_935 | 234 |
| 241 | 3300048917 | Ga0496114_0250698 | Ga0496114_0250698_582_1337 | 234 |
| 242 | 3300049568 | Ga0501031_0279736 | Ga0501031_0279736_175_930 | 234 |
| 243 | 3300049570 | Ga0501033_0169802 | Ga0501033_0169802_286_1041 | 234 |
| 244 | 3300049571 | Ga0501034_0102580 | Ga0501034_0102580_910_1668 | 234 |
| 245 | 3300049572 | Ga0501036_0331910 | Ga0501036_0331910_367_1122 | 234 |
| 246 | 3300049573 | Ga0501037_0037047 | Ga0501037_0037047_119_874 | 234 |
| 247 | 3300049574 | Ga0501038_0028880 | Ga0501038_0028880_4005_4760 | 234 |
| 248 | 3300049574 | Ga0501038_0268377 | Ga0501038_0268377_208_963 | 234 |
| 249 | 3300049575 | Ga0501039_0188427 | Ga0501039_0188427_709_1464 | 234 |
| 250 | 3300049575 | Ga0501039_0190127 | Ga0501039_0190127_847_1602 | 234 |
| 251 | 3300049575 | Ga0501039_0235604 | Ga0501039_0235604_84_839 | 234 |
| 252 | 3300049576 | Ga0501040_0062010 | Ga0501040_0062010_1563_2318 | 234 |
| 253 | 3300049577 | Ga0501041_0054907 | Ga0501041_0054907_1486_2241 | 234 |
| 254 | 3300049577 | Ga0501041_0060730 | Ga0501041_0060730_896_1651 | 234 |
| 255 | 3300049578 | Ga0501042_0126387 | Ga0501042_0126387_420_1175 | 234 |
| 256 | 3300049579 | Ga0501043_0248947 | Ga0501043_0248947_544_1299 | 234 |
| 257 | 3300049580 | Ga0501046_0048839 | Ga0501046_0048839_1805_2560 | 234 |
| 258 | 3300049582 | Ga0501048_0021393 | Ga0501048_0021393_3739_4494 | 234 |
| 259 | 3300049584 | Ga0501068_0018147 | Ga0501068_0018147_2561_3316 | 234 |
| 260 | 3300049584 | Ga0501068_0030274 | Ga0501068_0030274_2404_3159 | 234 |
| 261 | 3300049585 | Ga0501069_0167197 | Ga0501069_0167197_83_838 | 234 |
| 262 | 3300049587 | Ga0501071_0037374 | Ga0501071_0037374_424_1179 | 234 |
| 263 | 3300049587 | Ga0501071_0268483 | Ga0501071_0268483_126_881 | 234 |
| 264 | 3300049588 | Ga0501072_0010915 | Ga0501072_0010915_368_1123 | 234 |
| 265 | 3300049590 | Ga0501074_0185995 | Ga0501074_0185995_273_1028 | 234 |
| 266 | 3300049590 | Ga0501074_0244023 | Ga0501074_0244023_494_1249 | 234 |
| 267 | 3300049592 | Ga0501076_0110378 | Ga0501076_0110378_72_827 | 234 |
| 268 | 3300049592 | Ga0501076_0435976 | Ga0501076_0435976_167_922 | 234 |
| 269 | 3300049593 | Ga0501077_0038231 | Ga0501077_0038231_1797_2552 | 234 |
| 270 | 3300049741 | Ga0501079_0142116 | Ga0501079_0142116_346_1101 | 234 |
| 271 | 3300049741 | Ga0501079_0197499 | Ga0501079_0197499_368_1123 | 234 |
| 272 | 3300049742 | Ga0501080_0111403 | Ga0501080_0111403_723_1478 | 234 |
| 273 | 3300049742 | Ga0501080_0451461 | Ga0501080_0451461_31_786 | 234 |
| 274 | 3300049743 | Ga0501081_0054363 | Ga0501081_0054363_414_1169 | 234 |
| 275 | 3300049744 | Ga0501083_0069508 | Ga0501083_0069508_943_1698 | 234 |
| 276 | 3300049822 | Ga0501035_0048680 | Ga0501035_0048680_943_1698 | 234 |
| 277 | 3300050507 | nmdc:mga05p37_1046553_c1 | nmdc:mga05p37_1046553_c1_73_828 | 234 |
| 278 | 3300050511 | nmdc:mga08y16_513707_c1 | nmdc:mga08y16_513707_c1_255_1010 | 234 |
| 279 | 3300050512 | nmdc:mga0n895_86336_c1 | nmdc:mga0n895_86336_c1_2255_3010 | 234 |
| 280 | 3300050515 | nmdc:mga0a205_60343_c1 | nmdc:mga0a205_60343_c1_1483_2238 | 234 |
| 281 | 3300053077 | Ga0495601_0033194 | Ga0495601_0033194_1076_1831 | 234 |
| 282 | 3300053078 | Ga0495612_0012291 | Ga0495612_0012291_851_1606 | 234 |
| 283 | 3300053085 | Ga0495619_0027909 | Ga0495619_0027909_220_975 | 234 |
| 284 | 3300054114 | Ga0501084_0023099 | Ga0501084_0023099_1059_1814 | 234 |
| 285 | 3300054114 | Ga0501084_0124632 | Ga0501084_0124632_1371_2126 | 234 |
| 286 | 3300060353 | Ga0501082_0070245 | Ga0501082_0070245_26_781 | 234 |
| 287 | 3300060353 | Ga0501082_0233258 | Ga0501082_0233258_771_1526 | 234 |
| 288 | 3300061734 | Ga0530510_0033636 | Ga0530510_0033636_149_904 | 234 |
| 289 | iso_pu_bacteria | 2523231067 | 2523467840 | 234 |
| 290 | iso_pu_bacteria | 2738543031 | 2739349292 | 234 |
| 291 | 3300005546 | Ga0070696_100008510 | Ga0070696_1000085103 | 235 |
| 292 | 3300005844 | Ga0068862_100199410 | Ga0068862_1001994102 | 235 |
| 293 | 3300006844 | Ga0075428_100740915 | Ga0075428_1007409152 | 235 |
| 294 | 3300006847 | Ga0075431_100020391 | Ga0075431_1000203911 | 235 |
| 295 | 3300006852 | Ga0075433_10320624 | Ga0075433_103206242 | 235 |
| 296 | 3300006871 | Ga0075434_100103423 | Ga0075434_1001034232 | 235 |
| 297 | 3300007076 | Ga0075435_100141712 | Ga0075435_1001417123 | 235 |
| 298 | 3300009147 | Ga0114129_10011337 | Ga0114129_100113376 | 235 |
| 299 | 3300025923 | Ga0207681_10007620 | Ga0207681_100076205 | 235 |
| 300 | 3300025937 | Ga0207669_10137732 | Ga0207669_101377322 | 235 |
| 301 | 3300025938 | Ga0207704_10053675 | Ga0207704_100536753 | 235 |
| 302 | 3300026118 | Ga0207675_100023660 | Ga0207675_1000236606 | 235 |
| 303 | 3300026118 | Ga0207675_100881346 | Ga0207675_1008813461 | 235 |
| 304 | 3300027907 | Ga0207428_10000440 | Ga0207428_1000044024 | 235 |
| 305 | 3300028380 | Ga0268265_10266988 | Ga0268265_102669882 | 235 |
| 306 | 3300042435 | Ga0439434_0033961 | Ga0439434_0033961_360_1142 | 235 |
| 307 | 3300046455 | Ga0495603_0000026 | Ga0495603_0000026_59640_60410 | 235 |
| 308 | 3300046459 | Ga0495629_0096213 | Ga0495629_0096213_198_968 | 235 |
| 309 | 3300048927 | Ga0496124_0000174 | Ga0496124_0000174_13781_14563 | 235 |
| 310 | 3300049570 | Ga0501033_0103766 | Ga0501033_0103766_178_897 | 235 |
| 311 | 3300049572 | Ga0501036_0098239 | Ga0501036_0098239_756_1475 | 235 |
| 312 | 3300049576 | Ga0501040_0008431 | Ga0501040_0008431_310_1029 | 235 |
| 313 | 3300049577 | Ga0501041_0018246 | Ga0501041_0018246_1340_2059 | 235 |
| 314 | 3300049580 | Ga0501046_0060051 | Ga0501046_0060051_1471_2190 | 235 |
| 315 | 3300049582 | Ga0501048_0046877 | Ga0501048_0046877_1606_2325 | 235 |
| 316 | 3300049584 | Ga0501068_0209137 | Ga0501068_0209137_154_873 | 235 |
| 317 | 3300049587 | Ga0501071_0149415 | Ga0501071_0149415_971_1690 | 235 |
| 318 | 3300049590 | Ga0501074_0060176 | Ga0501074_0060176_825_1544 | 235 |
| 319 | 3300049591 | Ga0501075_0004606 | Ga0501075_0004606_5573_6292 | 235 |
| 320 | 3300049592 | Ga0501076_0004436 | Ga0501076_0004436_1661_2380 | 235 |
| 321 | 3300049741 | Ga0501079_0007738 | Ga0501079_0007738_923_1663 | 235 |
| 322 | 3300049742 | Ga0501080_0048854 | Ga0501080_0048854_2611_3330 | 235 |
| 323 | 3300049743 | Ga0501081_0002638 | Ga0501081_0002638_1175_1894 | 235 |
| 324 | 3300049824 | Ga0501045_0002264 | Ga0501045_0002264_1935_2654 | 235 |
| 325 | 3300050507 | nmdc:mga05p37_17400_c1 | nmdc:mga05p37_17400_c1_7597_8316 | 235 |
| 326 | 3300050508 | nmdc:mga09592_137341_c1 | nmdc:mga09592_137341_c1_1266_1985 | 235 |
| 327 | 3300050510 | nmdc:mga06r32_14807_c1 | nmdc:mga06r32_14807_c1_3934_4653 | 235 |
| 328 | 3300050511 | nmdc:mga08y16_118606_c1 | nmdc:mga08y16_118606_c1_805_1545 | 235 |
| 329 | 3300050512 | nmdc:mga0n895_101779_c1 | nmdc:mga0n895_101779_c1_1617_2357 | 235 |
| 330 | 3300050513 | nmdc:mga0rr50_366844_c1 | nmdc:mga0rr50_366844_c1_241_981 | 235 |
| 331 | 3300050514 | nmdc:mga08x19_170205_c1 | nmdc:mga08x19_170205_c1_84_824 | 235 |
| 332 | 3300050515 | nmdc:mga0a205_36894_c1 | nmdc:mga0a205_36894_c1_1918_2658 | 235 |
| 333 | 3300054114 | Ga0501084_0000488 | Ga0501084_0000488_689_1408 | 235 |
| 334 | 3300060353 | Ga0501082_0022657 | Ga0501082_0022657_2274_2993 | 235 |
| 335 | 3300061734 | Ga0530510_0018710 | Ga0530510_0018710_2358_3077 | 235 |
| 336 | iso_pu_bacteria | 2509276021 | 2509389433 | 235 |
| 337 | iso_pu_bacteria | 2509276033 | 2509446170 | 235 |
| 338 | iso_pu_bacteria | 2510065019 | 2510135224 | 235 |
| 339 | iso_pu_bacteria | 2510461069 | 2510841556 | 235 |
| 340 | iso_pu_bacteria | 2510461076 | 2510896678 | 235 |
| 341 | iso_pu_bacteria | 2510917028 | 2511183976 | 235 |
| 342 | iso_pu_bacteria | 2510917030 | 2511194580 | 235 |
| 343 | iso_pu_bacteria | 2513237084 | 2513571608 | 235 |
| 344 | iso_pu_bacteria | 2513237085 | 2513578641 | 235 |
| 345 | iso_pu_bacteria | 2513237088 | 2513596807 | 235 |
| 346 | iso_pu_bacteria | 2513237093 | 2513630174 | 235 |
| 347 | iso_pu_bacteria | 2513237103 | 2513711328 | 235 |
| 348 | iso_pu_bacteria | 2513237138 | 2513867458 | 235 |
| 349 | iso_pu_bacteria | 2513237144 | 2513912356 | 235 |
| 350 | iso_pu_bacteria | 2513237146 | 2513928459 | 235 |
| 351 | iso_pu_bacteria | 2513237162 | 2514019378 | 235 |
| 352 | iso_pu_bacteria | 2515075009 | 2515114380 | 235 |
| 353 | iso_pu_bacteria | 2515154113 | 2515635385 | 235 |
| 354 | iso_pu_bacteria | 2515154114 | 2515643208 | 235 |
| 355 | iso_pu_bacteria | 2515154116 | 2515657672 | 235 |
| 356 | iso_pu_bacteria | 2515154134 | 2515741565 | 235 |
| 357 | iso_pu_bacteria | 2516653077 | 2517038031 | 235 |
| 358 | iso_pu_bacteria | 2516653085 | 2517078296 | 235 |
| 359 | iso_pu_bacteria | 2517093000 | 2517097055 | 235 |
| 360 | iso_pu_bacteria | 2517287029 | 2517408561 | 235 |
| 361 | iso_pu_bacteria | 2519899620 | 2520379681 | 235 |
| 362 | iso_pu_bacteria | 2529292951 | 2530647373 | 235 |
| 363 | iso_pu_bacteria | 2582581294 | 2585201760 | 235 |
| 364 | iso_pu_bacteria | 2582581298 | 2585223901 | 235 |
| 365 | iso_pu_bacteria | 2582581867 | 2585399726 | 235 |
| 366 | iso_pu_bacteria | 2585427526 | 2585526067 | 235 |
| 367 | iso_pu_bacteria | 2585427528 | 2585540756 | 235 |
| 368 | iso_pu_bacteria | 2585427529 | 2585549124 | 235 |
| 369 | iso_pu_bacteria | 2585427590 | 2585820813 | 235 |
| 370 | iso_pu_bacteria | 2585427593 | 2585839026 | 235 |
| 371 | iso_pu_bacteria | 2599185170 | 2599420171 | 235 |
| 372 | iso_pu_bacteria | 2615840624 | 2616296337 | 235 |
| 373 | iso_pu_bacteria | 2718217882 | 2719182941 | 235 |
| 374 | iso_pu_bacteria | 2718217927 | 2719387654 | 235 |
| 375 | iso_pu_bacteria | 2718217997 | 2719667286 | 235 |
| 376 | iso_pu_bacteria | 2718218009 | 2719733658 | 235 |
| 377 | iso_pu_bacteria | 2718218199 | 2720493706 | 235 |
| 378 | iso_pu_bacteria | 2718218232 | 2720615159 | 235 |
| 379 | iso_pu_bacteria | 2718218233 | 2720621954 | 235 |
| 380 | iso_pu_bacteria | 2718218235 | 2720633304 | 235 |
| 381 | iso_pu_bacteria | 2718218269 | 2720777002 | 235 |
| 382 | iso_pu_bacteria | 2718218363 | 2721149053 | 235 |
| 383 | iso_pu_bacteria | 2718218365 | 2721160451 | 235 |
| 384 | iso_pu_bacteria | 2718218366 | 2721165866 | 235 |
| 385 | iso_pu_bacteria | 2718218423 | 2721401288 | 235 |
| 386 | iso_pu_bacteria | 2721755514 | 2722842036 | 235 |
| 387 | iso_pu_bacteria | 2721755556 | 2723028600 | 235 |
| 388 | iso_pu_bacteria | 2721755684 | 2723562204 | 235 |
| 389 | iso_pu_bacteria | 2721755685 | 2723568907 | 235 |
| 390 | iso_pu_bacteria | 2721755809 | 2724040102 | 235 |
| 391 | iso_pu_bacteria | 2721755810 | 2724046414 | 235 |
| 392 | iso_pu_bacteria | 2721755819 | 2724091609 | 235 |
| 393 | iso_pu_bacteria | 2721755822 | 2724106172 | 235 |
| 394 | iso_pu_bacteria | 2721755823 | 2724111978 | 235 |
| 395 | iso_pu_bacteria | 2724679232 | 2725947515 | 235 |
| 396 | iso_pu_bacteria | 2728369352 | 2730109536 | 235 |
| 397 | iso_pu_bacteria | 2728369365 | 2730166176 | 235 |
| 398 | iso_pu_bacteria | 2728369397 | 2730300083 | 235 |
| 399 | iso_pu_bacteria | 2738541333 | 2739037253 | 235 |
| 400 | iso_pu_bacteria | 2765235942 | 2766064290 | 235 |
| 401 | iso_pu_bacteria | 2791355256 | 2793295650 | 235 |
| 402 | iso_pu_bacteria | 2791355259 | 2793313401 | 235 |
| 403 | iso_pu_bacteria | 2791355260 | 2793320689 | 235 |
| 404 | iso_pu_bacteria | 2791355261 | 2793327260 | 235 |
| 405 | iso_pu_bacteria | 2791355262 | 2793332215 | 235 |
| 406 | iso_pu_bacteria | 2791355263 | 2793338790 | 235 |
| 407 | iso_pu_bacteria | 2791355264 | 2793346578 | 235 |
| 408 | iso_pu_bacteria | 2791355265 | 2793353883 | 235 |
| 409 | iso_pu_bacteria | 2791355266 | 2793359418 | 235 |
| 410 | iso_pu_bacteria | 2791355267 | 2793365881 | 235 |
| 411 | iso_pu_bacteria | 2802429605 | 2805926193 | 235 |
| 412 | iso_pu_bacteria | 2802429606 | 2805933919 | 235 |
| 413 | iso_pu_bacteria | 2802429633 | 2806047344 | 235 |
| 414 | iso_pu_bacteria | 2802429634 | 2806054199 | 235 |
| 415 | iso_pu_bacteria | 2802429635 | 2806060217 | 235 |
| 416 | iso_pu_bacteria | 2802429636 | 2806068828 | 235 |
| 417 | iso_pu_bacteria | 2802429637 | 2806076434 | 235 |
| 418 | iso_pu_bacteria | 2818991272 | 2819244688 | 235 |
| 419 | iso_pu_bacteria | 2838016132 | 2838018355 | 235 |
| 420 | iso_pu_bacteria | 2838022645 | 2838024038 | 235 |
| 421 | iso_pu_bacteria | 2838035591 | 2838040377 | 235 |
| 422 | iso_pu_bacteria | 2838042994 | 2838047817 | 235 |
| 423 | iso_pu_bacteria | 2838048938 | 2838050783 | 235 |
| 424 | iso_pu_bacteria | 2838061910 | 2838062549 | 235 |
| 425 | iso_pu_bacteria | 2838068647 | 2838072100 | 235 |
| 426 | iso_pu_bacteria | 2838661181 | 2838667791 | 235 |
| 427 | iso_pu_bacteria | 2838668709 | 2838672141 | 235 |
| 428 | iso_pu_bacteria | 2838680041 | 2838683901 | 235 |
| 429 | iso_pu_bacteria | 2838686498 | 2838690259 | 235 |
| 430 | iso_pu_bacteria | 2838694306 | 2838698429 | 235 |
| 431 | iso_pu_bacteria | 2838701080 | 2838704989 | 235 |
| 432 | iso_pu_bacteria | 2838707686 | 2838711544 | 235 |
| 433 | iso_pu_bacteria | 2838729681 | 2838732034 | 235 |
| 434 | iso_pu_bacteria | 2838742623 | 2838744930 | 235 |
| 435 | iso_pu_bacteria | 2841851746 | 2841855988 | 235 |
| 436 | iso_pu_bacteria | 2841864319 | 2841867782 | 235 |
| 437 | iso_pu_bacteria | 2842077413 | 2842081345 | 235 |
| 438 | iso_pu_bacteria | 2842110456 | 2842116878 | 235 |
| 439 | iso_pu_bacteria | 2842118031 | 2842121878 | 235 |
| 440 | iso_pu_bacteria | 2842146304 | 2842148775 | 235 |
| 441 | iso_pu_bacteria | 2842156927 | 2842161158 | 235 |
| 442 | iso_pu_bacteria | 2842163707 | 2842166669 | 235 |
| 443 | iso_pu_bacteria | 2842180545 | 2842184774 | 235 |
| 444 | iso_pu_bacteria | 2842192696 | 2842194905 | 235 |
| 445 | iso_pu_bacteria | 2842198810 | 2842201631 | 235 |
| 446 | iso_pu_bacteria | 2842205361 | 2842207397 | 235 |
| 447 | iso_pu_bacteria | 2842217011 | 2842221756 | 235 |
| 448 | iso_pu_bacteria | 2842229732 | 2842232356 | 235 |
| 449 | iso_pu_bacteria | 2842237096 | 2842240892 | 235 |
| 450 | iso_pu_bacteria | 2842243621 | 2842246772 | 235 |
| 451 | iso_pu_bacteria | 2842250916 | 2842254670 | 235 |
| 452 | iso_pu_bacteria | 2842257432 | 2842261127 | 235 |
| 453 | iso_pu_bacteria | 2842264693 | 2842269615 | 235 |
| 454 | iso_pu_bacteria | 2842271015 | 2842274279 | 235 |
| 455 | iso_pu_bacteria | 2842278818 | 2842280892 | 235 |
| 456 | iso_pu_bacteria | 2842285085 | 2842288495 | 235 |
| 457 | iso_pu_bacteria | 2842291075 | 2842295002 | 235 |
| 458 | iso_pu_bacteria | 2842304105 | 2842305878 | 235 |
| 459 | iso_pu_bacteria | 2842311132 | 2842311387 | 235 |
| 460 | iso_pu_bacteria | 2842317721 | 2842321088 | 235 |
| 461 | iso_pu_bacteria | 2842341865 | 2842346606 | 235 |
| 462 | iso_pu_bacteria | 2842363717 | 2842366296 | 235 |
| 463 | iso_pu_bacteria | 2842370503 | 2842374980 | 235 |
| 464 | iso_pu_bacteria | 2842377471 | 2842381401 | 235 |
| 465 | iso_pu_bacteria | 2842384541 | 2842388471 | 235 |
| 466 | iso_pu_bacteria | 2842395702 | 2842395967 | 235 |
| 467 | iso_pu_bacteria | 2842402390 | 2842406159 | 235 |
| 468 | iso_pu_bacteria | 2842409023 | 2842412744 | 235 |
| 469 | iso_pu_bacteria | 2842415677 | 2842419377 | 235 |
| 470 | iso_pu_bacteria | 2842422224 | 2842425732 | 235 |
| 471 | iso_pu_bacteria | 2842428310 | 2842433623 | 235 |
| 472 | iso_pu_bacteria | 2842434925 | 2842439951 | 235 |
| 473 | iso_pu_bacteria | 2842441272 | 2842446580 | 235 |
| 474 | iso_pu_bacteria | 2842447887 | 2842448804 | 235 |
| 475 | iso_pu_bacteria | 2842462802 | 2842467911 | 235 |
| 476 | iso_pu_bacteria | 2842469257 | 2842474560 | 235 |
| 477 | iso_pu_bacteria | 2842489311 | 2842491141 | 235 |
| 478 | iso_pu_bacteria | 2842495871 | 2842498478 | 235 |
| 479 | iso_pu_bacteria | 2844454524 | 2844457042 | 235 |
| 480 | iso_pu_bacteria | 2857516855 | 2857519550 | 235 |
| 481 | iso_pu_bacteria | 2919100787 | 2919105362 | 235 |
| 482 | iso_pu_bacteria | 2923556063 | 2923559513 | 235 |
| 483 | iso_pu_bacteria | 2933016740 | 2933017003 | 235 |
| 484 | iso_pu_bacteria | 2933570622 | 2933572383 | 235 |
| 485 | iso_pu_bacteria | 2933586486 | 2933593118 | 235 |
| 486 | iso_pu_bacteria | 2933599457 | 2933603046 | 235 |
| 487 | iso_pu_bacteria | 2935894831 | 2935897920 | 235 |
| 488 | iso_pu_bacteria | 2935901341 | 2935903659 | 235 |
| 489 | iso_pu_bacteria | 2936367885 | 2936369865 | 235 |
| 490 | iso_pu_bacteria | 2936375103 | 2936379051 | 235 |
| 491 | iso_pu_bacteria | 2936381700 | 2936381974 | 235 |
| 492 | iso_pu_bacteria | 2996887358 | 2996890217 | 235 |
| 493 | iso_pu_bacteria | 2996893221 | 2996895257 | 235 |
| 494 | iso_pu_bacteria | 3005445848 | 3005449636 | 235 |
| 495 | iso_pu_bacteria | 639633055 | 639650409 | 235 |
| 496 | iso_pu_bacteria | 8005258706 | 8005262401 | 235 |
| 497 | iso_pu_bacteria | 8005275841 | 8005282409 | 235 |
| 498 | iso_pu_bacteria | 8005282627 | 8005286772 | 235 |
| 499 | iso_pu_bacteria | 8005289223 | 8005295060 | 235 |
| 500 | iso_pu_bacteria | 8005301065 | 8005305939 | 235 |
| 501 | iso_pu_bacteria | 8005307578 | 8005313674 | 235 |
| 502 | iso_pu_bacteria | 8005321885 | 8005324744 | 235 |
| 503 | iso_pu_bacteria | 8005376324 | 8005381591 | 235 |
| 504 | iso_pu_bacteria | 8005382845 | 8005387796 | 235 |
| 505 | iso_pu_bacteria | 8005395548 | 8005400832 | 235 |
| 506 | iso_pu_bacteria | 8005430974 | 8005431082 | 235 |
| 507 | iso_pu_bacteria | 8005460587 | 8005465071 | 235 |
| 508 | iso_pu_bacteria | 8005497431 | 8005497650 | 235 |
| 509 | iso_pu_bacteria | 8005542996 | 8005546648 | 235 |
| 510 | iso_pu_bacteria | 8005556819 | 8005561147 | 235 |
| 511 | iso_pu_bacteria | 8005563573 | 8005565773 | 235 |
| 512 | iso_pu_bacteria | 8005570704 | 8005571820 | 235 |
| 513 | iso_pu_bacteria | 8005619151 | 8005623384 | 235 |
| 514 | iso_pu_bacteria | 8005626139 | 8005631036 | 235 |
| 515 | iso_pu_bacteria | 8005668836 | 8005669055 | 235 |
| 516 | iso_pu_bacteria | 8005688590 | 8005694362 | 235 |
| 517 | iso_pu_bacteria | 8005695170 | 8005695710 | 235 |
| 518 | iso_pu_bacteria | 8018127388 | 8018128887 | 235 |
| 519 | iso_pu_bacteria | 8018150411 | 8018153340 | 235 |
| 520 | iso_pu_bacteria | 8018163183 | 8018165115 | 235 |
| 521 | iso_pu_bacteria | 8018176218 | 8018177126 | 235 |
| 522 | iso_pu_bacteria | 8023680758 | 8023686513 | 235 |
| 523 | iso_pu_bacteria | 8024479707 | 8024484346 | 235 |
| 524 | iso_pu_bacteria | 8024501048 | 8024502348 | 235 |
| 525 | iso_pu_bacteria | 8056375014 | 8056380390 | 235 |
| 526 | iso_pu_bacteria | 8056382006 | 8056385222 | 235 |
| 527 | iso_pu_bacteria | 8057874678 | 8057879263 | 235 |
| 528 | 3300003559 | Ga0007427J51700_109799 | Ga0007427J51700_1097991 | 236 |
| 529 | 3300003578 | Ga0006562J51391_1003372 | Ga0006562J51391_10033721 | 236 |
| 530 | 3300003856 | Ga0058692_1002779 | Ga0058692_10027793 | 236 |
| 531 | 3300003856 | Ga0058692_1005607 | Ga0058692_10056072 | 236 |
| 532 | 3300005353 | Ga0070669_100173302 | Ga0070669_1001733022 | 236 |
| 533 | 3300005436 | Ga0070713_100209208 | Ga0070713_1002092082 | 236 |
| 534 | 3300005530 | Ga0070679_100086982 | Ga0070679_1000869823 | 236 |
| 535 | 3300005548 | Ga0070665_100004011 | Ga0070665_1000040114 | 236 |
| 536 | 3300006038 | Ga0075365_10026456 | Ga0075365_100264562 | 236 |
| 537 | 3300006038 | Ga0075365_10362224 | Ga0075365_103622242 | 236 |
| 538 | 3300006177 | Ga0075362_10014524 | Ga0075362_100145242 | 236 |
| 539 | 3300006186 | Ga0075369_10067768 | Ga0075369_100677682 | 236 |
| 540 | 3300006353 | Ga0075370_10174540 | Ga0075370_101745401 | 236 |
| 541 | 3300006871 | Ga0075434_100098722 | Ga0075434_1000987223 | 236 |
| 542 | 3300006914 | Ga0075436_100012045 | Ga0075436_1000120455 | 236 |
| 543 | 3300009148 | Ga0105243_10123484 | Ga0105243_101234841 | 236 |
| 544 | 3300011119 | Ga0105246_10179528 | Ga0105246_101795281 | 236 |
| 545 | 3300013100 | Ga0157373_10003539 | Ga0157373_1000353913 | 236 |
| 546 | 3300013102 | Ga0157371_10000108 | Ga0157371_1000010860 | 236 |
| 547 | 3300020077 | Ga0206351_10386933 | Ga0206351_103869331 | 236 |
| 548 | 3300020078 | Ga0206352_11134782 | Ga0206352_111347821 | 236 |
| 549 | 3300020081 | Ga0206354_10281947 | Ga0206354_102819471 | 236 |
| 550 | 3300020082 | Ga0206353_10082534 | Ga0206353_100825341 | 236 |
| 551 | 3300021388 | Ga0213875_10000033 | Ga0213875_1000003383 | 236 |
| 552 | 3300025294 | Ga0209025_1000487 | Ga0209025_100048736 | 236 |
| 553 | 3300025912 | Ga0207707_10604232 | Ga0207707_106042321 | 236 |
| 554 | 3300025928 | Ga0207700_10168542 | Ga0207700_101685422 | 236 |
| 555 | 3300025935 | Ga0207709_10049806 | Ga0207709_100498062 | 236 |
| 556 | 3300027312 | Ga0209371_1000037 | Ga0209371_1000037127 | 236 |
| 557 | 3300027312 | Ga0209371_1002109 | Ga0209371_10021092 | 236 |
| 558 | 3300030500 | Ga0268256_1000039 | Ga0268256_1000039182 | 236 |
| 559 | 3300030500 | Ga0268256_1036812 | Ga0268256_10368122 | 236 |
| 560 | 3300030744 | Ga0316181_1198006 | Ga0316181_11980064 | 236 |
| 561 | 3300048920 | Ga0496117_0000031 | Ga0496117_0000031_147282_148019 | 236 |
| 562 | 3300048921 | Ga0496118_0009274 | Ga0496118_0009274_6940_7677 | 236 |
| 563 | 3300048923 | Ga0496120_0002641 | Ga0496120_0002641_2413_3150 | 236 |
| 564 | 3300048925 | Ga0496122_0000023 | Ga0496122_0000023_147282_148019 | 236 |
| 565 | 3300048925 | Ga0496122_0008748 | Ga0496122_0008748_7736_8473 | 236 |
| 566 | 3300048926 | Ga0496123_0000027 | Ga0496123_0000027_233017_233754 | 236 |
| 567 | 3300048927 | Ga0496124_0002248 | Ga0496124_0002248_8399_9136 | 236 |
| 568 | 3300048929 | Ga0496126_0132120 | Ga0496126_0132120_36_773 | 236 |
| 569 | 3300048929 | Ga0496126_0303763 | Ga0496126_0303763_36_773 | 236 |
| 570 | 3300050491 | nmdc:mga00v17_151_c1 | nmdc:mga00v17_151_c1_33480_34217 | 236 |
| 571 | 3300050492 | nmdc:mga0yw44_359767_c1 | nmdc:mga0yw44_359767_c1_181_918 | 236 |
| 572 | 3300050492 | nmdc:mga0yw44_4983_c1 | nmdc:mga0yw44_4983_c1_1743_2480 | 236 |
| 573 | 3300050493 | nmdc:mga0k408_156037_c1 | nmdc:mga0k408_156037_c1_338_1075 | 236 |
| 574 | 3300050494 | nmdc:mga06z11_200613_c1 | nmdc:mga06z11_200613_c1_387_1124 | 236 |
| 575 | 3300050494 | nmdc:mga06z11_259719_c1 | nmdc:mga06z11_259719_c1_220_957 | 236 |
| 576 | 3300050496 | nmdc:mga07m45_210135_c1 | nmdc:mga07m45_210135_c1_114_851 | 236 |
| 577 | 3300050512 | nmdc:mga0n895_117208_c1 | nmdc:mga0n895_117208_c1_1537_2271 | 236 |
| 578 | 3300050514 | nmdc:mga08x19_8993_c2 | nmdc:mga08x19_8993_c2_190_924 | 236 |
| 579 | 3300050516 | nmdc:mga0sz30_107_c1 | nmdc:mga0sz30_107_c1_8961_9698 | 236 |
| 580 | 3300050516 | nmdc:mga0sz30_78283_c1 | nmdc:mga0sz30_78283_c1_34_771 | 236 |
| 581 | 3300053107 | Ga0500560_001253 | Ga0500560_001253_3288_4025 | 236 |
| 582 | 3300053108 | Ga0500562_011866 | Ga0500562_011866_958_1692 | 236 |
| 583 | 3300053137 | Ga0500561_0004680 | Ga0500561_0004680_206_943 | 236 |
| 584 | 3300053177 | Ga0500636_0000040 | Ga0500636_0000040_7668_8405 | 236 |
| 585 | 3300054114 | Ga0501084_0072325 | Ga0501084_0072325_1353_2099 | 236 |
| 586 | 3300059477 | Ga0587084_012964 | Ga0587084_012964_63_800 | 236 |
| 587 | 3300059490 | Ga0587066_008862 | Ga0587066_008862_450_1187 | 236 |
| 588 | 3300059493 | Ga0587077_058795 | Ga0587077_058795_22_759 | 236 |
| 589 | 3300059504 | Ga0587082_030751 | Ga0587082_030751_177_914 | 236 |
| 590 | 3300059506 | Ga0587085_008191 | Ga0587085_008191_71_808 | 236 |
| 591 | 3300059508 | Ga0587088_014040 | Ga0587088_014040_435_1172 | 236 |
| 592 | 3300059508 | Ga0587088_036020 | Ga0587088_036020_102_839 | 236 |
| 593 | 3300059509 | Ga0587089_016140 | Ga0587089_016140_40_777 | 236 |
| 594 | 3300059510 | Ga0587090_000942 | Ga0587090_000942_1786_2523 | 236 |
| 595 | 3300059511 | Ga0587091_028679 | Ga0587091_028679_71_808 | 236 |
| 596 | 3300059604 | Ga0587098_020948 | Ga0587098_020948_27_764 | 236 |
| 597 | 3300059609 | Ga0587131_004979 | Ga0587131_004979_18_755 | 236 |
| 598 | 3300059624 | Ga0587109_031993 | Ga0587109_031993_190_927 | 236 |
| 599 | 3300059630 | Ga0587128_031643 | Ga0587128_031643_74_811 | 236 |
| 600 | 3300059639 | Ga0587062_005423 | Ga0587062_005423_71_808 | 236 |
| 601 | 3300059640 | Ga0587067_010337 | Ga0587067_010337_66_803 | 236 |
| 602 | 3300059643 | Ga0587072_000182 | Ga0587072_000182_93_830 | 236 |
| 603 | 3300059645 | Ga0587076_010905 | Ga0587076_010905_517_1254 | 236 |
| 604 | 3300059652 | Ga0587107_024049 | Ga0587107_024049_69_806 | 236 |
| 605 | 3300059653 | Ga0587108_010063 | Ga0587108_010063_40_777 | 236 |
| 606 | 3300060344 | Ga0587071_057491 | Ga0587071_057491_63_800 | 236 |
| 607 | 3300060346 | Ga0587111_0063867 | Ga0587111_0063867_39_776 | 236 |
| 608 | iso_pu_bacteria | 2582581299 | 2585228763 | 236 |
| 609 | iso_pu_bacteria | 2582581304 | 2585257391 | 236 |
| 610 | iso_pu_bacteria | 2643221599 | 2644002448 | 236 |
| 611 | iso_pu_bacteria | 2643221634 | 2644194846 | 236 |
| 612 | iso_pu_bacteria | 2643221643 | 2644240526 | 236 |
| 613 | iso_pu_bacteria | 2643221674 | 2644412309 | 236 |
| 614 | iso_pu_bacteria | 2932401849 | 2932405758 | 236 |
| 615 | iso_pu_bacteria | 2939669807 | 2939674287 | 236 |
| 616 | iso_pu_bacteria | 3005409236 | 3005415774 | 236 |
| 617 | iso_pu_bacteria | 3005452660 | 3005455919 | 236 |
| 618 | 3300009093 | Ga0105240_10654649 | Ga0105240_106546492 | 237 |
| 619 | 3300013104 | Ga0157370_10308314 | Ga0157370_103083142 | 237 |
| 620 | 3300025920 | Ga0207649_10000822 | Ga0207649_1000082210 | 237 |
| 621 | 3300031250 | Ga0265331_10000625 | Ga0265331_1000062536 | 237 |
| 622 | 3300031251 | Ga0265327_10001092 | Ga0265327_1000109221 | 237 |
| 623 | 3300031711 | Ga0265314_10018826 | Ga0265314_100188263 | 237 |
| 624 | 3300049571 | Ga0501034_0050536 | Ga0501034_0050536_3108_3851 | 237 |
| 625 | 3300049580 | Ga0501046_0030285 | Ga0501046_0030285_3001_3741 | 237 |
| 626 | iso_pu_bacteria | 2508501122 | 2509109575 | 237 |
| 627 | iso_pu_bacteria | 2509276019 | 2509378101 | 237 |
| 628 | iso_pu_bacteria | 2510065057 | 2510305465 | 237 |
| 629 | iso_pu_bacteria | 2511231052 | 2511498477 | 237 |
| 630 | iso_pu_bacteria | 2512047086 | 2512534621 | 237 |
| 631 | iso_pu_bacteria | 2512875026 | 2512973574 | 237 |
| 632 | iso_pu_bacteria | 2513237086 | 2513583639 | 237 |
| 633 | iso_pu_bacteria | 2513237089 | 2513601907 | 237 |
| 634 | iso_pu_bacteria | 2513237091 | 2513615712 | 237 |
| 635 | iso_pu_bacteria | 2513237140 | 2513884993 | 237 |
| 636 | iso_pu_bacteria | 2513237143 | 2513905203 | 237 |
| 637 | iso_pu_bacteria | 2513237160 | 2514003493 | 237 |
| 638 | iso_pu_bacteria | 2515154107 | 2515611050 | 237 |
| 639 | iso_pu_bacteria | 2516143018 | 2516205563 | 237 |
| 640 | iso_pu_bacteria | 2516653046 | 2516894757 | 237 |
| 641 | iso_pu_bacteria | 2517487022 | 2517571422 | 237 |
| 642 | iso_pu_bacteria | 2524023207 | 2524450432 | 237 |
| 643 | iso_pu_bacteria | 2551306084 | 2551676611 | 237 |
| 644 | iso_pu_bacteria | 2551306084 | 2551680235 | 237 |
| 645 | iso_pu_bacteria | 2551306085 | 2551685065 | 237 |
| 646 | iso_pu_bacteria | 2551306086 | 2551694464 | 237 |
| 647 | iso_pu_bacteria | 2551306087 | 2551702663 | 237 |
| 648 | iso_pu_bacteria | 2551306089 | 2551708341 | 237 |
| 649 | iso_pu_bacteria | 2551306090 | 2551717593 | 237 |
| 650 | iso_pu_bacteria | 2551306091 | 2551731596 | 237 |
| 651 | iso_pu_bacteria | 2551306092 | 2551736180 | 237 |
| 652 | iso_pu_bacteria | 2551306093 | 2551746093 | 237 |
| 653 | iso_pu_bacteria | 2558860100 | 2558867398 | 237 |
| 654 | iso_pu_bacteria | 2599185156 | 2599335123 | 237 |
| 655 | iso_pu_bacteria | 2599185352 | 2600193351 | 237 |
| 656 | iso_pu_bacteria | 2643221558 | 2643813734 | 237 |
| 657 | iso_pu_bacteria | 2643221618 | 2644110168 | 237 |
| 658 | iso_pu_bacteria | 2643221626 | 2644150444 | 237 |
| 659 | iso_pu_bacteria | 2643221655 | 2644313048 | 237 |
| 660 | iso_pu_bacteria | 2643221659 | 2644336596 | 237 |
| 661 | iso_pu_bacteria | 2643221698 | 2644546243 | 237 |
| 662 | iso_pu_bacteria | 2643221712 | 2644618778 | 237 |
| 663 | iso_pu_bacteria | 2643221723 | 2644677077 | 237 |
| 664 | iso_pu_bacteria | 2657244999 | 2657682410 | 237 |
| 665 | iso_pu_bacteria | 2690316117 | 2692319942 | 237 |
| 666 | iso_pu_bacteria | 2751185821 | 2753458584 | 237 |
| 667 | iso_pu_bacteria | 2791355082 | 2792582240 | 237 |
| 668 | iso_pu_bacteria | 2791355091 | 2792621913 | 237 |
| 669 | iso_pu_bacteria | 2791355092 | 2792628830 | 237 |
| 670 | iso_pu_bacteria | 2791355094 | 2792639975 | 237 |
| 671 | iso_pu_bacteria | 2802428859 | 2802724800 | 237 |
| 672 | iso_pu_bacteria | 2802429268 | 2804753697 | 237 |
| 673 | iso_pu_bacteria | 2838074704 | 2838078165 | 237 |
| 674 | iso_pu_bacteria | 2842922631 | 2842926313 | 237 |
| 675 | iso_pu_bacteria | 2844163670 | 2844166257 | 237 |
| 676 | iso_pu_bacteria | 2847417321 | 2847420834 | 237 |
| 677 | iso_pu_bacteria | 2848992105 | 2848995661 | 237 |
| 678 | iso_pu_bacteria | 2850079185 | 2850082637 | 237 |
| 679 | iso_pu_bacteria | 2855825444 | 2855827385 | 237 |
| 680 | iso_pu_bacteria | 2855839649 | 2855842763 | 237 |
| 681 | iso_pu_bacteria | 2855872281 | 2855878198 | 237 |
| 682 | iso_pu_bacteria | 2858800743 | 2858802101 | 237 |
| 683 | iso_pu_bacteria | 2889914905 | 2889917273 | 237 |
| 684 | iso_pu_bacteria | 2894817345 | 2894821555 | 237 |
| 685 | iso_pu_bacteria | 2896384573 | 2896390194 | 237 |
| 686 | iso_pu_bacteria | 2913295892 | 2913300182 | 237 |
| 687 | iso_pu_bacteria | 2915980308 | 2915982424 | 237 |
| 688 | iso_pu_bacteria | 2915986958 | 2915992787 | 237 |
| 689 | iso_pu_bacteria | 2915993759 | 2915996464 | 237 |
| 690 | iso_pu_bacteria | 2916000859 | 2916005886 | 237 |
| 691 | iso_pu_bacteria | 2916007675 | 2916010591 | 237 |
| 692 | iso_pu_bacteria | 2916014648 | 2916018143 | 237 |
| 693 | iso_pu_bacteria | 2916021584 | 2916022924 | 237 |
| 694 | iso_pu_bacteria | 2916028427 | 2916034399 | 237 |
| 695 | iso_pu_bacteria | 2916035215 | 2916036046 | 237 |
| 696 | iso_pu_bacteria | 2916041962 | 2916045058 | 237 |
| 697 | iso_pu_bacteria | 2916048683 | 2916050756 | 237 |
| 698 | iso_pu_bacteria | 2916055098 | 2916061835 | 237 |
| 699 | iso_pu_bacteria | 2916061851 | 2916065010 | 237 |
| 700 | iso_pu_bacteria | 2916068649 | 2916074946 | 237 |
| 701 | iso_pu_bacteria | 2916076590 | 2916077733 | 237 |
| 702 | iso_pu_bacteria | 2920760137 | 2920760321 | 237 |
| 703 | iso_pu_bacteria | 2920822456 | 2920825948 | 237 |
| 704 | iso_pu_bacteria | 2921201388 | 2921206912 | 237 |
| 705 | iso_pu_bacteria | 2921208531 | 2921215108 | 237 |
| 706 | iso_pu_bacteria | 2921237296 | 2921239820 | 237 |
| 707 | iso_pu_bacteria | 2921244191 | 2921245807 | 237 |
| 708 | iso_pu_bacteria | 2921250672 | 2921252934 | 237 |
| 709 | iso_pu_bacteria | 2921257292 | 2921259016 | 237 |
| 710 | iso_pu_bacteria | 2921263974 | 2921264700 | 237 |
| 711 | iso_pu_bacteria | 2921282425 | 2921284564 | 237 |
| 712 | iso_pu_bacteria | 2921289301 | 2921296122 | 237 |
| 713 | iso_pu_bacteria | 2921296804 | 2921303368 | 237 |
| 714 | iso_pu_bacteria | 2924144063 | 2924146620 | 237 |
| 715 | iso_pu_bacteria | 2924150972 | 2924152538 | 237 |
| 716 | iso_pu_bacteria | 2924158325 | 2924161578 | 237 |
| 717 | iso_pu_bacteria | 2924165586 | 2924169677 | 237 |
| 718 | iso_pu_bacteria | 2924172951 | 2924174196 | 237 |
| 719 | iso_pu_bacteria | 2924179722 | 2924185126 | 237 |
| 720 | iso_pu_bacteria | 2924186466 | 2924187854 | 237 |
| 721 | iso_pu_bacteria | 2924193448 | 2924193596 | 237 |
| 722 | iso_pu_bacteria | 2924200457 | 2924201780 | 237 |
| 723 | iso_pu_bacteria | 2924207177 | 2924210303 | 237 |
| 724 | iso_pu_bacteria | 2924214083 | 2924221043 | 237 |
| 725 | iso_pu_bacteria | 2924221636 | 2924225858 | 237 |
| 726 | iso_pu_bacteria | 2924228884 | 2924229537 | 237 |
| 727 | iso_pu_bacteria | 2936996657 | 2936998964 | 237 |
| 728 | iso_pu_bacteria | 2937002841 | 2937006613 | 237 |
| 729 | iso_pu_bacteria | 2937009748 | 2937014622 | 237 |
| 730 | iso_pu_bacteria | 2937016420 | 2937019012 | 237 |
| 731 | iso_pu_bacteria | 2937023124 | 2937026019 | 237 |
| 732 | iso_pu_bacteria | 2937029754 | 2937031854 | 237 |
| 733 | iso_pu_bacteria | 2937042894 | 2937045102 | 237 |
| 734 | iso_pu_bacteria | 2937049772 | 2937053476 | 237 |
| 735 | iso_pu_bacteria | 2937056579 | 2937060069 | 237 |
| 736 | iso_pu_bacteria | 2937063883 | 2937065134 | 237 |
| 737 | iso_pu_bacteria | 2937071275 | 2937072790 | 237 |
| 738 | iso_pu_bacteria | 2937078374 | 2937082051 | 237 |
| 739 | iso_pu_bacteria | 2937091812 | 2937098092 | 237 |
| 740 | iso_pu_bacteria | 2937098957 | 2937101268 | 237 |
| 741 | iso_pu_bacteria | 2937106411 | 2937109135 | 237 |
| 742 | iso_pu_bacteria | 2937113482 | 2937116005 | 237 |
| 743 | iso_pu_bacteria | 2937119839 | 2937126078 | 237 |
| 744 | iso_pu_bacteria | 2937126314 | 2937127743 | 237 |
| 745 | iso_pu_bacteria | 2941499720 | 2941501369 | 237 |
| 746 | iso_pu_bacteria | 2957382221 | 2957384691 | 237 |
| 747 | iso_pu_bacteria | 2957388812 | 2957391461 | 237 |
| 748 | iso_pu_bacteria | 2957395598 | 2957400785 | 237 |
| 749 | iso_pu_bacteria | 2957402308 | 2957404431 | 237 |
| 750 | iso_pu_bacteria | 2957408893 | 2957411823 | 237 |
| 751 | iso_pu_bacteria | 2957415311 | 2957416704 | 237 |
| 752 | iso_pu_bacteria | 2957422303 | 2957428719 | 237 |
| 753 | iso_pu_bacteria | 2957430029 | 2957432026 | 237 |
| 754 | iso_pu_bacteria | 2957443900 | 2957450292 | 237 |
| 755 | iso_pu_bacteria | 2957450854 | 2957451938 | 237 |
| 756 | iso_pu_bacteria | 2957457609 | 2957461220 | 237 |
| 757 | iso_pu_bacteria | 2957464669 | 2957470921 | 237 |
| 758 | iso_pu_bacteria | 2957471148 | 2957474167 | 237 |
| 759 | iso_pu_bacteria | 2957478035 | 2957479357 | 237 |
| 760 | iso_pu_bacteria | 2957484790 | 2957489782 | 237 |
| 761 | iso_pu_bacteria | 2957491536 | 2957494546 | 237 |
| 762 | iso_pu_bacteria | 2957498199 | 2957503964 | 237 |
| 763 | iso_pu_bacteria | 2957505466 | 2957512210 | 237 |
| 764 | iso_pu_bacteria | 2960584000 | 2960586470 | 237 |
| 765 | iso_pu_bacteria | 2960597568 | 2960599193 | 237 |
| 766 | iso_pu_bacteria | 2960603979 | 2960609767 | 237 |
| 767 | iso_pu_bacteria | 2960610863 | 2960613280 | 237 |
| 768 | iso_pu_bacteria | 2960617483 | 2960618303 | 237 |
| 769 | iso_pu_bacteria | 2960624210 | 2960628480 | 237 |
| 770 | iso_pu_bacteria | 2960637947 | 2960643792 | 237 |
| 771 | iso_pu_bacteria | 2960645483 | 2960651387 | 237 |
| 772 | iso_pu_bacteria | 2960652885 | 2960659385 | 237 |
| 773 | iso_pu_bacteria | 2960660292 | 2960666830 | 237 |
| 774 | iso_pu_bacteria | 2960667422 | 2960673179 | 237 |
| 775 | iso_pu_bacteria | 2960674078 | 2960674619 | 237 |
| 776 | iso_pu_bacteria | 2960687367 | 2960691587 | 237 |
| 777 | iso_pu_bacteria | 2960693952 | 2960698228 | 237 |
| 778 | iso_pu_bacteria | 2964607997 | 2964613143 | 237 |
| 779 | iso_pu_bacteria | 2964615318 | 2964619359 | 237 |
| 780 | iso_pu_bacteria | 2964621998 | 2964627094 | 237 |
| 781 | iso_pu_bacteria | 2964628898 | 2964633234 | 237 |
| 782 | iso_pu_bacteria | 2964636051 | 2964641609 | 237 |
| 783 | iso_pu_bacteria | 2964643177 | 2964645928 | 237 |
| 784 | iso_pu_bacteria | 2964649959 | 2964654896 | 237 |
| 785 | iso_pu_bacteria | 2964656573 | 2964659590 | 237 |
| 786 | iso_pu_bacteria | 2964663802 | 2964669004 | 237 |
| 787 | iso_pu_bacteria | 2964670856 | 2964672152 | 237 |
| 788 | iso_pu_bacteria | 2964678106 | 2964681247 | 237 |
| 789 | iso_pu_bacteria | 2964685014 | 2964686733 | 237 |
| 790 | iso_pu_bacteria | 2964691889 | 2964695032 | 237 |
| 791 | iso_pu_bacteria | 2964698721 | 2964701387 | 237 |
| 792 | iso_pu_bacteria | 2964705432 | 2964707079 | 237 |
| 793 | iso_pu_bacteria | 2964712639 | 2964712771 | 237 |
| 794 | iso_pu_bacteria | 2964719344 | 2964726694 | 237 |
| 795 | iso_pu_bacteria | 2967664464 | 2967670620 | 237 |
| 796 | iso_pu_bacteria | 2967671571 | 2967676982 | 237 |
| 797 | iso_pu_bacteria | 2967678726 | 2967681713 | 237 |
| 798 | iso_pu_bacteria | 2967693043 | 2967695469 | 237 |
| 799 | iso_pu_bacteria | 2967699805 | 2967702358 | 237 |
| 800 | iso_pu_bacteria | 2967706974 | 2967712467 | 237 |
| 801 | iso_pu_bacteria | 2967714385 | 2967719557 | 237 |
| 802 | iso_pu_bacteria | 2967721400 | 2967726925 | 237 |
| 803 | iso_pu_bacteria | 2967735183 | 2967738353 | 237 |
| 804 | iso_pu_bacteria | 2967742019 | 2967744815 | 237 |
| 805 | iso_pu_bacteria | 2967748971 | 2967755460 | 237 |
| 806 | iso_pu_bacteria | 2967755722 | 2967761908 | 237 |
| 807 | iso_pu_bacteria | 2967762386 | 2967766404 | 237 |
| 808 | iso_pu_bacteria | 2967769361 | 2967772903 | 237 |
| 809 | iso_pu_bacteria | 2967775926 | 2967778315 | 237 |
| 810 | iso_pu_bacteria | 2970019648 | 2970023635 | 237 |
| 811 | iso_pu_bacteria | 2970033650 | 2970034492 | 237 |
| 812 | iso_pu_bacteria | 2970040964 | 2970044908 | 237 |
| 813 | iso_pu_bacteria | 2970047711 | 2970052437 | 237 |
| 814 | iso_pu_bacteria | 2970054988 | 2970058947 | 237 |
| 815 | iso_pu_bacteria | 2970061556 | 2970063551 | 237 |
| 816 | iso_pu_bacteria | 2970068827 | 2970069872 | 237 |
| 817 | iso_pu_bacteria | 2970076120 | 2970076892 | 237 |
| 818 | iso_pu_bacteria | 2970082768 | 2970086274 | 237 |
| 819 | iso_pu_bacteria | 2970088815 | 2970092854 | 237 |
| 820 | iso_pu_bacteria | 2970095765 | 2970101259 | 237 |
| 821 | iso_pu_bacteria | 2970102677 | 2970105359 | 237 |
| 822 | iso_pu_bacteria | 2970109326 | 2970112974 | 237 |
| 823 | iso_pu_bacteria | 2970116247 | 2970116828 | 237 |
| 824 | iso_pu_bacteria | 2970129317 | 2970133632 | 237 |
| 825 | iso_pu_bacteria | 2970136068 | 2970140968 | 237 |
| 826 | iso_pu_bacteria | 2970149975 | 2970152917 | 237 |
| 827 | iso_pu_bacteria | 2970156795 | 2970157997 | 237 |
| 828 | iso_pu_bacteria | 2970164137 | 2970170866 | 237 |
| 829 | iso_pu_bacteria | 2970170962 | 2970174738 | 237 |
| 830 | iso_pu_bacteria | 2970177841 | 2970178130 | 237 |
| 831 | iso_pu_bacteria | 2970184632 | 2970190793 | 237 |
| 832 | iso_pu_bacteria | 2970191845 | 2970192832 | 237 |
| 833 | iso_pu_bacteria | 2977516862 | 2977520049 | 237 |
| 834 | iso_pu_bacteria | 2977523885 | 2977525529 | 237 |
| 835 | iso_pu_bacteria | 2977537788 | 2977540373 | 237 |
| 836 | iso_pu_bacteria | 2977551784 | 2977553199 | 237 |
| 837 | iso_pu_bacteria | 2977558990 | 2977562159 | 237 |
| 838 | iso_pu_bacteria | 2977565890 | 2977571082 | 237 |
| 839 | iso_pu_bacteria | 2977572785 | 2977573310 | 237 |
| 840 | iso_pu_bacteria | 2977579622 | 2977585610 | 237 |
| 841 | iso_pu_bacteria | 643692032 | 643827429 | 237 |
| 842 | iso_pu_bacteria | 648276728 | 648737201 | 237 |
| 843 | iso_pu_bacteria | 8003992118 | 8003995343 | 237 |
| 844 | iso_pu_bacteria | 8024486573 | 8024490827 | 237 |
| 845 | iso_pu_bacteria | 8049293176 | 8049296295 | 237 |
| 846 | iso_pu_bacteria | 8055431914 | 8055435588 | 237 |
| 847 | 3300012513 | Ga0157326_1003319 | Ga0157326_10033193 | 238 |
| 848 | 3300048924 | Ga0496121_0135242 | Ga0496121_0135242_730_1500 | 238 |
| 849 | 3300048929 | Ga0496126_0058103 | Ga0496126_0058103_197_967 | 238 |
| 850 | 3300049527 | Ga0501311_024221 | Ga0501311_024221_52_822 | 238 |
| 851 | 3300049571 | Ga0501034_0007485 | Ga0501034_0007485_1129_1899 | 238 |
| 852 | 3300049589 | Ga0501073_0002812 | Ga0501073_0002812_9424_10200 | 238 |
| 853 | 3300053161 | Ga0500634_0000028 | Ga0500634_0000028_46910_47680 | 238 |
| 854 | iso_pu_bacteria | 2582581308 | 2585280702 | 238 |
| 855 | iso_pu_bacteria | 2582581315 | 2585326487 | 238 |
| 856 | iso_pu_bacteria | 2582581316 | 2585334171 | 238 |
| 857 | iso_pu_bacteria | 2585427527 | 2585531636 | 238 |
| 858 | iso_pu_bacteria | 2585427530 | 2585551417 | 238 |
| 859 | iso_pu_bacteria | 2585427594 | 2585844889 | 238 |
| 860 | iso_pu_bacteria | 2615840626 | 2616306753 | 238 |
| 861 | iso_pu_bacteria | 2615840698 | 2616557599 | 238 |
| 862 | iso_pu_bacteria | 2617270742 | 2617383272 | 238 |
| 863 | iso_pu_bacteria | 2667528174 | 2671113495 | 238 |
| 864 | iso_pu_bacteria | 2738541293 | 2738805597 | 238 |
| 865 | iso_pu_bacteria | 2775507266 | 2778173731 | 238 |
| 866 | iso_pu_bacteria | 2818991448 | 2819611224 | 238 |
| 867 | iso_pu_bacteria | 2818991453 | 2819638847 | 238 |
| 868 | iso_pu_bacteria | 2837651117 | 2837651269 | 238 |
| 869 | iso_pu_bacteria | 2838029111 | 2838030913 | 238 |
| 870 | iso_pu_bacteria | 2842475841 | 2842477645 | 238 |
| 871 | iso_pu_bacteria | 2842482326 | 2842484950 | 238 |
| 872 | iso_pu_bacteria | 2842502639 | 2842504482 | 238 |
| 873 | iso_pu_bacteria | 2919408235 | 2919411048 | 238 |
| 874 | iso_pu_bacteria | 3005416602 | 3005421641 | 238 |
| 875 | iso_pu_bacteria | 8005314921 | 8005319654 | 238 |
| 876 | iso_pu_bacteria | 8005484373 | 8005490277 | 238 |
| 877 | iso_pu_bacteria | 8005645114 | 8005646933 | 238 |
| 878 | iso_pu_bacteria | 8005682033 | 8005688006 | 238 |
| 879 | 3300001979 | JGI24740J21852_10077057 | JGI24740J21852_100770571 | 239 |
| 880 | 3300002739 | JGI25158J39367_1000061 | JGI25158J39367_10000615 | 239 |
| 881 | 3300002773 | JGI25152J39213_1002753 | JGI25152J39213_10027536 | 239 |
| 882 | 3300002773 | JGI25152J39213_1004278 | JGI25152J39213_10042783 | 239 |
| 883 | 3300002774 | JGI25150J39212_1021423 | JGI25150J39212_10214232 | 239 |
| 884 | 3300002987 | JGI25159J45721_1012147 | JGI25159J45721_10121472 | 239 |
| 885 | 3300003187 | JGI25151J46595_10068304 | JGI25151J46595_100683041 | 239 |
| 886 | 3300003354 | JGI25160J50197_1005889 | JGI25160J50197_10058894 | 239 |
| 887 | 3300003354 | JGI25160J50197_1035580 | JGI25160J50197_10355802 | 239 |
| 888 | 3300003374 | JGI25161J50226_1000137 | JGI25161J50226_10001375 | 239 |
| 889 | 3300003771 | Ga0055526_1003979 | Ga0055526_10039795 | 239 |
| 890 | 3300003771 | Ga0055526_1008345 | Ga0055526_10083455 | 239 |
| 891 | 3300003771 | Ga0055526_1013997 | Ga0055526_10139972 | 239 |
| 892 | 3300003775 | Ga0055524_1001868 | Ga0055524_10018688 | 239 |
| 893 | 3300003775 | Ga0055524_1005075 | Ga0055524_10050753 | 239 |
| 894 | 3300003775 | Ga0055524_1032827 | Ga0055524_10328272 | 239 |
| 895 | 3300003790 | Ga0055528_1002500 | Ga0055528_10025005 | 239 |
| 896 | 3300003790 | Ga0055528_1004711 | Ga0055528_10047114 | 239 |
| 897 | 3300003790 | Ga0055528_1005546 | Ga0055528_10055467 | 239 |
| 898 | 3300003790 | Ga0055528_1006903 | Ga0055528_10069032 | 239 |
| 899 | 3300003790 | Ga0055528_1017730 | Ga0055528_10177302 | 239 |
| 900 | 3300003792 | Ga0055540_1001660 | Ga0055540_10016609 | 239 |
| 901 | 3300003792 | Ga0055540_1003634 | Ga0055540_10036345 | 239 |
| 902 | 3300003794 | Ga0055531_10018117 | Ga0055531_100181172 | 239 |
| 903 | 3300004625 | Ga0055543_1000433 | Ga0055543_100043322 | 239 |
| 904 | 3300005262 | Ga0065165_1007334 | Ga0065165_10073342 | 239 |
| 905 | 3300005347 | Ga0070668_100015601 | Ga0070668_1000156014 | 239 |
| 906 | 3300005353 | Ga0070669_100057569 | Ga0070669_1000575692 | 239 |
| 907 | 3300005353 | Ga0070669_100115407 | Ga0070669_1001154072 | 239 |
| 908 | 3300005355 | Ga0070671_100012277 | Ga0070671_1000122774 | 239 |
| 909 | 3300005367 | Ga0070667_100418151 | Ga0070667_1004181512 | 239 |
| 910 | 3300005455 | Ga0070663_100114662 | Ga0070663_1001146622 | 239 |
| 911 | 3300005458 | Ga0070681_10000010 | Ga0070681_1000001057 | 239 |
| 912 | 3300005530 | Ga0070679_100001075 | Ga0070679_1000010759 | 239 |
| 913 | 3300005841 | Ga0068863_100521021 | Ga0068863_1005210212 | 239 |
| 914 | 3300006038 | Ga0075365_10000270 | Ga0075365_100002705 | 239 |
| 915 | 3300006178 | Ga0075367_10000078 | Ga0075367_100000786 | 239 |
| 916 | 3300009092 | Ga0105250_10021237 | Ga0105250_100212373 | 239 |
| 917 | 3300009148 | Ga0105243_10623038 | Ga0105243_106230381 | 239 |
| 918 | 3300009177 | Ga0105248_10013921 | Ga0105248_100139215 | 239 |
| 919 | 3300009763 | Ga0123340_1040891 | Ga0123340_10408911 | 239 |
| 920 | 3300009765 | Ga0123341_1000009 | Ga0123341_100000977 | 239 |
| 921 | 3300009765 | Ga0123341_1055213 | Ga0123341_10552133 | 239 |
| 922 | 3300009766 | Ga0123342_1009724 | Ga0123342_100972411 | 239 |
| 923 | 3300009766 | Ga0123342_1034152 | Ga0123342_10341522 | 239 |
| 924 | 3300010375 | Ga0105239_10002698 | Ga0105239_1000269816 | 239 |
| 925 | 3300025208 | Ga0209436_100018 | Ga0209436_1000184 | 239 |
| 926 | 3300025245 | Ga0207425_1002129 | Ga0207425_10021296 | 239 |
| 927 | 3300025258 | Ga0209129_1000118 | Ga0209129_100011843 | 239 |
| 928 | 3300025258 | Ga0209129_1000971 | Ga0209129_10009715 | 239 |
| 929 | 3300025258 | Ga0209129_1003727 | Ga0209129_10037275 | 239 |
| 930 | 3300025258 | Ga0209129_1003990 | Ga0209129_10039902 | 239 |
| 931 | 3300025258 | Ga0209129_1004733 | Ga0209129_10047335 | 239 |
| 932 | 3300025258 | Ga0209129_1009453 | Ga0209129_10094531 | 239 |
| 933 | 3300025273 | Ga0209673_1000033 | Ga0209673_1000033259 | 239 |
| 934 | 3300025273 | Ga0209673_1000052 | Ga0209673_1000052131 | 239 |
| 935 | 3300025273 | Ga0209673_1000953 | Ga0209673_100095336 | 239 |
| 936 | 3300025273 | Ga0209673_1000975 | Ga0209673_100097531 | 239 |
| 937 | 3300025273 | Ga0209673_1001533 | Ga0209673_10015337 | 239 |
| 938 | 3300025273 | Ga0209673_1006503 | Ga0209673_10065032 | 239 |
| 939 | 3300025284 | Ga0209130_1000009 | Ga0209130_1000009288 | 239 |
| 940 | 3300025284 | Ga0209130_1025277 | Ga0209130_10252772 | 239 |
| 941 | 3300025292 | Ga0209676_1015445 | Ga0209676_10154455 | 239 |
| 942 | 3300025294 | Ga0209025_1002217 | Ga0209025_100221717 | 239 |
| 943 | 3300025294 | Ga0209025_1003035 | Ga0209025_10030355 | 239 |
| 944 | 3300025294 | Ga0209025_1005459 | Ga0209025_10054596 | 239 |
| 945 | 3300025294 | Ga0209025_1017317 | Ga0209025_10173173 | 239 |
| 946 | 3300025294 | Ga0209025_1024298 | Ga0209025_10242984 | 239 |
| 947 | 3300025294 | Ga0209025_1065855 | Ga0209025_10658552 | 239 |
| 948 | 3300025295 | Ga0209564_1000782 | Ga0209564_100078230 | 239 |
| 949 | 3300025295 | Ga0209564_1001043 | Ga0209564_10010435 | 239 |
| 950 | 3300025295 | Ga0209564_1002280 | Ga0209564_100228017 | 239 |
| 951 | 3300025295 | Ga0209564_1003771 | Ga0209564_100377112 | 239 |
| 952 | 3300025295 | Ga0209564_1009145 | Ga0209564_10091455 | 239 |
| 953 | 3300025295 | Ga0209564_1041321 | Ga0209564_10413212 | 239 |
| 954 | 3300025297 | Ga0209758_1001085 | Ga0209758_100108518 | 239 |
| 955 | 3300025297 | Ga0209758_1001086 | Ga0209758_100108617 | 239 |
| 956 | 3300025297 | Ga0209758_1002520 | Ga0209758_10025203 | 239 |
| 957 | 3300025297 | Ga0209758_1016800 | Ga0209758_10168002 | 239 |
| 958 | 3300025297 | Ga0209758_1050098 | Ga0209758_10500982 | 239 |
| 959 | 3300025299 | Ga0209256_1000510 | Ga0209256_100051054 | 239 |
| 960 | 3300025299 | Ga0209256_1003900 | Ga0209256_10039005 | 239 |
| 961 | 3300025299 | Ga0209256_1007141 | Ga0209256_10071412 | 239 |
| 962 | 3300025299 | Ga0209256_1011065 | Ga0209256_10110655 | 239 |
| 963 | 3300025302 | Ga0207426_1000041 | Ga0207426_1000041226 | 239 |
| 964 | 3300025302 | Ga0207426_1000348 | Ga0207426_100034835 | 239 |
| 965 | 3300025302 | Ga0207426_1003830 | Ga0207426_10038302 | 239 |
| 966 | 3300025303 | Ga0209051_1002527 | Ga0209051_10025275 | 239 |
| 967 | 3300025303 | Ga0209051_1006376 | Ga0209051_10063762 | 239 |
| 968 | 3300025303 | Ga0209051_1039543 | Ga0209051_10395433 | 239 |
| 969 | 3300025304 | Ga0209257_1003532 | Ga0209257_10035323 | 239 |
| 970 | 3300025904 | Ga0207647_10124683 | Ga0207647_101246832 | 239 |
| 971 | 3300025912 | Ga0207707_10000005 | Ga0207707_1000000557 | 239 |
| 972 | 3300025917 | Ga0207660_10002390 | Ga0207660_1000239011 | 239 |
| 973 | 3300025921 | Ga0207652_10000068 | Ga0207652_1000006836 | 239 |
| 974 | 3300025923 | Ga0207681_10040141 | Ga0207681_100401411 | 239 |
| 975 | 3300025923 | Ga0207681_10183113 | Ga0207681_101831131 | 239 |
| 976 | 3300025923 | Ga0207681_10399421 | Ga0207681_103994212 | 239 |
| 977 | 3300025931 | Ga0207644_10082811 | Ga0207644_100828112 | 239 |
| 978 | 3300025941 | Ga0207711_10036003 | Ga0207711_100360033 | 239 |
| 979 | 3300025972 | Ga0207668_10014369 | Ga0207668_100143695 | 239 |
| 980 | 3300025986 | Ga0207658_10345059 | Ga0207658_103450592 | 239 |
| 981 | 3300026067 | Ga0207678_10231988 | Ga0207678_102319882 | 239 |
| 982 | 3300026142 | Ga0207698_10226456 | Ga0207698_102264563 | 239 |
| 983 | 3300028379 | Ga0268266_10271030 | Ga0268266_102710301 | 239 |
| 984 | 3300028379 | Ga0268266_10302678 | Ga0268266_103026782 | 239 |
| 985 | 3300031456 | Ga0307513_10015877 | Ga0307513_100158773 | 239 |
| 986 | 3300041404 | Ga0439436_0006561 | Ga0439436_0006561_1530_2258 | 239 |
| 987 | 3300041413 | Ga0439465_0002262 | Ga0439465_0002262_2531_3259 | 239 |
| 988 | 3300041413 | Ga0439465_0003401 | Ga0439465_0003401_2706_3434 | 239 |
| 989 | 3300041454 | Ga0451799_13591 | Ga0451799_13591_130_858 | 239 |
| 990 | 3300041455 | Ga0451801_39182 | Ga0451801_39182_33_761 | 239 |
| 991 | 3300041464 | Ga0451808_28627 | Ga0451808_28627_60_788 | 239 |
| 992 | 3300041498 | Ga0451841_0178587 | Ga0451841_0178587_1387_2115 | 239 |
| 993 | 3300041499 | Ga0451842_1121 | Ga0451842_1121_73_801 | 239 |
| 994 | 3300041507 | Ga0451851_1096957 | Ga0451851_1096957_174_902 | 239 |
| 995 | 3300041510 | Ga0451854_02560 | Ga0451854_02560_248_976 | 239 |
| 996 | 3300041907 | Ga0452268_06253 | Ga0452268_06253_39_767 | 239 |
| 997 | 3300042006 | Ga0439432_061694 | Ga0439432_061694_78_806 | 239 |
| 998 | 3300046474 | Ga0495605_0045144 | Ga0495605_0045144_432_1160 | 239 |
| 999 | 3300046492 | Ga0495585_0042999 | Ga0495585_0042999_351_1079 | 239 |
| 1000 | 3300046507 | Ga0495606_0041105 | Ga0495606_0041105_1082_1810 | 239 |
| 1001 | 3300046512 | Ga0495610_0021369 | Ga0495610_0021369_2554_3282 | 239 |
| 1002 | 3300046513 | Ga0495616_0055676 | Ga0495616_0055676_891_1619 | 239 |
| 1003 | 3300046522 | Ga0495643_0080657 | Ga0495643_0080657_110_838 | 239 |
| 1004 | 3300046558 | Ga0495633_0020355 | Ga0495633_0020355_494_1222 | 239 |
| 1005 | 3300046616 | Ga0495668_0042577 | Ga0495668_0042577_443_1171 | 239 |
| 1006 | 3300046660 | Ga0495625_0060527 | Ga0495625_0060527_965_1693 | 239 |
| 1007 | 3300046665 | Ga0495661_0210090 | Ga0495661_0210090_132_860 | 239 |
| 1008 | 3300046691 | Ga0495670_0038451 | Ga0495670_0038451_548_1276 | 239 |
| 1009 | 3300046692 | Ga0495671_0098250 | Ga0495671_0098250_522_1250 | 239 |
| 1010 | 3300046694 | Ga0495649_0020798 | Ga0495649_0020798_1739_2467 | 239 |
| 1011 | 3300046694 | Ga0495649_0060369 | Ga0495649_0060369_581_1309 | 239 |
| 1012 | 3300047323 | Ga0495683_0078014 | Ga0495683_0078014_764_1492 | 239 |
| 1013 | 3300047470 | Ga0495681_0046168 | Ga0495681_0046168_67_795 | 239 |
| 1014 | 3300048909 | Ga0496106_0003568 | Ga0496106_0003568_8288_9016 | 239 |
| 1015 | 3300048920 | Ga0496117_0056502 | Ga0496117_0056502_570_1298 | 239 |
| 1016 | 3300048921 | Ga0496118_0008110 | Ga0496118_0008110_2861_3589 | 239 |
| 1017 | 3300048921 | Ga0496118_0022589 | Ga0496118_0022589_3341_4069 | 239 |
| 1018 | 3300048924 | Ga0496121_0023905 | Ga0496121_0023905_3208_3936 | 239 |
| 1019 | 3300048925 | Ga0496122_0017928 | Ga0496122_0017928_1580_2308 | 239 |
| 1020 | 3300048926 | Ga0496123_0014122 | Ga0496123_0014122_3147_3875 | 239 |
| 1021 | 3300048926 | Ga0496123_0125085 | Ga0496123_0125085_665_1393 | 239 |
| 1022 | 3300048927 | Ga0496124_0067125 | Ga0496124_0067125_1151_1879 | 239 |
| 1023 | 3300048928 | Ga0496125_0004309 | Ga0496125_0004309_13949_14677 | 239 |
| 1024 | 3300048929 | Ga0496126_0031438 | Ga0496126_0031438_140_868 | 239 |
| 1025 | 3300049579 | Ga0501043_0368580 | Ga0501043_0368580_120_848 | 239 |
| 1026 | 3300049581 | Ga0501047_0246874 | Ga0501047_0246874_274_1002 | 239 |
| 1027 | 3300049744 | Ga0501083_0020023 | Ga0501083_0020023_3835_4563 | 239 |
| 1028 | 3300049823 | Ga0501044_0327500 | Ga0501044_0327500_621_1349 | 239 |
| 1029 | 3300050516 | nmdc:mga0sz30_108616_c1 | nmdc:mga0sz30_108616_c1_143_871 | 239 |
| 1030 | 3300050516 | nmdc:mga0sz30_8253_c2 | nmdc:mga0sz30_8253_c2_129_857 | 239 |
| 1031 | 3300053086 | Ga0500578_0033329 | Ga0500578_0033329_396_1124 | 239 |
| 1032 | 3300053134 | Ga0500658_0000309 | Ga0500658_0000309_19381_20109 | 239 |
| 1033 | 3300053153 | Ga0500616_0045185 | Ga0500616_0045185_1178_1906 | 239 |
| 1034 | 3300053156 | Ga0500622_0002162 | Ga0500622_0002162_3641_4369 | 239 |
| 1035 | 3300053158 | Ga0500627_0082713 | Ga0500627_0082713_674_1402 | 239 |
| 1036 | 3300053160 | Ga0500633_0008199 | Ga0500633_0008199_147_875 | 239 |
| 1037 | 3300059490 | Ga0587066_051258 | Ga0587066_051258_64_795 | 239 |
| 1038 | 3300059492 | Ga0587073_0037104 | Ga0587073_0037104_207_935 | 239 |
| 1039 | 3300059504 | Ga0587082_047957 | Ga0587082_047957_68_796 | 239 |
| 1040 | 3300059508 | Ga0587088_025879 | Ga0587088_025879_219_947 | 239 |
| 1041 | 3300059508 | Ga0587088_045251 | Ga0587088_045251_44_772 | 239 |
| 1042 | 3300059508 | Ga0587088_050095 | Ga0587088_050095_12_743 | 239 |
| 1043 | 3300059511 | Ga0587091_057629 | Ga0587091_057629_22_753 | 239 |
| 1044 | 3300059512 | Ga0587092_039632 | Ga0587092_039632_68_799 | 239 |
| 1045 | 3300059605 | Ga0587106_035629 | Ga0587106_035629_19_750 | 239 |
| 1046 | 3300059643 | Ga0587072_037083 | Ga0587072_037083_44_772 | 239 |
| 1047 | 3300059643 | Ga0587072_052909 | Ga0587072_052909_26_754 | 239 |
| 1048 | 3300059644 | Ga0587075_035666 | Ga0587075_035666_15_743 | 239 |
| 1049 | 3300059651 | Ga0587105_005868 | Ga0587105_005868_28_759 | 239 |
| 1050 | 3300060344 | Ga0587071_046356 | Ga0587071_046356_15_746 | 239 |
| 1051 | iso_pu_bacteria | 2510917022 | 2511133851 | 239 |
| 1052 | iso_pu_bacteria | 2513237159 | 2513998465 | 239 |
| 1053 | iso_pu_bacteria | 2524023209 | 2524458445 | 239 |
| 1054 | iso_pu_bacteria | 2558860983 | 2561467094 | 239 |
| 1055 | iso_pu_bacteria | 2582581307 | 2585271639 | 239 |
| 1056 | iso_pu_bacteria | 2582581866 | 2585396638 | 239 |
| 1057 | iso_pu_bacteria | 2585427531 | 2585563121 | 239 |
| 1058 | iso_pu_bacteria | 2585427609 | 2585907339 | 239 |
| 1059 | iso_pu_bacteria | 2585428125 | 2587982667 | 239 |
| 1060 | iso_pu_bacteria | 2600254933 | 2600373259 | 239 |
| 1061 | iso_pu_bacteria | 2643221557 | 2643808049 | 239 |
| 1062 | iso_pu_bacteria | 2643221607 | 2644052246 | 239 |
| 1063 | iso_pu_bacteria | 2643221610 | 2644068762 | 239 |
| 1064 | iso_pu_bacteria | 2643221636 | 2644201371 | 239 |
| 1065 | iso_pu_bacteria | 2643221637 | 2644209480 | 239 |
| 1066 | iso_pu_bacteria | 2643221668 | 2644379483 | 239 |
| 1067 | iso_pu_bacteria | 2643221675 | 2644419832 | 239 |
| 1068 | iso_pu_bacteria | 2643221680 | 2644453189 | 239 |
| 1069 | iso_pu_bacteria | 2643221686 | 2644484524 | 239 |
| 1070 | iso_pu_bacteria | 2643221688 | 2644493102 | 239 |
| 1071 | iso_pu_bacteria | 2643221689 | 2644499310 | 239 |
| 1072 | iso_pu_bacteria | 2643221718 | 2644653008 | 239 |
| 1073 | iso_pu_bacteria | 2643221726 | 2644688783 | 239 |
| 1074 | iso_pu_bacteria | 2842298080 | 2842300298 | 239 |
| 1075 | iso_pu_bacteria | 2842357229 | 2842361184 | 239 |
| 1076 | iso_pu_bacteria | 2842509118 | 2842511730 | 239 |
| 1077 | iso_pu_bacteria | 2842521101 | 2842524507 | 239 |
| 1078 | iso_pu_bacteria | 2899803654 | 2899808062 | 239 |
| 1079 | iso_pu_bacteria | 2917554339 | 2917555025 | 239 |
| 1080 | iso_pu_bacteria | 8005658619 | 8005660784 | 239 |
| 1081 | iso_pu_bacteria | 8046767195 | 8046767208 | 239 |
| 1082 | iso_pu_bacteria | 8057575449 | 8057581594 | 239 |
| 1083 | 3300017792 | Ga0163161_10005528 | Ga0163161_100055286 | 240 |
| 1084 | 3300025271 | Ga0207666_1000023 | Ga0207666_100002318 | 240 |
| 1085 | 3300025735 | Ga0207713_1051466 | Ga0207713_10514662 | 240 |
| 1086 | 3300025885 | Ga0207653_10020764 | Ga0207653_100207642 | 240 |
| 1087 | 3300025893 | Ga0207682_10000011 | Ga0207682_1000001133 | 240 |
| 1088 | 3300025899 | Ga0207642_10000936 | Ga0207642_100009363 | 240 |
| 1089 | 3300025901 | Ga0207688_10000212 | Ga0207688_100002125 | 240 |
| 1090 | 3300025903 | Ga0207680_10021218 | Ga0207680_100212182 | 240 |
| 1091 | 3300025907 | Ga0207645_10000788 | Ga0207645_100007883 | 240 |
| 1092 | 3300025908 | Ga0207643_10000284 | Ga0207643_1000028413 | 240 |
| 1093 | 3300025911 | Ga0207654_10026416 | Ga0207654_100264162 | 240 |
| 1094 | 3300025912 | Ga0207707_10001938 | Ga0207707_1000193810 | 240 |
| 1095 | 3300025913 | Ga0207695_10051370 | Ga0207695_100513702 | 240 |
| 1096 | 3300025914 | Ga0207671_10019417 | Ga0207671_100194176 | 240 |
| 1097 | 3300025917 | Ga0207660_10013909 | Ga0207660_100139093 | 240 |
| 1098 | 3300025920 | Ga0207649_10000057 | Ga0207649_10000057113 | 240 |
| 1099 | 3300025923 | Ga0207681_10000181 | Ga0207681_100001813 | 240 |
| 1100 | 3300025925 | Ga0207650_10001418 | Ga0207650_100014186 | 240 |
| 1101 | 3300025926 | Ga0207659_10000028 | Ga0207659_1000002821 | 240 |
| 1102 | 3300025927 | Ga0207687_10000061 | Ga0207687_1000006115 | 240 |
| 1103 | 3300025931 | Ga0207644_10004970 | Ga0207644_100049706 | 240 |
| 1104 | 3300025933 | Ga0207706_10008724 | Ga0207706_100087241 | 240 |
| 1105 | 3300025935 | Ga0207709_10000539 | Ga0207709_100005392 | 240 |
| 1106 | 3300025937 | Ga0207669_10000290 | Ga0207669_1000029014 | 240 |
| 1107 | 3300025938 | Ga0207704_10000767 | Ga0207704_100007673 | 240 |
| 1108 | 3300025941 | Ga0207711_10015022 | Ga0207711_100150225 | 240 |
| 1109 | 3300025942 | Ga0207689_10009011 | Ga0207689_100090113 | 240 |
| 1110 | 3300025944 | Ga0207661_10000215 | Ga0207661_100002153 | 240 |
| 1111 | 3300025945 | Ga0207679_10000026 | Ga0207679_10000026181 | 240 |
| 1112 | 3300025949 | Ga0207667_10056380 | Ga0207667_100563803 | 240 |
| 1113 | 3300025960 | Ga0207651_10000173 | Ga0207651_1000017332 | 240 |
| 1114 | 3300025961 | Ga0207712_10002375 | Ga0207712_100023754 | 240 |
| 1115 | 3300025972 | Ga0207668_10000474 | Ga0207668_1000047419 | 240 |
| 1116 | 3300025981 | Ga0207640_10000711 | Ga0207640_1000071113 | 240 |
| 1117 | 3300025986 | Ga0207658_10001541 | Ga0207658_100015416 | 240 |
| 1118 | 3300026023 | Ga0207677_10001215 | Ga0207677_100012153 | 240 |
| 1119 | 3300026078 | Ga0207702_10136128 | Ga0207702_101361282 | 240 |
| 1120 | 3300026089 | Ga0207648_10023516 | Ga0207648_100235163 | 240 |
| 1121 | 3300026095 | Ga0207676_10005845 | Ga0207676_100058456 | 240 |
| 1122 | 3300026116 | Ga0207674_10026646 | Ga0207674_100266464 | 240 |
| 1123 | 3300026121 | Ga0207683_10000034 | Ga0207683_1000003418 | 240 |
| 1124 | 3300027907 | Ga0207428_10001235 | Ga0207428_100012356 | 240 |
| 1125 | 3300028380 | Ga0268265_10001023 | Ga0268265_100010233 | 240 |
| 1126 | 3300028381 | Ga0268264_10001465 | Ga0268264_100014655 | 240 |
| 1127 | 3300031251 | Ga0265327_10016822 | Ga0265327_100168225 | 240 |
| 1128 | 3300034819 | Ga0373958_0000962 | Ga0373958_0000962_1145_1903 | 240 |
| 1129 | 3300034820 | Ga0373959_0006254 | Ga0373959_0006254_381_1139 | 240 |
| 1130 | 3300035091 | Ga0373951_0002104 | Ga0373951_0002104_3506_4264 | 240 |
| 1131 | 3300035092 | Ga0373952_0001391 | Ga0373952_0001391_96_854 | 240 |
| 1132 | 3300035112 | Ga0373932_0002140 | Ga0373932_0002140_915_1673 | 240 |
| 1133 | 3300035114 | Ga0373939_0002351 | Ga0373939_0002351_3464_4222 | 240 |
| 1134 | 3300035121 | Ga0373960_0003014 | Ga0373960_0003014_911_1669 | 240 |
| 1135 | 3300035242 | Ga0373962_0000385 | Ga0373962_0000385_8759_9517 | 240 |
| 1136 | 3300035691 | Ga0373931_0000254 | Ga0373931_0000254_16823_17581 | 240 |
| 1137 | 3300046492 | Ga0495585_0302012 | Ga0495585_0302012_23_757 | 240 |
| 1138 | 3300046506 | Ga0495583_0017655 | Ga0495583_0017655_650_1384 | 240 |
| 1139 | 3300046512 | Ga0495610_0002478 | Ga0495610_0002478_10406_11134 | 240 |
| 1140 | 3300046515 | Ga0495620_0011516 | Ga0495620_0011516_1055_1783 | 240 |
| 1141 | 3300046519 | Ga0495632_0002387 | Ga0495632_0002387_4812_5573 | 240 |
| 1142 | 3300046530 | Ga0495654_0161120 | Ga0495654_0161120_176_910 | 240 |
| 1143 | 3300046665 | Ga0495661_0102391 | Ga0495661_0102391_252_986 | 240 |
| 1144 | 3300046794 | Ga0495589_0034844 | Ga0495589_0034844_465_1199 | 240 |
| 1145 | 3300048090 | Ga0495615_0049660 | Ga0495615_0049660_294_1028 | 240 |
| 1146 | 3300048903 | Ga0496100_0019710 | Ga0496100_0019710_391_1149 | 240 |
| 1147 | 3300048904 | Ga0496101_0012868 | Ga0496101_0012868_3712_4470 | 240 |
| 1148 | 3300048905 | Ga0496102_0004000 | Ga0496102_0004000_3840_4598 | 240 |
| 1149 | 3300048906 | Ga0496103_0006985 | Ga0496103_0006985_2753_3511 | 240 |
| 1150 | 3300048907 | Ga0496104_0280128 | Ga0496104_0280128_429_1187 | 240 |
| 1151 | 3300048908 | Ga0496105_0624272 | Ga0496105_0624272_25_783 | 240 |
| 1152 | 3300048909 | Ga0496106_0010947 | Ga0496106_0010947_1601_2359 | 240 |
| 1153 | 3300048910 | Ga0496107_0005476 | Ga0496107_0005476_3658_4416 | 240 |
| 1154 | 3300048912 | Ga0496109_0000984 | Ga0496109_0000984_941_1699 | 240 |
| 1155 | 3300048913 | Ga0496110_0009931 | Ga0496110_0009931_3462_4220 | 240 |
| 1156 | 3300048915 | Ga0496112_0798778 | Ga0496112_0798778_41_799 | 240 |
| 1157 | 3300048917 | Ga0496114_0016680 | Ga0496114_0016680_4230_4988 | 240 |
| 1158 | 3300048918 | Ga0496115_0003065 | Ga0496115_0003065_2071_2829 | 240 |
| 1159 | 3300049581 | Ga0501047_0349477 | Ga0501047_0349477_387_1142 | 240 |
| 1160 | 3300049588 | Ga0501072_0037701 | Ga0501072_0037701_2992_3747 | 240 |
| 1161 | 3300049589 | Ga0501073_0116994 | Ga0501073_0116994_240_995 | 240 |
| 1162 | 3300049744 | Ga0501083_0019610 | Ga0501083_0019610_385_1140 | 240 |
| 1163 | 3300049823 | Ga0501044_0643058 | Ga0501044_0643058_116_898 | 240 |
| 1164 | 3300050494 | nmdc:mga06z11_266120_c1 | nmdc:mga06z11_266120_c1_227_985 | 240 |
| 1165 | 3300050511 | nmdc:mga08y16_68203_c1 | nmdc:mga08y16_68203_c1_199_957 | 240 |
| 1166 | 3300050512 | nmdc:mga0n895_11694_c1 | nmdc:mga0n895_11694_c1_4858_5616 | 240 |
| 1167 | 3300050514 | nmdc:mga08x19_362373_c1 | nmdc:mga08x19_362373_c1_174_932 | 240 |
| 1168 | 3300060353 | Ga0501082_0205576 | Ga0501082_0205576_16_771 | 240 |
| 1169 | iso_pu_bacteria | 2889790730 | 2889791529 | 240 |
| 1170 | 3300028794 | Ga0307515_10001330 | Ga0307515_1000133022 | 241 |
| 1171 | 3300031456 | Ga0307513_10000463 | Ga0307513_100004637 | 241 |
| 1172 | 3300033180 | Ga0307510_10157736 | Ga0307510_101577362 | 241 |
| 1173 | 3300046642 | Ga0495634_0120675 | Ga0495634_0120675_921_1661 | 241 |
| 1174 | 3300046674 | Ga0495588_0038007 | Ga0495588_0038007_909_1649 | 241 |
| 1175 | 3300046690 | Ga0495624_0130607 | Ga0495624_0130607_745_1485 | 241 |
| 1176 | 3300047317 | Ga0495604_0035060 | Ga0495604_0035060_1233_1973 | 241 |
| 1177 | 3300053085 | Ga0495619_0262615 | Ga0495619_0262615_38_778 | 241 |
| 1178 | 3300053148 | Ga0500590_001183 | Ga0500590_001183_5776_6516 | 241 |
| 1179 | iso_pu_bacteria | 2503198000 | 2503199004 | 241 |
| 1180 | iso_pu_bacteria | 2508501123 | 2509118467 | 241 |
| 1181 | iso_pu_bacteria | 2509276022 | 2509393909 | 241 |
| 1182 | iso_pu_bacteria | 2510917026 | 2511169779 | 241 |
| 1183 | iso_pu_bacteria | 2512875016 | 2512933595 | 241 |
| 1184 | iso_pu_bacteria | 2513237164 | 2514035584 | 241 |
| 1185 | iso_pu_bacteria | 2513237305 | 2514419570 | 241 |
| 1186 | iso_pu_bacteria | 2513237351 | 2514586601 | 241 |
| 1187 | iso_pu_bacteria | 2585427633 | 2585997756 | 241 |
| 1188 | iso_pu_bacteria | 2585427634 | 2586002340 | 241 |
| 1189 | iso_pu_bacteria | 2588253730 | 2588519673 | 241 |
| 1190 | iso_pu_bacteria | 2643221551 | 2643777214 | 241 |
| 1191 | iso_pu_bacteria | 2643221555 | 2643795662 | 241 |
| 1192 | iso_pu_bacteria | 2643221568 | 2643855058 | 241 |
| 1193 | iso_pu_bacteria | 2721755686 | 2723573402 | 241 |
| 1194 | iso_pu_bacteria | 2751185800 | 2753358432 | 241 |
| 1195 | iso_pu_bacteria | 2758568016 | 2758640661 | 241 |
| 1196 | iso_pu_bacteria | 2775507049 | 2776915456 | 241 |
| 1197 | iso_pu_bacteria | 2802428860 | 2802729551 | 241 |
| 1198 | iso_pu_bacteria | 2802428861 | 2802736897 | 241 |
| 1199 | iso_pu_bacteria | 2802428862 | 2802743302 | 241 |
| 1200 | iso_pu_bacteria | 2802428863 | 2802749572 | 241 |
| 1201 | iso_pu_bacteria | 2854911287 | 2854913958 | 241 |
| 1202 | iso_pu_bacteria | 2856320880 | 2856327149 | 241 |
| 1203 | iso_pu_bacteria | 2869278585 | 2869279620 | 241 |
| 1204 | iso_pu_bacteria | 2874139085 | 2874139389 | 241 |
| 1205 | iso_pu_bacteria | 2876363079 | 2876364151 | 241 |
| 1206 | iso_pu_bacteria | 2878738818 | 2878742147 | 241 |
| 1207 | iso_pu_bacteria | 2882632389 | 2882640395 | 241 |
| 1208 | iso_pu_bacteria | 2888337043 | 2888343683 | 241 |
| 1209 | iso_pu_bacteria | 2894652903 | 2894653756 | 241 |
| 1210 | iso_pu_bacteria | 2903448605 | 2903453745 | 241 |
| 1211 | iso_pu_bacteria | 2903521522 | 2903525689 | 241 |
| 1212 | iso_pu_bacteria | 2903528002 | 2903532764 | 241 |
| 1213 | iso_pu_bacteria | 2919166419 | 2919170608 | 241 |
| 1214 | iso_pu_bacteria | 2919171160 | 2919175812 | 241 |
| 1215 | iso_pu_bacteria | 2924718760 | 2924725576 | 241 |
| 1216 | iso_pu_bacteria | 2924776078 | 2924779831 | 241 |
| 1217 | iso_pu_bacteria | 2929138655 | 2929141849 | 241 |
| 1218 | iso_pu_bacteria | 2937036028 | 2937036215 | 241 |
| 1219 | iso_pu_bacteria | 2937084907 | 2937089989 | 241 |
| 1220 | iso_pu_bacteria | 2937848649 | 2937851691 | 241 |
| 1221 | iso_pu_bacteria | 2937877337 | 2937880582 | 241 |
| 1222 | iso_pu_bacteria | 2937972304 | 2937974212 | 241 |
| 1223 | iso_pu_bacteria | 2957375807 | 2957381824 | 241 |
| 1224 | iso_pu_bacteria | 2957437181 | 2957442083 | 241 |
| 1225 | iso_pu_bacteria | 2958034702 | 2958035197 | 241 |
| 1226 | iso_pu_bacteria | 2958041894 | 2958044229 | 241 |
| 1227 | iso_pu_bacteria | 2958064165 | 2958065667 | 241 |
| 1228 | iso_pu_bacteria | 2958084443 | 2958087715 | 241 |
| 1229 | iso_pu_bacteria | 2958092219 | 2958093674 | 241 |
| 1230 | iso_pu_bacteria | 2958144490 | 2958147244 | 241 |
| 1231 | iso_pu_bacteria | 2960591022 | 2960592239 | 241 |
| 1232 | iso_pu_bacteria | 2960631154 | 2960633809 | 241 |
| 1233 | iso_pu_bacteria | 2960680706 | 2960682346 | 241 |
| 1234 | iso_pu_bacteria | 2963644680 | 2963645609 | 241 |
| 1235 | iso_pu_bacteria | 2967686174 | 2967690244 | 241 |
| 1236 | iso_pu_bacteria | 2967728569 | 2967730829 | 241 |
| 1237 | iso_pu_bacteria | 2968016561 | 2968023617 | 241 |
| 1238 | iso_pu_bacteria | 2968083720 | 2968085055 | 241 |
| 1239 | iso_pu_bacteria | 2970026789 | 2970029540 | 241 |
| 1240 | iso_pu_bacteria | 2970122695 | 2970128926 | 241 |
| 1241 | iso_pu_bacteria | 2970143518 | 2970143598 | 241 |
| 1242 | iso_pu_bacteria | 2970469710 | 2970476199 | 241 |
| 1243 | iso_pu_bacteria | 2970593180 | 2970594219 | 241 |
| 1244 | iso_pu_bacteria | 2977530762 | 2977535078 | 241 |
| 1245 | iso_pu_bacteria | 2977544691 | 2977550623 | 241 |
| 1246 | iso_pu_bacteria | 2977922695 | 2977929547 | 241 |
| 1247 | iso_pu_bacteria | 2977986579 | 2977987984 | 241 |
| 1248 | iso_pu_bacteria | 2978969890 | 2978972589 | 241 |
| 1249 | iso_pu_bacteria | 2996310559 | 2996315194 | 241 |
| 1250 | iso_pu_bacteria | 2996336353 | 2996339460 | 241 |
| 1251 | iso_pu_bacteria | 2996348954 | 2996354783 | 241 |
| 1252 | iso_pu_bacteria | 3000135777 | 3000137673 | 241 |
| 1253 | iso_pu_bacteria | 3004211236 | 3004218401 | 241 |
| 1254 | iso_pu_bacteria | 3004218560 | 3004219502 | 241 |
| 1255 | iso_pu_bacteria | 3004275668 | 3004281431 | 241 |
| 1256 | iso_pu_bacteria | 3004334049 | 3004336970 | 241 |
| 1257 | iso_pu_bacteria | 637000159 | 637076702 | 241 |
| 1258 | iso_pu_bacteria | 8003999396 | 8004003084 | 241 |
| 1259 | iso_pu_bacteria | 8054460903 | 8054463813 | 241 |
| 1260 | iso_pu_bacteria | 8056875544 | 8056878246 | 241 |
| 1261 | 3300002704 | JGI25155J39150_1000010 | JGI25155J39150_100001017 | 242 |
| 1262 | 3300002705 | JGI25156J39149_1000102 | JGI25156J39149_100010216 | 242 |
| 1263 | 3300002737 | JGI25162J39368_1001052 | JGI25162J39368_100105213 | 242 |
| 1264 | 3300002737 | JGI25162J39368_1001061 | JGI25162J39368_10010615 | 242 |
| 1265 | 3300002738 | JGI25154J39366_1000184 | JGI25154J39366_100018452 | 242 |
| 1266 | 3300002741 | JGI25157J39369_1000009 | JGI25157J39369_100000916 | 242 |
| 1267 | 3300002773 | JGI25152J39213_1002993 | JGI25152J39213_10029934 | 242 |
| 1268 | 3300002774 | JGI25150J39212_1000037 | JGI25150J39212_100003726 | 242 |
| 1269 | 3300003187 | JGI25151J46595_10000220 | JGI25151J46595_1000022049 | 242 |
| 1270 | 3300003214 | JGI25165J46597_1001126 | JGI25165J46597_100112614 | 242 |
| 1271 | 3300003578 | Ga0006562J51391_1003164 | Ga0006562J51391_10031641 | 242 |
| 1272 | 3300003693 | Ga0032354_1026988 | Ga0032354_10269881 | 242 |
| 1273 | 3300003752 | Ga0055539_1004440 | Ga0055539_10044402 | 242 |
| 1274 | 3300005563 | Ga0068855_100113501 | Ga0068855_1001135012 | 242 |
| 1275 | 3300005578 | Ga0068854_100182740 | Ga0068854_1001827402 | 242 |
| 1276 | 3300005614 | Ga0068856_100252543 | Ga0068856_1002525432 | 242 |
| 1277 | 3300005616 | Ga0068852_100212449 | Ga0068852_1002124492 | 242 |
| 1278 | 3300005834 | Ga0068851_10096773 | Ga0068851_100967732 | 242 |
| 1279 | 3300006353 | Ga0075370_10079154 | Ga0075370_100791542 | 242 |
| 1280 | 3300009093 | Ga0105240_10000013 | Ga0105240_10000013193 | 242 |
| 1281 | 3300009545 | Ga0105237_10034241 | Ga0105237_100342413 | 242 |
| 1282 | 3300010375 | Ga0105239_10000820 | Ga0105239_1000082015 | 242 |
| 1283 | 3300013104 | Ga0157370_10002495 | Ga0157370_100024955 | 242 |
| 1284 | 3300015262 | Ga0182007_10003160 | Ga0182007_100031602 | 242 |
| 1285 | 3300015265 | Ga0182005_1001581 | Ga0182005_10015815 | 242 |
| 1286 | 3300025206 | Ga0209435_100009 | Ga0209435_100009273 | 242 |
| 1287 | 3300025233 | Ga0209437_100057 | Ga0209437_100057194 | 242 |
| 1288 | 3300025233 | Ga0209437_100107 | Ga0209437_100107163 | 242 |
| 1289 | 3300025245 | Ga0207425_1000034 | Ga0207425_100003426 | 242 |
| 1290 | 3300025246 | Ga0209646_1000018 | Ga0209646_1000018273 | 242 |
| 1291 | 3300025250 | Ga0209026_1000068 | Ga0209026_100006817 | 242 |
| 1292 | 3300025253 | Ga0209677_100199 | Ga0209677_10019910 | 242 |
| 1293 | 3300025256 | Ga0209759_1000007 | Ga0209759_1000007273 | 242 |
| 1294 | 3300025258 | Ga0209129_1000253 | Ga0209129_100025326 | 242 |
| 1295 | 3300025261 | Ga0209233_1000072 | Ga0209233_10000725 | 242 |
| 1296 | 3300025261 | Ga0209233_1000134 | Ga0209233_1000134194 | 242 |
| 1297 | 3300025261 | Ga0209233_1000479 | Ga0209233_10004795 | 242 |
| 1298 | 3300025272 | Ga0209455_1018745 | Ga0209455_10187452 | 242 |
| 1299 | 3300025273 | Ga0209673_1012482 | Ga0209673_10124822 | 242 |
| 1300 | 3300025294 | Ga0209025_1000533 | Ga0209025_100053351 | 242 |
| 1301 | 3300025297 | Ga0209758_1000415 | Ga0209758_100041551 | 242 |
| 1302 | 3300025913 | Ga0207695_10000044 | Ga0207695_10000044150 | 242 |
| 1303 | 3300025914 | Ga0207671_10000400 | Ga0207671_1000040017 | 242 |
| 1304 | 3300025949 | Ga0207667_10105936 | Ga0207667_101059362 | 242 |
| 1305 | 3300025981 | Ga0207640_10087541 | Ga0207640_100875412 | 242 |
| 1306 | 3300025986 | Ga0207658_10391025 | Ga0207658_103910252 | 242 |
| 1307 | 3300026078 | Ga0207702_10211582 | Ga0207702_102115822 | 242 |
| 1308 | 3300027312 | Ga0209371_1002474 | Ga0209371_10024745 | 242 |
| 1309 | 3300030500 | Ga0268256_1001864 | Ga0268256_10018647 | 242 |
| 1310 | 3300031731 | Ga0307405_10001569 | Ga0307405_100015693 | 242 |
| 1311 | 3300031911 | Ga0307412_10002170 | Ga0307412_100021708 | 242 |
| 1312 | 3300033527 | Ga0316586_1038278 | Ga0316586_10382781 | 242 |
| 1313 | 3300046507 | Ga0495606_0009969 | Ga0495606_0009969_3716_4456 | 242 |
| 1314 | 3300048920 | Ga0496117_0002097 | Ga0496117_0002097_7741_8481 | 242 |
| 1315 | 3300048920 | Ga0496117_0020361 | Ga0496117_0020361_717_1454 | 242 |
| 1316 | 3300048921 | Ga0496118_0002291 | Ga0496118_0002291_7845_8585 | 242 |
| 1317 | 3300048922 | Ga0496119_0028106 | Ga0496119_0028106_2561_3301 | 242 |
| 1318 | 3300048922 | Ga0496119_0096761 | Ga0496119_0096761_145_882 | 242 |
| 1319 | 3300048923 | Ga0496120_0039751 | Ga0496120_0039751_419_1159 | 242 |
| 1320 | 3300048924 | Ga0496121_0011232 | Ga0496121_0011232_7662_8402 | 242 |
| 1321 | 3300048924 | Ga0496121_0013424 | Ga0496121_0013424_5754_6491 | 242 |
| 1322 | 3300048924 | Ga0496121_0020808 | Ga0496121_0020808_2627_3367 | 242 |
| 1323 | 3300048925 | Ga0496122_0018012 | Ga0496122_0018012_3535_4272 | 242 |
| 1324 | 3300048926 | Ga0496123_0019242 | Ga0496123_0019242_2312_3049 | 242 |
| 1325 | 3300048927 | Ga0496124_0011409 | Ga0496124_0011409_5808_6545 | 242 |
| 1326 | 3300048928 | Ga0496125_0006873 | Ga0496125_0006873_10725_11462 | 242 |
| 1327 | 3300048929 | Ga0496126_0193912 | Ga0496126_0193912_670_1407 | 242 |
| 1328 | 3300049591 | Ga0501075_0072070 | Ga0501075_0072070_909_1676 | 242 |
| 1329 | 3300049592 | Ga0501076_0044976 | Ga0501076_0044976_410_1177 | 242 |
| 1330 | 3300049593 | Ga0501077_0000896 | Ga0501077_0000896_2007_2774 | 242 |
| 1331 | 3300049741 | Ga0501079_0009536 | Ga0501079_0009536_5810_6577 | 242 |
| 1332 | 3300049743 | Ga0501081_0075277 | Ga0501081_0075277_19_786 | 242 |
| 1333 | 3300053140 | Ga0500573_0000334 | Ga0500573_0000334_11186_11926 | 242 |
| 1334 | 3300059640 | Ga0587067_040453 | Ga0587067_040453_72_812 | 242 |
| 1335 | 3300060344 | Ga0587071_051619 | Ga0587071_051619_44_781 | 242 |
| 1336 | 3300060353 | Ga0501082_0012395 | Ga0501082_0012395_3743_4510 | 242 |
| 1337 | iso_pu_bacteria | 2508501127 | 2509143156 | 242 |
| 1338 | iso_pu_bacteria | 2509276018 | 2509371425 | 242 |
| 1339 | iso_pu_bacteria | 2510065059 | 2510318369 | 242 |
| 1340 | iso_pu_bacteria | 2513237087 | 2513592609 | 242 |
| 1341 | iso_pu_bacteria | 2513237090 | 2513613974 | 242 |
| 1342 | iso_pu_bacteria | 2597489875 | 2597811970 | 242 |
| 1343 | iso_pu_bacteria | 2599185301 | 2599938740 | 242 |
| 1344 | iso_pu_bacteria | 2643221550 | 2643771298 | 242 |
| 1345 | iso_pu_bacteria | 2643221564 | 2643837017 | 242 |
| 1346 | iso_pu_bacteria | 2643221595 | 2643988549 | 242 |
| 1347 | iso_pu_bacteria | 2643221627 | 2644154534 | 242 |
| 1348 | iso_pu_bacteria | 2687453392 | 2688596279 | 242 |
| 1349 | iso_pu_bacteria | 2693429783 | 2694631641 | 242 |
| 1350 | iso_pu_bacteria | 2693429784 | 2694638304 | 242 |
| 1351 | iso_pu_bacteria | 2756170246 | 2756673670 | 242 |
| 1352 | iso_pu_bacteria | 2791355123 | 2792747531 | 242 |
| 1353 | iso_pu_bacteria | 2828305725 | 2828309243 | 242 |
| 1354 | iso_pu_bacteria | 2841734538 | 2841736670 | 242 |
| 1355 | iso_pu_bacteria | 2844002411 | 2844003152 | 242 |
| 1356 | iso_pu_bacteria | 2844009547 | 2844011108 | 242 |
| 1357 | iso_pu_bacteria | 2847686936 | 2847690227 | 242 |
| 1358 | iso_pu_bacteria | 2856328259 | 2856329769 | 242 |
| 1359 | iso_pu_bacteria | 2856334872 | 2856336573 | 242 |
| 1360 | iso_pu_bacteria | 2856342000 | 2856343510 | 242 |
| 1361 | iso_pu_bacteria | 2856349417 | 2856349675 | 242 |
| 1362 | iso_pu_bacteria | 2856364286 | 2856365095 | 242 |
| 1363 | iso_pu_bacteria | 2857349434 | 2857353228 | 242 |
| 1364 | iso_pu_bacteria | 2869162929 | 2869168891 | 242 |
| 1365 | iso_pu_bacteria | 2869169390 | 2869176125 | 242 |
| 1366 | iso_pu_bacteria | 2869234852 | 2869241787 | 242 |
| 1367 | iso_pu_bacteria | 2869242130 | 2869243703 | 242 |
| 1368 | iso_pu_bacteria | 2869249662 | 2869253331 | 242 |
| 1369 | iso_pu_bacteria | 2869256925 | 2869257338 | 242 |
| 1370 | iso_pu_bacteria | 2869264136 | 2869269011 | 242 |
| 1371 | iso_pu_bacteria | 2869285874 | 2869286281 | 242 |
| 1372 | iso_pu_bacteria | 2871429161 | 2871430250 | 242 |
| 1373 | iso_pu_bacteria | 2871435913 | 2871441681 | 242 |
| 1374 | iso_pu_bacteria | 2871444079 | 2871445055 | 242 |
| 1375 | iso_pu_bacteria | 2871451962 | 2871458705 | 242 |
| 1376 | iso_pu_bacteria | 2871459585 | 2871463878 | 242 |
| 1377 | iso_pu_bacteria | 2871466892 | 2871471950 | 242 |
| 1378 | iso_pu_bacteria | 2871474448 | 2871476266 | 242 |
| 1379 | iso_pu_bacteria | 2871481445 | 2871484845 | 242 |
| 1380 | iso_pu_bacteria | 2871488783 | 2871494979 | 242 |
| 1381 | iso_pu_bacteria | 2871495908 | 2871500151 | 242 |
| 1382 | iso_pu_bacteria | 2874102143 | 2874107367 | 242 |
| 1383 | iso_pu_bacteria | 2874109183 | 2874115776 | 242 |
| 1384 | iso_pu_bacteria | 2874116593 | 2874123033 | 242 |
| 1385 | iso_pu_bacteria | 2874123672 | 2874130059 | 242 |
| 1386 | iso_pu_bacteria | 2874146452 | 2874146666 | 242 |
| 1387 | iso_pu_bacteria | 2874155637 | 2874155741 | 242 |
| 1388 | iso_pu_bacteria | 2874162495 | 2874162544 | 242 |
| 1389 | iso_pu_bacteria | 2874168670 | 2874170645 | 242 |
| 1390 | iso_pu_bacteria | 2876369609 | 2876376803 | 242 |
| 1391 | iso_pu_bacteria | 2876377896 | 2876378850 | 242 |
| 1392 | iso_pu_bacteria | 2876386047 | 2876386993 | 242 |
| 1393 | iso_pu_bacteria | 2876392853 | 2876399207 | 242 |
| 1394 | iso_pu_bacteria | 2876399893 | 2876406693 | 242 |
| 1395 | iso_pu_bacteria | 2876406927 | 2876409271 | 242 |
| 1396 | iso_pu_bacteria | 2876413966 | 2876414070 | 242 |
| 1397 | iso_pu_bacteria | 2876420981 | 2876426319 | 242 |
| 1398 | iso_pu_bacteria | 2878730984 | 2878738200 | 242 |
| 1399 | iso_pu_bacteria | 2878745973 | 2878746446 | 242 |
| 1400 | iso_pu_bacteria | 2878753008 | 2878760104 | 242 |
| 1401 | iso_pu_bacteria | 2878760144 | 2878764273 | 242 |
| 1402 | iso_pu_bacteria | 2878767105 | 2878771343 | 242 |
| 1403 | iso_pu_bacteria | 2878788777 | 2878796173 | 242 |
| 1404 | iso_pu_bacteria | 2881147464 | 2881148499 | 242 |
| 1405 | iso_pu_bacteria | 2881155292 | 2881159582 | 242 |
| 1406 | iso_pu_bacteria | 2881161766 | 2881165304 | 242 |
| 1407 | iso_pu_bacteria | 2881845957 | 2881852048 | 242 |
| 1408 | iso_pu_bacteria | 2881853255 | 2881858605 | 242 |
| 1409 | iso_pu_bacteria | 2881861095 | 2881863923 | 242 |
| 1410 | iso_pu_bacteria | 2882912400 | 2882917841 | 242 |
| 1411 | iso_pu_bacteria | 2885305155 | 2885307145 | 242 |
| 1412 | iso_pu_bacteria | 2885312484 | 2885313846 | 242 |
| 1413 | iso_pu_bacteria | 2885318864 | 2885322978 | 242 |
| 1414 | iso_pu_bacteria | 2885334103 | 2885341200 | 242 |
| 1415 | iso_pu_bacteria | 2885342637 | 2885344618 | 242 |
| 1416 | iso_pu_bacteria | 2885350715 | 2885352187 | 242 |
| 1417 | iso_pu_bacteria | 2888343758 | 2888344657 | 242 |
| 1418 | iso_pu_bacteria | 2888350351 | 2888353498 | 242 |
| 1419 | iso_pu_bacteria | 2889010040 | 2889015211 | 242 |
| 1420 | iso_pu_bacteria | 2889016732 | 2889019708 | 242 |
| 1421 | iso_pu_bacteria | 2903492973 | 2903494338 | 242 |
| 1422 | iso_pu_bacteria | 2903492973 | 2903499845 | 242 |
| 1423 | iso_pu_bacteria | 2903540706 | 2903544966 | 242 |
| 1424 | iso_pu_bacteria | 2904659560 | 2904665734 | 242 |
| 1425 | iso_pu_bacteria | 2906308376 | 2906308847 | 242 |
| 1426 | iso_pu_bacteria | 2906321335 | 2906322127 | 242 |
| 1427 | iso_pu_bacteria | 2906328253 | 2906333913 | 242 |
| 1428 | iso_pu_bacteria | 2906354277 | 2906361652 | 242 |
| 1429 | iso_pu_bacteria | 2906363423 | 2906367995 | 242 |
| 1430 | iso_pu_bacteria | 2906370794 | 2906372021 | 242 |
| 1431 | iso_pu_bacteria | 2906378014 | 2906382867 | 242 |
| 1432 | iso_pu_bacteria | 2906386501 | 2906388974 | 242 |
| 1433 | iso_pu_bacteria | 2906393657 | 2906398064 | 242 |
| 1434 | iso_pu_bacteria | 2906401398 | 2906408086 | 242 |
| 1435 | iso_pu_bacteria | 2906408224 | 2906410586 | 242 |
| 1436 | iso_pu_bacteria | 2906427513 | 2906433935 | 242 |
| 1437 | iso_pu_bacteria | 2922130491 | 2922135534 | 242 |
| 1438 | iso_pu_bacteria | 2922151315 | 2922152911 | 242 |
| 1439 | iso_pu_bacteria | 2922158528 | 2922165400 | 242 |
| 1440 | iso_pu_bacteria | 2922172374 | 2922176070 | 242 |
| 1441 | iso_pu_bacteria | 2922185730 | 2922193522 | 242 |
| 1442 | iso_pu_bacteria | 2924710171 | 2924711486 | 242 |
| 1443 | iso_pu_bacteria | 2924726620 | 2924727673 | 242 |
| 1444 | iso_pu_bacteria | 2924733363 | 2924737292 | 242 |
| 1445 | iso_pu_bacteria | 2924741084 | 2924747609 | 242 |
| 1446 | iso_pu_bacteria | 2924748358 | 2924754460 | 242 |
| 1447 | iso_pu_bacteria | 2924754689 | 2924758106 | 242 |
| 1448 | iso_pu_bacteria | 2924762789 | 2924768605 | 242 |
| 1449 | iso_pu_bacteria | 2924784321 | 2924790907 | 242 |
| 1450 | iso_pu_bacteria | 2937813078 | 2937822186 | 242 |
| 1451 | iso_pu_bacteria | 2937822353 | 2937823877 | 242 |
| 1452 | iso_pu_bacteria | 2937836603 | 2937839277 | 242 |
| 1453 | iso_pu_bacteria | 2937861824 | 2937862104 | 242 |
| 1454 | iso_pu_bacteria | 2937868953 | 2937873469 | 242 |
| 1455 | iso_pu_bacteria | 2937891427 | 2937894380 | 242 |
| 1456 | iso_pu_bacteria | 2937980651 | 2937983200 | 242 |
| 1457 | iso_pu_bacteria | 2937994558 | 2937998811 | 242 |
| 1458 | iso_pu_bacteria | 2938014810 | 2938015722 | 242 |
| 1459 | iso_pu_bacteria | 2958041894 | 2958054601 | 242 |
| 1460 | iso_pu_bacteria | 2958071322 | 2958072447 | 242 |
| 1461 | iso_pu_bacteria | 2958100919 | 2958104724 | 242 |
| 1462 | iso_pu_bacteria | 2958108152 | 2958115094 | 242 |
| 1463 | iso_pu_bacteria | 2958115193 | 2958120399 | 242 |
| 1464 | iso_pu_bacteria | 2958122699 | 2958130220 | 242 |
| 1465 | iso_pu_bacteria | 2958130278 | 2958130680 | 242 |
| 1466 | iso_pu_bacteria | 2958137437 | 2958140827 | 242 |
| 1467 | iso_pu_bacteria | 2958158011 | 2958161107 | 242 |
| 1468 | iso_pu_bacteria | 2958165035 | 2958169286 | 242 |
| 1469 | iso_pu_bacteria | 2958172287 | 2958176728 | 242 |
| 1470 | iso_pu_bacteria | 2958179912 | 2958180019 | 242 |
| 1471 | iso_pu_bacteria | 2961077736 | 2961077846 | 242 |
| 1472 | iso_pu_bacteria | 2961114664 | 2961121077 | 242 |
| 1473 | iso_pu_bacteria | 2961127735 | 2961128628 | 242 |
| 1474 | iso_pu_bacteria | 2961136820 | 2961141959 | 242 |
| 1475 | iso_pu_bacteria | 2961163497 | 2961167748 | 242 |
| 1476 | iso_pu_bacteria | 2961170736 | 2961177373 | 242 |
| 1477 | iso_pu_bacteria | 2961183825 | 2961185080 | 242 |
| 1478 | iso_pu_bacteria | 2965018300 | 2965022567 | 242 |
| 1479 | iso_pu_bacteria | 2965025482 | 2965026686 | 242 |
| 1480 | iso_pu_bacteria | 2965032056 | 2965034383 | 242 |
| 1481 | iso_pu_bacteria | 2965040258 | 2965043504 | 242 |
| 1482 | iso_pu_bacteria | 2965047637 | 2965049513 | 242 |
| 1483 | iso_pu_bacteria | 2965062239 | 2965065074 | 242 |
| 1484 | iso_pu_bacteria | 2965089291 | 2965092347 | 242 |
| 1485 | iso_pu_bacteria | 2965102966 | 2965108443 | 242 |
| 1486 | iso_pu_bacteria | 2965110997 | 2965117589 | 242 |
| 1487 | iso_pu_bacteria | 2965119406 | 2965127384 | 242 |
| 1488 | iso_pu_bacteria | 2967996073 | 2968002478 | 242 |
| 1489 | iso_pu_bacteria | 2968003550 | 2968009709 | 242 |
| 1490 | iso_pu_bacteria | 2968091066 | 2968093510 | 242 |
| 1491 | iso_pu_bacteria | 2968097103 | 2968100228 | 242 |
| 1492 | iso_pu_bacteria | 2968110612 | 2968117227 | 242 |
| 1493 | iso_pu_bacteria | 2968117919 | 2968122366 | 242 |
| 1494 | iso_pu_bacteria | 2968128360 | 2968129633 | 242 |
| 1495 | iso_pu_bacteria | 2968138860 | 2968142978 | 242 |
| 1496 | iso_pu_bacteria | 2968171901 | 2968176149 | 242 |
| 1497 | iso_pu_bacteria | 2970489779 | 2970493798 | 242 |
| 1498 | iso_pu_bacteria | 2970503327 | 2970510047 | 242 |
| 1499 | iso_pu_bacteria | 2970510686 | 2970517191 | 242 |
| 1500 | iso_pu_bacteria | 2970540015 | 2970544597 | 242 |
| 1501 | iso_pu_bacteria | 2970547951 | 2970550781 | 242 |
| 1502 | iso_pu_bacteria | 2970554993 | 2970559117 | 242 |
| 1503 | iso_pu_bacteria | 2970619444 | 2970625155 | 242 |
| 1504 | iso_pu_bacteria | 2970627176 | 2970629748 | 242 |
| 1505 | iso_pu_bacteria | 2977821940 | 2977828625 | 242 |
| 1506 | iso_pu_bacteria | 2977828996 | 2977834125 | 242 |
| 1507 | iso_pu_bacteria | 2977843712 | 2977844317 | 242 |
| 1508 | iso_pu_bacteria | 2977851361 | 2977854338 | 242 |
| 1509 | iso_pu_bacteria | 2977858184 | 2977862079 | 242 |
| 1510 | iso_pu_bacteria | 2977864932 | 2977865661 | 242 |
| 1511 | iso_pu_bacteria | 2977898635 | 2977902808 | 242 |
| 1512 | iso_pu_bacteria | 2977907340 | 2977909726 | 242 |
| 1513 | iso_pu_bacteria | 2977915119 | 2977921995 | 242 |
| 1514 | iso_pu_bacteria | 2977942078 | 2977942440 | 242 |
| 1515 | iso_pu_bacteria | 2977950692 | 2977957707 | 242 |
| 1516 | iso_pu_bacteria | 2977957713 | 2977964932 | 242 |
| 1517 | iso_pu_bacteria | 2979710463 | 2979714872 | 242 |
| 1518 | iso_pu_bacteria | 2979764755 | 2979767615 | 242 |
| 1519 | iso_pu_bacteria | 2979772303 | 2979774672 | 242 |
| 1520 | iso_pu_bacteria | 2979779861 | 2979784490 | 242 |
| 1521 | iso_pu_bacteria | 2979808191 | 2979814923 | 242 |
| 1522 | iso_pu_bacteria | 2987636660 | 2987641820 | 242 |
| 1523 | iso_pu_bacteria | 2987645492 | 2987651742 | 242 |
| 1524 | iso_pu_bacteria | 2987652177 | 2987657890 | 242 |
| 1525 | iso_pu_bacteria | 2987659509 | 2987663755 | 242 |
| 1526 | iso_pu_bacteria | 2987666974 | 2987673334 | 242 |
| 1527 | iso_pu_bacteria | 2987673487 | 2987678448 | 242 |
| 1528 | iso_pu_bacteria | 2996341866 | 2996343519 | 242 |
| 1529 | iso_pu_bacteria | 2996386984 | 2996389154 | 242 |
| 1530 | iso_pu_bacteria | 3004167301 | 3004173606 | 242 |
| 1531 | iso_pu_bacteria | 3004188549 | 3004192812 | 242 |
| 1532 | iso_pu_bacteria | 3004203850 | 3004209368 | 242 |
| 1533 | iso_pu_bacteria | 3004232784 | 3004236502 | 242 |
| 1534 | iso_pu_bacteria | 3004248173 | 3004252157 | 242 |
| 1535 | iso_pu_bacteria | 3004268573 | 3004269435 | 242 |
| 1536 | iso_pu_bacteria | 649633066 | 649870833 | 242 |
| 1537 | iso_pu_bacteria | 8001845381 | 8001847438 | 242 |
| 1538 | iso_pu_bacteria | 8004300914 | 8004304232 | 242 |
| 1539 | iso_pu_bacteria | 8004312739 | 8004316412 | 242 |
| 1540 | iso_pu_bacteria | 8004361976 | 8004366109 | 242 |
| 1541 | iso_pu_bacteria | 8004374579 | 8004381602 | 242 |
| 1542 | iso_pu_bacteria | 8004387939 | 8004388693 | 242 |
| 1543 | iso_pu_bacteria | 8004395343 | 8004401087 | 242 |
| 1544 | iso_pu_bacteria | 8004445564 | 8004448263 | 242 |
| 1545 | iso_pu_bacteria | 8004633249 | 8004633360 | 242 |
| 1546 | iso_pu_bacteria | 8004640170 | 8004646533 | 242 |
| 1547 | iso_pu_bacteria | 8004703790 | 8004706444 | 242 |
| 1548 | iso_pu_bacteria | 8004714634 | 8004715103 | 242 |
| 1549 | iso_pu_bacteria | 8004727605 | 8004733210 | 242 |
| 1550 | iso_pu_bacteria | 8055617313 | 8055618207 | 242 |
| 1551 | 3300005262 | Ga0065165_1003519 | Ga0065165_10035197 | 243 |
| 1552 | 3300005331 | Ga0070670_100000116 | Ga0070670_10000011611 | 243 |
| 1553 | 3300006353 | Ga0075370_10076142 | Ga0075370_100761421 | 243 |
| 1554 | 3300013104 | Ga0157370_10062213 | Ga0157370_100622132 | 243 |
| 1555 | 3300013105 | Ga0157369_10028357 | Ga0157369_100283572 | 243 |
| 1556 | 3300025295 | Ga0209564_1031739 | Ga0209564_10317392 | 243 |
| 1557 | 3300025299 | Ga0209256_1002945 | Ga0209256_10029459 | 243 |
| 1558 | 3300025925 | Ga0207650_10000691 | Ga0207650_1000069126 | 243 |
| 1559 | 3300031548 | Ga0307408_100492954 | Ga0307408_1004929541 | 243 |
| 1560 | 3300031731 | Ga0307405_10234530 | Ga0307405_102345302 | 243 |
| 1561 | 3300031852 | Ga0307410_10178930 | Ga0307410_101789303 | 243 |
| 1562 | 3300031995 | Ga0307409_100045667 | Ga0307409_1000456674 | 243 |
| 1563 | 3300041404 | Ga0439436_0012216 | Ga0439436_0012216_265_1008 | 243 |
| 1564 | 3300041405 | Ga0439438_009534 | Ga0439438_009534_1527_2270 | 243 |
| 1565 | 3300041406 | Ga0439439_0047919 | Ga0439439_0047919_77_820 | 243 |
| 1566 | 3300041407 | Ga0439447_065989 | Ga0439447_065989_48_791 | 243 |
| 1567 | 3300042002 | Ga0439442_018773 | Ga0439442_018773_487_1230 | 243 |
| 1568 | 3300042007 | Ga0439449_0122416 | Ga0439449_0122416_25_768 | 243 |
| 1569 | 3300042122 | Ga0450920_003459 | Ga0450920_003459_1912_2655 | 243 |
| 1570 | 3300042531 | Ga0450918_005441 | Ga0450918_005441_1019_1762 | 243 |
| 1571 | 3300049571 | Ga0501034_0232959 | Ga0501034_0232959_255_1034 | 243 |
| 1572 | 3300050496 | nmdc:mga07m45_246996_c1 | nmdc:mga07m45_246996_c1_185_928 | 243 |
| 1573 | 3300053125 | Ga0500618_001280 | Ga0500618_001280_3251_3997 | 243 |
| 1574 | 3300053156 | Ga0500622_0000343 | Ga0500622_0000343_9425_10171 | 243 |
| 1575 | 3300005548 | Ga0070665_100021286 | Ga0070665_1000212867 | 244 |
| 1576 | 3300028379 | Ga0268266_10015172 | Ga0268266_100151722 | 244 |
| 1577 | 3300048922 | Ga0496119_0000147 | Ga0496119_0000147_28212_28994 | 244 |
| 1578 | 3300048926 | Ga0496123_0002376 | Ga0496123_0002376_22781_23563 | 244 |
| 1579 | 3300053104 | Ga0500556_0000142 | Ga0500556_0000142_43811_44593 | 244 |
| 1580 | 3300002705 | JGI25156J39149_1009778 | JGI25156J39149_10097782 | 245 |
| 1581 | 3300002741 | JGI25157J39369_1001314 | JGI25157J39369_10013147 | 245 |
| 1582 | 3300003763 | Ga0055529_1004728 | Ga0055529_10047283 | 245 |
| 1583 | 3300005614 | Ga0068856_100444889 | Ga0068856_1004448892 | 245 |
| 1584 | 3300006178 | Ga0075367_10045738 | Ga0075367_100457382 | 245 |
| 1585 | 3300006353 | Ga0075370_10079900 | Ga0075370_100799002 | 245 |
| 1586 | 3300009093 | Ga0105240_10250829 | Ga0105240_102508291 | 245 |
| 1587 | 3300009148 | Ga0105243_10595485 | Ga0105243_105954852 | 245 |
| 1588 | 3300009174 | Ga0105241_10849041 | Ga0105241_108490411 | 245 |
| 1589 | 3300009551 | Ga0105238_10344342 | Ga0105238_103443421 | 245 |
| 1590 | 3300010375 | Ga0105239_10246399 | Ga0105239_102463991 | 245 |
| 1591 | 3300013102 | Ga0157371_10018609 | Ga0157371_100186092 | 245 |
| 1592 | 3300013105 | Ga0157369_10126588 | Ga0157369_101265881 | 245 |
| 1593 | 3300013105 | Ga0157369_10172253 | Ga0157369_101722532 | 245 |
| 1594 | 3300013306 | Ga0163162_10117870 | Ga0163162_101178703 | 245 |
| 1595 | 3300013306 | Ga0163162_10442404 | Ga0163162_104424042 | 245 |
| 1596 | 3300014325 | Ga0163163_10261064 | Ga0163163_102610642 | 245 |
| 1597 | 3300014497 | Ga0182008_10119652 | Ga0182008_101196521 | 245 |
| 1598 | 3300014969 | Ga0157376_10226366 | Ga0157376_102263662 | 245 |
| 1599 | 3300015261 | Ga0182006_1048187 | Ga0182006_10481871 | 245 |
| 1600 | 3300020070 | Ga0206356_10905856 | Ga0206356_109058561 | 245 |
| 1601 | 3300020076 | Ga0206355_1532750 | Ga0206355_15327501 | 245 |
| 1602 | 3300020077 | Ga0206351_10295174 | Ga0206351_102951741 | 245 |
| 1603 | 3300020080 | Ga0206350_10165189 | Ga0206350_101651891 | 245 |
| 1604 | 3300020610 | Ga0154015_1345373 | Ga0154015_13453731 | 245 |
| 1605 | 3300025250 | Ga0209026_1000032 | Ga0209026_100003269 | 245 |
| 1606 | 3300025254 | Ga0209148_1000111 | Ga0209148_1000111179 | 245 |
| 1607 | 3300025256 | Ga0209759_1000142 | Ga0209759_1000142128 | 245 |
| 1608 | 3300025272 | Ga0209455_1000223 | Ga0209455_100022372 | 245 |
| 1609 | 3300025904 | Ga0207647_10101029 | Ga0207647_101010292 | 245 |
| 1610 | 3300025909 | Ga0207705_10471583 | Ga0207705_104715831 | 245 |
| 1611 | 3300025911 | Ga0207654_10039900 | Ga0207654_100399002 | 245 |
| 1612 | 3300025913 | Ga0207695_10191320 | Ga0207695_101913201 | 245 |
| 1613 | 3300025914 | Ga0207671_10060555 | Ga0207671_100605552 | 245 |
| 1614 | 3300025919 | Ga0207657_10074718 | Ga0207657_100747182 | 245 |
| 1615 | 3300025920 | Ga0207649_10231881 | Ga0207649_102318811 | 245 |
| 1616 | 3300025924 | Ga0207694_10484140 | Ga0207694_104841401 | 245 |
| 1617 | 3300025972 | Ga0207668_10488147 | Ga0207668_104881471 | 245 |
| 1618 | 3300026067 | Ga0207678_10120431 | Ga0207678_101204311 | 245 |
| 1619 | 3300028379 | Ga0268266_10233666 | Ga0268266_102336662 | 245 |
| 1620 | 3300037418 | Ga0395900_0028708 | Ga0395900_0028708_2588_3358 | 245 |
| 1621 | 3300038443 | Ga0395901_0223550 | Ga0395901_0223550_772_1542 | 245 |
| 1622 | 3300041413 | Ga0439465_0009497 | Ga0439465_0009497_918_1700 | 245 |
| 1623 | 3300048918 | Ga0496115_0194736 | Ga0496115_0194736_573_1346 | 245 |
| 1624 | 3300048919 | Ga0496116_0000057 | Ga0496116_0000057_240902_241684 | 245 |
| 1625 | 3300048919 | Ga0496116_0081392 | Ga0496116_0081392_149_931 | 245 |
| 1626 | 3300048920 | Ga0496117_0010058 | Ga0496117_0010058_5574_6356 | 245 |
| 1627 | 3300048921 | Ga0496118_0030421 | Ga0496118_0030421_2972_3754 | 245 |
| 1628 | 3300048922 | Ga0496119_0023944 | Ga0496119_0023944_2725_3507 | 245 |
| 1629 | 3300048922 | Ga0496119_0148981 | Ga0496119_0148981_302_1075 | 245 |
| 1630 | 3300048923 | Ga0496120_0045241 | Ga0496120_0045241_1291_2064 | 245 |
| 1631 | 3300048924 | Ga0496121_0000034 | Ga0496121_0000034_239030_239812 | 245 |
| 1632 | 3300048924 | Ga0496121_0178584 | Ga0496121_0178584_503_1276 | 245 |
| 1633 | 3300048927 | Ga0496124_0005858 | Ga0496124_0005858_5313_6095 | 245 |
| 1634 | 3300048927 | Ga0496124_0153424 | Ga0496124_0153424_668_1441 | 245 |
| 1635 | 3300048927 | Ga0496124_0222685 | Ga0496124_0222685_566_1348 | 245 |
| 1636 | 3300048928 | Ga0496125_0000030 | Ga0496125_0000030_134707_135489 | 245 |
| 1637 | 3300048928 | Ga0496125_0189741 | Ga0496125_0189741_61_834 | 245 |
| 1638 | 3300048929 | Ga0496126_0005711 | Ga0496126_0005711_5660_6442 | 245 |
| 1639 | 3300048929 | Ga0496126_0094014 | Ga0496126_0094014_773_1555 | 245 |
| 1640 | 3300048929 | Ga0496126_0214460 | Ga0496126_0214460_802_1584 | 245 |
| 1641 | 3300048929 | Ga0496126_0223749 | Ga0496126_0223749_36_809 | 245 |
| 1642 | 3300049569 | Ga0501032_0000006 | Ga0501032_0000006_25692_26468 | 245 |
| 1643 | 3300049569 | Ga0501032_0046093 | Ga0501032_0046093_209_985 | 245 |
| 1644 | 3300049570 | Ga0501033_0000053 | Ga0501033_0000053_38743_39519 | 245 |
| 1645 | 3300049571 | Ga0501034_0000030 | Ga0501034_0000030_208662_209438 | 245 |
| 1646 | 3300049571 | Ga0501034_0042799 | Ga0501034_0042799_2391_3167 | 245 |
| 1647 | 3300049572 | Ga0501036_0000003 | Ga0501036_0000003_235260_236036 | 245 |
| 1648 | 3300049572 | Ga0501036_0156857 | Ga0501036_0156857_965_1741 | 245 |
| 1649 | 3300049573 | Ga0501037_0000003 | Ga0501037_0000003_235260_236036 | 245 |
| 1650 | 3300049573 | Ga0501037_0150970 | Ga0501037_0150970_620_1396 | 245 |
| 1651 | 3300049574 | Ga0501038_0000004 | Ga0501038_0000004_235260_236036 | 245 |
| 1652 | 3300049574 | Ga0501038_0075791 | Ga0501038_0075791_1418_2194 | 245 |
| 1653 | 3300049574 | Ga0501038_0155929 | Ga0501038_0155929_41_784 | 245 |
| 1654 | 3300049575 | Ga0501039_0000008 | Ga0501039_0000008_235260_236036 | 245 |
| 1655 | 3300049576 | Ga0501040_0104897 | Ga0501040_0104897_253_1029 | 245 |
| 1656 | 3300049579 | Ga0501043_0000365 | Ga0501043_0000365_24525_25301 | 245 |
| 1657 | 3300049580 | Ga0501046_0018481 | Ga0501046_0018481_4462_5238 | 245 |
| 1658 | 3300049581 | Ga0501047_0001197 | Ga0501047_0001197_11466_12242 | 245 |
| 1659 | 3300049582 | Ga0501048_0008179 | Ga0501048_0008179_2411_3187 | 245 |
| 1660 | 3300049584 | Ga0501068_0015949 | Ga0501068_0015949_2716_3492 | 245 |
| 1661 | 3300049586 | Ga0501070_0086535 | Ga0501070_0086535_302_1078 | 245 |
| 1662 | 3300049586 | Ga0501070_0181061 | Ga0501070_0181061_813_1589 | 245 |
| 1663 | 3300049590 | Ga0501074_0453288 | Ga0501074_0453288_122_898 | 245 |
| 1664 | 3300049742 | Ga0501080_0033256 | Ga0501080_0033256_2089_2865 | 245 |
| 1665 | 3300049822 | Ga0501035_0000031 | Ga0501035_0000031_136073_136849 | 245 |
| 1666 | 3300049822 | Ga0501035_0034682 | Ga0501035_0034682_1418_2194 | 245 |
| 1667 | 3300049822 | Ga0501035_0346898 | Ga0501035_0346898_53_796 | 245 |
| 1668 | 3300049823 | Ga0501044_0000008 | Ga0501044_0000008_235260_236036 | 245 |
| 1669 | 3300049823 | Ga0501044_0056269 | Ga0501044_0056269_404_1147 | 245 |
| 1670 | 3300049823 | Ga0501044_0086497 | Ga0501044_0086497_1418_2194 | 245 |
| 1671 | 3300049824 | Ga0501045_0069019 | Ga0501045_0069019_619_1395 | 245 |
| 1672 | 3300050491 | nmdc:mga00v17_172266_c1 | nmdc:mga00v17_172266_c1_522_1304 | 245 |
| 1673 | 3300050491 | nmdc:mga00v17_20304_c1 | nmdc:mga00v17_20304_c1_2632_3411 | 245 |
| 1674 | 3300050492 | nmdc:mga0yw44_20329_c1 | nmdc:mga0yw44_20329_c1_1937_2710 | 245 |
| 1675 | 3300050492 | nmdc:mga0yw44_273955_c1 | nmdc:mga0yw44_273955_c1_248_1021 | 245 |
| 1676 | 3300050492 | nmdc:mga0yw44_398542_c1 | nmdc:mga0yw44_398542_c1_106_885 | 245 |
| 1677 | 3300053153 | Ga0500616_0003388 | Ga0500616_0003388_3471_4253 | 245 |
| 1678 | 3300053158 | Ga0500627_0075957 | Ga0500627_0075957_572_1354 | 245 |
| 1679 | 3300053177 | Ga0500636_0002588 | Ga0500636_0002588_1639_2421 | 245 |
| 1680 | 3300059508 | Ga0587088_038458 | Ga0587088_038458_80_817 | 245 |
| 1681 | 3300059604 | Ga0587098_010749 | Ga0587098_010749_172_945 | 245 |
| 1682 | iso_pu_bacteria | 2738543024 | 2739306008 | 245 |
| 1683 | 3300001979 | JGI24740J21852_10038081 | JGI24740J21852_100380811 | 246 |
| 1684 | 3300001989 | JGI24739J22299_10055633 | JGI24739J22299_100556332 | 246 |
| 1685 | 3300002067 | JGI24735J21928_10035258 | JGI24735J21928_100352581 | 246 |
| 1686 | 3300005563 | Ga0068855_100305394 | Ga0068855_1003053942 | 246 |
| 1687 | 3300005577 | Ga0068857_100181861 | Ga0068857_1001818612 | 246 |
| 1688 | 3300005616 | Ga0068852_100491483 | Ga0068852_1004914832 | 246 |
| 1689 | 3300006038 | Ga0075365_10089590 | Ga0075365_100895903 | 246 |
| 1690 | 3300006042 | Ga0075368_10030823 | Ga0075368_100308232 | 246 |
| 1691 | 3300006051 | Ga0075364_10146058 | Ga0075364_101460582 | 246 |
| 1692 | 3300006051 | Ga0075364_10256754 | Ga0075364_102567541 | 246 |
| 1693 | 3300006177 | Ga0075362_10117247 | Ga0075362_101172472 | 246 |
| 1694 | 3300006178 | Ga0075367_10029691 | Ga0075367_100296912 | 246 |
| 1695 | 3300006178 | Ga0075367_10169485 | Ga0075367_101694852 | 246 |
| 1696 | 3300006195 | Ga0075366_10085787 | Ga0075366_100857871 | 246 |
| 1697 | 3300006195 | Ga0075366_10233095 | Ga0075366_102330952 | 246 |
| 1698 | 3300006881 | Ga0068865_100269196 | Ga0068865_1002691962 | 246 |
| 1699 | 3300009101 | Ga0105247_10075884 | Ga0105247_100758842 | 246 |
| 1700 | 3300009148 | Ga0105243_10213017 | Ga0105243_102130171 | 246 |
| 1701 | 3300009545 | Ga0105237_10140495 | Ga0105237_101404953 | 246 |
| 1702 | 3300009551 | Ga0105238_10009792 | Ga0105238_100097926 | 246 |
| 1703 | 3300010375 | Ga0105239_10386213 | Ga0105239_103862131 | 246 |
| 1704 | 3300013297 | Ga0157378_10243186 | Ga0157378_102431862 | 246 |
| 1705 | 3300013307 | Ga0157372_10759888 | Ga0157372_107598881 | 246 |
| 1706 | 3300025261 | Ga0209233_1000118 | Ga0209233_100011877 | 246 |
| 1707 | 3300025297 | Ga0209758_1009917 | Ga0209758_10099172 | 246 |
| 1708 | 3300025900 | Ga0207710_10283127 | Ga0207710_102831271 | 246 |
| 1709 | 3300025904 | Ga0207647_10008981 | Ga0207647_100089817 | 246 |
| 1710 | 3300025935 | Ga0207709_10378626 | Ga0207709_103786261 | 246 |
| 1711 | 3300025938 | Ga0207704_10301885 | Ga0207704_103018851 | 246 |
| 1712 | 3300025949 | Ga0207667_10668146 | Ga0207667_106681462 | 246 |
| 1713 | 3300026041 | Ga0207639_10697687 | Ga0207639_106976871 | 246 |
| 1714 | 3300026067 | Ga0207678_10418061 | Ga0207678_104180612 | 246 |
| 1715 | 3300026078 | Ga0207702_10850325 | Ga0207702_108503251 | 246 |
| 1716 | 3300026089 | Ga0207648_10045791 | Ga0207648_100457914 | 246 |
| 1717 | 3300026116 | Ga0207674_10096921 | Ga0207674_100969213 | 246 |
| 1718 | 3300027866 | Ga0209813_10021294 | Ga0209813_100212941 | 246 |
| 1719 | 3300028794 | Ga0307515_10290965 | Ga0307515_102909651 | 246 |
| 1720 | 3300037418 | Ga0395900_0000056 | Ga0395900_0000056_202389_203168 | 246 |
| 1721 | 3300037418 | Ga0395900_0084320 | Ga0395900_0084320_1857_2597 | 246 |
| 1722 | 3300037466 | Ga0395898_0000114 | Ga0395898_0000114_202380_203159 | 246 |
| 1723 | 3300037471 | Ga0395905_0000053 | Ga0395905_0000053_9910_10689 | 246 |
| 1724 | 3300038443 | Ga0395901_0000037 | Ga0395901_0000037_202389_203168 | 246 |
| 1725 | 3300038443 | Ga0395901_0277792 | Ga0395901_0277792_726_1466 | 246 |
| 1726 | 3300044658 | Ga0466972_0037303 | Ga0466972_0037303_994_1734 | 246 |
| 1727 | 3300044658 | Ga0466972_0124009 | Ga0466972_0124009_15_755 | 246 |
| 1728 | 3300044901 | Ga0466960_0023442 | Ga0466960_0023442_1845_2585 | 246 |
| 1729 | 3300046519 | Ga0495632_0126415 | Ga0495632_0126415_201_941 | 246 |
| 1730 | 3300046542 | Ga0495597_0021206 | Ga0495597_0021206_1793_2533 | 246 |
| 1731 | 3300046660 | Ga0495625_0011675 | Ga0495625_0011675_2673_3413 | 246 |
| 1732 | 3300048091 | Ga0495626_0031946 | Ga0495626_0031946_124_864 | 246 |
| 1733 | 3300048905 | Ga0496102_0462299 | Ga0496102_0462299_21_761 | 246 |
| 1734 | 3300048918 | Ga0496115_0180530 | Ga0496115_0180530_684_1424 | 246 |
| 1735 | 3300048928 | Ga0496125_0126996 | Ga0496125_0126996_724_1464 | 246 |
| 1736 | 3300049570 | Ga0501033_0000477 | Ga0501033_0000477_30077_30859 | 246 |
| 1737 | 3300049571 | Ga0501034_0000023 | Ga0501034_0000023_189721_190503 | 246 |
| 1738 | 3300049572 | Ga0501036_0002249 | Ga0501036_0002249_7142_7924 | 246 |
| 1739 | 3300049573 | Ga0501037_0000269 | Ga0501037_0000269_4588_5370 | 246 |
| 1740 | 3300049574 | Ga0501038_0000040 | Ga0501038_0000040_73390_74172 | 246 |
| 1741 | 3300049575 | Ga0501039_0000089 | Ga0501039_0000089_60326_61108 | 246 |
| 1742 | 3300049579 | Ga0501043_0000019 | Ga0501043_0000019_91349_92131 | 246 |
| 1743 | 3300049580 | Ga0501046_0034838 | Ga0501046_0034838_384_1166 | 246 |
| 1744 | 3300049583 | Ga0501067_0081299 | Ga0501067_0081299_933_1712 | 246 |
| 1745 | 3300049822 | Ga0501035_0000434 | Ga0501035_0000434_7012_7794 | 246 |
| 1746 | 3300049823 | Ga0501044_0017484 | Ga0501044_0017484_2077_2859 | 246 |
| 1747 | 3300049823 | Ga0501044_0347256 | Ga0501044_0347256_479_1258 | 246 |
| 1748 | 3300050489 | nmdc:mga03683_90896_c1 | nmdc:mga03683_90896_c1_249_1028 | 246 |
| 1749 | 3300050491 | nmdc:mga00v17_240018_c1 | nmdc:mga00v17_240018_c1_420_1160 | 246 |
| 1750 | 3300050492 | nmdc:mga0yw44_109607_c1 | nmdc:mga0yw44_109607_c1_700_1479 | 246 |
| 1751 | 3300050493 | nmdc:mga0k408_253397_c1 | nmdc:mga0k408_253397_c1_79_819 | 246 |
| 1752 | 3300050494 | nmdc:mga06z11_275005_c1 | nmdc:mga06z11_275005_c1_146_886 | 246 |
| 1753 | 3300050494 | nmdc:mga06z11_53830_c1 | nmdc:mga06z11_53830_c1_124_903 | 246 |
| 1754 | 3300050495 | nmdc:mga04h51_12766_c1 | nmdc:mga04h51_12766_c1_108_848 | 246 |
| 1755 | 3300050516 | nmdc:mga0sz30_33980_c1 | nmdc:mga0sz30_33980_c1_834_1613 | 246 |
| 1756 | 3300053079 | Ga0500610_0017821 | Ga0500610_0017821_319_1059 | 246 |
| 1757 | 3300053158 | Ga0500627_0127987 | Ga0500627_0127987_171_911 | 246 |
| 1758 | 3300059505 | Ga0587083_0062428 | Ga0587083_0062428_25_765 | 246 |
| 1759 | 3300059513 | Ga0587094_028773 | Ga0587094_028773_24_767 | 246 |
| 1760 | 3300059513 | Ga0587094_029811 | Ga0587094_029811_17_760 | 246 |
| 1761 | 3300059608 | Ga0587129_004592 | Ga0587129_004592_110_850 | 246 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4pgw-assembly1.cif.gz_A | crystal structure of yetj from bacillus subtilis at ph 6 by pt-sad | 0.6681 | 27 | 242 |
| 6nq8-assembly2.cif.gz_B | crystal structure of yetj mutant from bacillus subtilis - d171e | 0.6659 | 27 | 242 |
| 4pgw-assembly1.cif.gz_A | crystal structure of yetj from bacillus subtilis at ph 6 by pt-sad | 0.6532 | 27 | 242 |
| 6nq9-assembly3.cif.gz_C | crystal structure of yetj mutant from bacillus subtilis - d195e | 0.65 | 27 | 244 |
| 6nq8-assembly2.cif.gz_B | crystal structure of yetj mutant from bacillus subtilis - d171e | 0.6454 | 27 | 242 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AAC4_18_230_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.758 | 27 | 240 | 1.20.1250.20 |
| af_P0AAC4_18_230_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.7418 | 27 | 240 | 1.20.1250.20 |
| af_B6TIY8_53_257_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.7038 | 26 | 241 | 1.20.1250.20 |
| af_Q4DZH5_101_300_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.6978 | 26 | 240 | 1.20.1250.20 |
| af_B6TIY8_53_257_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.6945 | 26 | 241 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3YGB9-F1-model_v4 | Bax inhibitor-1/YccA family protein | 0.9613 | 18 | 143 |
GO:0016020
|
| AF-A0A357LPT4-F1-model_v4 | BAX inhibitor (BI)-1/YccA family protein | 0.9102 | 15 | 118 |
GO:0016020
|
| AF-A0A530L932-F1-model_v4 | Bax inhibitor-1/YccA family protein | 0.9024 | 13 | 158 |
GO:0016020
|
| AF-A0A259AWH8-F1-model_v4 | BAX inhibitor (BI)-1/YccA family protein | 0.864 | 1 | 133 |
GO:0016020
|
| AF-A0A529Q9T2-F1-model_v4 | Bax inhibitor-1/YccA family protein | 0.8539 | 19 | 173 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar