F495613

General Info

Members Datasets Scaffolds Average Seq Length
1761 1273 928 246

Family's Representative Sequence

Representative Sequence 3300012513|Ga0157326_1003319|Ga0157326_10033193
Length 241
Sequence MADLRNYQSRAQTGEMIDQGLRAYMLKVYNLMALGLAITGVAAYLGFNFAVQDGQLTQFGVLLFQSPLRWVVILAPLAAVFFLSFRINSMSVAAAQTTFWVYAGLVGLSLSSIFLVYTGQSVVQTFFVTAFFGALSLYGYTTKRDLSAMGSFLVMGLFGLIIASIVNVFLASSAMQFAISVIGVLIFAGLTAYDTQRIKELYLEADDVAVAGRKAIMGALTLYLDFINLFMFLLQFMGNRK

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
8 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
9 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
10 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
11 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
12 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
13 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
14 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
15 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
16 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
17 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
18 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
19 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
20 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
21 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
22 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
23 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
24 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
25 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
26 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
27 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
28 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
29 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
30 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
31 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
32 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
33 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
34 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
35 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
36 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
37 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
38 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
39 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
40 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
41 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
42 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
43 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
44 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
45 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
46 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
47 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
48 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
49 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
50 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
51 2516143018 Ensifer sp. BR816 Isolate Nodule
52 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
53 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
54 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
55 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
56 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
57 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
58 2519899620 Rhizobium sp. Pop5 Isolate Nodule
59 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
60 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
61 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
62 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
63 2534681786 Brucella suis 92/29 Isolate Unclassified
64 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
65 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
66 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
67 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
68 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
69 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
70 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
71 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
72 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
73 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
74 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
75 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
76 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
77 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
78 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
79 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
80 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
81 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
82 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
83 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
84 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
85 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
86 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
87 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
88 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
89 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
90 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
91 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
92 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
93 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
94 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
95 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
96 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
97 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
98 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
99 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
100 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
101 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
102 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
103 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
104 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
105 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
106 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
107 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
108 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
109 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
110 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
111 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
112 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
113 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
114 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
115 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
116 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
117 2643221557 Ensifer sp. Root558 Isolate Unclassified
118 2643221558 Rhizobium sp. Root149 Isolate Unclassified
119 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
120 2643221568 Rhizobium sp. Root564 Isolate Unclassified
121 2643221582 Rhizobium sp. Root651 Isolate Unclassified
122 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
123 2643221599 Rhizobium sp. Root708 Isolate Unclassified
124 2643221607 Rhizobium sp. Root73 Isolate Unclassified
125 2643221610 Ensifer sp. Root74 Isolate Unclassified
126 2643221618 Ensifer sp. Root231 Isolate Unclassified
127 2643221626 Ensifer sp. Root31 Isolate Unclassified
128 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
129 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
130 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
131 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
132 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
133 2643221655 Ensifer sp. Root1252 Isolate Unclassified
134 2643221659 Ensifer sp. Root127 Isolate Unclassified
135 2643221668 Ensifer sp. Root423 Isolate Unclassified
136 2643221674 Devosia sp. Root436 Isolate Unclassified
137 2643221675 Ensifer sp. Root1298 Isolate Unclassified
138 2643221680 Ensifer sp. Root1312 Isolate Unclassified
139 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
140 2643221688 Rhizobium sp. Root482 Isolate Unclassified
141 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
142 2643221693 Rhizobium sp. Root491 Isolate Unclassified
143 2643221698 Ensifer sp. Root142 Isolate Unclassified
144 2643221712 Ensifer sp. Root258 Isolate Unclassified
145 2643221718 Rhizobium sp. Root268 Isolate Unclassified
146 2643221723 Ensifer sp. Root278 Isolate Unclassified
147 2643221726 Ensifer sp. Root954 Isolate Unclassified
148 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
149 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
150 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
151 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
152 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
153 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
154 2718217882 Rhizobium sp. N741 Isolate Nodule
155 2718217927 Rhizobium sp. N324 Isolate Nodule
156 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
157 2718218009 Rhizobium sp. N561 Isolate Nodule
158 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
159 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
160 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
161 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
162 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
163 2718218363 Rhizobium sp. N113 Isolate Nodule
164 2718218365 Rhizobium sp. N731 Isolate Nodule
165 2718218366 Rhizobium sp. N621 Isolate Nodule
166 2718218423 Rhizobium sp. N941 Isolate Nodule
167 2721755514 Rhizobium sp. N6212 Isolate Nodule
168 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
169 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
170 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
171 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
172 2721755809 Rhizobium sp. N541 Isolate Nodule
173 2721755810 Rhizobium sp. N871 Isolate Nodule
174 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
175 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
176 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
177 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
178 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
179 2728369365 Rhizobium sp. N1341 Isolate Nodule
180 2728369397 Rhizobium sp. N1314 Isolate Nodule
181 2738541293 Rhizobium sp. GV031 Isolate Unclassified
182 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
183 2738543024 Aminobacter sp. AP02 Isolate Unclassified
184 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
185 2751185800 Brucella pituitosa AA2 Isolate Unclassified
186 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
187 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
188 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
189 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
190 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
191 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
192 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
193 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
194 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
195 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
196 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
197 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
198 2791355256 Rhizobium sp. M10 Isolate Nodule
199 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
200 2791355260 Rhizobium sp. L9 Isolate Nodule
201 2791355261 Rhizobium sp. J15 Isolate Nodule
202 2791355262 Rhizobium sp. M1 Isolate Nodule
203 2791355263 Rhizobium chutanense C5 Isolate Nodule
204 2791355264 Rhizobium sp. S9 Isolate Nodule
205 2791355265 Rhizobium sp. H4 Isolate Nodule
206 2791355266 Rhizobium sp. L43 Isolate Nodule
207 2791355267 Rhizobium sp. L18 Isolate Nodule
208 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
209 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
210 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
211 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
212 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
213 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
214 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
215 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
216 2802429633 Rhizobium anhuiense J3 Isolate Nodule
217 2802429634 Rhizobium anhuiense S10 Isolate Nodule
218 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
219 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
220 2802429637 Rhizobium anhuiense C15 Isolate Nodule
221 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
222 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
223 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
224 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
225 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
226 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
227 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
228 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
229 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
230 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
231 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
232 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
233 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
234 2838048938 Rhizobium pisi 27/80 Isolate Nodule
235 2838061910 Rhizobium phaseoli L15 Isolate Nodule
236 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
237 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
238 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
239 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
240 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
241 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
242 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
243 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
244 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
245 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
246 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
247 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
248 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
249 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
250 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
251 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
252 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
253 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
254 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
255 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
256 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
257 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
258 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
259 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
260 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
261 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
262 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
263 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
264 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
265 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
266 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
267 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
268 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
269 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
270 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
271 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
272 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
273 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
274 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
275 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
276 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
277 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
278 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
279 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
280 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
281 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
282 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
283 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
284 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
285 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
286 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
287 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
288 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
289 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
290 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
291 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
292 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
293 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
294 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
295 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
296 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
297 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
298 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
299 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
300 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
301 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
302 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
303 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
304 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
305 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
306 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
307 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
308 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
309 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
310 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
311 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
312 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
313 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
314 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
315 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
316 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
317 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
318 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
319 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
320 2844163670 Ensifer sp. 1H6 Isolate Unclassified
321 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
322 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
323 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
324 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
325 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
326 2854911287 Brucella lupini LUP21 Isolate Unclassified
327 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
328 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
329 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
330 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
331 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
332 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
333 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
334 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
335 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
336 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
337 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
338 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
339 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
340 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
341 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
342 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
343 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
344 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
345 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
346 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
347 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
348 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
349 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
350 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
351 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
352 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
353 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
354 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
355 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
356 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
357 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
358 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
359 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
360 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
361 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
362 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
363 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
364 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
365 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
366 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
367 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
368 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
369 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
370 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
371 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
372 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
373 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
374 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
375 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
376 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
377 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
378 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
379 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
380 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
381 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
382 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
383 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
384 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
385 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
386 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
387 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
388 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
389 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
390 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
391 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
392 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
393 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
394 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
395 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
396 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
397 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
398 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
399 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
400 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
401 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
402 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
403 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
404 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
405 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
406 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
407 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
408 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
409 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
410 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
411 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
412 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
413 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
414 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
415 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
416 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
417 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
418 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
419 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
420 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
421 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
422 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
423 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
424 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
425 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
426 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
427 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
428 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
429 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
430 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
431 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
432 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
433 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
434 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
435 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
436 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
437 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
438 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
439 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
440 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
441 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
442 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
443 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
444 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
445 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
446 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
447 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
448 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
449 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
450 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
451 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
452 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
453 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
454 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
455 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
456 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
457 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
458 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
459 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
460 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
461 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
462 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
463 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
464 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
465 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
466 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
467 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
468 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
469 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
470 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
471 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
472 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
473 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
474 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
475 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
476 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
477 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
478 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
479 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
480 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
481 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
482 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
483 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
484 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
485 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
486 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
487 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
488 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
489 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
490 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
491 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
492 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
493 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
494 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
495 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
496 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
497 2932401849 Devosia sp. 2618 Isolate Rhizosphere
498 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
499 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
500 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
501 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
502 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
503 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
504 2933599457 Rhizobium phaseoli M3 Isolate Nodule
505 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
506 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
507 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
508 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
509 2936381700 Rhizobium chutanense C16 Isolate Unclassified
510 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
511 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
512 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
513 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
514 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
515 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
516 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
517 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
518 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
519 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
520 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
521 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
522 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
523 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
524 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
525 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
526 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
527 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
528 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
529 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
530 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
531 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
532 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
533 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
534 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
535 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
536 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
537 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
538 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
539 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
540 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
541 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
542 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
543 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
544 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
545 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
546 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
547 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
548 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
549 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
550 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
551 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
552 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
553 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
554 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
555 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
556 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
557 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
558 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
559 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
560 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
561 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
562 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
563 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
564 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
565 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
566 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
567 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
568 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
569 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
570 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
571 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
572 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
573 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
574 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
575 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
576 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
577 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
578 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
579 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
580 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
581 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
582 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
583 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
584 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
585 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
586 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
587 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
588 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
589 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
590 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
591 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
592 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
593 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
594 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
595 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
596 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
597 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
598 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
599 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
600 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
601 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
602 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
603 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
604 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
605 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
606 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
607 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
608 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
609 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
610 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
611 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
612 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
613 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
614 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
615 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
616 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
617 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
618 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
619 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
620 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
621 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
622 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
623 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
624 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
625 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
626 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
627 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
628 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
629 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
630 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
631 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
632 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
633 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
634 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
635 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
636 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
637 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
638 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
639 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
640 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
641 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
642 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
643 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
644 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
645 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
646 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
647 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
648 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
649 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
650 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
651 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
652 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
653 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
654 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
655 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
656 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
657 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
658 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
659 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
660 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
661 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
662 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
663 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
664 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
665 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
666 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
667 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
668 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
669 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
670 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
671 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
672 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
673 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
674 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
675 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
676 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
677 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
678 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
679 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
680 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
681 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
682 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
683 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
684 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
685 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
686 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
687 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
688 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
689 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
690 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
691 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
692 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
693 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
694 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
695 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
696 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
697 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
698 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
699 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
700 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
701 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
702 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
703 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
704 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
705 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
706 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
707 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
708 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
709 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
710 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
711 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
712 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
713 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
714 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
715 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
716 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
717 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
718 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
719 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
720 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
721 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
722 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
723 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
724 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
725 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
726 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
727 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
728 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
729 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
730 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
731 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
732 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
733 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
734 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
735 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
736 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
737 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
738 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
739 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
740 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
741 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
742 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
743 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
744 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
745 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
746 2996887358 Rhizobium sp. R711 Isolate Nodule
747 2996893221 Rhizobium sp. R635 Isolate Nodule
748 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
749 3004167301 Mesorhizobium loti 582 Isolate Unclassified
750 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
751 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
752 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
753 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
754 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
755 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
756 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
757 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
758 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
759 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
760 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
761 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
762 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
763 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
764 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
765 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
766 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
767 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
768 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
769 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
770 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
771 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
772 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
773 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
774 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
775 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
776 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
777 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
778 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
779 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
780 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
781 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
782 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
783 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
784 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
785 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
786 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
787 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
788 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
789 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
790 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
791 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
792 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
793 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
794 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
795 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
796 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
797 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
798 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
799 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
800 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
801 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
802 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
803 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
804 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
805 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
806 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
807 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
808 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
809 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
810 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
811 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
812 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
813 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
814 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
815 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
816 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
817 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
818 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
819 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
820 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
821 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
822 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
823 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
824 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
825 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
826 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
827 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
828 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
829 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
830 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
831 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
832 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
833 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
834 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
835 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
836 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
837 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
838 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
839 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
840 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
841 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
842 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
843 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
844 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
845 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
846 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
847 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
848 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
849 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
850 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
851 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
852 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
853 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
854 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
855 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
856 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
857 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
858 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
859 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
860 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
861 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
862 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
863 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
864 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
865 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
866 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
867 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
868 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
869 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
870 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
871 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
872 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
873 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
874 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
875 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
876 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
877 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
878 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
879 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
880 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
881 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
882 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
883 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
884 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
885 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
886 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
887 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
888 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
889 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
890 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
891 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
892 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
893 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
894 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
895 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
896 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
897 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
898 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
899 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
900 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
901 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
902 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
903 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
904 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
905 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
906 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
907 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
908 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
909 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
910 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
911 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
912 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
913 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
914 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
915 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
916 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
917 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
918 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
919 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
920 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
921 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
922 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
923 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
924 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
925 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
926 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
927 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
928 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
929 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
930 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
931 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
932 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
933 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
934 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
935 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
936 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
937 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
938 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
939 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
940 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
941 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
942 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
943 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
944 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
945 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
946 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
947 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
948 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
949 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
950 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
951 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
952 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
953 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
954 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
955 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
956 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
957 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
958 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
959 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
960 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
961 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
962 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
963 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
964 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
965 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
966 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
967 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
968 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
969 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
970 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
971 3300029283 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 Metatranscriptome Rhizosphere
972 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
973 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
974 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
975 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
976 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
977 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
978 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
979 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
980 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
981 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
982 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
983 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
984 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
985 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
986 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
987 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
988 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
989 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
990 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
991 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
992 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
993 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
994 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
995 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
996 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
997 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
998 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
999 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
1000 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
1001 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
1002 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
1003 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
1004 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1005 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1006 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1007 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1008 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1009 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
1010 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
1011 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
1012 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
1013 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
1014 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
1015 3300041454 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT Metatranscriptome Rhizoplane
1016 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
1017 3300041464 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT Metatranscriptome Rhizoplane
1018 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
1019 3300041499 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaT Metatranscriptome Unclassified
1020 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
1021 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
1022 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
1023 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
1024 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
1025 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
1026 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
1027 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
1028 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
1029 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
1030 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
1031 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
1032 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
1033 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
1034 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
1035 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1036 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1037 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
1038 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1039 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
1040 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
1041 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
1042 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1043 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
1044 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
1045 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
1046 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
1047 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1048 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1049 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1050 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
1051 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1052 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
1053 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1054 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
1055 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1056 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
1057 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
1058 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1059 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
1060 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
1061 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
1062 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
1063 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
1064 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1065 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
1066 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1067 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
1068 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1069 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
1070 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
1071 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1072 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1073 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1074 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1075 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1076 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1077 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1078 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1079 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1080 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1081 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1082 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1083 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1084 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1085 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1086 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1087 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1088 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1089 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1090 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1091 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1092 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1093 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1094 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1095 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1096 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1097 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1098 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1099 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1100 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1101 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1102 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1103 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1104 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1112 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
1114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1121 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1125 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
1128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
1130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
1133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1137 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1139 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1140 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1141 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1142 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1143 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
1146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
1151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
1152 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1154 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
1155 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
1156 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
1157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1158 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1159 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
1160 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
1161 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
1162 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1163 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1164 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1165 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1166 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
1167 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1168 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1169 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1170 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
1171 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1172 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1174 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1175 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1176 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1177 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1178 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1179 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1180 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1181 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1182 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1183 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1184 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1185 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1186 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1187 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1188 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1189 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1190 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1191 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1192 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1193 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1194 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1195 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1196 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1197 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1198 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1199 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1200 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1201 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1202 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1203 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1206 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1207 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1208 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1209 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1210 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1211 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1212 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
1213 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1214 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1215 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1216 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1217 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1218 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1219 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1220 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1221 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1222 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1223 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1224 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1225 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1226 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1227 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1228 8005258706 Rhizobium sp. R693 Isolate Nodule
1229 8005275841 Rhizobium sp. N4311 Isolate Nodule
1230 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1231 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1232 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1233 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1234 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1235 8005321885 Rhizobium sp. R72 Isolate Nodule
1236 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1237 8005382845 Rhizobium sp. R634 Isolate Nodule
1238 8005395548 Rhizobium sp. R339 Isolate Nodule
1239 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1240 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1241 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1242 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1243 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1244 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1245 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1246 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1247 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1248 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1249 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1250 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1251 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1252 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1253 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1254 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1255 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1256 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1257 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1258 8018176218 Rhizobium sp. N122 Isolate Nodule
1259 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
1260 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1261 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1262 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1263 8024501048 Rhizobium sp. H4 Isolate Nodule
1264 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1265 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1266 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1267 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1268 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1269 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1270 8056382006 Rhizobium croatiense 13T Isolate Nodule
1271 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1272 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1273 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 48.1
Metatranscriptomes 4.6
Isolates 47.3

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 9.6
Nodule 36.74
Rhizoplane 1.93
Rhizosphere 39.13
Stem 0
Stem Tuber 0
Unclassified 12.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10038081 3300001979 Bacteria 1478
2 JGI24740J21852_10077057 3300001979 Bacteria 880
3 JGI24739J22299_10055633 3300001989 Bacteria 1264
4 JGI24743J22301_10037076 3300001991 Bacteria 971
5 JGI24735J21928_10035258 3300002067 Bacteria 1472
6 JGI24735J21928_10095477 3300002067 Bacteria 853
7 JGI25155J39150_1000010 3300002704 Bacteria 207717
8 JGI25156J39149_1000102 3300002705 Bacteria 62463
9 JGI25156J39149_1009778 3300002705 Bacteria 2303
10 JGI25162J39368_1001052 3300002737 Bacteria 16925
11 JGI25162J39368_1001061 3300002737 Bacteria 16807
12 JGI25154J39366_1000184 3300002738 Bacteria 48243
13 JGI25158J39367_1000061 3300002739 Bacteria 24434
14 JGI25157J39369_1000009 3300002741 Bacteria 207868
15 JGI25157J39369_1001314 3300002741 Bacteria 9892
16 JGI25152J39213_1002753 3300002773 Bacteria 6388
17 JGI25152J39213_1002993 3300002773 Bacteria 5984
18 JGI25152J39213_1004278 3300002773 Bacteria 4555
19 JGI25150J39212_1000037 3300002774 Bacteria 88885
20 JGI25150J39212_1021423 3300002774 Bacteria 983
21 JGI25159J45721_1012147 3300002987 Bacteria 2070
22 JGI25151J46595_10000220 3300003187 Bacteria 67327
23 JGI25151J46595_10068304 3300003187 Bacteria 1091
24 JGI25165J46597_1001126 3300003214 Bacteria 16807
25 JGI25160J50197_1005889 3300003354 Bacteria 5038
26 JGI25160J50197_1035580 3300003354 Bacteria 1220
27 JGI25161J50226_1000137 3300003374 Bacteria 50627
28 Ga0007427J51700_109799 3300003559 Bacteria 845
29 Ga0006562J51391_1002937 3300003578 Bacteria 3750
30 Ga0006562J51391_1003164 3300003578 Bacteria 843
31 Ga0006562J51391_1003372 3300003578 Bacteria 1020
32 Ga0032354_1026988 3300003693 Bacteria 856
33 Ga0055539_1004440 3300003752 Bacteria 1869
34 Ga0055529_1004728 3300003763 Bacteria 2044
35 Ga0055526_1003979 3300003771 Bacteria 9100
36 Ga0055526_1008345 3300003771 Bacteria 5191
37 Ga0055526_1013997 3300003771 Bacteria 3341
38 Ga0055524_1001868 3300003775 Bacteria 11508
39 Ga0055524_1005075 3300003775 Bacteria 5955
40 Ga0055524_1032827 3300003775 Bacteria 1464
41 Ga0055528_1002500 3300003790 Bacteria 9814
42 Ga0055528_1004711 3300003790 Bacteria 6509
43 Ga0055528_1005546 3300003790 Bacteria 5848
44 Ga0055528_1006903 3300003790 Bacteria 5091
45 Ga0055528_1017730 3300003790 Bacteria 2452
46 Ga0055540_1001660 3300003792 Bacteria 12897
47 Ga0055540_1003634 3300003792 Bacteria 7353
48 Ga0055531_10018117 3300003794 Bacteria 2927
49 Ga0058692_1002779 3300003856 Bacteria 5755
50 Ga0058692_1005607 3300003856 Bacteria 3557
51 Ga0055543_1000433 3300004625 Bacteria 25933
52 Ga0065165_1003519 3300005262 Bacteria 10867
53 Ga0065165_1007334 3300005262 Bacteria 5460
54 Ga0070670_100000116 3300005331 Bacteria 74586
55 Ga0070680_100006198 3300005336 Bacteria 9071
56 Ga0070680_100027023 3300005336 Bacteria 4595
57 Ga0070682_100601182 3300005337 Bacteria 868
58 Ga0068868_100141002 3300005338 Bacteria 1979
59 Ga0070660_100000020 3300005339 Bacteria 98286
60 Ga0070668_100015601 3300005347 Bacteria 5679
61 Ga0070668_100434563 3300005347 Bacteria 1126
62 Ga0070669_100057569 3300005353 Bacteria 2852
63 Ga0070669_100115407 3300005353 Bacteria 2043
64 Ga0070669_100173302 3300005353 Bacteria 1683
65 Ga0070671_100012277 3300005355 Bacteria 6894
66 Ga0070673_100034031 3300005364 Bacteria 3852
67 Ga0070659_100000047 3300005366 Bacteria 98286
68 Ga0070659_100140961 3300005366 Bacteria 1963
69 Ga0070667_100418151 3300005367 Bacteria 1222
70 Ga0070713_100209208 3300005436 Bacteria 1765
71 Ga0070705_100399940 3300005440 Bacteria 1017
72 Ga0070663_100005665 3300005455 Bacteria 7441
73 Ga0070663_100114662 3300005455 Bacteria 2029
74 Ga0070662_100648312 3300005457 Bacteria 891
75 Ga0070681_10000010 3300005458 Bacteria 140126
76 Ga0070681_10005513 3300005458 Bacteria 12226
77 Ga0070681_10056435 3300005458 Bacteria 3908
78 Ga0068867_100365757 3300005459 Bacteria 1208
79 Ga0070679_100001075 3300005530 Bacteria 23895
80 Ga0070679_100031668 3300005530 Bacteria 5227
81 Ga0070679_100086982 3300005530 Bacteria 3112
82 Ga0070697_100408525 3300005536 Bacteria 1179
83 Ga0068853_100005537 3300005539 Bacteria 9905
84 Ga0070696_100008510 3300005546 Bacteria 6870
85 Ga0070696_100030767 3300005546 Bacteria 3677
86 Ga0070665_100004011 3300005548 Bacteria 15524
87 Ga0070665_100021286 3300005548 Bacteria 6521
88 Ga0070704_100017621 3300005549 Bacteria 4547
89 Ga0068855_100027087 3300005563 Bacteria 6858
90 Ga0068855_100113501 3300005563 Bacteria 3108
91 Ga0068855_100305394 3300005563 Bacteria 1761
92 Ga0068855_100715821 3300005563 Bacteria 1070
93 Ga0068857_100181861 3300005577 Bacteria 1913
94 Ga0068854_100101418 3300005578 Bacteria 2158
95 Ga0068854_100182740 3300005578 Bacteria 1639
96 Ga0068856_100252543 3300005614 Bacteria 1778
97 Ga0068856_100444889 3300005614 Bacteria 1316
98 Ga0068852_100212449 3300005616 Bacteria 1836
99 Ga0068852_100491483 3300005616 Bacteria 1221
100 Ga0068851_10096773 3300005834 Bacteria 1561
101 Ga0068863_100521021 3300005841 Bacteria 1172
102 Ga0068858_100117226 3300005842 Bacteria 2489
103 Ga0068858_100157053 3300005842 Bacteria 2140
104 Ga0068860_100145567 3300005843 Bacteria 2280
105 Ga0068862_100195314 3300005844 Bacteria 1823
106 Ga0068862_100199410 3300005844 Bacteria 1804
107 Ga0081538_10050330 3300005981 Bacteria 2517
108 Ga0081539_10000690 3300005985 Bacteria 67656
109 Ga0081539_10004943 3300005985 Bacteria 14171
110 Ga0075365_10000270 3300006038 Bacteria 17782
111 Ga0075365_10026456 3300006038 Bacteria 3684
112 Ga0075365_10089590 3300006038 Bacteria 2094
113 Ga0075365_10362224 3300006038 Bacteria 1022
114 Ga0075368_10030823 3300006042 Bacteria 2078
115 Ga0075364_10146058 3300006051 Bacteria 1592
116 Ga0075364_10256754 3300006051 Bacteria 1188
117 Ga0075362_10014524 3300006177 Bacteria 3180
118 Ga0075362_10117247 3300006177 Bacteria 1257
119 Ga0075367_10000078 3300006178 Bacteria 25393
120 Ga0075367_10029691 3300006178 Bacteria 3130
121 Ga0075367_10045738 3300006178 Bacteria 2569
122 Ga0075367_10169485 3300006178 Bacteria 1360
123 Ga0075369_10067768 3300006186 Bacteria 1567
124 Ga0075366_10085787 3300006195 Bacteria 1883
125 Ga0075366_10233095 3300006195 Bacteria 1122
126 Ga0075370_10076142 3300006353 Bacteria 1924
127 Ga0075370_10079154 3300006353 Bacteria 1888
128 Ga0075370_10079900 3300006353 Bacteria 1879
129 Ga0075370_10174540 3300006353 Bacteria 1264
130 Ga0075428_100740915 3300006844 Bacteria 1046
131 Ga0075431_100020391 3300006847 Bacteria 6773
132 Ga0075433_10320624 3300006852 Bacteria 1371
133 Ga0075434_100084518 3300006871 Bacteria 3172
134 Ga0075434_100098722 3300006871 Bacteria 2926
135 Ga0075434_100103423 3300006871 Bacteria 2856
136 Ga0068865_100269196 3300006881 Bacteria 1352
137 Ga0075436_100012045 3300006914 Bacteria 5931
138 Ga0075436_100076116 3300006914 Bacteria 2324
139 Ga0075435_100141712 3300007076 Bacteria 2017
140 Ga0105250_10004360 3300009092 Bacteria 6519
141 Ga0105250_10021237 3300009092 Bacteria 2621
142 Ga0105240_10000013 3300009093 Bacteria 483458
143 Ga0105240_10011135 3300009093 Bacteria 12566
144 Ga0105240_10250829 3300009093 Bacteria 2047
145 Ga0105240_10501254 3300009093 Bacteria 1350
146 Ga0105240_10654649 3300009093 Bacteria 1151
147 Ga0105247_10075884 3300009101 Bacteria 2110
148 Ga0105247_10076292 3300009101 Bacteria 2104
149 Ga0114129_10011337 3300009147 Bacteria 12697
150 Ga0105243_10079313 3300009148 Bacteria 2676
151 Ga0105243_10123484 3300009148 Bacteria 2187
152 Ga0105243_10213017 3300009148 Bacteria 1702
153 Ga0105243_10595485 3300009148 Bacteria 1064
154 Ga0105243_10623038 3300009148 Bacteria 1042
155 Ga0105241_10849041 3300009174 Bacteria 844
156 Ga0105248_10013921 3300009177 Bacteria 8851
157 Ga0105237_10034241 3300009545 Bacteria 5144
158 Ga0105237_10038473 3300009545 Bacteria 4830
159 Ga0105237_10140495 3300009545 Bacteria 2409
160 Ga0105237_10168486 3300009545 Bacteria 2190
161 Ga0105238_10005332 3300009551 Bacteria 12703
162 Ga0105238_10009792 3300009551 Bacteria 9593
163 Ga0105238_10344342 3300009551 Bacteria 1479
164 Ga0105249_10178565 3300009553 Bacteria 2064
165 Ga0123340_1040891 3300009763 Bacteria 2157
166 Ga0123341_1000009 3300009765 Bacteria 122597
167 Ga0123341_1055213 3300009765 Bacteria 2108
168 Ga0123342_1009724 3300009766 Bacteria 11342
169 Ga0123342_1034152 3300009766 Bacteria 2259
170 Ga0105239_10000820 3300010375 Bacteria 44190
171 Ga0105239_10002698 3300010375 Bacteria 22316
172 Ga0105239_10010060 3300010375 Bacteria 10602
173 Ga0105239_10035669 3300010375 Bacteria 5461
174 Ga0105239_10246399 3300010375 Bacteria 2006
175 Ga0105239_10386213 3300010375 Bacteria 1583
176 Ga0105246_10179528 3300011119 Bacteria 1629
177 Ga0157344_1001511 3300012476 Bacteria 1119
178 Ga0157326_1003319 3300012513 Bacteria 1695
179 Ga0157373_10003539 3300013100 Bacteria 11797
180 Ga0157373_10013897 3300013100 Bacteria 5904
181 Ga0157373_10015389 3300013100 Bacteria 5592
182 Ga0157371_10000108 3300013102 Bacteria 126288
183 Ga0157371_10018609 3300013102 Bacteria 5132
184 Ga0157370_10002495 3300013104 Bacteria 22179
185 Ga0157370_10004314 3300013104 Bacteria 16344
186 Ga0157370_10008875 3300013104 Bacteria 10805
187 Ga0157370_10062213 3300013104 Bacteria 3541
188 Ga0157370_10104424 3300013104 Bacteria 2652
189 Ga0157370_10308314 3300013104 Bacteria 1461
190 Ga0157369_10025178 3300013105 Bacteria 6606
191 Ga0157369_10028357 3300013105 Bacteria 6197
192 Ga0157369_10126588 3300013105 Bacteria 2708
193 Ga0157369_10172253 3300013105 Bacteria 2280
194 Ga0157378_10243186 3300013297 Bacteria 1720
195 Ga0163162_10117870 3300013306 Bacteria 2757
196 Ga0163162_10442404 3300013306 Bacteria 1432
197 Ga0157372_10001645 3300013307 Bacteria 24280
198 Ga0157372_10759888 3300013307 Bacteria 1127
199 Ga0157375_10605948 3300013308 Bacteria 1254
200 Ga0163163_10261064 3300014325 Bacteria 1783
201 Ga0182008_10119652 3300014497 Bacteria 1309
202 Ga0157379_10018880 3300014968 Bacteria 6084
203 Ga0157376_10226366 3300014969 Bacteria 1735
204 Ga0182006_1048187 3300015261 Bacteria 1649
205 Ga0182007_10003160 3300015262 Bacteria 7893
206 Ga0182005_1001581 3300015265 Bacteria 8979
207 Ga0182005_1009966 3300015265 Bacteria 2744
208 Ga0163161_10005528 3300017792 Bacteria 8755
209 Ga0206356_10905856 3300020070 Bacteria 914
210 Ga0206349_1464035 3300020075 Bacteria 898
211 Ga0206355_1532750 3300020076 Bacteria 883
212 Ga0206351_10295174 3300020077 Bacteria 1052
213 Ga0206351_10386933 3300020077 Bacteria 928
214 Ga0206352_11134782 3300020078 Bacteria 820
215 Ga0206350_10165189 3300020080 Bacteria 943
216 Ga0206350_10789658 3300020080 Bacteria 905
217 Ga0206350_10800904 3300020080 Bacteria 951
218 Ga0206354_10281947 3300020081 Bacteria 833
219 Ga0206353_10082534 3300020082 Bacteria 822
220 Ga0154015_1345373 3300020610 Bacteria 936
221 Ga0213875_10000033 3300021388 Bacteria 170944
222 Ga0209435_100009 3300025206 Bacteria 476614
223 Ga0209436_100018 3300025208 Bacteria 113499
224 Ga0209437_100057 3300025233 Bacteria 362922
225 Ga0209437_100107 3300025233 Bacteria 218656
226 Ga0207425_1000034 3300025245 Bacteria 227886
227 Ga0207425_1002129 3300025245 Bacteria 7274
228 Ga0209646_1000018 3300025246 Bacteria 476716
229 Ga0209026_1000032 3300025250 Bacteria 322378
230 Ga0209026_1000068 3300025250 Bacteria 207601
231 Ga0209677_100199 3300025253 Bacteria 48030
232 Ga0209148_1000111 3300025254 Bacteria 198095
233 Ga0209759_1000007 3300025256 Bacteria 476614
234 Ga0209759_1000142 3300025256 Bacteria 124090
235 Ga0209759_1004146 3300025256 Bacteria 5523
236 Ga0209129_1000118 3300025258 Bacteria 139972
237 Ga0209129_1000253 3300025258 Bacteria 55709
238 Ga0209129_1000971 3300025258 Bacteria 17232
239 Ga0209129_1003727 3300025258 Bacteria 6451
240 Ga0209129_1003990 3300025258 Bacteria 6073
241 Ga0209129_1004733 3300025258 Bacteria 5161
242 Ga0209129_1009453 3300025258 Bacteria 2568
243 Ga0209233_1000072 3300025261 Bacteria 363074
244 Ga0209233_1000118 3300025261 Bacteria 236172
245 Ga0209233_1000134 3300025261 Bacteria 202535
246 Ga0209233_1000479 3300025261 Bacteria 24402
247 Ga0207666_1000023 3300025271 Bacteria 37093
248 Ga0209455_1000223 3300025272 Bacteria 77481
249 Ga0209455_1018745 3300025272 Bacteria 1413
250 Ga0209673_1000033 3300025273 Bacteria 335369
251 Ga0209673_1000052 3300025273 Bacteria 279795
252 Ga0209673_1000953 3300025273 Bacteria 36121
253 Ga0209673_1000975 3300025273 Bacteria 35311
254 Ga0209673_1001533 3300025273 Bacteria 21036
255 Ga0209673_1006503 3300025273 Bacteria 5628
256 Ga0209673_1012482 3300025273 Bacteria 3418
257 Ga0209130_1000009 3300025284 Bacteria 498952
258 Ga0209130_1025277 3300025284 Bacteria 1287
259 Ga0209676_1015445 3300025292 Bacteria 2810
260 Ga0209025_1000487 3300025294 Bacteria 76541
261 Ga0209025_1000533 3300025294 Bacteria 72404
262 Ga0209025_1002217 3300025294 Bacteria 21448
263 Ga0209025_1003035 3300025294 Bacteria 16560
264 Ga0209025_1005459 3300025294 Bacteria 10359
265 Ga0209025_1017317 3300025294 Bacteria 4169
266 Ga0209025_1024298 3300025294 Bacteria 3132
267 Ga0209025_1065855 3300025294 Bacteria 1320
268 Ga0209564_1000782 3300025295 Bacteria 44138
269 Ga0209564_1001043 3300025295 Bacteria 33899
270 Ga0209564_1002280 3300025295 Bacteria 15659
271 Ga0209564_1003771 3300025295 Bacteria 9865
272 Ga0209564_1009145 3300025295 Bacteria 4765
273 Ga0209564_1031739 3300025295 Bacteria 1607
274 Ga0209564_1041321 3300025295 Bacteria 1238
275 Ga0209758_1000415 3300025297 Bacteria 72404
276 Ga0209758_1001085 3300025297 Bacteria 35309
277 Ga0209758_1001086 3300025297 Bacteria 35300
278 Ga0209758_1002520 3300025297 Bacteria 18534
279 Ga0209758_1009917 3300025297 Bacteria 5806
280 Ga0209758_1016800 3300025297 Bacteria 3692
281 Ga0209758_1050098 3300025297 Bacteria 1467
282 Ga0209256_1000510 3300025299 Bacteria 57080
283 Ga0209256_1002945 3300025299 Bacteria 12778
284 Ga0209256_1003900 3300025299 Bacteria 9866
285 Ga0209256_1007141 3300025299 Bacteria 5627
286 Ga0209256_1011065 3300025299 Bacteria 3667
287 Ga0207426_1000041 3300025302 Bacteria 433536
288 Ga0207426_1000348 3300025302 Bacteria 85294
289 Ga0207426_1003830 3300025302 Bacteria 7773
290 Ga0209051_1002527 3300025303 Bacteria 12957
291 Ga0209051_1006376 3300025303 Bacteria 6669
292 Ga0209051_1039543 3300025303 Bacteria 1701
293 Ga0209257_1003532 3300025304 Bacteria 13296
294 Ga0207696_1011005 3300025711 Bacteria 3284
295 Ga0207713_1051466 3300025735 Bacteria 1637
296 Ga0207653_10020764 3300025885 Bacteria 2081
297 Ga0207682_10000011 3300025893 Bacteria 85533
298 Ga0207642_10000936 3300025899 Bacteria 9137
299 Ga0207710_10283127 3300025900 Bacteria 835
300 Ga0207688_10000212 3300025901 Bacteria 25999
301 Ga0207680_10021218 3300025903 Bacteria 3512
302 Ga0207647_10008981 3300025904 Bacteria 7120
303 Ga0207647_10101029 3300025904 Bacteria 1711
304 Ga0207647_10101197 3300025904 Bacteria 1709
305 Ga0207647_10124683 3300025904 Bacteria 1516
306 Ga0207645_10000788 3300025907 Bacteria 26477
307 Ga0207643_10000284 3300025908 Bacteria 35172
308 Ga0207705_10471583 3300025909 Bacteria 974
309 Ga0207654_10026416 3300025911 Bacteria 3144
310 Ga0207654_10039900 3300025911 Bacteria 2643
311 Ga0207654_10185994 3300025911 Bacteria 1358
312 Ga0207707_10000005 3300025912 Bacteria 382024
313 Ga0207707_10001938 3300025912 Bacteria 18823
314 Ga0207707_10004935 3300025912 Bacteria 11731
315 Ga0207707_10604232 3300025912 Bacteria 928
316 Ga0207695_10000044 3300025913 Bacteria 440819
317 Ga0207695_10051370 3300025913 Bacteria 4329
318 Ga0207695_10085396 3300025913 Bacteria 3185
319 Ga0207695_10191320 3300025913 Bacteria 1964
320 Ga0207671_10000400 3300025914 Bacteria 60604
321 Ga0207671_10017490 3300025914 Bacteria 5525
322 Ga0207671_10019417 3300025914 Bacteria 5196
323 Ga0207671_10060555 3300025914 Bacteria 2809
324 Ga0207660_10002390 3300025917 Bacteria 12338
325 Ga0207660_10013909 3300025917 Bacteria 5281
326 Ga0207660_10027643 3300025917 Bacteria 3874
327 Ga0207657_10000390 3300025919 Bacteria 46278
328 Ga0207657_10074718 3300025919 Bacteria 2861
329 Ga0207649_10000057 3300025920 Bacteria 102314
330 Ga0207649_10000822 3300025920 Bacteria 19938
331 Ga0207649_10231881 3300025920 Bacteria 1321
332 Ga0207652_10000068 3300025921 Bacteria 110287
333 Ga0207652_10035039 3300025921 Bacteria 4234
334 Ga0207681_10000181 3300025923 Bacteria 51755
335 Ga0207681_10007620 3300025923 Bacteria 6635
336 Ga0207681_10040141 3300025923 Bacteria 3112
337 Ga0207681_10183113 3300025923 Bacteria 1597
338 Ga0207681_10399421 3300025923 Bacteria 1110
339 Ga0207694_10008165 3300025924 Bacteria 7910
340 Ga0207694_10484140 3300025924 Bacteria 1035
341 Ga0207650_10000691 3300025925 Bacteria 26420
342 Ga0207650_10001418 3300025925 Bacteria 17264
343 Ga0207659_10000028 3300025926 Bacteria 130804
344 Ga0207687_10000061 3300025927 Bacteria 84113
345 Ga0207700_10168542 3300025928 Bacteria 1825
346 Ga0207644_10004970 3300025931 Bacteria 8672
347 Ga0207644_10082811 3300025931 Bacteria 2374
348 Ga0207690_10000037 3300025932 Bacteria 142658
349 Ga0207690_10090157 3300025932 Bacteria 2164
350 Ga0207690_10239966 3300025932 Bacteria 1395
351 Ga0207706_10008724 3300025933 Bacteria 9338
352 Ga0207706_10121395 3300025933 Bacteria 2298
353 Ga0207709_10000539 3300025935 Bacteria 32486
354 Ga0207709_10049806 3300025935 Bacteria 2559
355 Ga0207709_10378626 3300025935 Bacteria 1076
356 Ga0207669_10000290 3300025937 Bacteria 23055
357 Ga0207669_10137732 3300025937 Bacteria 1689
358 Ga0207704_10000767 3300025938 Bacteria 14133
359 Ga0207704_10053675 3300025938 Bacteria 2452
360 Ga0207704_10301885 3300025938 Bacteria 1227
361 Ga0207711_10015022 3300025941 Bacteria 6431
362 Ga0207711_10036003 3300025941 Bacteria 4198
363 Ga0207689_10009011 3300025942 Bacteria 8641
364 Ga0207661_10000215 3300025944 Bacteria 37435
365 Ga0207679_10000026 3300025945 Bacteria 200073
366 Ga0207667_10008668 3300025949 Bacteria 12055
367 Ga0207667_10056380 3300025949 Bacteria 4128
368 Ga0207667_10105936 3300025949 Bacteria 2901
369 Ga0207667_10668146 3300025949 Bacteria 1043
370 Ga0207651_10000173 3300025960 Bacteria 27970
371 Ga0207651_10176714 3300025960 Bacteria 1689
372 Ga0207712_10002375 3300025961 Bacteria 12203
373 Ga0207712_10435544 3300025961 Bacteria 1109
374 Ga0207668_10000474 3300025972 Bacteria 25172
375 Ga0207668_10014369 3300025972 Bacteria 4900
376 Ga0207668_10488147 3300025972 Bacteria 1058
377 Ga0207640_10000711 3300025981 Bacteria 19295
378 Ga0207640_10087541 3300025981 Bacteria 2147
379 Ga0207640_10183110 3300025981 Bacteria 1572
380 Ga0207640_10552868 3300025981 Bacteria 967
381 Ga0207658_10001541 3300025986 Bacteria 17874
382 Ga0207658_10345059 3300025986 Bacteria 1295
383 Ga0207658_10368762 3300025986 Bacteria 1255
384 Ga0207658_10391025 3300025986 Bacteria 1220
385 Ga0207677_10001215 3300026023 Bacteria 13903
386 Ga0207677_10132357 3300026023 Bacteria 1896
387 Ga0207703_10457427 3300026035 Bacteria 1193
388 Ga0207639_10697687 3300026041 Bacteria 941
389 Ga0207678_10002696 3300026067 Bacteria 16099
390 Ga0207678_10120431 3300026067 Bacteria 2240
391 Ga0207678_10231988 3300026067 Bacteria 1580
392 Ga0207678_10418061 3300026067 Bacteria 1162
393 Ga0207702_10136128 3300026078 Bacteria 2216
394 Ga0207702_10211582 3300026078 Bacteria 1803
395 Ga0207702_10850325 3300026078 Bacteria 903
396 Ga0207648_10023516 3300026089 Bacteria 5518
397 Ga0207648_10045791 3300026089 Bacteria 3836
398 Ga0207648_10334193 3300026089 Bacteria 1363
399 Ga0207676_10005845 3300026095 Bacteria 8692
400 Ga0207674_10026646 3300026116 Bacteria 6133
401 Ga0207674_10096921 3300026116 Bacteria 2934
402 Ga0207675_100023660 3300026118 Bacteria 5714
403 Ga0207675_100108076 3300026118 Bacteria 2623
404 Ga0207675_100881346 3300026118 Bacteria 911
405 Ga0207683_10000034 3300026121 Bacteria 101817
406 Ga0207698_10226456 3300026142 Bacteria 1694
407 Ga0209371_1000037 3300027312 Bacteria 367074
408 Ga0209371_1002109 3300027312 Bacteria 11760
409 Ga0209371_1002474 3300027312 Bacteria 10284
410 Ga0209998_10005453 3300027717 Bacteria 2662
411 Ga0209813_10021294 3300027866 Bacteria 1821
412 Ga0209974_10025784 3300027876 Bacteria 1946
413 Ga0207428_10000440 3300027907 Bacteria 50907
414 Ga0207428_10001235 3300027907 Bacteria 27417
415 Ga0207428_10156798 3300027907 Bacteria 1731
416 Ga0268266_10015172 3300028379 Bacteria 6615
417 Ga0268266_10233666 3300028379 Bacteria 1694
418 Ga0268266_10271030 3300028379 Bacteria 1576
419 Ga0268266_10302678 3300028379 Bacteria 1492
420 Ga0268265_10001023 3300028380 Bacteria 25231
421 Ga0268265_10266988 3300028380 Bacteria 1524
422 Ga0268264_10001465 3300028381 Bacteria 22046
423 Ga0268264_10447985 3300028381 Bacteria 1250
424 Ga0307515_10001330 3300028794 Bacteria 55993
425 Ga0307515_10290965 3300028794 Bacteria 1329
426 Ga0310982_132715 3300029283 Bacteria 1018
427 Ga0268256_1000039 3300030500 Bacteria 354969
428 Ga0268256_1001864 3300030500 Bacteria 11667
429 Ga0268256_1036812 3300030500 Bacteria 1125
430 Ga0316181_1198006 3300030744 Bacteria 6176
431 Ga0265331_10000625 3300031250 Bacteria 30747
432 Ga0265327_10001092 3300031251 Bacteria 37637
433 Ga0265327_10003920 3300031251 Bacteria 13663
434 Ga0265327_10016822 3300031251 Bacteria 4624
435 Ga0265316_10148817 3300031344 Bacteria 1755
436 Ga0307513_10000463 3300031456 Bacteria 58389
437 Ga0307513_10015877 3300031456 Bacteria 9106
438 Ga0307408_100492954 3300031548 Bacteria 1071
439 Ga0265313_10001402 3300031595 Bacteria 22597
440 Ga0265314_10018826 3300031711 Bacteria 5365
441 Ga0307405_10001569 3300031731 Bacteria 9698
442 Ga0307405_10234530 3300031731 Bacteria 1355
443 Ga0307413_10114192 3300031824 Bacteria 1815
444 Ga0307413_10231357 3300031824 Bacteria 1358
445 Ga0307410_10178930 3300031852 Bacteria 1604
446 Ga0307412_10002170 3300031911 Bacteria 10894
447 Ga0307409_100045667 3300031995 Bacteria 3309
448 Ga0307409_100871771 3300031995 Bacteria 912
449 Ga0316593_10165967 3300032168 Bacteria 808
450 Ga0307510_10157736 3300033180 Bacteria 1873
451 Ga0316592_1058377 3300033524 Bacteria 865
452 Ga0316586_1038278 3300033527 Bacteria 838
453 Ga0316596_1079334 3300033541 Bacteria 882
454 Ga0373958_0000962 3300034819 Bacteria 3738
455 Ga0373959_0006254 3300034820 Bacteria 1970
456 Ga0373938_0045057 3300034957 Bacteria 992
457 Ga0373951_0002104 3300035091 Bacteria 5096
458 Ga0373952_0001391 3300035092 Bacteria 4420
459 Ga0373952_0033990 3300035092 Bacteria 1147
460 Ga0373932_0002140 3300035112 Bacteria 5132
461 Ga0373939_0002351 3300035114 Bacteria 4472
462 Ga0373960_0003014 3300035121 Bacteria 3803
463 Ga0373960_0044953 3300035121 Bacteria 1291
464 Ga0373962_0000385 3300035242 Bacteria 9627
465 Ga0373962_0009108 3300035242 Bacteria 2453
466 Ga0373931_0000254 3300035691 Bacteria 22696
467 Ga0373937_0001845 3300036401 Bacteria 17802
468 Ga0316582_0116711 3300036647 Bacteria 1782
469 Ga0316584_0243521 3300036712 Bacteria 1315
470 Ga0395899_0007406 3300037312 Bacteria 8482
471 Ga0395900_0000056 3300037418 Bacteria 213077
472 Ga0395900_0008711 3300037418 Bacteria 10420
473 Ga0395900_0028708 3300037418 Bacteria 5703
474 Ga0395900_0031790 3300037418 Bacteria 5425
475 Ga0395900_0084320 3300037418 Bacteria 3265
476 Ga0395900_0321935 3300037418 Bacteria 1526
477 Ga0395898_0000114 3300037466 Bacteria 213068
478 Ga0395898_0033165 3300037466 Bacteria 5154
479 Ga0395905_0000053 3300037471 Bacteria 213077
480 Ga0395905_0020139 3300037471 Bacteria 6319
481 Ga0395901_0000037 3300038443 Bacteria 213059
482 Ga0395901_0079118 3300038443 Bacteria 3432
483 Ga0395901_0120745 3300038443 Bacteria 2754
484 Ga0395901_0223550 3300038443 Bacteria 1967
485 Ga0395901_0277792 3300038443 Bacteria 1741
486 Ga0400483_039327 3300039062 Bacteria 5442
487 Ga0400483_125138 3300039062 Bacteria 1424
488 Ga0400483_252775 3300039062 Bacteria 17955
489 Ga0439436_0006561 3300041404 Bacteria 3574
490 Ga0439436_0012216 3300041404 Bacteria 2606
491 Ga0439436_0039541 3300041404 Bacteria 1354
492 Ga0439438_009534 3300041405 Bacteria 3136
493 Ga0439439_0047919 3300041406 Bacteria 1117
494 Ga0439447_065989 3300041407 Bacteria 846
495 Ga0439465_0002262 3300041413 Bacteria 6326
496 Ga0439465_0003401 3300041413 Bacteria 5189
497 Ga0439465_0009497 3300041413 Bacteria 3064
498 Ga0451799_13591 3300041454 Bacteria 960
499 Ga0451801_39182 3300041455 Bacteria 787
500 Ga0451808_28627 3300041464 Bacteria 803
501 Ga0451841_0178587 3300041498 Bacteria 3957
502 Ga0451842_1121 3300041499 Bacteria 824
503 Ga0451851_1096957 3300041507 Bacteria 2171
504 Ga0451854_02560 3300041510 Bacteria 1556
505 Ga0452268_06253 3300041907 Bacteria 969
506 Ga0439442_018773 3300042002 Bacteria 1430
507 Ga0439432_061694 3300042006 Bacteria 1155
508 Ga0439449_0122416 3300042007 Bacteria 966
509 Ga0450920_003459 3300042122 Bacteria 2735
510 Ga0439434_0033961 3300042435 Bacteria 1557
511 Ga0450918_005441 3300042531 Bacteria 2289
512 Ga0466972_0037303 3300044658 Bacteria 2376
513 Ga0466972_0124009 3300044658 Bacteria 1217
514 Ga0453684_0000015 3300044712 Bacteria 969198
515 Ga0453684_0000020 3300044712 Bacteria 879938
516 Ga0466960_0023442 3300044901 Bacteria 2771
517 Ga0466959_0072685 3300045049 Bacteria 2489
518 Ga0466958_0232688 3300045836 Bacteria 1177
519 Ga0495603_0000026 3300046455 Bacteria 61348
520 Ga0495629_0096213 3300046459 Bacteria 2065
521 Ga0495605_0045144 3300046474 Bacteria 2173
522 Ga0495584_0023947 3300046491 Bacteria 3095
523 Ga0495585_0042999 3300046492 Bacteria 2528
524 Ga0495585_0089241 3300046492 Bacteria 1662
525 Ga0495585_0302012 3300046492 Bacteria 786
526 Ga0495607_0011406 3300046501 Bacteria 5917
527 Ga0495583_0017655 3300046506 Bacteria 3781
528 Ga0495583_0196796 3300046506 Bacteria 820
529 Ga0495606_0009969 3300046507 Bacteria 7946
530 Ga0495606_0041105 3300046507 Bacteria 3102
531 Ga0495610_0002478 3300046512 Bacteria 15473
532 Ga0495610_0021369 3300046512 Bacteria 3561
533 Ga0495616_0055676 3300046513 Bacteria 1957
534 Ga0495620_0011516 3300046515 Bacteria 4614
535 Ga0495632_0002387 3300046519 Bacteria 14346
536 Ga0495632_0126415 3300046519 Bacteria 1192
537 Ga0495637_0045872 3300046520 Bacteria 1851
538 Ga0495643_0080657 3300046522 Bacteria 1693
539 Ga0495654_0161120 3300046530 Bacteria 985
540 Ga0495587_0125894 3300046536 Bacteria 1466
541 Ga0495597_0021206 3300046542 Bacteria 3022
542 Ga0495633_0020355 3300046558 Bacteria 3338
543 Ga0495656_0117104 3300046615 Bacteria 1253
544 Ga0495668_0042577 3300046616 Bacteria 2528
545 Ga0495634_0120675 3300046642 Bacteria 1679
546 Ga0495625_0011675 3300046660 Bacteria 7145
547 Ga0495625_0060527 3300046660 Bacteria 2682
548 Ga0495659_0043452 3300046664 Bacteria 1612
549 Ga0495661_0102391 3300046665 Bacteria 1610
550 Ga0495661_0210090 3300046665 Bacteria 1014
551 Ga0495588_0038007 3300046674 Bacteria 2448
552 Ga0495624_0130607 3300046690 Bacteria 1540
553 Ga0495670_0038451 3300046691 Bacteria 2385
554 Ga0495670_0116322 3300046691 Bacteria 1387
555 Ga0495671_0098250 3300046692 Bacteria 1432
556 Ga0495649_0020798 3300046694 Bacteria 3678
557 Ga0495649_0060369 3300046694 Bacteria 2040
558 Ga0495589_0034844 3300046794 Bacteria 2525
559 Ga0495604_0035060 3300047317 Bacteria 3964
560 Ga0495636_0045205 3300047318 Bacteria 1835
561 Ga0495674_0218363 3300047319 Bacteria 1577
562 Ga0495683_0078014 3300047323 Bacteria 1619
563 Ga0495681_0046168 3300047470 Bacteria 2079
564 Ga0495615_0049660 3300048090 Bacteria 1076
565 Ga0495626_0031946 3300048091 Bacteria 2531
566 Ga0496100_0019710 3300048903 Bacteria 4029
567 Ga0496101_0012868 3300048904 Bacteria 5596
568 Ga0496102_0004000 3300048905 Bacteria 12481
569 Ga0496102_0462299 3300048905 Bacteria 1190
570 Ga0496103_0006985 3300048906 Bacteria 6736
571 Ga0496104_0009450 3300048907 Bacteria 8674
572 Ga0496104_0280128 3300048907 Bacteria 1580
573 Ga0496105_0041839 3300048908 Bacteria 3776
574 Ga0496105_0624272 3300048908 Bacteria 834
575 Ga0496106_0003568 3300048909 Bacteria 11590
576 Ga0496106_0010947 3300048909 Bacteria 6705
577 Ga0496106_0280746 3300048909 Bacteria 1334
578 Ga0496107_0005476 3300048910 Bacteria 8685
579 Ga0496108_0173192 3300048911 Bacteria 1868
580 Ga0496109_0000984 3300048912 Bacteria 23543
581 Ga0496110_0009931 3300048913 Bacteria 7717
582 Ga0496110_0354148 3300048913 Bacteria 1337
583 Ga0496112_0798778 3300048915 Bacteria 868
584 Ga0496114_0016680 3300048917 Bacteria 5923
585 Ga0496114_0250698 3300048917 Bacteria 1558
586 Ga0496115_0003065 3300048918 Bacteria 12001
587 Ga0496115_0180530 3300048918 Bacteria 1745
588 Ga0496115_0194736 3300048918 Bacteria 1675
589 Ga0496116_0000057 3300048919 Bacteria 281652
590 Ga0496116_0081392 3300048919 Bacteria 2007
591 Ga0496117_0000031 3300048920 Bacteria 381048
592 Ga0496117_0002097 3300048920 Bacteria 26238
593 Ga0496117_0010058 3300048920 Bacteria 8689
594 Ga0496117_0020361 3300048920 Bacteria 5409
595 Ga0496117_0056502 3300048920 Bacteria 2733
596 Ga0496117_0061998 3300048920 Bacteria 2566
597 Ga0496118_0002291 3300048921 Bacteria 26051
598 Ga0496118_0008110 3300048921 Bacteria 10943
599 Ga0496118_0009274 3300048921 Bacteria 9980
600 Ga0496118_0022589 3300048921 Bacteria 5492
601 Ga0496118_0030421 3300048921 Bacteria 4506
602 Ga0496119_0000147 3300048922 Bacteria 98899
603 Ga0496119_0023944 3300048922 Bacteria 4312
604 Ga0496119_0028106 3300048922 Bacteria 3847
605 Ga0496119_0096761 3300048922 Bacteria 1665
606 Ga0496119_0148981 3300048922 Bacteria 1256
607 Ga0496120_0002641 3300048923 Bacteria 17737
608 Ga0496120_0039751 3300048923 Bacteria 2771
609 Ga0496120_0045241 3300048923 Bacteria 2551
610 Ga0496121_0000034 3300048924 Bacteria 377095
611 Ga0496121_0008479 3300048924 Bacteria 12066
612 Ga0496121_0011232 3300048924 Bacteria 9980
613 Ga0496121_0013424 3300048924 Bacteria 8802
614 Ga0496121_0020808 3300048924 Bacteria 6466
615 Ga0496121_0023905 3300048924 Bacteria 5861
616 Ga0496121_0135242 3300048924 Bacteria 1838
617 Ga0496121_0178584 3300048924 Bacteria 1535
618 Ga0496122_0000023 3300048925 Bacteria 381035
619 Ga0496122_0008748 3300048925 Bacteria 10832
620 Ga0496122_0017928 3300048925 Bacteria 6573
621 Ga0496122_0018012 3300048925 Bacteria 6550
622 Ga0496122_0043273 3300048925 Bacteria 3530
623 Ga0496123_0000027 3300048926 Bacteria 306773
624 Ga0496123_0002376 3300048926 Bacteria 23589
625 Ga0496123_0014122 3300048926 Bacteria 6642
626 Ga0496123_0019242 3300048926 Bacteria 5387
627 Ga0496123_0071680 3300048926 Bacteria 2160
628 Ga0496123_0125085 3300048926 Bacteria 1437
629 Ga0496124_0000174 3300048927 Bacteria 129228
630 Ga0496124_0002248 3300048927 Bacteria 25664
631 Ga0496124_0005858 3300048927 Bacteria 13630
632 Ga0496124_0011409 3300048927 Bacteria 8883
633 Ga0496124_0067125 3300048927 Bacteria 2985
634 Ga0496124_0096090 3300048927 Bacteria 2407
635 Ga0496124_0153424 3300048927 Bacteria 1804
636 Ga0496124_0222685 3300048927 Bacteria 1417
637 Ga0496125_0000030 3300048928 Bacteria 375023
638 Ga0496125_0004309 3300048928 Bacteria 16518
639 Ga0496125_0006873 3300048928 Bacteria 12189
640 Ga0496125_0126996 3300048928 Bacteria 1805
641 Ga0496125_0136094 3300048928 Bacteria 1718
642 Ga0496125_0189741 3300048928 Bacteria 1359
643 Ga0496126_0005711 3300048929 Bacteria 14100
644 Ga0496126_0031438 3300048929 Bacteria 5016
645 Ga0496126_0058103 3300048929 Bacteria 3488
646 Ga0496126_0094014 3300048929 Bacteria 2631
647 Ga0496126_0132120 3300048929 Bacteria 2156
648 Ga0496126_0193912 3300048929 Bacteria 1719
649 Ga0496126_0214460 3300048929 Bacteria 1619
650 Ga0496126_0223749 3300048929 Bacteria 1579
651 Ga0496126_0303763 3300048929 Bacteria 1315
652 Ga0501308_017966 3300049128 Bacteria 861
653 Ga0501307_028324 3300049162 Bacteria 765
654 Ga0501311_024221 3300049527 Bacteria 844
655 Ga0501315_027457 3300049531 Bacteria 804
656 Ga0501318_016002 3300049534 Bacteria 901
657 Ga0501335_016323 3300049551 Bacteria 764
658 Ga0501337_007142 3300049553 Bacteria 775
659 Ga0501340_007485 3300049556 Bacteria 754
660 Ga0501031_0204605 3300049568 Bacteria 1287
661 Ga0501031_0279736 3300049568 Bacteria 1082
662 Ga0501032_0000006 3300049569 Bacteria 261727
663 Ga0501032_0046093 3300049569 Bacteria 2946
664 Ga0501033_0000053 3300049570 Bacteria 109042
665 Ga0501033_0000477 3300049570 Bacteria 37842
666 Ga0501033_0103766 3300049570 Bacteria 2073
667 Ga0501033_0169802 3300049570 Bacteria 1567
668 Ga0501033_0318653 3300049570 Bacteria 1092
669 Ga0501034_0000023 3300049571 Bacteria 263892
670 Ga0501034_0000030 3300049571 Bacteria 248180
671 Ga0501034_0002652 3300049571 Bacteria 21172
672 Ga0501034_0007485 3300049571 Bacteria 11615
673 Ga0501034_0042799 3300049571 Bacteria 4584
674 Ga0501034_0044944 3300049571 Bacteria 4464
675 Ga0501034_0050536 3300049571 Bacteria 4193
676 Ga0501034_0102580 3300049571 Bacteria 2854
677 Ga0501034_0232959 3300049571 Bacteria 1790
678 Ga0501036_0000003 3300049572 Bacteria 261545
679 Ga0501036_0002249 3300049572 Bacteria 15079
680 Ga0501036_0011045 3300049572 Bacteria 7468
681 Ga0501036_0098239 3300049572 Bacteria 2475
682 Ga0501036_0156857 3300049572 Bacteria 1919
683 Ga0501036_0331910 3300049572 Bacteria 1270
684 Ga0501037_0000003 3300049573 Bacteria 261548
685 Ga0501037_0000269 3300049573 Bacteria 44747
686 Ga0501037_0037047 3300049573 Bacteria 3595
687 Ga0501037_0052558 3300049573 Bacteria 2980
688 Ga0501037_0150970 3300049573 Bacteria 1660
689 Ga0501038_0000004 3300049574 Bacteria 261289
690 Ga0501038_0000040 3300049574 Bacteria 121177
691 Ga0501038_0028880 3300049574 Bacteria 4923
692 Ga0501038_0075791 3300049574 Bacteria 2842
693 Ga0501038_0155929 3300049574 Bacteria 1859
694 Ga0501038_0268377 3300049574 Bacteria 1346
695 Ga0501038_0396686 3300049574 Bacteria 1068
696 Ga0501039_0000008 3300049575 Bacteria 274778
697 Ga0501039_0000089 3300049575 Bacteria 68136
698 Ga0501039_0023552 3300049575 Bacteria 4725
699 Ga0501039_0188427 3300049575 Bacteria 1622
700 Ga0501039_0190127 3300049575 Bacteria 1614
701 Ga0501039_0235604 3300049575 Bacteria 1439
702 Ga0501040_0008431 3300049576 Bacteria 6697
703 Ga0501040_0046579 3300049576 Bacteria 2960
704 Ga0501040_0062010 3300049576 Bacteria 2572
705 Ga0501040_0104897 3300049576 Bacteria 1974
706 Ga0501041_0018246 3300049577 Bacteria 4179
707 Ga0501041_0054907 3300049577 Bacteria 2430
708 Ga0501041_0060730 3300049577 Bacteria 2313
709 Ga0501042_0005598 3300049578 Bacteria 8098
710 Ga0501042_0126387 3300049578 Bacteria 1841
711 Ga0501043_0000019 3300049579 Bacteria 155347
712 Ga0501043_0000365 3300049579 Bacteria 40969
713 Ga0501043_0248947 3300049579 Bacteria 1369
714 Ga0501043_0368580 3300049579 Bacteria 1089
715 Ga0501046_0018273 3300049580 Bacteria 5837
716 Ga0501046_0018481 3300049580 Bacteria 5799
717 Ga0501046_0030285 3300049580 Bacteria 4393
718 Ga0501046_0034838 3300049580 Bacteria 4060
719 Ga0501046_0048839 3300049580 Bacteria 3349
720 Ga0501046_0060051 3300049580 Bacteria 2976
721 Ga0501047_0001197 3300049581 Bacteria 25699
722 Ga0501047_0246874 3300049581 Bacteria 1634
723 Ga0501047_0349477 3300049581 Bacteria 1315
724 Ga0501048_0008179 3300049582 Bacteria 7912
725 Ga0501048_0021393 3300049582 Bacteria 4736
726 Ga0501048_0046877 3300049582 Bacteria 3085
727 Ga0501048_0105263 3300049582 Bacteria 1991
728 Ga0501067_0081299 3300049583 Bacteria 1796
729 Ga0501068_0015949 3300049584 Bacteria 4327
730 Ga0501068_0018147 3300049584 Bacteria 4073
731 Ga0501068_0030274 3300049584 Bacteria 3210
732 Ga0501068_0209137 3300049584 Bacteria 1239
733 Ga0501068_0222795 3300049584 Bacteria 1199
734 Ga0501069_0167197 3300049585 Bacteria 1268
735 Ga0501070_0086535 3300049586 Bacteria 2594
736 Ga0501070_0181061 3300049586 Bacteria 1734
737 Ga0501071_0027577 3300049587 Bacteria 3997
738 Ga0501071_0037374 3300049587 Bacteria 3467
739 Ga0501071_0149415 3300049587 Bacteria 1742
740 Ga0501071_0268483 3300049587 Bacteria 1289
741 Ga0501072_0010915 3300049588 Bacteria 6930
742 Ga0501072_0030130 3300049588 Bacteria 4241
743 Ga0501072_0037701 3300049588 Bacteria 3792
744 Ga0501073_0002812 3300049589 Bacteria 13028
745 Ga0501073_0116994 3300049589 Bacteria 1847
746 Ga0501074_0060176 3300049590 Bacteria 2736
747 Ga0501074_0185995 3300049590 Bacteria 1481
748 Ga0501074_0244023 3300049590 Bacteria 1277
749 Ga0501074_0453288 3300049590 Bacteria 909
750 Ga0501075_0004606 3300049591 Bacteria 9355
751 Ga0501075_0072070 3300049591 Bacteria 2611
752 Ga0501075_0088069 3300049591 Bacteria 2353
753 Ga0501076_0004436 3300049592 Bacteria 9983
754 Ga0501076_0044976 3300049592 Bacteria 3484
755 Ga0501076_0110378 3300049592 Bacteria 2223
756 Ga0501076_0435976 3300049592 Bacteria 1079
757 Ga0501076_0436776 3300049592 Bacteria 1077
758 Ga0501077_0000896 3300049593 Bacteria 17896
759 Ga0501077_0038231 3300049593 Bacteria 3055
760 Ga0501077_0042622 3300049593 Bacteria 2885
761 Ga0501077_0115784 3300049593 Bacteria 1699
762 Ga0501079_0007738 3300049741 Bacteria 8135
763 Ga0501079_0009536 3300049741 Bacteria 7361
764 Ga0501079_0023397 3300049741 Bacteria 4741
765 Ga0501079_0142116 3300049741 Bacteria 1869
766 Ga0501079_0197499 3300049741 Bacteria 1570
767 Ga0501080_0033256 3300049742 Bacteria 4812
768 Ga0501080_0048854 3300049742 Bacteria 3937
769 Ga0501080_0111403 3300049742 Bacteria 2537
770 Ga0501080_0451461 3300049742 Bacteria 1152
771 Ga0501080_0586822 3300049742 Bacteria 990
772 Ga0501081_0002638 3300049743 Bacteria 11336
773 Ga0501081_0054363 3300049743 Bacteria 2766
774 Ga0501081_0075277 3300049743 Bacteria 2356
775 Ga0501083_0019610 3300049744 Bacteria 4710
776 Ga0501083_0020023 3300049744 Bacteria 4656
777 Ga0501083_0059804 3300049744 Bacteria 2548
778 Ga0501083_0069508 3300049744 Bacteria 2343
779 Ga0501035_0000031 3300049822 Bacteria 175591
780 Ga0501035_0000434 3300049822 Bacteria 47060
781 Ga0501035_0034682 3300049822 Bacteria 4583
782 Ga0501035_0048680 3300049822 Bacteria 3801
783 Ga0501035_0346898 3300049822 Bacteria 1243
784 Ga0501035_0446086 3300049822 Bacteria 1071
785 Ga0501044_0000008 3300049823 Bacteria 274778
786 Ga0501044_0017484 3300049823 Bacteria 7697
787 Ga0501044_0056269 3300049823 Bacteria 4038
788 Ga0501044_0086497 3300049823 Bacteria 3166
789 Ga0501044_0327500 3300049823 Bacteria 1455
790 Ga0501044_0347256 3300049823 Bacteria 1404
791 Ga0501044_0643058 3300049823 Bacteria 950
792 Ga0501045_0002264 3300049824 Bacteria 13063
793 Ga0501045_0069019 3300049824 Bacteria 2597
794 Ga0501045_0216790 3300049824 Bacteria 1425
795 nmdc:mga03683_90896_c1 3300050489 Bacteria 1331
796 nmdc:mga00v17_151_c1 3300050491 Bacteria 40348
797 nmdc:mga00v17_172266_c1 3300050491 Bacteria 1396
798 nmdc:mga00v17_20304_c1 3300050491 Bacteria 3804
799 nmdc:mga00v17_240018_c1 3300050491 Bacteria 1175
800 nmdc:mga00v17_240312_c1 3300050491 Bacteria 1174
801 nmdc:mga0yw44_109607_c1 3300050492 Bacteria 1768
802 nmdc:mga0yw44_20329_c1 3300050492 Bacteria 3683
803 nmdc:mga0yw44_273955_c1 3300050492 Bacteria 1127
804 nmdc:mga0yw44_359767_c1 3300050492 Bacteria 981
805 nmdc:mga0yw44_398542_c1 3300050492 Bacteria 930
806 nmdc:mga0yw44_4983_c1 3300050492 Bacteria 6197
807 nmdc:mga0k408_156037_c1 3300050493 Bacteria 1360
808 nmdc:mga0k408_253397_c1 3300050493 Bacteria 1051
809 nmdc:mga06z11_200613_c1 3300050494 Bacteria 1159
810 nmdc:mga06z11_259719_c1 3300050494 Bacteria 1025
811 nmdc:mga06z11_266120_c1 3300050494 Bacteria 1013
812 nmdc:mga06z11_275005_c1 3300050494 Bacteria 997
813 nmdc:mga06z11_53830_c1 3300050494 Bacteria 2071
814 nmdc:mga04h51_12766_c1 3300050495 Bacteria 2366
815 nmdc:mga07m45_210135_c1 3300050496 Bacteria 1132
816 nmdc:mga07m45_246996_c1 3300050496 Bacteria 1038
817 nmdc:mga05p37_1046553_c1 3300050507 Bacteria 861
818 nmdc:mga05p37_17400_c1 3300050507 Bacteria 8674
819 nmdc:mga05p37_97560_c1 3300050507 Bacteria 3620
820 nmdc:mga09592_137341_c1 3300050508 Bacteria 2106
821 nmdc:mga06r32_14807_c1 3300050510 Bacteria 7077
822 nmdc:mga08y16_118606_c1 3300050511 Bacteria 2754
823 nmdc:mga08y16_513707_c1 3300050511 Bacteria 1216
824 nmdc:mga08y16_68203_c1 3300050511 Bacteria 3709
825 nmdc:mga0n895_101779_c1 3300050512 Bacteria 2883
826 nmdc:mga0n895_11694_c1 3300050512 Bacteria 7844
827 nmdc:mga0n895_117208_c1 3300050512 Bacteria 2682
828 nmdc:mga0n895_86336_c1 3300050512 Bacteria 3134
829 nmdc:mga0rr50_366844_c1 3300050513 Bacteria 1213
830 nmdc:mga08x19_170205_c1 3300050514 Bacteria 1483
831 nmdc:mga08x19_362373_c1 3300050514 Bacteria 1013
832 nmdc:mga08x19_55954_c2 3300050514 Bacteria 2185
833 nmdc:mga08x19_8993_c2 3300050514 Bacteria 2644
834 nmdc:mga0a205_36894_c1 3300050515 Bacteria 4699
835 nmdc:mga0a205_60343_c1 3300050515 Bacteria 3663
836 nmdc:mga0sz30_107_c1 3300050516 Bacteria 31264
837 nmdc:mga0sz30_108616_c1 3300050516 Bacteria 1215
838 nmdc:mga0sz30_33980_c1 3300050516 Bacteria 2121
839 nmdc:mga0sz30_78283_c1 3300050516 Bacteria 1429
840 nmdc:mga0sz30_8253_c2 3300050516 Bacteria 2598
841 Ga0495601_0033194 3300053077 Bacteria 3215
842 Ga0495612_0012291 3300053078 Bacteria 3451
843 Ga0500610_0017821 3300053079 Bacteria 3420
844 Ga0495595_0147946 3300053084 Bacteria 1155
845 Ga0495619_0027909 3300053085 Bacteria 3640
846 Ga0495619_0058253 3300053085 Bacteria 2564
847 Ga0495619_0262615 3300053085 Bacteria 1196
848 Ga0500578_0033329 3300053086 Bacteria 3309
849 Ga0500556_0000142 3300053104 Bacteria 59905
850 Ga0500560_001253 3300053107 Bacteria 4277
851 Ga0500562_011866 3300053108 Bacteria 2214
852 Ga0500618_001280 3300053125 Bacteria 11596
853 Ga0500618_007068 3300053125 Bacteria 3234
854 Ga0500658_0000309 3300053134 Bacteria 21891
855 Ga0500561_0004680 3300053137 Bacteria 2487
856 Ga0500573_0000334 3300053140 Bacteria 19960
857 Ga0500590_001183 3300053148 Bacteria 10347
858 Ga0500616_0003388 3300053153 Bacteria 12230
859 Ga0500616_0045185 3300053153 Bacteria 2347
860 Ga0500622_0000343 3300053156 Bacteria 45668
861 Ga0500622_0002162 3300053156 Bacteria 14566
862 Ga0500627_0075957 3300053158 Bacteria 1494
863 Ga0500627_0082713 3300053158 Bacteria 1432
864 Ga0500627_0127987 3300053158 Bacteria 1146
865 Ga0500633_0008199 3300053160 Bacteria 2679
866 Ga0500634_0000028 3300053161 Bacteria 80877
867 Ga0500634_0018742 3300053161 Bacteria 3721
868 Ga0500636_0000040 3300053177 Bacteria 69881
869 Ga0500636_0002588 3300053177 Bacteria 10040
870 Ga0501084_0000488 3300054114 Bacteria 30370
871 Ga0501084_0023099 3300054114 Bacteria 5191
872 Ga0501084_0072325 3300054114 Bacteria 2888
873 Ga0501084_0124632 3300054114 Bacteria 2167
874 Ga0501084_0251041 3300054114 Bacteria 1493
875 Ga0587084_012964 3300059477 Bacteria 1138
876 Ga0587066_008862 3300059490 Bacteria 1409
877 Ga0587066_051258 3300059490 Bacteria 813
878 Ga0587073_0037104 3300059492 Bacteria 1042
879 Ga0587077_058795 3300059493 Bacteria 827
880 Ga0587082_030751 3300059504 Bacteria 934
881 Ga0587082_047957 3300059504 Bacteria 806
882 Ga0587083_0062428 3300059505 Bacteria 844
883 Ga0587085_008191 3300059506 Bacteria 1326
884 Ga0587088_014040 3300059508 Bacteria 1240
885 Ga0587088_025879 3300059508 Bacteria 1015
886 Ga0587088_036020 3300059508 Bacteria 910
887 Ga0587088_038458 3300059508 Bacteria 891
888 Ga0587088_045251 3300059508 Bacteria 843
889 Ga0587088_050095 3300059508 Bacteria 815
890 Ga0587089_016140 3300059509 Bacteria 992
891 Ga0587090_000942 3300059510 Bacteria 2737
892 Ga0587091_028679 3300059511 Bacteria 1029
893 Ga0587091_057629 3300059511 Bacteria 816
894 Ga0587092_039632 3300059512 Bacteria 815
895 Ga0587094_028773 3300059513 Bacteria 850
896 Ga0587094_029811 3300059513 Bacteria 840
897 Ga0587098_010749 3300059604 Bacteria 1018
898 Ga0587098_020948 3300059604 Bacteria 830
899 Ga0587106_035629 3300059605 Bacteria 821
900 Ga0587129_004592 3300059608 Bacteria 914
901 Ga0587131_004979 3300059609 Bacteria 819
902 Ga0587109_031993 3300059624 Bacteria 1003
903 Ga0587128_031643 3300059630 Bacteria 880
904 Ga0587062_005423 3300059639 Bacteria 1408
905 Ga0587067_010337 3300059640 Bacteria 1412
906 Ga0587067_040453 3300059640 Bacteria 904
907 Ga0587072_000182 3300059643 Bacteria 5539
908 Ga0587072_037083 3300059643 Bacteria 934
909 Ga0587072_052909 3300059643 Bacteria 818
910 Ga0587075_035666 3300059644 Bacteria 812
911 Ga0587076_010905 3300059645 Bacteria 1324
912 Ga0587078_020968 3300059646 Bacteria 825
913 Ga0587105_005868 3300059651 Bacteria 828
914 Ga0587107_024049 3300059652 Bacteria 875
915 Ga0587108_010063 3300059653 Bacteria 789
916 Ga0587071_046356 3300060344 Bacteria 887
917 Ga0587071_051619 3300060344 Bacteria 852
918 Ga0587071_057491 3300060344 Bacteria 819
919 Ga0587111_0063867 3300060346 Bacteria 844
920 Ga0501082_0012395 3300060353 Bacteria 7327
921 Ga0501082_0022657 3300060353 Bacteria 5409
922 Ga0501082_0070245 3300060353 Bacteria 3015
923 Ga0501082_0205576 3300060353 Bacteria 1713
924 Ga0501082_0233258 3300060353 Bacteria 1602
925 Ga0501082_0247295 3300060353 Bacteria 1552
926 Ga0530510_0018710 3300061734 Bacteria 4913
927 Ga0530510_0033636 3300061734 Bacteria 3689
928 Ga0530510_0038261 3300061734 Bacteria 3463

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046501 Ga0495607_0011406 Ga0495607_0011406_2038_2820 217
2 3300053125 Ga0500618_007068 Ga0500618_007068_87_869 217
3 3300033524 Ga0316592_1058377 Ga0316592_10583771 219
4 3300033541 Ga0316596_1079334 Ga0316596_10793341 219
5 3300036647 Ga0316582_0116711 Ga0316582_0116711_332_1108 219
6 3300036712 Ga0316584_0243521 Ga0316584_0243521_443_1219 219
7 3300049571 Ga0501034_0002652 Ga0501034_0002652_2413_3192 220
8 3300049571 Ga0501034_0044944 Ga0501034_0044944_3528_4379 220
9 3300053161 Ga0500634_0018742 Ga0500634_0018742_1494_2276 221
10 3300020080 Ga0206350_10800904 Ga0206350_108009041 222
11 3300041404 Ga0439436_0039541 Ga0439436_0039541_490_1323 222
12 3300050491 nmdc:mga00v17_240312_c1 nmdc:mga00v17_240312_c1_244_1083 223
13 3300005985 Ga0081539_10000690 Ga0081539_100006908 224
14 iso_pu_bacteria 2903513507 2903515779 224
15 3300039062 Ga0400483_039327 Ga0400483_039327_930_1640 226
16 3300048927 Ga0496124_0096090 Ga0496124_0096090_1667_2389 227
17 3300049568 Ga0501031_0204605 Ga0501031_0204605_543_1256 227
18 3300049570 Ga0501033_0318653 Ga0501033_0318653_65_778 227
19 3300049572 Ga0501036_0011045 Ga0501036_0011045_256_969 227
20 3300049574 Ga0501038_0396686 Ga0501038_0396686_338_1051 227
21 3300049575 Ga0501039_0023552 Ga0501039_0023552_256_969 227
22 3300049576 Ga0501040_0046579 Ga0501040_0046579_1898_2611 227
23 3300049578 Ga0501042_0005598 Ga0501042_0005598_6387_7100 227
24 3300049580 Ga0501046_0018273 Ga0501046_0018273_3663_4376 227
25 3300049582 Ga0501048_0105263 Ga0501048_0105263_811_1524 227
26 3300049584 Ga0501068_0222795 Ga0501068_0222795_308_1021 227
27 3300049587 Ga0501071_0027577 Ga0501071_0027577_1386_2099 227
28 3300049588 Ga0501072_0030130 Ga0501072_0030130_3273_3986 227
29 3300049591 Ga0501075_0088069 Ga0501075_0088069_514_1227 227
30 3300049592 Ga0501076_0436776 Ga0501076_0436776_100_813 227
31 3300049593 Ga0501077_0115784 Ga0501077_0115784_811_1524 227
32 3300049741 Ga0501079_0023397 Ga0501079_0023397_152_865 227
33 3300049822 Ga0501035_0446086 Ga0501035_0446086_141_854 227
34 3300049824 Ga0501045_0216790 Ga0501045_0216790_95_808 227
35 3300054114 Ga0501084_0251041 Ga0501084_0251041_226_939 227
36 3300060353 Ga0501082_0247295 Ga0501082_0247295_196_909 227
37 3300061734 Ga0530510_0038261 Ga0530510_0038261_2252_2965 227
38 3300003578 Ga0006562J51391_1002937 Ga0006562J51391_10029372 228
39 3300005981 Ga0081538_10050330 Ga0081538_100503303 228
40 3300020075 Ga0206349_1464035 Ga0206349_14640351 228
41 3300032168 Ga0316593_10165967 Ga0316593_101659671 228
42 3300049573 Ga0501037_0052558 Ga0501037_0052558_1967_2683 228
43 3300049742 Ga0501080_0586822 Ga0501080_0586822_253_969 228
44 3300050507 nmdc:mga05p37_97560_c1 nmdc:mga05p37_97560_c1_861_1562 228
45 3300001991 JGI24743J22301_10037076 JGI24743J22301_100370761 229
46 3300005338 Ga0068868_100141002 Ga0068868_1001410022 229
47 3300005364 Ga0070673_100034031 Ga0070673_1000340312 229
48 3300025960 Ga0207651_10176714 Ga0207651_101767141 229
49 3300025986 Ga0207658_10368762 Ga0207658_103687621 229
50 3300026023 Ga0207677_10132357 Ga0207677_101323572 229
51 3300037418 Ga0395900_0031790 Ga0395900_0031790_84_824 229
52 3300037471 Ga0395905_0020139 Ga0395905_0020139_3670_4410 229
53 3300038443 Ga0395901_0120745 Ga0395901_0120745_1023_1763 229
54 3300039062 Ga0400483_125138 Ga0400483_125138_374_1099 229
55 3300039062 Ga0400483_252775 Ga0400483_252775_16396_17121 229
56 3300045049 Ga0466959_0072685 Ga0466959_0072685_1158_1901 229
57 3300045836 Ga0466958_0232688 Ga0466958_0232688_406_1149 229
58 iso_pu_bacteria 8020945358 8020949293 229
59 3300005985 Ga0081539_10004943 Ga0081539_1000494313 230
60 3300006914 Ga0075436_100076116 Ga0075436_1000761162 231
61 3300031251 Ga0265327_10003920 Ga0265327_100039206 231
62 3300031595 Ga0265313_10001402 Ga0265313_1000140217 231
63 3300037312 Ga0395899_0007406 Ga0395899_0007406_3818_4540 231
64 3300037418 Ga0395900_0008711 Ga0395900_0008711_6131_6853 231
65 3300037418 Ga0395900_0321935 Ga0395900_0321935_774_1496 231
66 3300037466 Ga0395898_0033165 Ga0395898_0033165_914_1636 231
67 3300038443 Ga0395901_0079118 Ga0395901_0079118_914_1636 231
68 3300044712 Ga0453684_0000015 Ga0453684_0000015_366618_367331 231
69 3300044712 Ga0453684_0000020 Ga0453684_0000020_391818_392528 231
70 3300050514 nmdc:mga08x19_55954_c2 nmdc:mga08x19_55954_c2_363_1076 231
71 3300053084 Ga0495595_0147946 Ga0495595_0147946_54_767 231
72 3300053085 Ga0495619_0058253 Ga0495619_0058253_1749_2462 231
73 iso_pu_bacteria 2534681786 2535485706 231
74 iso_pu_bacteria 2757320392 2757570179 231
75 iso_pu_bacteria 2915650412 2915650815 231
76 3300029283 Ga0310982_132715 Ga0310982_1327151 232
77 3300031824 Ga0307413_10114192 Ga0307413_101141922 232
78 3300049128 Ga0501308_017966 Ga0501308_017966_23_754 232
79 3300049162 Ga0501307_028324 Ga0501307_028324_24_755 232
80 3300049531 Ga0501315_027457 Ga0501315_027457_52_783 232
81 3300049534 Ga0501318_016002 Ga0501318_016002_149_880 232
82 3300049551 Ga0501335_016323 Ga0501335_016323_18_749 232
83 3300049553 Ga0501337_007142 Ga0501337_007142_18_749 232
84 3300049556 Ga0501340_007485 Ga0501340_007485_13_744 232
85 iso_pu_bacteria 2513237094 2513640073 232
86 iso_pu_bacteria 2537561587 2537876412 232
87 iso_pu_bacteria 2554235003 2554248846 232
88 iso_pu_bacteria 2558860242 2559295934 232
89 iso_pu_bacteria 2599185210 2599603275 232
90 iso_pu_bacteria 2599185236 2599720310 232
91 iso_pu_bacteria 2643221582 2643921459 232
92 iso_pu_bacteria 2643221693 2644521512 232
93 iso_pu_bacteria 2808606387 2808988242 232
94 iso_pu_bacteria 2818991439 2819560944 232
95 iso_pu_bacteria 2821123053 2821128703 232
96 iso_pu_bacteria 2838675328 2838678694 232
97 iso_pu_bacteria 2838714209 2838718217 232
98 iso_pu_bacteria 2838719591 2838722991 232
99 iso_pu_bacteria 2838724970 2838728284 232
100 iso_pu_bacteria 2838736955 2838741719 232
101 iso_pu_bacteria 2841840854 2841845447 232
102 iso_pu_bacteria 2841846520 2841850547 232
103 iso_pu_bacteria 2841859092 2841863201 232
104 iso_pu_bacteria 2842124991 2842128943 232
105 iso_pu_bacteria 2842130223 2842133586 232
106 iso_pu_bacteria 2842140634 2842145150 232
107 iso_pu_bacteria 2842152218 2842155502 232
108 iso_pu_bacteria 2842170452 2842174541 232
109 iso_pu_bacteria 2842175837 2842179200 232
110 iso_pu_bacteria 2842187318 2842190641 232
111 iso_pu_bacteria 2842211629 2842215035 232
112 iso_pu_bacteria 2842224351 2842227756 232
113 iso_pu_bacteria 2842515876 2842520061 232
114 iso_pu_bacteria 2857531043 2857534144 232
115 iso_pu_bacteria 2899792073 2899795301 232
116 iso_pu_bacteria 2899845264 2899849281 232
117 iso_pu_bacteria 2919114240 2919118525 232
118 iso_pu_bacteria 2926754445 2926755055 232
119 iso_pu_bacteria 2926760298 2926762214 232
120 iso_pu_bacteria 2933006813 2933010648 232
121 iso_pu_bacteria 2933011516 2933015680 232
122 iso_pu_bacteria 2979089926 2979092516 232
123 iso_pu_bacteria 2979095461 2979100093 232
124 iso_pu_bacteria 2979100975 2979104488 232
125 iso_pu_bacteria 2984509177 2984513717 232
126 iso_pu_bacteria 2984518228 2984522705 232
127 iso_pu_bacteria 2984537506 2984542011 232
128 iso_pu_bacteria 2984587000 2984590841 232
129 iso_pu_bacteria 2984601300 2984601441 232
130 iso_pu_bacteria 650716007 650741147 232
131 iso_pu_bacteria 8003570095 8003573793 232
132 3300002067 JGI24735J21928_10095477 JGI24735J21928_100954771 233
133 3300005339 Ga0070660_100000020 Ga0070660_10000002010 233
134 3300005366 Ga0070659_100000047 Ga0070659_10000004710 233
135 3300005455 Ga0070663_100005665 Ga0070663_1000056657 233
136 3300005563 Ga0068855_100027087 Ga0068855_1000270876 233
137 3300005842 Ga0068858_100157053 Ga0068858_1001570533 233
138 3300009092 Ga0105250_10004360 Ga0105250_100043607 233
139 3300009093 Ga0105240_10011135 Ga0105240_1001113511 233
140 3300009545 Ga0105237_10038473 Ga0105237_100384736 233
141 3300009551 Ga0105238_10005332 Ga0105238_1000533210 233
142 3300009553 Ga0105249_10178565 Ga0105249_101785652 233
143 3300010375 Ga0105239_10010060 Ga0105239_100100607 233
144 3300013100 Ga0157373_10013897 Ga0157373_100138973 233
145 3300013104 Ga0157370_10008875 Ga0157370_100088758 233
146 3300013105 Ga0157369_10025178 Ga0157369_100251788 233
147 3300015265 Ga0182005_1009966 Ga0182005_10099664 233
148 3300025256 Ga0209759_1004146 Ga0209759_10041462 233
149 3300025711 Ga0207696_1011005 Ga0207696_10110053 233
150 3300025904 Ga0207647_10101197 Ga0207647_101011973 233
151 3300025913 Ga0207695_10085396 Ga0207695_100853963 233
152 3300025914 Ga0207671_10017490 Ga0207671_100174901 233
153 3300025919 Ga0207657_10000390 Ga0207657_100003909 233
154 3300025924 Ga0207694_10008165 Ga0207694_100081656 233
155 3300025932 Ga0207690_10000037 Ga0207690_1000003796 233
156 3300025949 Ga0207667_10008668 Ga0207667_100086688 233
157 3300025961 Ga0207712_10435544 Ga0207712_104355441 233
158 3300026067 Ga0207678_10002696 Ga0207678_1000269611 233
159 3300031824 Ga0307413_10231357 Ga0307413_102313572 233
160 3300031995 Ga0307409_100871771 Ga0307409_1008717711 233
161 3300048907 Ga0496104_0009450 Ga0496104_0009450_5682_6401 233
162 3300048908 Ga0496105_0041839 Ga0496105_0041839_1243_1962 233
163 3300048920 Ga0496117_0061998 Ga0496117_0061998_1223_1942 233
164 3300048924 Ga0496121_0008479 Ga0496121_0008479_4826_5545 233
165 3300048925 Ga0496122_0043273 Ga0496122_0043273_1968_2687 233
166 3300048926 Ga0496123_0071680 Ga0496123_0071680_377_1096 233
167 3300048928 Ga0496125_0136094 Ga0496125_0136094_700_1419 233
168 3300049593 Ga0501077_0042622 Ga0501077_0042622_920_1675 233
169 3300049744 Ga0501083_0059804 Ga0501083_0059804_116_871 233
170 3300059646 Ga0587078_020968 Ga0587078_020968_84_803 233
171 iso_pu_bacteria 2932818245 2932824960 233
172 3300005336 Ga0070680_100006198 Ga0070680_1000061985 234
173 3300005336 Ga0070680_100027023 Ga0070680_1000270234 234
174 3300005337 Ga0070682_100601182 Ga0070682_1006011821 234
175 3300005347 Ga0070668_100434563 Ga0070668_1004345631 234
176 3300005366 Ga0070659_100140961 Ga0070659_1001409611 234
177 3300005440 Ga0070705_100399940 Ga0070705_1003999401 234
178 3300005457 Ga0070662_100648312 Ga0070662_1006483121 234
179 3300005458 Ga0070681_10005513 Ga0070681_1000551312 234
180 3300005458 Ga0070681_10056435 Ga0070681_100564354 234
181 3300005459 Ga0068867_100365757 Ga0068867_1003657572 234
182 3300005530 Ga0070679_100031668 Ga0070679_1000316682 234
183 3300005536 Ga0070697_100408525 Ga0070697_1004085251 234
184 3300005539 Ga0068853_100005537 Ga0068853_1000055379 234
185 3300005546 Ga0070696_100030767 Ga0070696_1000307672 234
186 3300005549 Ga0070704_100017621 Ga0070704_1000176215 234
187 3300005563 Ga0068855_100715821 Ga0068855_1007158211 234
188 3300005578 Ga0068854_100101418 Ga0068854_1001014182 234
189 3300005842 Ga0068858_100117226 Ga0068858_1001172262 234
190 3300005843 Ga0068860_100145567 Ga0068860_1001455672 234
191 3300005844 Ga0068862_100195314 Ga0068862_1001953142 234
192 3300006871 Ga0075434_100084518 Ga0075434_1000845181 234
193 3300009093 Ga0105240_10501254 Ga0105240_105012541 234
194 3300009101 Ga0105247_10076292 Ga0105247_100762923 234
195 3300009148 Ga0105243_10079313 Ga0105243_100793133 234
196 3300009545 Ga0105237_10168486 Ga0105237_101684861 234
197 3300010375 Ga0105239_10035669 Ga0105239_100356696 234
198 3300012476 Ga0157344_1001511 Ga0157344_10015112 234
199 3300013100 Ga0157373_10015389 Ga0157373_100153895 234
200 3300013104 Ga0157370_10004314 Ga0157370_1000431411 234
201 3300013104 Ga0157370_10104424 Ga0157370_101044241 234
202 3300013307 Ga0157372_10001645 Ga0157372_1000164525 234
203 3300013308 Ga0157375_10605948 Ga0157375_106059481 234
204 3300014968 Ga0157379_10018880 Ga0157379_100188805 234
205 3300020080 Ga0206350_10789658 Ga0206350_107896581 234
206 3300025911 Ga0207654_10185994 Ga0207654_101859942 234
207 3300025912 Ga0207707_10004935 Ga0207707_100049353 234
208 3300025917 Ga0207660_10027643 Ga0207660_100276435 234
209 3300025921 Ga0207652_10035039 Ga0207652_100350394 234
210 3300025932 Ga0207690_10090157 Ga0207690_100901571 234
211 3300025932 Ga0207690_10239966 Ga0207690_102399662 234
212 3300025933 Ga0207706_10121395 Ga0207706_101213951 234
213 3300025981 Ga0207640_10183110 Ga0207640_101831102 234
214 3300025981 Ga0207640_10552868 Ga0207640_105528681 234
215 3300026035 Ga0207703_10457427 Ga0207703_104574271 234
216 3300026089 Ga0207648_10334193 Ga0207648_103341931 234
217 3300026118 Ga0207675_100108076 Ga0207675_1001080762 234
218 3300027717 Ga0209998_10005453 Ga0209998_100054532 234
219 3300027876 Ga0209974_10025784 Ga0209974_100257842 234
220 3300027907 Ga0207428_10156798 Ga0207428_101567981 234
221 3300028381 Ga0268264_10447985 Ga0268264_104479851 234
222 3300031344 Ga0265316_10148817 Ga0265316_101488172 234
223 3300034957 Ga0373938_0045057 Ga0373938_0045057_122_877 234
224 3300035092 Ga0373952_0033990 Ga0373952_0033990_92_847 234
225 3300035121 Ga0373960_0044953 Ga0373960_0044953_181_936 234
226 3300035242 Ga0373962_0009108 Ga0373962_0009108_1552_2307 234
227 3300036401 Ga0373937_0001845 Ga0373937_0001845_10786_11511 234
228 3300046491 Ga0495584_0023947 Ga0495584_0023947_1938_2693 234
229 3300046492 Ga0495585_0089241 Ga0495585_0089241_472_1227 234
230 3300046506 Ga0495583_0196796 Ga0495583_0196796_50_805 234
231 3300046520 Ga0495637_0045872 Ga0495637_0045872_1037_1792 234
232 3300046536 Ga0495587_0125894 Ga0495587_0125894_14_769 234
233 3300046615 Ga0495656_0117104 Ga0495656_0117104_317_1072 234
234 3300046664 Ga0495659_0043452 Ga0495659_0043452_47_802 234
235 3300046691 Ga0495670_0116322 Ga0495670_0116322_576_1331 234
236 3300047318 Ga0495636_0045205 Ga0495636_0045205_699_1454 234
237 3300047319 Ga0495674_0218363 Ga0495674_0218363_571_1326 234
238 3300048909 Ga0496106_0280746 Ga0496106_0280746_272_1027 234
239 3300048911 Ga0496108_0173192 Ga0496108_0173192_495_1250 234
240 3300048913 Ga0496110_0354148 Ga0496110_0354148_180_935 234
241 3300048917 Ga0496114_0250698 Ga0496114_0250698_582_1337 234
242 3300049568 Ga0501031_0279736 Ga0501031_0279736_175_930 234
243 3300049570 Ga0501033_0169802 Ga0501033_0169802_286_1041 234
244 3300049571 Ga0501034_0102580 Ga0501034_0102580_910_1668 234
245 3300049572 Ga0501036_0331910 Ga0501036_0331910_367_1122 234
246 3300049573 Ga0501037_0037047 Ga0501037_0037047_119_874 234
247 3300049574 Ga0501038_0028880 Ga0501038_0028880_4005_4760 234
248 3300049574 Ga0501038_0268377 Ga0501038_0268377_208_963 234
249 3300049575 Ga0501039_0188427 Ga0501039_0188427_709_1464 234
250 3300049575 Ga0501039_0190127 Ga0501039_0190127_847_1602 234
251 3300049575 Ga0501039_0235604 Ga0501039_0235604_84_839 234
252 3300049576 Ga0501040_0062010 Ga0501040_0062010_1563_2318 234
253 3300049577 Ga0501041_0054907 Ga0501041_0054907_1486_2241 234
254 3300049577 Ga0501041_0060730 Ga0501041_0060730_896_1651 234
255 3300049578 Ga0501042_0126387 Ga0501042_0126387_420_1175 234
256 3300049579 Ga0501043_0248947 Ga0501043_0248947_544_1299 234
257 3300049580 Ga0501046_0048839 Ga0501046_0048839_1805_2560 234
258 3300049582 Ga0501048_0021393 Ga0501048_0021393_3739_4494 234
259 3300049584 Ga0501068_0018147 Ga0501068_0018147_2561_3316 234
260 3300049584 Ga0501068_0030274 Ga0501068_0030274_2404_3159 234
261 3300049585 Ga0501069_0167197 Ga0501069_0167197_83_838 234
262 3300049587 Ga0501071_0037374 Ga0501071_0037374_424_1179 234
263 3300049587 Ga0501071_0268483 Ga0501071_0268483_126_881 234
264 3300049588 Ga0501072_0010915 Ga0501072_0010915_368_1123 234
265 3300049590 Ga0501074_0185995 Ga0501074_0185995_273_1028 234
266 3300049590 Ga0501074_0244023 Ga0501074_0244023_494_1249 234
267 3300049592 Ga0501076_0110378 Ga0501076_0110378_72_827 234
268 3300049592 Ga0501076_0435976 Ga0501076_0435976_167_922 234
269 3300049593 Ga0501077_0038231 Ga0501077_0038231_1797_2552 234
270 3300049741 Ga0501079_0142116 Ga0501079_0142116_346_1101 234
271 3300049741 Ga0501079_0197499 Ga0501079_0197499_368_1123 234
272 3300049742 Ga0501080_0111403 Ga0501080_0111403_723_1478 234
273 3300049742 Ga0501080_0451461 Ga0501080_0451461_31_786 234
274 3300049743 Ga0501081_0054363 Ga0501081_0054363_414_1169 234
275 3300049744 Ga0501083_0069508 Ga0501083_0069508_943_1698 234
276 3300049822 Ga0501035_0048680 Ga0501035_0048680_943_1698 234
277 3300050507 nmdc:mga05p37_1046553_c1 nmdc:mga05p37_1046553_c1_73_828 234
278 3300050511 nmdc:mga08y16_513707_c1 nmdc:mga08y16_513707_c1_255_1010 234
279 3300050512 nmdc:mga0n895_86336_c1 nmdc:mga0n895_86336_c1_2255_3010 234
280 3300050515 nmdc:mga0a205_60343_c1 nmdc:mga0a205_60343_c1_1483_2238 234
281 3300053077 Ga0495601_0033194 Ga0495601_0033194_1076_1831 234
282 3300053078 Ga0495612_0012291 Ga0495612_0012291_851_1606 234
283 3300053085 Ga0495619_0027909 Ga0495619_0027909_220_975 234
284 3300054114 Ga0501084_0023099 Ga0501084_0023099_1059_1814 234
285 3300054114 Ga0501084_0124632 Ga0501084_0124632_1371_2126 234
286 3300060353 Ga0501082_0070245 Ga0501082_0070245_26_781 234
287 3300060353 Ga0501082_0233258 Ga0501082_0233258_771_1526 234
288 3300061734 Ga0530510_0033636 Ga0530510_0033636_149_904 234
289 iso_pu_bacteria 2523231067 2523467840 234
290 iso_pu_bacteria 2738543031 2739349292 234
291 3300005546 Ga0070696_100008510 Ga0070696_1000085103 235
292 3300005844 Ga0068862_100199410 Ga0068862_1001994102 235
293 3300006844 Ga0075428_100740915 Ga0075428_1007409152 235
294 3300006847 Ga0075431_100020391 Ga0075431_1000203911 235
295 3300006852 Ga0075433_10320624 Ga0075433_103206242 235
296 3300006871 Ga0075434_100103423 Ga0075434_1001034232 235
297 3300007076 Ga0075435_100141712 Ga0075435_1001417123 235
298 3300009147 Ga0114129_10011337 Ga0114129_100113376 235
299 3300025923 Ga0207681_10007620 Ga0207681_100076205 235
300 3300025937 Ga0207669_10137732 Ga0207669_101377322 235
301 3300025938 Ga0207704_10053675 Ga0207704_100536753 235
302 3300026118 Ga0207675_100023660 Ga0207675_1000236606 235
303 3300026118 Ga0207675_100881346 Ga0207675_1008813461 235
304 3300027907 Ga0207428_10000440 Ga0207428_1000044024 235
305 3300028380 Ga0268265_10266988 Ga0268265_102669882 235
306 3300042435 Ga0439434_0033961 Ga0439434_0033961_360_1142 235
307 3300046455 Ga0495603_0000026 Ga0495603_0000026_59640_60410 235
308 3300046459 Ga0495629_0096213 Ga0495629_0096213_198_968 235
309 3300048927 Ga0496124_0000174 Ga0496124_0000174_13781_14563 235
310 3300049570 Ga0501033_0103766 Ga0501033_0103766_178_897 235
311 3300049572 Ga0501036_0098239 Ga0501036_0098239_756_1475 235
312 3300049576 Ga0501040_0008431 Ga0501040_0008431_310_1029 235
313 3300049577 Ga0501041_0018246 Ga0501041_0018246_1340_2059 235
314 3300049580 Ga0501046_0060051 Ga0501046_0060051_1471_2190 235
315 3300049582 Ga0501048_0046877 Ga0501048_0046877_1606_2325 235
316 3300049584 Ga0501068_0209137 Ga0501068_0209137_154_873 235
317 3300049587 Ga0501071_0149415 Ga0501071_0149415_971_1690 235
318 3300049590 Ga0501074_0060176 Ga0501074_0060176_825_1544 235
319 3300049591 Ga0501075_0004606 Ga0501075_0004606_5573_6292 235
320 3300049592 Ga0501076_0004436 Ga0501076_0004436_1661_2380 235
321 3300049741 Ga0501079_0007738 Ga0501079_0007738_923_1663 235
322 3300049742 Ga0501080_0048854 Ga0501080_0048854_2611_3330 235
323 3300049743 Ga0501081_0002638 Ga0501081_0002638_1175_1894 235
324 3300049824 Ga0501045_0002264 Ga0501045_0002264_1935_2654 235
325 3300050507 nmdc:mga05p37_17400_c1 nmdc:mga05p37_17400_c1_7597_8316 235
326 3300050508 nmdc:mga09592_137341_c1 nmdc:mga09592_137341_c1_1266_1985 235
327 3300050510 nmdc:mga06r32_14807_c1 nmdc:mga06r32_14807_c1_3934_4653 235
328 3300050511 nmdc:mga08y16_118606_c1 nmdc:mga08y16_118606_c1_805_1545 235
329 3300050512 nmdc:mga0n895_101779_c1 nmdc:mga0n895_101779_c1_1617_2357 235
330 3300050513 nmdc:mga0rr50_366844_c1 nmdc:mga0rr50_366844_c1_241_981 235
331 3300050514 nmdc:mga08x19_170205_c1 nmdc:mga08x19_170205_c1_84_824 235
332 3300050515 nmdc:mga0a205_36894_c1 nmdc:mga0a205_36894_c1_1918_2658 235
333 3300054114 Ga0501084_0000488 Ga0501084_0000488_689_1408 235
334 3300060353 Ga0501082_0022657 Ga0501082_0022657_2274_2993 235
335 3300061734 Ga0530510_0018710 Ga0530510_0018710_2358_3077 235
336 iso_pu_bacteria 2509276021 2509389433 235
337 iso_pu_bacteria 2509276033 2509446170 235
338 iso_pu_bacteria 2510065019 2510135224 235
339 iso_pu_bacteria 2510461069 2510841556 235
340 iso_pu_bacteria 2510461076 2510896678 235
341 iso_pu_bacteria 2510917028 2511183976 235
342 iso_pu_bacteria 2510917030 2511194580 235
343 iso_pu_bacteria 2513237084 2513571608 235
344 iso_pu_bacteria 2513237085 2513578641 235
345 iso_pu_bacteria 2513237088 2513596807 235
346 iso_pu_bacteria 2513237093 2513630174 235
347 iso_pu_bacteria 2513237103 2513711328 235
348 iso_pu_bacteria 2513237138 2513867458 235
349 iso_pu_bacteria 2513237144 2513912356 235
350 iso_pu_bacteria 2513237146 2513928459 235
351 iso_pu_bacteria 2513237162 2514019378 235
352 iso_pu_bacteria 2515075009 2515114380 235
353 iso_pu_bacteria 2515154113 2515635385 235
354 iso_pu_bacteria 2515154114 2515643208 235
355 iso_pu_bacteria 2515154116 2515657672 235
356 iso_pu_bacteria 2515154134 2515741565 235
357 iso_pu_bacteria 2516653077 2517038031 235
358 iso_pu_bacteria 2516653085 2517078296 235
359 iso_pu_bacteria 2517093000 2517097055 235
360 iso_pu_bacteria 2517287029 2517408561 235
361 iso_pu_bacteria 2519899620 2520379681 235
362 iso_pu_bacteria 2529292951 2530647373 235
363 iso_pu_bacteria 2582581294 2585201760 235
364 iso_pu_bacteria 2582581298 2585223901 235
365 iso_pu_bacteria 2582581867 2585399726 235
366 iso_pu_bacteria 2585427526 2585526067 235
367 iso_pu_bacteria 2585427528 2585540756 235
368 iso_pu_bacteria 2585427529 2585549124 235
369 iso_pu_bacteria 2585427590 2585820813 235
370 iso_pu_bacteria 2585427593 2585839026 235
371 iso_pu_bacteria 2599185170 2599420171 235
372 iso_pu_bacteria 2615840624 2616296337 235
373 iso_pu_bacteria 2718217882 2719182941 235
374 iso_pu_bacteria 2718217927 2719387654 235
375 iso_pu_bacteria 2718217997 2719667286 235
376 iso_pu_bacteria 2718218009 2719733658 235
377 iso_pu_bacteria 2718218199 2720493706 235
378 iso_pu_bacteria 2718218232 2720615159 235
379 iso_pu_bacteria 2718218233 2720621954 235
380 iso_pu_bacteria 2718218235 2720633304 235
381 iso_pu_bacteria 2718218269 2720777002 235
382 iso_pu_bacteria 2718218363 2721149053 235
383 iso_pu_bacteria 2718218365 2721160451 235
384 iso_pu_bacteria 2718218366 2721165866 235
385 iso_pu_bacteria 2718218423 2721401288 235
386 iso_pu_bacteria 2721755514 2722842036 235
387 iso_pu_bacteria 2721755556 2723028600 235
388 iso_pu_bacteria 2721755684 2723562204 235
389 iso_pu_bacteria 2721755685 2723568907 235
390 iso_pu_bacteria 2721755809 2724040102 235
391 iso_pu_bacteria 2721755810 2724046414 235
392 iso_pu_bacteria 2721755819 2724091609 235
393 iso_pu_bacteria 2721755822 2724106172 235
394 iso_pu_bacteria 2721755823 2724111978 235
395 iso_pu_bacteria 2724679232 2725947515 235
396 iso_pu_bacteria 2728369352 2730109536 235
397 iso_pu_bacteria 2728369365 2730166176 235
398 iso_pu_bacteria 2728369397 2730300083 235
399 iso_pu_bacteria 2738541333 2739037253 235
400 iso_pu_bacteria 2765235942 2766064290 235
401 iso_pu_bacteria 2791355256 2793295650 235
402 iso_pu_bacteria 2791355259 2793313401 235
403 iso_pu_bacteria 2791355260 2793320689 235
404 iso_pu_bacteria 2791355261 2793327260 235
405 iso_pu_bacteria 2791355262 2793332215 235
406 iso_pu_bacteria 2791355263 2793338790 235
407 iso_pu_bacteria 2791355264 2793346578 235
408 iso_pu_bacteria 2791355265 2793353883 235
409 iso_pu_bacteria 2791355266 2793359418 235
410 iso_pu_bacteria 2791355267 2793365881 235
411 iso_pu_bacteria 2802429605 2805926193 235
412 iso_pu_bacteria 2802429606 2805933919 235
413 iso_pu_bacteria 2802429633 2806047344 235
414 iso_pu_bacteria 2802429634 2806054199 235
415 iso_pu_bacteria 2802429635 2806060217 235
416 iso_pu_bacteria 2802429636 2806068828 235
417 iso_pu_bacteria 2802429637 2806076434 235
418 iso_pu_bacteria 2818991272 2819244688 235
419 iso_pu_bacteria 2838016132 2838018355 235
420 iso_pu_bacteria 2838022645 2838024038 235
421 iso_pu_bacteria 2838035591 2838040377 235
422 iso_pu_bacteria 2838042994 2838047817 235
423 iso_pu_bacteria 2838048938 2838050783 235
424 iso_pu_bacteria 2838061910 2838062549 235
425 iso_pu_bacteria 2838068647 2838072100 235
426 iso_pu_bacteria 2838661181 2838667791 235
427 iso_pu_bacteria 2838668709 2838672141 235
428 iso_pu_bacteria 2838680041 2838683901 235
429 iso_pu_bacteria 2838686498 2838690259 235
430 iso_pu_bacteria 2838694306 2838698429 235
431 iso_pu_bacteria 2838701080 2838704989 235
432 iso_pu_bacteria 2838707686 2838711544 235
433 iso_pu_bacteria 2838729681 2838732034 235
434 iso_pu_bacteria 2838742623 2838744930 235
435 iso_pu_bacteria 2841851746 2841855988 235
436 iso_pu_bacteria 2841864319 2841867782 235
437 iso_pu_bacteria 2842077413 2842081345 235
438 iso_pu_bacteria 2842110456 2842116878 235
439 iso_pu_bacteria 2842118031 2842121878 235
440 iso_pu_bacteria 2842146304 2842148775 235
441 iso_pu_bacteria 2842156927 2842161158 235
442 iso_pu_bacteria 2842163707 2842166669 235
443 iso_pu_bacteria 2842180545 2842184774 235
444 iso_pu_bacteria 2842192696 2842194905 235
445 iso_pu_bacteria 2842198810 2842201631 235
446 iso_pu_bacteria 2842205361 2842207397 235
447 iso_pu_bacteria 2842217011 2842221756 235
448 iso_pu_bacteria 2842229732 2842232356 235
449 iso_pu_bacteria 2842237096 2842240892 235
450 iso_pu_bacteria 2842243621 2842246772 235
451 iso_pu_bacteria 2842250916 2842254670 235
452 iso_pu_bacteria 2842257432 2842261127 235
453 iso_pu_bacteria 2842264693 2842269615 235
454 iso_pu_bacteria 2842271015 2842274279 235
455 iso_pu_bacteria 2842278818 2842280892 235
456 iso_pu_bacteria 2842285085 2842288495 235
457 iso_pu_bacteria 2842291075 2842295002 235
458 iso_pu_bacteria 2842304105 2842305878 235
459 iso_pu_bacteria 2842311132 2842311387 235
460 iso_pu_bacteria 2842317721 2842321088 235
461 iso_pu_bacteria 2842341865 2842346606 235
462 iso_pu_bacteria 2842363717 2842366296 235
463 iso_pu_bacteria 2842370503 2842374980 235
464 iso_pu_bacteria 2842377471 2842381401 235
465 iso_pu_bacteria 2842384541 2842388471 235
466 iso_pu_bacteria 2842395702 2842395967 235
467 iso_pu_bacteria 2842402390 2842406159 235
468 iso_pu_bacteria 2842409023 2842412744 235
469 iso_pu_bacteria 2842415677 2842419377 235
470 iso_pu_bacteria 2842422224 2842425732 235
471 iso_pu_bacteria 2842428310 2842433623 235
472 iso_pu_bacteria 2842434925 2842439951 235
473 iso_pu_bacteria 2842441272 2842446580 235
474 iso_pu_bacteria 2842447887 2842448804 235
475 iso_pu_bacteria 2842462802 2842467911 235
476 iso_pu_bacteria 2842469257 2842474560 235
477 iso_pu_bacteria 2842489311 2842491141 235
478 iso_pu_bacteria 2842495871 2842498478 235
479 iso_pu_bacteria 2844454524 2844457042 235
480 iso_pu_bacteria 2857516855 2857519550 235
481 iso_pu_bacteria 2919100787 2919105362 235
482 iso_pu_bacteria 2923556063 2923559513 235
483 iso_pu_bacteria 2933016740 2933017003 235
484 iso_pu_bacteria 2933570622 2933572383 235
485 iso_pu_bacteria 2933586486 2933593118 235
486 iso_pu_bacteria 2933599457 2933603046 235
487 iso_pu_bacteria 2935894831 2935897920 235
488 iso_pu_bacteria 2935901341 2935903659 235
489 iso_pu_bacteria 2936367885 2936369865 235
490 iso_pu_bacteria 2936375103 2936379051 235
491 iso_pu_bacteria 2936381700 2936381974 235
492 iso_pu_bacteria 2996887358 2996890217 235
493 iso_pu_bacteria 2996893221 2996895257 235
494 iso_pu_bacteria 3005445848 3005449636 235
495 iso_pu_bacteria 639633055 639650409 235
496 iso_pu_bacteria 8005258706 8005262401 235
497 iso_pu_bacteria 8005275841 8005282409 235
498 iso_pu_bacteria 8005282627 8005286772 235
499 iso_pu_bacteria 8005289223 8005295060 235
500 iso_pu_bacteria 8005301065 8005305939 235
501 iso_pu_bacteria 8005307578 8005313674 235
502 iso_pu_bacteria 8005321885 8005324744 235
503 iso_pu_bacteria 8005376324 8005381591 235
504 iso_pu_bacteria 8005382845 8005387796 235
505 iso_pu_bacteria 8005395548 8005400832 235
506 iso_pu_bacteria 8005430974 8005431082 235
507 iso_pu_bacteria 8005460587 8005465071 235
508 iso_pu_bacteria 8005497431 8005497650 235
509 iso_pu_bacteria 8005542996 8005546648 235
510 iso_pu_bacteria 8005556819 8005561147 235
511 iso_pu_bacteria 8005563573 8005565773 235
512 iso_pu_bacteria 8005570704 8005571820 235
513 iso_pu_bacteria 8005619151 8005623384 235
514 iso_pu_bacteria 8005626139 8005631036 235
515 iso_pu_bacteria 8005668836 8005669055 235
516 iso_pu_bacteria 8005688590 8005694362 235
517 iso_pu_bacteria 8005695170 8005695710 235
518 iso_pu_bacteria 8018127388 8018128887 235
519 iso_pu_bacteria 8018150411 8018153340 235
520 iso_pu_bacteria 8018163183 8018165115 235
521 iso_pu_bacteria 8018176218 8018177126 235
522 iso_pu_bacteria 8023680758 8023686513 235
523 iso_pu_bacteria 8024479707 8024484346 235
524 iso_pu_bacteria 8024501048 8024502348 235
525 iso_pu_bacteria 8056375014 8056380390 235
526 iso_pu_bacteria 8056382006 8056385222 235
527 iso_pu_bacteria 8057874678 8057879263 235
528 3300003559 Ga0007427J51700_109799 Ga0007427J51700_1097991 236
529 3300003578 Ga0006562J51391_1003372 Ga0006562J51391_10033721 236
530 3300003856 Ga0058692_1002779 Ga0058692_10027793 236
531 3300003856 Ga0058692_1005607 Ga0058692_10056072 236
532 3300005353 Ga0070669_100173302 Ga0070669_1001733022 236
533 3300005436 Ga0070713_100209208 Ga0070713_1002092082 236
534 3300005530 Ga0070679_100086982 Ga0070679_1000869823 236
535 3300005548 Ga0070665_100004011 Ga0070665_1000040114 236
536 3300006038 Ga0075365_10026456 Ga0075365_100264562 236
537 3300006038 Ga0075365_10362224 Ga0075365_103622242 236
538 3300006177 Ga0075362_10014524 Ga0075362_100145242 236
539 3300006186 Ga0075369_10067768 Ga0075369_100677682 236
540 3300006353 Ga0075370_10174540 Ga0075370_101745401 236
541 3300006871 Ga0075434_100098722 Ga0075434_1000987223 236
542 3300006914 Ga0075436_100012045 Ga0075436_1000120455 236
543 3300009148 Ga0105243_10123484 Ga0105243_101234841 236
544 3300011119 Ga0105246_10179528 Ga0105246_101795281 236
545 3300013100 Ga0157373_10003539 Ga0157373_1000353913 236
546 3300013102 Ga0157371_10000108 Ga0157371_1000010860 236
547 3300020077 Ga0206351_10386933 Ga0206351_103869331 236
548 3300020078 Ga0206352_11134782 Ga0206352_111347821 236
549 3300020081 Ga0206354_10281947 Ga0206354_102819471 236
550 3300020082 Ga0206353_10082534 Ga0206353_100825341 236
551 3300021388 Ga0213875_10000033 Ga0213875_1000003383 236
552 3300025294 Ga0209025_1000487 Ga0209025_100048736 236
553 3300025912 Ga0207707_10604232 Ga0207707_106042321 236
554 3300025928 Ga0207700_10168542 Ga0207700_101685422 236
555 3300025935 Ga0207709_10049806 Ga0207709_100498062 236
556 3300027312 Ga0209371_1000037 Ga0209371_1000037127 236
557 3300027312 Ga0209371_1002109 Ga0209371_10021092 236
558 3300030500 Ga0268256_1000039 Ga0268256_1000039182 236
559 3300030500 Ga0268256_1036812 Ga0268256_10368122 236
560 3300030744 Ga0316181_1198006 Ga0316181_11980064 236
561 3300048920 Ga0496117_0000031 Ga0496117_0000031_147282_148019 236
562 3300048921 Ga0496118_0009274 Ga0496118_0009274_6940_7677 236
563 3300048923 Ga0496120_0002641 Ga0496120_0002641_2413_3150 236
564 3300048925 Ga0496122_0000023 Ga0496122_0000023_147282_148019 236
565 3300048925 Ga0496122_0008748 Ga0496122_0008748_7736_8473 236
566 3300048926 Ga0496123_0000027 Ga0496123_0000027_233017_233754 236
567 3300048927 Ga0496124_0002248 Ga0496124_0002248_8399_9136 236
568 3300048929 Ga0496126_0132120 Ga0496126_0132120_36_773 236
569 3300048929 Ga0496126_0303763 Ga0496126_0303763_36_773 236
570 3300050491 nmdc:mga00v17_151_c1 nmdc:mga00v17_151_c1_33480_34217 236
571 3300050492 nmdc:mga0yw44_359767_c1 nmdc:mga0yw44_359767_c1_181_918 236
572 3300050492 nmdc:mga0yw44_4983_c1 nmdc:mga0yw44_4983_c1_1743_2480 236
573 3300050493 nmdc:mga0k408_156037_c1 nmdc:mga0k408_156037_c1_338_1075 236
574 3300050494 nmdc:mga06z11_200613_c1 nmdc:mga06z11_200613_c1_387_1124 236
575 3300050494 nmdc:mga06z11_259719_c1 nmdc:mga06z11_259719_c1_220_957 236
576 3300050496 nmdc:mga07m45_210135_c1 nmdc:mga07m45_210135_c1_114_851 236
577 3300050512 nmdc:mga0n895_117208_c1 nmdc:mga0n895_117208_c1_1537_2271 236
578 3300050514 nmdc:mga08x19_8993_c2 nmdc:mga08x19_8993_c2_190_924 236
579 3300050516 nmdc:mga0sz30_107_c1 nmdc:mga0sz30_107_c1_8961_9698 236
580 3300050516 nmdc:mga0sz30_78283_c1 nmdc:mga0sz30_78283_c1_34_771 236
581 3300053107 Ga0500560_001253 Ga0500560_001253_3288_4025 236
582 3300053108 Ga0500562_011866 Ga0500562_011866_958_1692 236
583 3300053137 Ga0500561_0004680 Ga0500561_0004680_206_943 236
584 3300053177 Ga0500636_0000040 Ga0500636_0000040_7668_8405 236
585 3300054114 Ga0501084_0072325 Ga0501084_0072325_1353_2099 236
586 3300059477 Ga0587084_012964 Ga0587084_012964_63_800 236
587 3300059490 Ga0587066_008862 Ga0587066_008862_450_1187 236
588 3300059493 Ga0587077_058795 Ga0587077_058795_22_759 236
589 3300059504 Ga0587082_030751 Ga0587082_030751_177_914 236
590 3300059506 Ga0587085_008191 Ga0587085_008191_71_808 236
591 3300059508 Ga0587088_014040 Ga0587088_014040_435_1172 236
592 3300059508 Ga0587088_036020 Ga0587088_036020_102_839 236
593 3300059509 Ga0587089_016140 Ga0587089_016140_40_777 236
594 3300059510 Ga0587090_000942 Ga0587090_000942_1786_2523 236
595 3300059511 Ga0587091_028679 Ga0587091_028679_71_808 236
596 3300059604 Ga0587098_020948 Ga0587098_020948_27_764 236
597 3300059609 Ga0587131_004979 Ga0587131_004979_18_755 236
598 3300059624 Ga0587109_031993 Ga0587109_031993_190_927 236
599 3300059630 Ga0587128_031643 Ga0587128_031643_74_811 236
600 3300059639 Ga0587062_005423 Ga0587062_005423_71_808 236
601 3300059640 Ga0587067_010337 Ga0587067_010337_66_803 236
602 3300059643 Ga0587072_000182 Ga0587072_000182_93_830 236
603 3300059645 Ga0587076_010905 Ga0587076_010905_517_1254 236
604 3300059652 Ga0587107_024049 Ga0587107_024049_69_806 236
605 3300059653 Ga0587108_010063 Ga0587108_010063_40_777 236
606 3300060344 Ga0587071_057491 Ga0587071_057491_63_800 236
607 3300060346 Ga0587111_0063867 Ga0587111_0063867_39_776 236
608 iso_pu_bacteria 2582581299 2585228763 236
609 iso_pu_bacteria 2582581304 2585257391 236
610 iso_pu_bacteria 2643221599 2644002448 236
611 iso_pu_bacteria 2643221634 2644194846 236
612 iso_pu_bacteria 2643221643 2644240526 236
613 iso_pu_bacteria 2643221674 2644412309 236
614 iso_pu_bacteria 2932401849 2932405758 236
615 iso_pu_bacteria 2939669807 2939674287 236
616 iso_pu_bacteria 3005409236 3005415774 236
617 iso_pu_bacteria 3005452660 3005455919 236
618 3300009093 Ga0105240_10654649 Ga0105240_106546492 237
619 3300013104 Ga0157370_10308314 Ga0157370_103083142 237
620 3300025920 Ga0207649_10000822 Ga0207649_1000082210 237
621 3300031250 Ga0265331_10000625 Ga0265331_1000062536 237
622 3300031251 Ga0265327_10001092 Ga0265327_1000109221 237
623 3300031711 Ga0265314_10018826 Ga0265314_100188263 237
624 3300049571 Ga0501034_0050536 Ga0501034_0050536_3108_3851 237
625 3300049580 Ga0501046_0030285 Ga0501046_0030285_3001_3741 237
626 iso_pu_bacteria 2508501122 2509109575 237
627 iso_pu_bacteria 2509276019 2509378101 237
628 iso_pu_bacteria 2510065057 2510305465 237
629 iso_pu_bacteria 2511231052 2511498477 237
630 iso_pu_bacteria 2512047086 2512534621 237
631 iso_pu_bacteria 2512875026 2512973574 237
632 iso_pu_bacteria 2513237086 2513583639 237
633 iso_pu_bacteria 2513237089 2513601907 237
634 iso_pu_bacteria 2513237091 2513615712 237
635 iso_pu_bacteria 2513237140 2513884993 237
636 iso_pu_bacteria 2513237143 2513905203 237
637 iso_pu_bacteria 2513237160 2514003493 237
638 iso_pu_bacteria 2515154107 2515611050 237
639 iso_pu_bacteria 2516143018 2516205563 237
640 iso_pu_bacteria 2516653046 2516894757 237
641 iso_pu_bacteria 2517487022 2517571422 237
642 iso_pu_bacteria 2524023207 2524450432 237
643 iso_pu_bacteria 2551306084 2551676611 237
644 iso_pu_bacteria 2551306084 2551680235 237
645 iso_pu_bacteria 2551306085 2551685065 237
646 iso_pu_bacteria 2551306086 2551694464 237
647 iso_pu_bacteria 2551306087 2551702663 237
648 iso_pu_bacteria 2551306089 2551708341 237
649 iso_pu_bacteria 2551306090 2551717593 237
650 iso_pu_bacteria 2551306091 2551731596 237
651 iso_pu_bacteria 2551306092 2551736180 237
652 iso_pu_bacteria 2551306093 2551746093 237
653 iso_pu_bacteria 2558860100 2558867398 237
654 iso_pu_bacteria 2599185156 2599335123 237
655 iso_pu_bacteria 2599185352 2600193351 237
656 iso_pu_bacteria 2643221558 2643813734 237
657 iso_pu_bacteria 2643221618 2644110168 237
658 iso_pu_bacteria 2643221626 2644150444 237
659 iso_pu_bacteria 2643221655 2644313048 237
660 iso_pu_bacteria 2643221659 2644336596 237
661 iso_pu_bacteria 2643221698 2644546243 237
662 iso_pu_bacteria 2643221712 2644618778 237
663 iso_pu_bacteria 2643221723 2644677077 237
664 iso_pu_bacteria 2657244999 2657682410 237
665 iso_pu_bacteria 2690316117 2692319942 237
666 iso_pu_bacteria 2751185821 2753458584 237
667 iso_pu_bacteria 2791355082 2792582240 237
668 iso_pu_bacteria 2791355091 2792621913 237
669 iso_pu_bacteria 2791355092 2792628830 237
670 iso_pu_bacteria 2791355094 2792639975 237
671 iso_pu_bacteria 2802428859 2802724800 237
672 iso_pu_bacteria 2802429268 2804753697 237
673 iso_pu_bacteria 2838074704 2838078165 237
674 iso_pu_bacteria 2842922631 2842926313 237
675 iso_pu_bacteria 2844163670 2844166257 237
676 iso_pu_bacteria 2847417321 2847420834 237
677 iso_pu_bacteria 2848992105 2848995661 237
678 iso_pu_bacteria 2850079185 2850082637 237
679 iso_pu_bacteria 2855825444 2855827385 237
680 iso_pu_bacteria 2855839649 2855842763 237
681 iso_pu_bacteria 2855872281 2855878198 237
682 iso_pu_bacteria 2858800743 2858802101 237
683 iso_pu_bacteria 2889914905 2889917273 237
684 iso_pu_bacteria 2894817345 2894821555 237
685 iso_pu_bacteria 2896384573 2896390194 237
686 iso_pu_bacteria 2913295892 2913300182 237
687 iso_pu_bacteria 2915980308 2915982424 237
688 iso_pu_bacteria 2915986958 2915992787 237
689 iso_pu_bacteria 2915993759 2915996464 237
690 iso_pu_bacteria 2916000859 2916005886 237
691 iso_pu_bacteria 2916007675 2916010591 237
692 iso_pu_bacteria 2916014648 2916018143 237
693 iso_pu_bacteria 2916021584 2916022924 237
694 iso_pu_bacteria 2916028427 2916034399 237
695 iso_pu_bacteria 2916035215 2916036046 237
696 iso_pu_bacteria 2916041962 2916045058 237
697 iso_pu_bacteria 2916048683 2916050756 237
698 iso_pu_bacteria 2916055098 2916061835 237
699 iso_pu_bacteria 2916061851 2916065010 237
700 iso_pu_bacteria 2916068649 2916074946 237
701 iso_pu_bacteria 2916076590 2916077733 237
702 iso_pu_bacteria 2920760137 2920760321 237
703 iso_pu_bacteria 2920822456 2920825948 237
704 iso_pu_bacteria 2921201388 2921206912 237
705 iso_pu_bacteria 2921208531 2921215108 237
706 iso_pu_bacteria 2921237296 2921239820 237
707 iso_pu_bacteria 2921244191 2921245807 237
708 iso_pu_bacteria 2921250672 2921252934 237
709 iso_pu_bacteria 2921257292 2921259016 237
710 iso_pu_bacteria 2921263974 2921264700 237
711 iso_pu_bacteria 2921282425 2921284564 237
712 iso_pu_bacteria 2921289301 2921296122 237
713 iso_pu_bacteria 2921296804 2921303368 237
714 iso_pu_bacteria 2924144063 2924146620 237
715 iso_pu_bacteria 2924150972 2924152538 237
716 iso_pu_bacteria 2924158325 2924161578 237
717 iso_pu_bacteria 2924165586 2924169677 237
718 iso_pu_bacteria 2924172951 2924174196 237
719 iso_pu_bacteria 2924179722 2924185126 237
720 iso_pu_bacteria 2924186466 2924187854 237
721 iso_pu_bacteria 2924193448 2924193596 237
722 iso_pu_bacteria 2924200457 2924201780 237
723 iso_pu_bacteria 2924207177 2924210303 237
724 iso_pu_bacteria 2924214083 2924221043 237
725 iso_pu_bacteria 2924221636 2924225858 237
726 iso_pu_bacteria 2924228884 2924229537 237
727 iso_pu_bacteria 2936996657 2936998964 237
728 iso_pu_bacteria 2937002841 2937006613 237
729 iso_pu_bacteria 2937009748 2937014622 237
730 iso_pu_bacteria 2937016420 2937019012 237
731 iso_pu_bacteria 2937023124 2937026019 237
732 iso_pu_bacteria 2937029754 2937031854 237
733 iso_pu_bacteria 2937042894 2937045102 237
734 iso_pu_bacteria 2937049772 2937053476 237
735 iso_pu_bacteria 2937056579 2937060069 237
736 iso_pu_bacteria 2937063883 2937065134 237
737 iso_pu_bacteria 2937071275 2937072790 237
738 iso_pu_bacteria 2937078374 2937082051 237
739 iso_pu_bacteria 2937091812 2937098092 237
740 iso_pu_bacteria 2937098957 2937101268 237
741 iso_pu_bacteria 2937106411 2937109135 237
742 iso_pu_bacteria 2937113482 2937116005 237
743 iso_pu_bacteria 2937119839 2937126078 237
744 iso_pu_bacteria 2937126314 2937127743 237
745 iso_pu_bacteria 2941499720 2941501369 237
746 iso_pu_bacteria 2957382221 2957384691 237
747 iso_pu_bacteria 2957388812 2957391461 237
748 iso_pu_bacteria 2957395598 2957400785 237
749 iso_pu_bacteria 2957402308 2957404431 237
750 iso_pu_bacteria 2957408893 2957411823 237
751 iso_pu_bacteria 2957415311 2957416704 237
752 iso_pu_bacteria 2957422303 2957428719 237
753 iso_pu_bacteria 2957430029 2957432026 237
754 iso_pu_bacteria 2957443900 2957450292 237
755 iso_pu_bacteria 2957450854 2957451938 237
756 iso_pu_bacteria 2957457609 2957461220 237
757 iso_pu_bacteria 2957464669 2957470921 237
758 iso_pu_bacteria 2957471148 2957474167 237
759 iso_pu_bacteria 2957478035 2957479357 237
760 iso_pu_bacteria 2957484790 2957489782 237
761 iso_pu_bacteria 2957491536 2957494546 237
762 iso_pu_bacteria 2957498199 2957503964 237
763 iso_pu_bacteria 2957505466 2957512210 237
764 iso_pu_bacteria 2960584000 2960586470 237
765 iso_pu_bacteria 2960597568 2960599193 237
766 iso_pu_bacteria 2960603979 2960609767 237
767 iso_pu_bacteria 2960610863 2960613280 237
768 iso_pu_bacteria 2960617483 2960618303 237
769 iso_pu_bacteria 2960624210 2960628480 237
770 iso_pu_bacteria 2960637947 2960643792 237
771 iso_pu_bacteria 2960645483 2960651387 237
772 iso_pu_bacteria 2960652885 2960659385 237
773 iso_pu_bacteria 2960660292 2960666830 237
774 iso_pu_bacteria 2960667422 2960673179 237
775 iso_pu_bacteria 2960674078 2960674619 237
776 iso_pu_bacteria 2960687367 2960691587 237
777 iso_pu_bacteria 2960693952 2960698228 237
778 iso_pu_bacteria 2964607997 2964613143 237
779 iso_pu_bacteria 2964615318 2964619359 237
780 iso_pu_bacteria 2964621998 2964627094 237
781 iso_pu_bacteria 2964628898 2964633234 237
782 iso_pu_bacteria 2964636051 2964641609 237
783 iso_pu_bacteria 2964643177 2964645928 237
784 iso_pu_bacteria 2964649959 2964654896 237
785 iso_pu_bacteria 2964656573 2964659590 237
786 iso_pu_bacteria 2964663802 2964669004 237
787 iso_pu_bacteria 2964670856 2964672152 237
788 iso_pu_bacteria 2964678106 2964681247 237
789 iso_pu_bacteria 2964685014 2964686733 237
790 iso_pu_bacteria 2964691889 2964695032 237
791 iso_pu_bacteria 2964698721 2964701387 237
792 iso_pu_bacteria 2964705432 2964707079 237
793 iso_pu_bacteria 2964712639 2964712771 237
794 iso_pu_bacteria 2964719344 2964726694 237
795 iso_pu_bacteria 2967664464 2967670620 237
796 iso_pu_bacteria 2967671571 2967676982 237
797 iso_pu_bacteria 2967678726 2967681713 237
798 iso_pu_bacteria 2967693043 2967695469 237
799 iso_pu_bacteria 2967699805 2967702358 237
800 iso_pu_bacteria 2967706974 2967712467 237
801 iso_pu_bacteria 2967714385 2967719557 237
802 iso_pu_bacteria 2967721400 2967726925 237
803 iso_pu_bacteria 2967735183 2967738353 237
804 iso_pu_bacteria 2967742019 2967744815 237
805 iso_pu_bacteria 2967748971 2967755460 237
806 iso_pu_bacteria 2967755722 2967761908 237
807 iso_pu_bacteria 2967762386 2967766404 237
808 iso_pu_bacteria 2967769361 2967772903 237
809 iso_pu_bacteria 2967775926 2967778315 237
810 iso_pu_bacteria 2970019648 2970023635 237
811 iso_pu_bacteria 2970033650 2970034492 237
812 iso_pu_bacteria 2970040964 2970044908 237
813 iso_pu_bacteria 2970047711 2970052437 237
814 iso_pu_bacteria 2970054988 2970058947 237
815 iso_pu_bacteria 2970061556 2970063551 237
816 iso_pu_bacteria 2970068827 2970069872 237
817 iso_pu_bacteria 2970076120 2970076892 237
818 iso_pu_bacteria 2970082768 2970086274 237
819 iso_pu_bacteria 2970088815 2970092854 237
820 iso_pu_bacteria 2970095765 2970101259 237
821 iso_pu_bacteria 2970102677 2970105359 237
822 iso_pu_bacteria 2970109326 2970112974 237
823 iso_pu_bacteria 2970116247 2970116828 237
824 iso_pu_bacteria 2970129317 2970133632 237
825 iso_pu_bacteria 2970136068 2970140968 237
826 iso_pu_bacteria 2970149975 2970152917 237
827 iso_pu_bacteria 2970156795 2970157997 237
828 iso_pu_bacteria 2970164137 2970170866 237
829 iso_pu_bacteria 2970170962 2970174738 237
830 iso_pu_bacteria 2970177841 2970178130 237
831 iso_pu_bacteria 2970184632 2970190793 237
832 iso_pu_bacteria 2970191845 2970192832 237
833 iso_pu_bacteria 2977516862 2977520049 237
834 iso_pu_bacteria 2977523885 2977525529 237
835 iso_pu_bacteria 2977537788 2977540373 237
836 iso_pu_bacteria 2977551784 2977553199 237
837 iso_pu_bacteria 2977558990 2977562159 237
838 iso_pu_bacteria 2977565890 2977571082 237
839 iso_pu_bacteria 2977572785 2977573310 237
840 iso_pu_bacteria 2977579622 2977585610 237
841 iso_pu_bacteria 643692032 643827429 237
842 iso_pu_bacteria 648276728 648737201 237
843 iso_pu_bacteria 8003992118 8003995343 237
844 iso_pu_bacteria 8024486573 8024490827 237
845 iso_pu_bacteria 8049293176 8049296295 237
846 iso_pu_bacteria 8055431914 8055435588 237
847 3300012513 Ga0157326_1003319 Ga0157326_10033193 238
848 3300048924 Ga0496121_0135242 Ga0496121_0135242_730_1500 238
849 3300048929 Ga0496126_0058103 Ga0496126_0058103_197_967 238
850 3300049527 Ga0501311_024221 Ga0501311_024221_52_822 238
851 3300049571 Ga0501034_0007485 Ga0501034_0007485_1129_1899 238
852 3300049589 Ga0501073_0002812 Ga0501073_0002812_9424_10200 238
853 3300053161 Ga0500634_0000028 Ga0500634_0000028_46910_47680 238
854 iso_pu_bacteria 2582581308 2585280702 238
855 iso_pu_bacteria 2582581315 2585326487 238
856 iso_pu_bacteria 2582581316 2585334171 238
857 iso_pu_bacteria 2585427527 2585531636 238
858 iso_pu_bacteria 2585427530 2585551417 238
859 iso_pu_bacteria 2585427594 2585844889 238
860 iso_pu_bacteria 2615840626 2616306753 238
861 iso_pu_bacteria 2615840698 2616557599 238
862 iso_pu_bacteria 2617270742 2617383272 238
863 iso_pu_bacteria 2667528174 2671113495 238
864 iso_pu_bacteria 2738541293 2738805597 238
865 iso_pu_bacteria 2775507266 2778173731 238
866 iso_pu_bacteria 2818991448 2819611224 238
867 iso_pu_bacteria 2818991453 2819638847 238
868 iso_pu_bacteria 2837651117 2837651269 238
869 iso_pu_bacteria 2838029111 2838030913 238
870 iso_pu_bacteria 2842475841 2842477645 238
871 iso_pu_bacteria 2842482326 2842484950 238
872 iso_pu_bacteria 2842502639 2842504482 238
873 iso_pu_bacteria 2919408235 2919411048 238
874 iso_pu_bacteria 3005416602 3005421641 238
875 iso_pu_bacteria 8005314921 8005319654 238
876 iso_pu_bacteria 8005484373 8005490277 238
877 iso_pu_bacteria 8005645114 8005646933 238
878 iso_pu_bacteria 8005682033 8005688006 238
879 3300001979 JGI24740J21852_10077057 JGI24740J21852_100770571 239
880 3300002739 JGI25158J39367_1000061 JGI25158J39367_10000615 239
881 3300002773 JGI25152J39213_1002753 JGI25152J39213_10027536 239
882 3300002773 JGI25152J39213_1004278 JGI25152J39213_10042783 239
883 3300002774 JGI25150J39212_1021423 JGI25150J39212_10214232 239
884 3300002987 JGI25159J45721_1012147 JGI25159J45721_10121472 239
885 3300003187 JGI25151J46595_10068304 JGI25151J46595_100683041 239
886 3300003354 JGI25160J50197_1005889 JGI25160J50197_10058894 239
887 3300003354 JGI25160J50197_1035580 JGI25160J50197_10355802 239
888 3300003374 JGI25161J50226_1000137 JGI25161J50226_10001375 239
889 3300003771 Ga0055526_1003979 Ga0055526_10039795 239
890 3300003771 Ga0055526_1008345 Ga0055526_10083455 239
891 3300003771 Ga0055526_1013997 Ga0055526_10139972 239
892 3300003775 Ga0055524_1001868 Ga0055524_10018688 239
893 3300003775 Ga0055524_1005075 Ga0055524_10050753 239
894 3300003775 Ga0055524_1032827 Ga0055524_10328272 239
895 3300003790 Ga0055528_1002500 Ga0055528_10025005 239
896 3300003790 Ga0055528_1004711 Ga0055528_10047114 239
897 3300003790 Ga0055528_1005546 Ga0055528_10055467 239
898 3300003790 Ga0055528_1006903 Ga0055528_10069032 239
899 3300003790 Ga0055528_1017730 Ga0055528_10177302 239
900 3300003792 Ga0055540_1001660 Ga0055540_10016609 239
901 3300003792 Ga0055540_1003634 Ga0055540_10036345 239
902 3300003794 Ga0055531_10018117 Ga0055531_100181172 239
903 3300004625 Ga0055543_1000433 Ga0055543_100043322 239
904 3300005262 Ga0065165_1007334 Ga0065165_10073342 239
905 3300005347 Ga0070668_100015601 Ga0070668_1000156014 239
906 3300005353 Ga0070669_100057569 Ga0070669_1000575692 239
907 3300005353 Ga0070669_100115407 Ga0070669_1001154072 239
908 3300005355 Ga0070671_100012277 Ga0070671_1000122774 239
909 3300005367 Ga0070667_100418151 Ga0070667_1004181512 239
910 3300005455 Ga0070663_100114662 Ga0070663_1001146622 239
911 3300005458 Ga0070681_10000010 Ga0070681_1000001057 239
912 3300005530 Ga0070679_100001075 Ga0070679_1000010759 239
913 3300005841 Ga0068863_100521021 Ga0068863_1005210212 239
914 3300006038 Ga0075365_10000270 Ga0075365_100002705 239
915 3300006178 Ga0075367_10000078 Ga0075367_100000786 239
916 3300009092 Ga0105250_10021237 Ga0105250_100212373 239
917 3300009148 Ga0105243_10623038 Ga0105243_106230381 239
918 3300009177 Ga0105248_10013921 Ga0105248_100139215 239
919 3300009763 Ga0123340_1040891 Ga0123340_10408911 239
920 3300009765 Ga0123341_1000009 Ga0123341_100000977 239
921 3300009765 Ga0123341_1055213 Ga0123341_10552133 239
922 3300009766 Ga0123342_1009724 Ga0123342_100972411 239
923 3300009766 Ga0123342_1034152 Ga0123342_10341522 239
924 3300010375 Ga0105239_10002698 Ga0105239_1000269816 239
925 3300025208 Ga0209436_100018 Ga0209436_1000184 239
926 3300025245 Ga0207425_1002129 Ga0207425_10021296 239
927 3300025258 Ga0209129_1000118 Ga0209129_100011843 239
928 3300025258 Ga0209129_1000971 Ga0209129_10009715 239
929 3300025258 Ga0209129_1003727 Ga0209129_10037275 239
930 3300025258 Ga0209129_1003990 Ga0209129_10039902 239
931 3300025258 Ga0209129_1004733 Ga0209129_10047335 239
932 3300025258 Ga0209129_1009453 Ga0209129_10094531 239
933 3300025273 Ga0209673_1000033 Ga0209673_1000033259 239
934 3300025273 Ga0209673_1000052 Ga0209673_1000052131 239
935 3300025273 Ga0209673_1000953 Ga0209673_100095336 239
936 3300025273 Ga0209673_1000975 Ga0209673_100097531 239
937 3300025273 Ga0209673_1001533 Ga0209673_10015337 239
938 3300025273 Ga0209673_1006503 Ga0209673_10065032 239
939 3300025284 Ga0209130_1000009 Ga0209130_1000009288 239
940 3300025284 Ga0209130_1025277 Ga0209130_10252772 239
941 3300025292 Ga0209676_1015445 Ga0209676_10154455 239
942 3300025294 Ga0209025_1002217 Ga0209025_100221717 239
943 3300025294 Ga0209025_1003035 Ga0209025_10030355 239
944 3300025294 Ga0209025_1005459 Ga0209025_10054596 239
945 3300025294 Ga0209025_1017317 Ga0209025_10173173 239
946 3300025294 Ga0209025_1024298 Ga0209025_10242984 239
947 3300025294 Ga0209025_1065855 Ga0209025_10658552 239
948 3300025295 Ga0209564_1000782 Ga0209564_100078230 239
949 3300025295 Ga0209564_1001043 Ga0209564_10010435 239
950 3300025295 Ga0209564_1002280 Ga0209564_100228017 239
951 3300025295 Ga0209564_1003771 Ga0209564_100377112 239
952 3300025295 Ga0209564_1009145 Ga0209564_10091455 239
953 3300025295 Ga0209564_1041321 Ga0209564_10413212 239
954 3300025297 Ga0209758_1001085 Ga0209758_100108518 239
955 3300025297 Ga0209758_1001086 Ga0209758_100108617 239
956 3300025297 Ga0209758_1002520 Ga0209758_10025203 239
957 3300025297 Ga0209758_1016800 Ga0209758_10168002 239
958 3300025297 Ga0209758_1050098 Ga0209758_10500982 239
959 3300025299 Ga0209256_1000510 Ga0209256_100051054 239
960 3300025299 Ga0209256_1003900 Ga0209256_10039005 239
961 3300025299 Ga0209256_1007141 Ga0209256_10071412 239
962 3300025299 Ga0209256_1011065 Ga0209256_10110655 239
963 3300025302 Ga0207426_1000041 Ga0207426_1000041226 239
964 3300025302 Ga0207426_1000348 Ga0207426_100034835 239
965 3300025302 Ga0207426_1003830 Ga0207426_10038302 239
966 3300025303 Ga0209051_1002527 Ga0209051_10025275 239
967 3300025303 Ga0209051_1006376 Ga0209051_10063762 239
968 3300025303 Ga0209051_1039543 Ga0209051_10395433 239
969 3300025304 Ga0209257_1003532 Ga0209257_10035323 239
970 3300025904 Ga0207647_10124683 Ga0207647_101246832 239
971 3300025912 Ga0207707_10000005 Ga0207707_1000000557 239
972 3300025917 Ga0207660_10002390 Ga0207660_1000239011 239
973 3300025921 Ga0207652_10000068 Ga0207652_1000006836 239
974 3300025923 Ga0207681_10040141 Ga0207681_100401411 239
975 3300025923 Ga0207681_10183113 Ga0207681_101831131 239
976 3300025923 Ga0207681_10399421 Ga0207681_103994212 239
977 3300025931 Ga0207644_10082811 Ga0207644_100828112 239
978 3300025941 Ga0207711_10036003 Ga0207711_100360033 239
979 3300025972 Ga0207668_10014369 Ga0207668_100143695 239
980 3300025986 Ga0207658_10345059 Ga0207658_103450592 239
981 3300026067 Ga0207678_10231988 Ga0207678_102319882 239
982 3300026142 Ga0207698_10226456 Ga0207698_102264563 239
983 3300028379 Ga0268266_10271030 Ga0268266_102710301 239
984 3300028379 Ga0268266_10302678 Ga0268266_103026782 239
985 3300031456 Ga0307513_10015877 Ga0307513_100158773 239
986 3300041404 Ga0439436_0006561 Ga0439436_0006561_1530_2258 239
987 3300041413 Ga0439465_0002262 Ga0439465_0002262_2531_3259 239
988 3300041413 Ga0439465_0003401 Ga0439465_0003401_2706_3434 239
989 3300041454 Ga0451799_13591 Ga0451799_13591_130_858 239
990 3300041455 Ga0451801_39182 Ga0451801_39182_33_761 239
991 3300041464 Ga0451808_28627 Ga0451808_28627_60_788 239
992 3300041498 Ga0451841_0178587 Ga0451841_0178587_1387_2115 239
993 3300041499 Ga0451842_1121 Ga0451842_1121_73_801 239
994 3300041507 Ga0451851_1096957 Ga0451851_1096957_174_902 239
995 3300041510 Ga0451854_02560 Ga0451854_02560_248_976 239
996 3300041907 Ga0452268_06253 Ga0452268_06253_39_767 239
997 3300042006 Ga0439432_061694 Ga0439432_061694_78_806 239
998 3300046474 Ga0495605_0045144 Ga0495605_0045144_432_1160 239
999 3300046492 Ga0495585_0042999 Ga0495585_0042999_351_1079 239
1000 3300046507 Ga0495606_0041105 Ga0495606_0041105_1082_1810 239
1001 3300046512 Ga0495610_0021369 Ga0495610_0021369_2554_3282 239
1002 3300046513 Ga0495616_0055676 Ga0495616_0055676_891_1619 239
1003 3300046522 Ga0495643_0080657 Ga0495643_0080657_110_838 239
1004 3300046558 Ga0495633_0020355 Ga0495633_0020355_494_1222 239
1005 3300046616 Ga0495668_0042577 Ga0495668_0042577_443_1171 239
1006 3300046660 Ga0495625_0060527 Ga0495625_0060527_965_1693 239
1007 3300046665 Ga0495661_0210090 Ga0495661_0210090_132_860 239
1008 3300046691 Ga0495670_0038451 Ga0495670_0038451_548_1276 239
1009 3300046692 Ga0495671_0098250 Ga0495671_0098250_522_1250 239
1010 3300046694 Ga0495649_0020798 Ga0495649_0020798_1739_2467 239
1011 3300046694 Ga0495649_0060369 Ga0495649_0060369_581_1309 239
1012 3300047323 Ga0495683_0078014 Ga0495683_0078014_764_1492 239
1013 3300047470 Ga0495681_0046168 Ga0495681_0046168_67_795 239
1014 3300048909 Ga0496106_0003568 Ga0496106_0003568_8288_9016 239
1015 3300048920 Ga0496117_0056502 Ga0496117_0056502_570_1298 239
1016 3300048921 Ga0496118_0008110 Ga0496118_0008110_2861_3589 239
1017 3300048921 Ga0496118_0022589 Ga0496118_0022589_3341_4069 239
1018 3300048924 Ga0496121_0023905 Ga0496121_0023905_3208_3936 239
1019 3300048925 Ga0496122_0017928 Ga0496122_0017928_1580_2308 239
1020 3300048926 Ga0496123_0014122 Ga0496123_0014122_3147_3875 239
1021 3300048926 Ga0496123_0125085 Ga0496123_0125085_665_1393 239
1022 3300048927 Ga0496124_0067125 Ga0496124_0067125_1151_1879 239
1023 3300048928 Ga0496125_0004309 Ga0496125_0004309_13949_14677 239
1024 3300048929 Ga0496126_0031438 Ga0496126_0031438_140_868 239
1025 3300049579 Ga0501043_0368580 Ga0501043_0368580_120_848 239
1026 3300049581 Ga0501047_0246874 Ga0501047_0246874_274_1002 239
1027 3300049744 Ga0501083_0020023 Ga0501083_0020023_3835_4563 239
1028 3300049823 Ga0501044_0327500 Ga0501044_0327500_621_1349 239
1029 3300050516 nmdc:mga0sz30_108616_c1 nmdc:mga0sz30_108616_c1_143_871 239
1030 3300050516 nmdc:mga0sz30_8253_c2 nmdc:mga0sz30_8253_c2_129_857 239
1031 3300053086 Ga0500578_0033329 Ga0500578_0033329_396_1124 239
1032 3300053134 Ga0500658_0000309 Ga0500658_0000309_19381_20109 239
1033 3300053153 Ga0500616_0045185 Ga0500616_0045185_1178_1906 239
1034 3300053156 Ga0500622_0002162 Ga0500622_0002162_3641_4369 239
1035 3300053158 Ga0500627_0082713 Ga0500627_0082713_674_1402 239
1036 3300053160 Ga0500633_0008199 Ga0500633_0008199_147_875 239
1037 3300059490 Ga0587066_051258 Ga0587066_051258_64_795 239
1038 3300059492 Ga0587073_0037104 Ga0587073_0037104_207_935 239
1039 3300059504 Ga0587082_047957 Ga0587082_047957_68_796 239
1040 3300059508 Ga0587088_025879 Ga0587088_025879_219_947 239
1041 3300059508 Ga0587088_045251 Ga0587088_045251_44_772 239
1042 3300059508 Ga0587088_050095 Ga0587088_050095_12_743 239
1043 3300059511 Ga0587091_057629 Ga0587091_057629_22_753 239
1044 3300059512 Ga0587092_039632 Ga0587092_039632_68_799 239
1045 3300059605 Ga0587106_035629 Ga0587106_035629_19_750 239
1046 3300059643 Ga0587072_037083 Ga0587072_037083_44_772 239
1047 3300059643 Ga0587072_052909 Ga0587072_052909_26_754 239
1048 3300059644 Ga0587075_035666 Ga0587075_035666_15_743 239
1049 3300059651 Ga0587105_005868 Ga0587105_005868_28_759 239
1050 3300060344 Ga0587071_046356 Ga0587071_046356_15_746 239
1051 iso_pu_bacteria 2510917022 2511133851 239
1052 iso_pu_bacteria 2513237159 2513998465 239
1053 iso_pu_bacteria 2524023209 2524458445 239
1054 iso_pu_bacteria 2558860983 2561467094 239
1055 iso_pu_bacteria 2582581307 2585271639 239
1056 iso_pu_bacteria 2582581866 2585396638 239
1057 iso_pu_bacteria 2585427531 2585563121 239
1058 iso_pu_bacteria 2585427609 2585907339 239
1059 iso_pu_bacteria 2585428125 2587982667 239
1060 iso_pu_bacteria 2600254933 2600373259 239
1061 iso_pu_bacteria 2643221557 2643808049 239
1062 iso_pu_bacteria 2643221607 2644052246 239
1063 iso_pu_bacteria 2643221610 2644068762 239
1064 iso_pu_bacteria 2643221636 2644201371 239
1065 iso_pu_bacteria 2643221637 2644209480 239
1066 iso_pu_bacteria 2643221668 2644379483 239
1067 iso_pu_bacteria 2643221675 2644419832 239
1068 iso_pu_bacteria 2643221680 2644453189 239
1069 iso_pu_bacteria 2643221686 2644484524 239
1070 iso_pu_bacteria 2643221688 2644493102 239
1071 iso_pu_bacteria 2643221689 2644499310 239
1072 iso_pu_bacteria 2643221718 2644653008 239
1073 iso_pu_bacteria 2643221726 2644688783 239
1074 iso_pu_bacteria 2842298080 2842300298 239
1075 iso_pu_bacteria 2842357229 2842361184 239
1076 iso_pu_bacteria 2842509118 2842511730 239
1077 iso_pu_bacteria 2842521101 2842524507 239
1078 iso_pu_bacteria 2899803654 2899808062 239
1079 iso_pu_bacteria 2917554339 2917555025 239
1080 iso_pu_bacteria 8005658619 8005660784 239
1081 iso_pu_bacteria 8046767195 8046767208 239
1082 iso_pu_bacteria 8057575449 8057581594 239
1083 3300017792 Ga0163161_10005528 Ga0163161_100055286 240
1084 3300025271 Ga0207666_1000023 Ga0207666_100002318 240
1085 3300025735 Ga0207713_1051466 Ga0207713_10514662 240
1086 3300025885 Ga0207653_10020764 Ga0207653_100207642 240
1087 3300025893 Ga0207682_10000011 Ga0207682_1000001133 240
1088 3300025899 Ga0207642_10000936 Ga0207642_100009363 240
1089 3300025901 Ga0207688_10000212 Ga0207688_100002125 240
1090 3300025903 Ga0207680_10021218 Ga0207680_100212182 240
1091 3300025907 Ga0207645_10000788 Ga0207645_100007883 240
1092 3300025908 Ga0207643_10000284 Ga0207643_1000028413 240
1093 3300025911 Ga0207654_10026416 Ga0207654_100264162 240
1094 3300025912 Ga0207707_10001938 Ga0207707_1000193810 240
1095 3300025913 Ga0207695_10051370 Ga0207695_100513702 240
1096 3300025914 Ga0207671_10019417 Ga0207671_100194176 240
1097 3300025917 Ga0207660_10013909 Ga0207660_100139093 240
1098 3300025920 Ga0207649_10000057 Ga0207649_10000057113 240
1099 3300025923 Ga0207681_10000181 Ga0207681_100001813 240
1100 3300025925 Ga0207650_10001418 Ga0207650_100014186 240
1101 3300025926 Ga0207659_10000028 Ga0207659_1000002821 240
1102 3300025927 Ga0207687_10000061 Ga0207687_1000006115 240
1103 3300025931 Ga0207644_10004970 Ga0207644_100049706 240
1104 3300025933 Ga0207706_10008724 Ga0207706_100087241 240
1105 3300025935 Ga0207709_10000539 Ga0207709_100005392 240
1106 3300025937 Ga0207669_10000290 Ga0207669_1000029014 240
1107 3300025938 Ga0207704_10000767 Ga0207704_100007673 240
1108 3300025941 Ga0207711_10015022 Ga0207711_100150225 240
1109 3300025942 Ga0207689_10009011 Ga0207689_100090113 240
1110 3300025944 Ga0207661_10000215 Ga0207661_100002153 240
1111 3300025945 Ga0207679_10000026 Ga0207679_10000026181 240
1112 3300025949 Ga0207667_10056380 Ga0207667_100563803 240
1113 3300025960 Ga0207651_10000173 Ga0207651_1000017332 240
1114 3300025961 Ga0207712_10002375 Ga0207712_100023754 240
1115 3300025972 Ga0207668_10000474 Ga0207668_1000047419 240
1116 3300025981 Ga0207640_10000711 Ga0207640_1000071113 240
1117 3300025986 Ga0207658_10001541 Ga0207658_100015416 240
1118 3300026023 Ga0207677_10001215 Ga0207677_100012153 240
1119 3300026078 Ga0207702_10136128 Ga0207702_101361282 240
1120 3300026089 Ga0207648_10023516 Ga0207648_100235163 240
1121 3300026095 Ga0207676_10005845 Ga0207676_100058456 240
1122 3300026116 Ga0207674_10026646 Ga0207674_100266464 240
1123 3300026121 Ga0207683_10000034 Ga0207683_1000003418 240
1124 3300027907 Ga0207428_10001235 Ga0207428_100012356 240
1125 3300028380 Ga0268265_10001023 Ga0268265_100010233 240
1126 3300028381 Ga0268264_10001465 Ga0268264_100014655 240
1127 3300031251 Ga0265327_10016822 Ga0265327_100168225 240
1128 3300034819 Ga0373958_0000962 Ga0373958_0000962_1145_1903 240
1129 3300034820 Ga0373959_0006254 Ga0373959_0006254_381_1139 240
1130 3300035091 Ga0373951_0002104 Ga0373951_0002104_3506_4264 240
1131 3300035092 Ga0373952_0001391 Ga0373952_0001391_96_854 240
1132 3300035112 Ga0373932_0002140 Ga0373932_0002140_915_1673 240
1133 3300035114 Ga0373939_0002351 Ga0373939_0002351_3464_4222 240
1134 3300035121 Ga0373960_0003014 Ga0373960_0003014_911_1669 240
1135 3300035242 Ga0373962_0000385 Ga0373962_0000385_8759_9517 240
1136 3300035691 Ga0373931_0000254 Ga0373931_0000254_16823_17581 240
1137 3300046492 Ga0495585_0302012 Ga0495585_0302012_23_757 240
1138 3300046506 Ga0495583_0017655 Ga0495583_0017655_650_1384 240
1139 3300046512 Ga0495610_0002478 Ga0495610_0002478_10406_11134 240
1140 3300046515 Ga0495620_0011516 Ga0495620_0011516_1055_1783 240
1141 3300046519 Ga0495632_0002387 Ga0495632_0002387_4812_5573 240
1142 3300046530 Ga0495654_0161120 Ga0495654_0161120_176_910 240
1143 3300046665 Ga0495661_0102391 Ga0495661_0102391_252_986 240
1144 3300046794 Ga0495589_0034844 Ga0495589_0034844_465_1199 240
1145 3300048090 Ga0495615_0049660 Ga0495615_0049660_294_1028 240
1146 3300048903 Ga0496100_0019710 Ga0496100_0019710_391_1149 240
1147 3300048904 Ga0496101_0012868 Ga0496101_0012868_3712_4470 240
1148 3300048905 Ga0496102_0004000 Ga0496102_0004000_3840_4598 240
1149 3300048906 Ga0496103_0006985 Ga0496103_0006985_2753_3511 240
1150 3300048907 Ga0496104_0280128 Ga0496104_0280128_429_1187 240
1151 3300048908 Ga0496105_0624272 Ga0496105_0624272_25_783 240
1152 3300048909 Ga0496106_0010947 Ga0496106_0010947_1601_2359 240
1153 3300048910 Ga0496107_0005476 Ga0496107_0005476_3658_4416 240
1154 3300048912 Ga0496109_0000984 Ga0496109_0000984_941_1699 240
1155 3300048913 Ga0496110_0009931 Ga0496110_0009931_3462_4220 240
1156 3300048915 Ga0496112_0798778 Ga0496112_0798778_41_799 240
1157 3300048917 Ga0496114_0016680 Ga0496114_0016680_4230_4988 240
1158 3300048918 Ga0496115_0003065 Ga0496115_0003065_2071_2829 240
1159 3300049581 Ga0501047_0349477 Ga0501047_0349477_387_1142 240
1160 3300049588 Ga0501072_0037701 Ga0501072_0037701_2992_3747 240
1161 3300049589 Ga0501073_0116994 Ga0501073_0116994_240_995 240
1162 3300049744 Ga0501083_0019610 Ga0501083_0019610_385_1140 240
1163 3300049823 Ga0501044_0643058 Ga0501044_0643058_116_898 240
1164 3300050494 nmdc:mga06z11_266120_c1 nmdc:mga06z11_266120_c1_227_985 240
1165 3300050511 nmdc:mga08y16_68203_c1 nmdc:mga08y16_68203_c1_199_957 240
1166 3300050512 nmdc:mga0n895_11694_c1 nmdc:mga0n895_11694_c1_4858_5616 240
1167 3300050514 nmdc:mga08x19_362373_c1 nmdc:mga08x19_362373_c1_174_932 240
1168 3300060353 Ga0501082_0205576 Ga0501082_0205576_16_771 240
1169 iso_pu_bacteria 2889790730 2889791529 240
1170 3300028794 Ga0307515_10001330 Ga0307515_1000133022 241
1171 3300031456 Ga0307513_10000463 Ga0307513_100004637 241
1172 3300033180 Ga0307510_10157736 Ga0307510_101577362 241
1173 3300046642 Ga0495634_0120675 Ga0495634_0120675_921_1661 241
1174 3300046674 Ga0495588_0038007 Ga0495588_0038007_909_1649 241
1175 3300046690 Ga0495624_0130607 Ga0495624_0130607_745_1485 241
1176 3300047317 Ga0495604_0035060 Ga0495604_0035060_1233_1973 241
1177 3300053085 Ga0495619_0262615 Ga0495619_0262615_38_778 241
1178 3300053148 Ga0500590_001183 Ga0500590_001183_5776_6516 241
1179 iso_pu_bacteria 2503198000 2503199004 241
1180 iso_pu_bacteria 2508501123 2509118467 241
1181 iso_pu_bacteria 2509276022 2509393909 241
1182 iso_pu_bacteria 2510917026 2511169779 241
1183 iso_pu_bacteria 2512875016 2512933595 241
1184 iso_pu_bacteria 2513237164 2514035584 241
1185 iso_pu_bacteria 2513237305 2514419570 241
1186 iso_pu_bacteria 2513237351 2514586601 241
1187 iso_pu_bacteria 2585427633 2585997756 241
1188 iso_pu_bacteria 2585427634 2586002340 241
1189 iso_pu_bacteria 2588253730 2588519673 241
1190 iso_pu_bacteria 2643221551 2643777214 241
1191 iso_pu_bacteria 2643221555 2643795662 241
1192 iso_pu_bacteria 2643221568 2643855058 241
1193 iso_pu_bacteria 2721755686 2723573402 241
1194 iso_pu_bacteria 2751185800 2753358432 241
1195 iso_pu_bacteria 2758568016 2758640661 241
1196 iso_pu_bacteria 2775507049 2776915456 241
1197 iso_pu_bacteria 2802428860 2802729551 241
1198 iso_pu_bacteria 2802428861 2802736897 241
1199 iso_pu_bacteria 2802428862 2802743302 241
1200 iso_pu_bacteria 2802428863 2802749572 241
1201 iso_pu_bacteria 2854911287 2854913958 241
1202 iso_pu_bacteria 2856320880 2856327149 241
1203 iso_pu_bacteria 2869278585 2869279620 241
1204 iso_pu_bacteria 2874139085 2874139389 241
1205 iso_pu_bacteria 2876363079 2876364151 241
1206 iso_pu_bacteria 2878738818 2878742147 241
1207 iso_pu_bacteria 2882632389 2882640395 241
1208 iso_pu_bacteria 2888337043 2888343683 241
1209 iso_pu_bacteria 2894652903 2894653756 241
1210 iso_pu_bacteria 2903448605 2903453745 241
1211 iso_pu_bacteria 2903521522 2903525689 241
1212 iso_pu_bacteria 2903528002 2903532764 241
1213 iso_pu_bacteria 2919166419 2919170608 241
1214 iso_pu_bacteria 2919171160 2919175812 241
1215 iso_pu_bacteria 2924718760 2924725576 241
1216 iso_pu_bacteria 2924776078 2924779831 241
1217 iso_pu_bacteria 2929138655 2929141849 241
1218 iso_pu_bacteria 2937036028 2937036215 241
1219 iso_pu_bacteria 2937084907 2937089989 241
1220 iso_pu_bacteria 2937848649 2937851691 241
1221 iso_pu_bacteria 2937877337 2937880582 241
1222 iso_pu_bacteria 2937972304 2937974212 241
1223 iso_pu_bacteria 2957375807 2957381824 241
1224 iso_pu_bacteria 2957437181 2957442083 241
1225 iso_pu_bacteria 2958034702 2958035197 241
1226 iso_pu_bacteria 2958041894 2958044229 241
1227 iso_pu_bacteria 2958064165 2958065667 241
1228 iso_pu_bacteria 2958084443 2958087715 241
1229 iso_pu_bacteria 2958092219 2958093674 241
1230 iso_pu_bacteria 2958144490 2958147244 241
1231 iso_pu_bacteria 2960591022 2960592239 241
1232 iso_pu_bacteria 2960631154 2960633809 241
1233 iso_pu_bacteria 2960680706 2960682346 241
1234 iso_pu_bacteria 2963644680 2963645609 241
1235 iso_pu_bacteria 2967686174 2967690244 241
1236 iso_pu_bacteria 2967728569 2967730829 241
1237 iso_pu_bacteria 2968016561 2968023617 241
1238 iso_pu_bacteria 2968083720 2968085055 241
1239 iso_pu_bacteria 2970026789 2970029540 241
1240 iso_pu_bacteria 2970122695 2970128926 241
1241 iso_pu_bacteria 2970143518 2970143598 241
1242 iso_pu_bacteria 2970469710 2970476199 241
1243 iso_pu_bacteria 2970593180 2970594219 241
1244 iso_pu_bacteria 2977530762 2977535078 241
1245 iso_pu_bacteria 2977544691 2977550623 241
1246 iso_pu_bacteria 2977922695 2977929547 241
1247 iso_pu_bacteria 2977986579 2977987984 241
1248 iso_pu_bacteria 2978969890 2978972589 241
1249 iso_pu_bacteria 2996310559 2996315194 241
1250 iso_pu_bacteria 2996336353 2996339460 241
1251 iso_pu_bacteria 2996348954 2996354783 241
1252 iso_pu_bacteria 3000135777 3000137673 241
1253 iso_pu_bacteria 3004211236 3004218401 241
1254 iso_pu_bacteria 3004218560 3004219502 241
1255 iso_pu_bacteria 3004275668 3004281431 241
1256 iso_pu_bacteria 3004334049 3004336970 241
1257 iso_pu_bacteria 637000159 637076702 241
1258 iso_pu_bacteria 8003999396 8004003084 241
1259 iso_pu_bacteria 8054460903 8054463813 241
1260 iso_pu_bacteria 8056875544 8056878246 241
1261 3300002704 JGI25155J39150_1000010 JGI25155J39150_100001017 242
1262 3300002705 JGI25156J39149_1000102 JGI25156J39149_100010216 242
1263 3300002737 JGI25162J39368_1001052 JGI25162J39368_100105213 242
1264 3300002737 JGI25162J39368_1001061 JGI25162J39368_10010615 242
1265 3300002738 JGI25154J39366_1000184 JGI25154J39366_100018452 242
1266 3300002741 JGI25157J39369_1000009 JGI25157J39369_100000916 242
1267 3300002773 JGI25152J39213_1002993 JGI25152J39213_10029934 242
1268 3300002774 JGI25150J39212_1000037 JGI25150J39212_100003726 242
1269 3300003187 JGI25151J46595_10000220 JGI25151J46595_1000022049 242
1270 3300003214 JGI25165J46597_1001126 JGI25165J46597_100112614 242
1271 3300003578 Ga0006562J51391_1003164 Ga0006562J51391_10031641 242
1272 3300003693 Ga0032354_1026988 Ga0032354_10269881 242
1273 3300003752 Ga0055539_1004440 Ga0055539_10044402 242
1274 3300005563 Ga0068855_100113501 Ga0068855_1001135012 242
1275 3300005578 Ga0068854_100182740 Ga0068854_1001827402 242
1276 3300005614 Ga0068856_100252543 Ga0068856_1002525432 242
1277 3300005616 Ga0068852_100212449 Ga0068852_1002124492 242
1278 3300005834 Ga0068851_10096773 Ga0068851_100967732 242
1279 3300006353 Ga0075370_10079154 Ga0075370_100791542 242
1280 3300009093 Ga0105240_10000013 Ga0105240_10000013193 242
1281 3300009545 Ga0105237_10034241 Ga0105237_100342413 242
1282 3300010375 Ga0105239_10000820 Ga0105239_1000082015 242
1283 3300013104 Ga0157370_10002495 Ga0157370_100024955 242
1284 3300015262 Ga0182007_10003160 Ga0182007_100031602 242
1285 3300015265 Ga0182005_1001581 Ga0182005_10015815 242
1286 3300025206 Ga0209435_100009 Ga0209435_100009273 242
1287 3300025233 Ga0209437_100057 Ga0209437_100057194 242
1288 3300025233 Ga0209437_100107 Ga0209437_100107163 242
1289 3300025245 Ga0207425_1000034 Ga0207425_100003426 242
1290 3300025246 Ga0209646_1000018 Ga0209646_1000018273 242
1291 3300025250 Ga0209026_1000068 Ga0209026_100006817 242
1292 3300025253 Ga0209677_100199 Ga0209677_10019910 242
1293 3300025256 Ga0209759_1000007 Ga0209759_1000007273 242
1294 3300025258 Ga0209129_1000253 Ga0209129_100025326 242
1295 3300025261 Ga0209233_1000072 Ga0209233_10000725 242
1296 3300025261 Ga0209233_1000134 Ga0209233_1000134194 242
1297 3300025261 Ga0209233_1000479 Ga0209233_10004795 242
1298 3300025272 Ga0209455_1018745 Ga0209455_10187452 242
1299 3300025273 Ga0209673_1012482 Ga0209673_10124822 242
1300 3300025294 Ga0209025_1000533 Ga0209025_100053351 242
1301 3300025297 Ga0209758_1000415 Ga0209758_100041551 242
1302 3300025913 Ga0207695_10000044 Ga0207695_10000044150 242
1303 3300025914 Ga0207671_10000400 Ga0207671_1000040017 242
1304 3300025949 Ga0207667_10105936 Ga0207667_101059362 242
1305 3300025981 Ga0207640_10087541 Ga0207640_100875412 242
1306 3300025986 Ga0207658_10391025 Ga0207658_103910252 242
1307 3300026078 Ga0207702_10211582 Ga0207702_102115822 242
1308 3300027312 Ga0209371_1002474 Ga0209371_10024745 242
1309 3300030500 Ga0268256_1001864 Ga0268256_10018647 242
1310 3300031731 Ga0307405_10001569 Ga0307405_100015693 242
1311 3300031911 Ga0307412_10002170 Ga0307412_100021708 242
1312 3300033527 Ga0316586_1038278 Ga0316586_10382781 242
1313 3300046507 Ga0495606_0009969 Ga0495606_0009969_3716_4456 242
1314 3300048920 Ga0496117_0002097 Ga0496117_0002097_7741_8481 242
1315 3300048920 Ga0496117_0020361 Ga0496117_0020361_717_1454 242
1316 3300048921 Ga0496118_0002291 Ga0496118_0002291_7845_8585 242
1317 3300048922 Ga0496119_0028106 Ga0496119_0028106_2561_3301 242
1318 3300048922 Ga0496119_0096761 Ga0496119_0096761_145_882 242
1319 3300048923 Ga0496120_0039751 Ga0496120_0039751_419_1159 242
1320 3300048924 Ga0496121_0011232 Ga0496121_0011232_7662_8402 242
1321 3300048924 Ga0496121_0013424 Ga0496121_0013424_5754_6491 242
1322 3300048924 Ga0496121_0020808 Ga0496121_0020808_2627_3367 242
1323 3300048925 Ga0496122_0018012 Ga0496122_0018012_3535_4272 242
1324 3300048926 Ga0496123_0019242 Ga0496123_0019242_2312_3049 242
1325 3300048927 Ga0496124_0011409 Ga0496124_0011409_5808_6545 242
1326 3300048928 Ga0496125_0006873 Ga0496125_0006873_10725_11462 242
1327 3300048929 Ga0496126_0193912 Ga0496126_0193912_670_1407 242
1328 3300049591 Ga0501075_0072070 Ga0501075_0072070_909_1676 242
1329 3300049592 Ga0501076_0044976 Ga0501076_0044976_410_1177 242
1330 3300049593 Ga0501077_0000896 Ga0501077_0000896_2007_2774 242
1331 3300049741 Ga0501079_0009536 Ga0501079_0009536_5810_6577 242
1332 3300049743 Ga0501081_0075277 Ga0501081_0075277_19_786 242
1333 3300053140 Ga0500573_0000334 Ga0500573_0000334_11186_11926 242
1334 3300059640 Ga0587067_040453 Ga0587067_040453_72_812 242
1335 3300060344 Ga0587071_051619 Ga0587071_051619_44_781 242
1336 3300060353 Ga0501082_0012395 Ga0501082_0012395_3743_4510 242
1337 iso_pu_bacteria 2508501127 2509143156 242
1338 iso_pu_bacteria 2509276018 2509371425 242
1339 iso_pu_bacteria 2510065059 2510318369 242
1340 iso_pu_bacteria 2513237087 2513592609 242
1341 iso_pu_bacteria 2513237090 2513613974 242
1342 iso_pu_bacteria 2597489875 2597811970 242
1343 iso_pu_bacteria 2599185301 2599938740 242
1344 iso_pu_bacteria 2643221550 2643771298 242
1345 iso_pu_bacteria 2643221564 2643837017 242
1346 iso_pu_bacteria 2643221595 2643988549 242
1347 iso_pu_bacteria 2643221627 2644154534 242
1348 iso_pu_bacteria 2687453392 2688596279 242
1349 iso_pu_bacteria 2693429783 2694631641 242
1350 iso_pu_bacteria 2693429784 2694638304 242
1351 iso_pu_bacteria 2756170246 2756673670 242
1352 iso_pu_bacteria 2791355123 2792747531 242
1353 iso_pu_bacteria 2828305725 2828309243 242
1354 iso_pu_bacteria 2841734538 2841736670 242
1355 iso_pu_bacteria 2844002411 2844003152 242
1356 iso_pu_bacteria 2844009547 2844011108 242
1357 iso_pu_bacteria 2847686936 2847690227 242
1358 iso_pu_bacteria 2856328259 2856329769 242
1359 iso_pu_bacteria 2856334872 2856336573 242
1360 iso_pu_bacteria 2856342000 2856343510 242
1361 iso_pu_bacteria 2856349417 2856349675 242
1362 iso_pu_bacteria 2856364286 2856365095 242
1363 iso_pu_bacteria 2857349434 2857353228 242
1364 iso_pu_bacteria 2869162929 2869168891 242
1365 iso_pu_bacteria 2869169390 2869176125 242
1366 iso_pu_bacteria 2869234852 2869241787 242
1367 iso_pu_bacteria 2869242130 2869243703 242
1368 iso_pu_bacteria 2869249662 2869253331 242
1369 iso_pu_bacteria 2869256925 2869257338 242
1370 iso_pu_bacteria 2869264136 2869269011 242
1371 iso_pu_bacteria 2869285874 2869286281 242
1372 iso_pu_bacteria 2871429161 2871430250 242
1373 iso_pu_bacteria 2871435913 2871441681 242
1374 iso_pu_bacteria 2871444079 2871445055 242
1375 iso_pu_bacteria 2871451962 2871458705 242
1376 iso_pu_bacteria 2871459585 2871463878 242
1377 iso_pu_bacteria 2871466892 2871471950 242
1378 iso_pu_bacteria 2871474448 2871476266 242
1379 iso_pu_bacteria 2871481445 2871484845 242
1380 iso_pu_bacteria 2871488783 2871494979 242
1381 iso_pu_bacteria 2871495908 2871500151 242
1382 iso_pu_bacteria 2874102143 2874107367 242
1383 iso_pu_bacteria 2874109183 2874115776 242
1384 iso_pu_bacteria 2874116593 2874123033 242
1385 iso_pu_bacteria 2874123672 2874130059 242
1386 iso_pu_bacteria 2874146452 2874146666 242
1387 iso_pu_bacteria 2874155637 2874155741 242
1388 iso_pu_bacteria 2874162495 2874162544 242
1389 iso_pu_bacteria 2874168670 2874170645 242
1390 iso_pu_bacteria 2876369609 2876376803 242
1391 iso_pu_bacteria 2876377896 2876378850 242
1392 iso_pu_bacteria 2876386047 2876386993 242
1393 iso_pu_bacteria 2876392853 2876399207 242
1394 iso_pu_bacteria 2876399893 2876406693 242
1395 iso_pu_bacteria 2876406927 2876409271 242
1396 iso_pu_bacteria 2876413966 2876414070 242
1397 iso_pu_bacteria 2876420981 2876426319 242
1398 iso_pu_bacteria 2878730984 2878738200 242
1399 iso_pu_bacteria 2878745973 2878746446 242
1400 iso_pu_bacteria 2878753008 2878760104 242
1401 iso_pu_bacteria 2878760144 2878764273 242
1402 iso_pu_bacteria 2878767105 2878771343 242
1403 iso_pu_bacteria 2878788777 2878796173 242
1404 iso_pu_bacteria 2881147464 2881148499 242
1405 iso_pu_bacteria 2881155292 2881159582 242
1406 iso_pu_bacteria 2881161766 2881165304 242
1407 iso_pu_bacteria 2881845957 2881852048 242
1408 iso_pu_bacteria 2881853255 2881858605 242
1409 iso_pu_bacteria 2881861095 2881863923 242
1410 iso_pu_bacteria 2882912400 2882917841 242
1411 iso_pu_bacteria 2885305155 2885307145 242
1412 iso_pu_bacteria 2885312484 2885313846 242
1413 iso_pu_bacteria 2885318864 2885322978 242
1414 iso_pu_bacteria 2885334103 2885341200 242
1415 iso_pu_bacteria 2885342637 2885344618 242
1416 iso_pu_bacteria 2885350715 2885352187 242
1417 iso_pu_bacteria 2888343758 2888344657 242
1418 iso_pu_bacteria 2888350351 2888353498 242
1419 iso_pu_bacteria 2889010040 2889015211 242
1420 iso_pu_bacteria 2889016732 2889019708 242
1421 iso_pu_bacteria 2903492973 2903494338 242
1422 iso_pu_bacteria 2903492973 2903499845 242
1423 iso_pu_bacteria 2903540706 2903544966 242
1424 iso_pu_bacteria 2904659560 2904665734 242
1425 iso_pu_bacteria 2906308376 2906308847 242
1426 iso_pu_bacteria 2906321335 2906322127 242
1427 iso_pu_bacteria 2906328253 2906333913 242
1428 iso_pu_bacteria 2906354277 2906361652 242
1429 iso_pu_bacteria 2906363423 2906367995 242
1430 iso_pu_bacteria 2906370794 2906372021 242
1431 iso_pu_bacteria 2906378014 2906382867 242
1432 iso_pu_bacteria 2906386501 2906388974 242
1433 iso_pu_bacteria 2906393657 2906398064 242
1434 iso_pu_bacteria 2906401398 2906408086 242
1435 iso_pu_bacteria 2906408224 2906410586 242
1436 iso_pu_bacteria 2906427513 2906433935 242
1437 iso_pu_bacteria 2922130491 2922135534 242
1438 iso_pu_bacteria 2922151315 2922152911 242
1439 iso_pu_bacteria 2922158528 2922165400 242
1440 iso_pu_bacteria 2922172374 2922176070 242
1441 iso_pu_bacteria 2922185730 2922193522 242
1442 iso_pu_bacteria 2924710171 2924711486 242
1443 iso_pu_bacteria 2924726620 2924727673 242
1444 iso_pu_bacteria 2924733363 2924737292 242
1445 iso_pu_bacteria 2924741084 2924747609 242
1446 iso_pu_bacteria 2924748358 2924754460 242
1447 iso_pu_bacteria 2924754689 2924758106 242
1448 iso_pu_bacteria 2924762789 2924768605 242
1449 iso_pu_bacteria 2924784321 2924790907 242
1450 iso_pu_bacteria 2937813078 2937822186 242
1451 iso_pu_bacteria 2937822353 2937823877 242
1452 iso_pu_bacteria 2937836603 2937839277 242
1453 iso_pu_bacteria 2937861824 2937862104 242
1454 iso_pu_bacteria 2937868953 2937873469 242
1455 iso_pu_bacteria 2937891427 2937894380 242
1456 iso_pu_bacteria 2937980651 2937983200 242
1457 iso_pu_bacteria 2937994558 2937998811 242
1458 iso_pu_bacteria 2938014810 2938015722 242
1459 iso_pu_bacteria 2958041894 2958054601 242
1460 iso_pu_bacteria 2958071322 2958072447 242
1461 iso_pu_bacteria 2958100919 2958104724 242
1462 iso_pu_bacteria 2958108152 2958115094 242
1463 iso_pu_bacteria 2958115193 2958120399 242
1464 iso_pu_bacteria 2958122699 2958130220 242
1465 iso_pu_bacteria 2958130278 2958130680 242
1466 iso_pu_bacteria 2958137437 2958140827 242
1467 iso_pu_bacteria 2958158011 2958161107 242
1468 iso_pu_bacteria 2958165035 2958169286 242
1469 iso_pu_bacteria 2958172287 2958176728 242
1470 iso_pu_bacteria 2958179912 2958180019 242
1471 iso_pu_bacteria 2961077736 2961077846 242
1472 iso_pu_bacteria 2961114664 2961121077 242
1473 iso_pu_bacteria 2961127735 2961128628 242
1474 iso_pu_bacteria 2961136820 2961141959 242
1475 iso_pu_bacteria 2961163497 2961167748 242
1476 iso_pu_bacteria 2961170736 2961177373 242
1477 iso_pu_bacteria 2961183825 2961185080 242
1478 iso_pu_bacteria 2965018300 2965022567 242
1479 iso_pu_bacteria 2965025482 2965026686 242
1480 iso_pu_bacteria 2965032056 2965034383 242
1481 iso_pu_bacteria 2965040258 2965043504 242
1482 iso_pu_bacteria 2965047637 2965049513 242
1483 iso_pu_bacteria 2965062239 2965065074 242
1484 iso_pu_bacteria 2965089291 2965092347 242
1485 iso_pu_bacteria 2965102966 2965108443 242
1486 iso_pu_bacteria 2965110997 2965117589 242
1487 iso_pu_bacteria 2965119406 2965127384 242
1488 iso_pu_bacteria 2967996073 2968002478 242
1489 iso_pu_bacteria 2968003550 2968009709 242
1490 iso_pu_bacteria 2968091066 2968093510 242
1491 iso_pu_bacteria 2968097103 2968100228 242
1492 iso_pu_bacteria 2968110612 2968117227 242
1493 iso_pu_bacteria 2968117919 2968122366 242
1494 iso_pu_bacteria 2968128360 2968129633 242
1495 iso_pu_bacteria 2968138860 2968142978 242
1496 iso_pu_bacteria 2968171901 2968176149 242
1497 iso_pu_bacteria 2970489779 2970493798 242
1498 iso_pu_bacteria 2970503327 2970510047 242
1499 iso_pu_bacteria 2970510686 2970517191 242
1500 iso_pu_bacteria 2970540015 2970544597 242
1501 iso_pu_bacteria 2970547951 2970550781 242
1502 iso_pu_bacteria 2970554993 2970559117 242
1503 iso_pu_bacteria 2970619444 2970625155 242
1504 iso_pu_bacteria 2970627176 2970629748 242
1505 iso_pu_bacteria 2977821940 2977828625 242
1506 iso_pu_bacteria 2977828996 2977834125 242
1507 iso_pu_bacteria 2977843712 2977844317 242
1508 iso_pu_bacteria 2977851361 2977854338 242
1509 iso_pu_bacteria 2977858184 2977862079 242
1510 iso_pu_bacteria 2977864932 2977865661 242
1511 iso_pu_bacteria 2977898635 2977902808 242
1512 iso_pu_bacteria 2977907340 2977909726 242
1513 iso_pu_bacteria 2977915119 2977921995 242
1514 iso_pu_bacteria 2977942078 2977942440 242
1515 iso_pu_bacteria 2977950692 2977957707 242
1516 iso_pu_bacteria 2977957713 2977964932 242
1517 iso_pu_bacteria 2979710463 2979714872 242
1518 iso_pu_bacteria 2979764755 2979767615 242
1519 iso_pu_bacteria 2979772303 2979774672 242
1520 iso_pu_bacteria 2979779861 2979784490 242
1521 iso_pu_bacteria 2979808191 2979814923 242
1522 iso_pu_bacteria 2987636660 2987641820 242
1523 iso_pu_bacteria 2987645492 2987651742 242
1524 iso_pu_bacteria 2987652177 2987657890 242
1525 iso_pu_bacteria 2987659509 2987663755 242
1526 iso_pu_bacteria 2987666974 2987673334 242
1527 iso_pu_bacteria 2987673487 2987678448 242
1528 iso_pu_bacteria 2996341866 2996343519 242
1529 iso_pu_bacteria 2996386984 2996389154 242
1530 iso_pu_bacteria 3004167301 3004173606 242
1531 iso_pu_bacteria 3004188549 3004192812 242
1532 iso_pu_bacteria 3004203850 3004209368 242
1533 iso_pu_bacteria 3004232784 3004236502 242
1534 iso_pu_bacteria 3004248173 3004252157 242
1535 iso_pu_bacteria 3004268573 3004269435 242
1536 iso_pu_bacteria 649633066 649870833 242
1537 iso_pu_bacteria 8001845381 8001847438 242
1538 iso_pu_bacteria 8004300914 8004304232 242
1539 iso_pu_bacteria 8004312739 8004316412 242
1540 iso_pu_bacteria 8004361976 8004366109 242
1541 iso_pu_bacteria 8004374579 8004381602 242
1542 iso_pu_bacteria 8004387939 8004388693 242
1543 iso_pu_bacteria 8004395343 8004401087 242
1544 iso_pu_bacteria 8004445564 8004448263 242
1545 iso_pu_bacteria 8004633249 8004633360 242
1546 iso_pu_bacteria 8004640170 8004646533 242
1547 iso_pu_bacteria 8004703790 8004706444 242
1548 iso_pu_bacteria 8004714634 8004715103 242
1549 iso_pu_bacteria 8004727605 8004733210 242
1550 iso_pu_bacteria 8055617313 8055618207 242
1551 3300005262 Ga0065165_1003519 Ga0065165_10035197 243
1552 3300005331 Ga0070670_100000116 Ga0070670_10000011611 243
1553 3300006353 Ga0075370_10076142 Ga0075370_100761421 243
1554 3300013104 Ga0157370_10062213 Ga0157370_100622132 243
1555 3300013105 Ga0157369_10028357 Ga0157369_100283572 243
1556 3300025295 Ga0209564_1031739 Ga0209564_10317392 243
1557 3300025299 Ga0209256_1002945 Ga0209256_10029459 243
1558 3300025925 Ga0207650_10000691 Ga0207650_1000069126 243
1559 3300031548 Ga0307408_100492954 Ga0307408_1004929541 243
1560 3300031731 Ga0307405_10234530 Ga0307405_102345302 243
1561 3300031852 Ga0307410_10178930 Ga0307410_101789303 243
1562 3300031995 Ga0307409_100045667 Ga0307409_1000456674 243
1563 3300041404 Ga0439436_0012216 Ga0439436_0012216_265_1008 243
1564 3300041405 Ga0439438_009534 Ga0439438_009534_1527_2270 243
1565 3300041406 Ga0439439_0047919 Ga0439439_0047919_77_820 243
1566 3300041407 Ga0439447_065989 Ga0439447_065989_48_791 243
1567 3300042002 Ga0439442_018773 Ga0439442_018773_487_1230 243
1568 3300042007 Ga0439449_0122416 Ga0439449_0122416_25_768 243
1569 3300042122 Ga0450920_003459 Ga0450920_003459_1912_2655 243
1570 3300042531 Ga0450918_005441 Ga0450918_005441_1019_1762 243
1571 3300049571 Ga0501034_0232959 Ga0501034_0232959_255_1034 243
1572 3300050496 nmdc:mga07m45_246996_c1 nmdc:mga07m45_246996_c1_185_928 243
1573 3300053125 Ga0500618_001280 Ga0500618_001280_3251_3997 243
1574 3300053156 Ga0500622_0000343 Ga0500622_0000343_9425_10171 243
1575 3300005548 Ga0070665_100021286 Ga0070665_1000212867 244
1576 3300028379 Ga0268266_10015172 Ga0268266_100151722 244
1577 3300048922 Ga0496119_0000147 Ga0496119_0000147_28212_28994 244
1578 3300048926 Ga0496123_0002376 Ga0496123_0002376_22781_23563 244
1579 3300053104 Ga0500556_0000142 Ga0500556_0000142_43811_44593 244
1580 3300002705 JGI25156J39149_1009778 JGI25156J39149_10097782 245
1581 3300002741 JGI25157J39369_1001314 JGI25157J39369_10013147 245
1582 3300003763 Ga0055529_1004728 Ga0055529_10047283 245
1583 3300005614 Ga0068856_100444889 Ga0068856_1004448892 245
1584 3300006178 Ga0075367_10045738 Ga0075367_100457382 245
1585 3300006353 Ga0075370_10079900 Ga0075370_100799002 245
1586 3300009093 Ga0105240_10250829 Ga0105240_102508291 245
1587 3300009148 Ga0105243_10595485 Ga0105243_105954852 245
1588 3300009174 Ga0105241_10849041 Ga0105241_108490411 245
1589 3300009551 Ga0105238_10344342 Ga0105238_103443421 245
1590 3300010375 Ga0105239_10246399 Ga0105239_102463991 245
1591 3300013102 Ga0157371_10018609 Ga0157371_100186092 245
1592 3300013105 Ga0157369_10126588 Ga0157369_101265881 245
1593 3300013105 Ga0157369_10172253 Ga0157369_101722532 245
1594 3300013306 Ga0163162_10117870 Ga0163162_101178703 245
1595 3300013306 Ga0163162_10442404 Ga0163162_104424042 245
1596 3300014325 Ga0163163_10261064 Ga0163163_102610642 245
1597 3300014497 Ga0182008_10119652 Ga0182008_101196521 245
1598 3300014969 Ga0157376_10226366 Ga0157376_102263662 245
1599 3300015261 Ga0182006_1048187 Ga0182006_10481871 245
1600 3300020070 Ga0206356_10905856 Ga0206356_109058561 245
1601 3300020076 Ga0206355_1532750 Ga0206355_15327501 245
1602 3300020077 Ga0206351_10295174 Ga0206351_102951741 245
1603 3300020080 Ga0206350_10165189 Ga0206350_101651891 245
1604 3300020610 Ga0154015_1345373 Ga0154015_13453731 245
1605 3300025250 Ga0209026_1000032 Ga0209026_100003269 245
1606 3300025254 Ga0209148_1000111 Ga0209148_1000111179 245
1607 3300025256 Ga0209759_1000142 Ga0209759_1000142128 245
1608 3300025272 Ga0209455_1000223 Ga0209455_100022372 245
1609 3300025904 Ga0207647_10101029 Ga0207647_101010292 245
1610 3300025909 Ga0207705_10471583 Ga0207705_104715831 245
1611 3300025911 Ga0207654_10039900 Ga0207654_100399002 245
1612 3300025913 Ga0207695_10191320 Ga0207695_101913201 245
1613 3300025914 Ga0207671_10060555 Ga0207671_100605552 245
1614 3300025919 Ga0207657_10074718 Ga0207657_100747182 245
1615 3300025920 Ga0207649_10231881 Ga0207649_102318811 245
1616 3300025924 Ga0207694_10484140 Ga0207694_104841401 245
1617 3300025972 Ga0207668_10488147 Ga0207668_104881471 245
1618 3300026067 Ga0207678_10120431 Ga0207678_101204311 245
1619 3300028379 Ga0268266_10233666 Ga0268266_102336662 245
1620 3300037418 Ga0395900_0028708 Ga0395900_0028708_2588_3358 245
1621 3300038443 Ga0395901_0223550 Ga0395901_0223550_772_1542 245
1622 3300041413 Ga0439465_0009497 Ga0439465_0009497_918_1700 245
1623 3300048918 Ga0496115_0194736 Ga0496115_0194736_573_1346 245
1624 3300048919 Ga0496116_0000057 Ga0496116_0000057_240902_241684 245
1625 3300048919 Ga0496116_0081392 Ga0496116_0081392_149_931 245
1626 3300048920 Ga0496117_0010058 Ga0496117_0010058_5574_6356 245
1627 3300048921 Ga0496118_0030421 Ga0496118_0030421_2972_3754 245
1628 3300048922 Ga0496119_0023944 Ga0496119_0023944_2725_3507 245
1629 3300048922 Ga0496119_0148981 Ga0496119_0148981_302_1075 245
1630 3300048923 Ga0496120_0045241 Ga0496120_0045241_1291_2064 245
1631 3300048924 Ga0496121_0000034 Ga0496121_0000034_239030_239812 245
1632 3300048924 Ga0496121_0178584 Ga0496121_0178584_503_1276 245
1633 3300048927 Ga0496124_0005858 Ga0496124_0005858_5313_6095 245
1634 3300048927 Ga0496124_0153424 Ga0496124_0153424_668_1441 245
1635 3300048927 Ga0496124_0222685 Ga0496124_0222685_566_1348 245
1636 3300048928 Ga0496125_0000030 Ga0496125_0000030_134707_135489 245
1637 3300048928 Ga0496125_0189741 Ga0496125_0189741_61_834 245
1638 3300048929 Ga0496126_0005711 Ga0496126_0005711_5660_6442 245
1639 3300048929 Ga0496126_0094014 Ga0496126_0094014_773_1555 245
1640 3300048929 Ga0496126_0214460 Ga0496126_0214460_802_1584 245
1641 3300048929 Ga0496126_0223749 Ga0496126_0223749_36_809 245
1642 3300049569 Ga0501032_0000006 Ga0501032_0000006_25692_26468 245
1643 3300049569 Ga0501032_0046093 Ga0501032_0046093_209_985 245
1644 3300049570 Ga0501033_0000053 Ga0501033_0000053_38743_39519 245
1645 3300049571 Ga0501034_0000030 Ga0501034_0000030_208662_209438 245
1646 3300049571 Ga0501034_0042799 Ga0501034_0042799_2391_3167 245
1647 3300049572 Ga0501036_0000003 Ga0501036_0000003_235260_236036 245
1648 3300049572 Ga0501036_0156857 Ga0501036_0156857_965_1741 245
1649 3300049573 Ga0501037_0000003 Ga0501037_0000003_235260_236036 245
1650 3300049573 Ga0501037_0150970 Ga0501037_0150970_620_1396 245
1651 3300049574 Ga0501038_0000004 Ga0501038_0000004_235260_236036 245
1652 3300049574 Ga0501038_0075791 Ga0501038_0075791_1418_2194 245
1653 3300049574 Ga0501038_0155929 Ga0501038_0155929_41_784 245
1654 3300049575 Ga0501039_0000008 Ga0501039_0000008_235260_236036 245
1655 3300049576 Ga0501040_0104897 Ga0501040_0104897_253_1029 245
1656 3300049579 Ga0501043_0000365 Ga0501043_0000365_24525_25301 245
1657 3300049580 Ga0501046_0018481 Ga0501046_0018481_4462_5238 245
1658 3300049581 Ga0501047_0001197 Ga0501047_0001197_11466_12242 245
1659 3300049582 Ga0501048_0008179 Ga0501048_0008179_2411_3187 245
1660 3300049584 Ga0501068_0015949 Ga0501068_0015949_2716_3492 245
1661 3300049586 Ga0501070_0086535 Ga0501070_0086535_302_1078 245
1662 3300049586 Ga0501070_0181061 Ga0501070_0181061_813_1589 245
1663 3300049590 Ga0501074_0453288 Ga0501074_0453288_122_898 245
1664 3300049742 Ga0501080_0033256 Ga0501080_0033256_2089_2865 245
1665 3300049822 Ga0501035_0000031 Ga0501035_0000031_136073_136849 245
1666 3300049822 Ga0501035_0034682 Ga0501035_0034682_1418_2194 245
1667 3300049822 Ga0501035_0346898 Ga0501035_0346898_53_796 245
1668 3300049823 Ga0501044_0000008 Ga0501044_0000008_235260_236036 245
1669 3300049823 Ga0501044_0056269 Ga0501044_0056269_404_1147 245
1670 3300049823 Ga0501044_0086497 Ga0501044_0086497_1418_2194 245
1671 3300049824 Ga0501045_0069019 Ga0501045_0069019_619_1395 245
1672 3300050491 nmdc:mga00v17_172266_c1 nmdc:mga00v17_172266_c1_522_1304 245
1673 3300050491 nmdc:mga00v17_20304_c1 nmdc:mga00v17_20304_c1_2632_3411 245
1674 3300050492 nmdc:mga0yw44_20329_c1 nmdc:mga0yw44_20329_c1_1937_2710 245
1675 3300050492 nmdc:mga0yw44_273955_c1 nmdc:mga0yw44_273955_c1_248_1021 245
1676 3300050492 nmdc:mga0yw44_398542_c1 nmdc:mga0yw44_398542_c1_106_885 245
1677 3300053153 Ga0500616_0003388 Ga0500616_0003388_3471_4253 245
1678 3300053158 Ga0500627_0075957 Ga0500627_0075957_572_1354 245
1679 3300053177 Ga0500636_0002588 Ga0500636_0002588_1639_2421 245
1680 3300059508 Ga0587088_038458 Ga0587088_038458_80_817 245
1681 3300059604 Ga0587098_010749 Ga0587098_010749_172_945 245
1682 iso_pu_bacteria 2738543024 2739306008 245
1683 3300001979 JGI24740J21852_10038081 JGI24740J21852_100380811 246
1684 3300001989 JGI24739J22299_10055633 JGI24739J22299_100556332 246
1685 3300002067 JGI24735J21928_10035258 JGI24735J21928_100352581 246
1686 3300005563 Ga0068855_100305394 Ga0068855_1003053942 246
1687 3300005577 Ga0068857_100181861 Ga0068857_1001818612 246
1688 3300005616 Ga0068852_100491483 Ga0068852_1004914832 246
1689 3300006038 Ga0075365_10089590 Ga0075365_100895903 246
1690 3300006042 Ga0075368_10030823 Ga0075368_100308232 246
1691 3300006051 Ga0075364_10146058 Ga0075364_101460582 246
1692 3300006051 Ga0075364_10256754 Ga0075364_102567541 246
1693 3300006177 Ga0075362_10117247 Ga0075362_101172472 246
1694 3300006178 Ga0075367_10029691 Ga0075367_100296912 246
1695 3300006178 Ga0075367_10169485 Ga0075367_101694852 246
1696 3300006195 Ga0075366_10085787 Ga0075366_100857871 246
1697 3300006195 Ga0075366_10233095 Ga0075366_102330952 246
1698 3300006881 Ga0068865_100269196 Ga0068865_1002691962 246
1699 3300009101 Ga0105247_10075884 Ga0105247_100758842 246
1700 3300009148 Ga0105243_10213017 Ga0105243_102130171 246
1701 3300009545 Ga0105237_10140495 Ga0105237_101404953 246
1702 3300009551 Ga0105238_10009792 Ga0105238_100097926 246
1703 3300010375 Ga0105239_10386213 Ga0105239_103862131 246
1704 3300013297 Ga0157378_10243186 Ga0157378_102431862 246
1705 3300013307 Ga0157372_10759888 Ga0157372_107598881 246
1706 3300025261 Ga0209233_1000118 Ga0209233_100011877 246
1707 3300025297 Ga0209758_1009917 Ga0209758_10099172 246
1708 3300025900 Ga0207710_10283127 Ga0207710_102831271 246
1709 3300025904 Ga0207647_10008981 Ga0207647_100089817 246
1710 3300025935 Ga0207709_10378626 Ga0207709_103786261 246
1711 3300025938 Ga0207704_10301885 Ga0207704_103018851 246
1712 3300025949 Ga0207667_10668146 Ga0207667_106681462 246
1713 3300026041 Ga0207639_10697687 Ga0207639_106976871 246
1714 3300026067 Ga0207678_10418061 Ga0207678_104180612 246
1715 3300026078 Ga0207702_10850325 Ga0207702_108503251 246
1716 3300026089 Ga0207648_10045791 Ga0207648_100457914 246
1717 3300026116 Ga0207674_10096921 Ga0207674_100969213 246
1718 3300027866 Ga0209813_10021294 Ga0209813_100212941 246
1719 3300028794 Ga0307515_10290965 Ga0307515_102909651 246
1720 3300037418 Ga0395900_0000056 Ga0395900_0000056_202389_203168 246
1721 3300037418 Ga0395900_0084320 Ga0395900_0084320_1857_2597 246
1722 3300037466 Ga0395898_0000114 Ga0395898_0000114_202380_203159 246
1723 3300037471 Ga0395905_0000053 Ga0395905_0000053_9910_10689 246
1724 3300038443 Ga0395901_0000037 Ga0395901_0000037_202389_203168 246
1725 3300038443 Ga0395901_0277792 Ga0395901_0277792_726_1466 246
1726 3300044658 Ga0466972_0037303 Ga0466972_0037303_994_1734 246
1727 3300044658 Ga0466972_0124009 Ga0466972_0124009_15_755 246
1728 3300044901 Ga0466960_0023442 Ga0466960_0023442_1845_2585 246
1729 3300046519 Ga0495632_0126415 Ga0495632_0126415_201_941 246
1730 3300046542 Ga0495597_0021206 Ga0495597_0021206_1793_2533 246
1731 3300046660 Ga0495625_0011675 Ga0495625_0011675_2673_3413 246
1732 3300048091 Ga0495626_0031946 Ga0495626_0031946_124_864 246
1733 3300048905 Ga0496102_0462299 Ga0496102_0462299_21_761 246
1734 3300048918 Ga0496115_0180530 Ga0496115_0180530_684_1424 246
1735 3300048928 Ga0496125_0126996 Ga0496125_0126996_724_1464 246
1736 3300049570 Ga0501033_0000477 Ga0501033_0000477_30077_30859 246
1737 3300049571 Ga0501034_0000023 Ga0501034_0000023_189721_190503 246
1738 3300049572 Ga0501036_0002249 Ga0501036_0002249_7142_7924 246
1739 3300049573 Ga0501037_0000269 Ga0501037_0000269_4588_5370 246
1740 3300049574 Ga0501038_0000040 Ga0501038_0000040_73390_74172 246
1741 3300049575 Ga0501039_0000089 Ga0501039_0000089_60326_61108 246
1742 3300049579 Ga0501043_0000019 Ga0501043_0000019_91349_92131 246
1743 3300049580 Ga0501046_0034838 Ga0501046_0034838_384_1166 246
1744 3300049583 Ga0501067_0081299 Ga0501067_0081299_933_1712 246
1745 3300049822 Ga0501035_0000434 Ga0501035_0000434_7012_7794 246
1746 3300049823 Ga0501044_0017484 Ga0501044_0017484_2077_2859 246
1747 3300049823 Ga0501044_0347256 Ga0501044_0347256_479_1258 246
1748 3300050489 nmdc:mga03683_90896_c1 nmdc:mga03683_90896_c1_249_1028 246
1749 3300050491 nmdc:mga00v17_240018_c1 nmdc:mga00v17_240018_c1_420_1160 246
1750 3300050492 nmdc:mga0yw44_109607_c1 nmdc:mga0yw44_109607_c1_700_1479 246
1751 3300050493 nmdc:mga0k408_253397_c1 nmdc:mga0k408_253397_c1_79_819 246
1752 3300050494 nmdc:mga06z11_275005_c1 nmdc:mga06z11_275005_c1_146_886 246
1753 3300050494 nmdc:mga06z11_53830_c1 nmdc:mga06z11_53830_c1_124_903 246
1754 3300050495 nmdc:mga04h51_12766_c1 nmdc:mga04h51_12766_c1_108_848 246
1755 3300050516 nmdc:mga0sz30_33980_c1 nmdc:mga0sz30_33980_c1_834_1613 246
1756 3300053079 Ga0500610_0017821 Ga0500610_0017821_319_1059 246
1757 3300053158 Ga0500627_0127987 Ga0500627_0127987_171_911 246
1758 3300059505 Ga0587083_0062428 Ga0587083_0062428_25_765 246
1759 3300059513 Ga0587094_028773 Ga0587094_028773_24_767 246
1760 3300059513 Ga0587094_029811 Ga0587094_029811_17_760 246
1761 3300059608 Ga0587129_004592 Ga0587129_004592_110_850 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01027

Bax1-I

Inhibitor of apoptosis-promoting Bax1

22

237

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pgw-assembly1.cif.gz_A crystal structure of yetj from bacillus subtilis at ph 6 by pt-sad 0.6681 27 242
6nq8-assembly2.cif.gz_B crystal structure of yetj mutant from bacillus subtilis - d171e 0.6659 27 242
4pgw-assembly1.cif.gz_A crystal structure of yetj from bacillus subtilis at ph 6 by pt-sad 0.6532 27 242
6nq9-assembly3.cif.gz_C crystal structure of yetj mutant from bacillus subtilis - d195e 0.65 27 244
6nq8-assembly2.cif.gz_B crystal structure of yetj mutant from bacillus subtilis - d171e 0.6454 27 242
ID Description Score Start End Superfamily
af_P0AAC4_18_230_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.758 27 240 1.20.1250.20
af_P0AAC4_18_230_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7418 27 240 1.20.1250.20
af_B6TIY8_53_257_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7038 26 241 1.20.1250.20
af_Q4DZH5_101_300_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6978 26 240 1.20.1250.20
af_B6TIY8_53_257_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6945 26 241 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A4Q3YGB9-F1-model_v4 Bax inhibitor-1/YccA family protein 0.9613 18 143 GO:0016020
AF-A0A357LPT4-F1-model_v4 BAX inhibitor (BI)-1/YccA family protein 0.9102 15 118 GO:0016020
AF-A0A530L932-F1-model_v4 Bax inhibitor-1/YccA family protein 0.9024 13 158 GO:0016020
AF-A0A259AWH8-F1-model_v4 BAX inhibitor (BI)-1/YccA family protein 0.864 1 133 GO:0016020
AF-A0A529Q9T2-F1-model_v4 Bax inhibitor-1/YccA family protein 0.8539 19 173 GO:0016020

Feature Viewer

pLDDT pTM Quality
82.61 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map