F495592
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1757 | 755 | 3514 | 65 |
Family's Representative Sequence
| Representative Sequence | 3300049568|Ga0501031_0109985|Ga0501031_0109985_1301_1510 |
| Length | 69 |
| Sequence | MQVTRQVIVNGERREIAAQTVDALLTELDYEGTHFAIAVNFDVLPKSRWAETALNSGDEIEIITPRQGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 12 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 89 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 90 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 92 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 93 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 94 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 95 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 96 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 100 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 101 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 102 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 108 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 109 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 113 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 114 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 130 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 142 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 152 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 153 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 154 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 155 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 156 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 157 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300023224 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU4 | Metagenome | Unclassified |
| 159 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 160 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 238 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 239 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 240 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 241 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 245 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 246 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 247 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 248 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 249 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 250 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 251 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 252 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 253 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 254 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 257 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 258 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 259 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 260 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 261 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 262 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 263 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 264 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 265 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 266 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 267 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 268 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 269 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 270 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 271 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 272 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 273 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 274 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 275 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 276 | 3300033546 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 | Metagenome | Unclassified |
| 277 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 278 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 279 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 280 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 281 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 282 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 283 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 284 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 286 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 288 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 289 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 290 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 291 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 292 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 293 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 294 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 295 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 296 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 297 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 298 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 299 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 300 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 301 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 302 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 303 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 304 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 305 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 306 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 307 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 310 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 313 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 314 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 315 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 316 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 317 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 318 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 319 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 320 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 321 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 322 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 323 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 324 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 325 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 326 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 327 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 328 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 329 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 330 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 331 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 415 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 416 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 417 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 418 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 419 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 420 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 421 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 423 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 424 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 425 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 426 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 427 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 428 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 429 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 430 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 431 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 432 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 433 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 434 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 435 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 436 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 437 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 438 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 439 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 471 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 472 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 473 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 474 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 475 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 476 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 477 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 482 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 484 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 485 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 489 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 490 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 491 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 492 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 493 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 494 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 495 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 496 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 497 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 498 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 499 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 500 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 501 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 502 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 503 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 504 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 505 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 506 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 507 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 508 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 509 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 510 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 511 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 512 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 513 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 514 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 515 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 516 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 517 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 518 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 519 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 520 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 521 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 522 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 523 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 524 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 525 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 526 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 527 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 528 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 529 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 530 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 531 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 532 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 533 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 534 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 535 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 536 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 537 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 538 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 539 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 541 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 542 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 543 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 544 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 545 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 546 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 547 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 548 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 549 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 550 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 551 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 552 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 553 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 554 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 555 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 556 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 557 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 558 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 559 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 560 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 561 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 562 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 563 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 564 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 565 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 566 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 567 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 568 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 569 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 570 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 571 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 572 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 573 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 574 | 2791355199 | |||
| 575 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 576 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 577 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 578 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 579 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 580 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 581 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 582 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 583 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 584 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 585 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 586 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 587 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 588 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 589 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 590 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 591 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 592 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 593 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 594 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 595 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 596 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 597 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 598 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 599 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 600 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 601 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 602 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 603 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 604 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 605 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 606 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 607 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 608 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 609 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 610 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 611 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 612 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 613 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 614 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 615 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 616 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 617 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 618 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 619 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 620 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 621 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 622 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 623 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 624 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 625 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 626 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 627 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 628 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 629 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 630 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 631 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 632 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 633 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 634 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 635 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 636 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 637 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 638 | 2906610324 | |||
| 639 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 640 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 641 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 642 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 643 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 644 | 2922368715 | |||
| 645 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 646 | 2922425934 | |||
| 647 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 648 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 649 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 650 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 651 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 652 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 653 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 654 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 655 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 656 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 657 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 658 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 659 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 660 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 661 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 662 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 663 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 664 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 665 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 666 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 667 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 668 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 669 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 670 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 671 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 672 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 673 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 674 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 675 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 676 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 677 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 678 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 679 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 680 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 681 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 682 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 683 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 684 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 685 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 686 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 687 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 688 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 689 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 690 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 691 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 692 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 693 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 694 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 695 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 696 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 697 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 698 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 699 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 700 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 701 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 702 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 703 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 704 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 705 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 706 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 707 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 708 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 709 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 710 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 711 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 712 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 713 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 714 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 715 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 716 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 717 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 718 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 719 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 720 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 721 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 722 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 723 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 724 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 725 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 726 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 727 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 728 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 729 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 730 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 731 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 732 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 733 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 734 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 735 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 736 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 737 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 738 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 739 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 740 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 741 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 742 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 743 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 744 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 745 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 746 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 747 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 748 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 749 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 750 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 751 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 752 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 753 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 754 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 755 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.39 |
| Metatranscriptomes | 0.63 |
| Isolates | 11.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.42 |
| Nodule | 9.56 |
| Rhizoplane | 4.72 |
| Rhizosphere | 65.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501031_0109985 | 3300049568 | Bacteria | 1799 |
| 2 | JGI24741J21665_1039409 | 3300001915 | Bacteria | 698 |
| 3 | JGI24740J21852_10003892 | 3300001979 | Bacteria | 6483 |
| 4 | JGI24737J22298_10064718 | 3300001990 | Bacteria | 1097 |
| 5 | JGI24735J21928_10060318 | 3300002067 | Bacteria | 1090 |
| 6 | JGI24738J21930_10096861 | 3300002075 | Bacteria | 628 |
| 7 | JGI24742J22300_10027093 | 3300002244 | Bacteria | 993 |
| 8 | JGI25165J46597_1029680 | 3300003214 | Bacteria | 706 |
| 9 | JGI25165J46597_1040290 | 3300003214 | Bacteria | 600 |
| 10 | JGI25153J46596_10013493 | 3300003215 | Bacteria | 3448 |
| 11 | JGI25153J46596_10014078 | 3300003215 | Bacteria | 3345 |
| 12 | JGI25153J46596_10070966 | 3300003215 | Bacteria | 902 |
| 13 | JGI25160J50197_1003238 | 3300003354 | Bacteria | 7344 |
| 14 | JGI25160J50197_1020072 | 3300003354 | Bacteria | 2028 |
| 15 | JGI25404J52841_10003406 | 3300003659 | Bacteria | 3139 |
| 16 | JGI25404J52841_10026407 | 3300003659 | Bacteria | 1249 |
| 17 | Ga0055525_1009691 | 3300003759 | Bacteria | 813 |
| 18 | Ga0055542_1005917 | 3300003762 | Bacteria | 2681 |
| 19 | Ga0055529_1037036 | 3300003763 | Bacteria | 594 |
| 20 | Ga0055526_1094550 | 3300003771 | Bacteria | 558 |
| 21 | Ga0055524_1051419 | 3300003775 | Bacteria | 930 |
| 22 | Ga0055531_10033850 | 3300003794 | Bacteria | 1635 |
| 23 | Ga0055543_1002483 | 3300004625 | Bacteria | 6074 |
| 24 | Ga0055543_1017973 | 3300004625 | Bacteria | 1324 |
| 25 | Ga0065165_1000866 | 3300005262 | Bacteria | 39512 |
| 26 | Ga0065165_1010304 | 3300005262 | Bacteria | 4058 |
| 27 | Ga0065165_1011062 | 3300005262 | Bacteria | 3817 |
| 28 | Ga0065165_1022843 | 3300005262 | Bacteria | 2133 |
| 29 | Ga0065165_1023762 | 3300005262 | Bacteria | 2071 |
| 30 | Ga0065165_1126985 | 3300005262 | Bacteria | 613 |
| 31 | Ga0070658_10204771 | 3300005327 | Bacteria | 1666 |
| 32 | Ga0070658_10221713 | 3300005327 | Bacteria | 1599 |
| 33 | Ga0070658_10570579 | 3300005327 | Bacteria | 980 |
| 34 | Ga0070683_100080343 | 3300005329 | Bacteria | 3052 |
| 35 | Ga0070683_100574399 | 3300005329 | Bacteria | 1078 |
| 36 | Ga0070683_100591401 | 3300005329 | Bacteria | 1062 |
| 37 | Ga0070690_100402238 | 3300005330 | Bacteria | 1006 |
| 38 | Ga0070670_101356060 | 3300005331 | Bacteria | 652 |
| 39 | Ga0068869_100334072 | 3300005334 | Bacteria | 1232 |
| 40 | Ga0068869_101316200 | 3300005334 | Bacteria | 638 |
| 41 | Ga0070666_11089069 | 3300005335 | Bacteria | 594 |
| 42 | Ga0070680_100184081 | 3300005336 | Bacteria | 1759 |
| 43 | Ga0070680_100323344 | 3300005336 | Bacteria | 1309 |
| 44 | Ga0070682_100022257 | 3300005337 | Bacteria | 3753 |
| 45 | Ga0070682_100065301 | 3300005337 | Bacteria | 2312 |
| 46 | Ga0070682_100719122 | 3300005337 | Bacteria | 803 |
| 47 | Ga0070682_101008069 | 3300005337 | Bacteria | 691 |
| 48 | Ga0070682_101723733 | 3300005337 | Bacteria | 545 |
| 49 | Ga0068868_100678638 | 3300005338 | Bacteria | 920 |
| 50 | Ga0070660_100674651 | 3300005339 | Bacteria | 866 |
| 51 | Ga0070660_100757012 | 3300005339 | Bacteria | 816 |
| 52 | Ga0070660_101065446 | 3300005339 | Bacteria | 684 |
| 53 | Ga0070689_100243712 | 3300005340 | Bacteria | 1481 |
| 54 | Ga0070689_100626786 | 3300005340 | Bacteria | 934 |
| 55 | Ga0070691_10344385 | 3300005341 | Bacteria | 826 |
| 56 | Ga0070687_101146268 | 3300005343 | Bacteria | 571 |
| 57 | Ga0070661_101425714 | 3300005344 | Bacteria | 583 |
| 58 | Ga0070668_100027110 | 3300005347 | Bacteria | 4348 |
| 59 | Ga0070668_100103345 | 3300005347 | Bacteria | 2260 |
| 60 | Ga0070668_100225475 | 3300005347 | Bacteria | 1547 |
| 61 | Ga0070668_100676450 | 3300005347 | Bacteria | 908 |
| 62 | Ga0070668_100709753 | 3300005347 | Bacteria | 887 |
| 63 | Ga0070668_101156388 | 3300005347 | Bacteria | 700 |
| 64 | Ga0070668_101213991 | 3300005347 | Bacteria | 683 |
| 65 | Ga0070668_101326768 | 3300005347 | Bacteria | 654 |
| 66 | Ga0070669_100641980 | 3300005353 | Bacteria | 892 |
| 67 | Ga0070669_101570086 | 3300005353 | Bacteria | 573 |
| 68 | Ga0070675_100268798 | 3300005354 | Bacteria | 1496 |
| 69 | Ga0070675_101532882 | 3300005354 | Bacteria | 615 |
| 70 | Ga0070671_101027901 | 3300005355 | Bacteria | 722 |
| 71 | Ga0070671_101369625 | 3300005355 | Bacteria | 625 |
| 72 | Ga0070671_101379069 | 3300005355 | Bacteria | 622 |
| 73 | Ga0070674_100036028 | 3300005356 | Bacteria | 3318 |
| 74 | Ga0070673_100380173 | 3300005364 | Bacteria | 1259 |
| 75 | Ga0070673_100717943 | 3300005364 | Bacteria | 919 |
| 76 | Ga0070673_101548483 | 3300005364 | Bacteria | 626 |
| 77 | Ga0070673_101603820 | 3300005364 | Bacteria | 615 |
| 78 | Ga0070688_100549144 | 3300005365 | Bacteria | 878 |
| 79 | Ga0070659_100633869 | 3300005366 | Bacteria | 920 |
| 80 | Ga0070667_100523159 | 3300005367 | Bacteria | 1089 |
| 81 | Ga0070667_101912606 | 3300005367 | Bacteria | 559 |
| 82 | Ga0070709_10017774 | 3300005434 | Bacteria | 4085 |
| 83 | Ga0070709_10861234 | 3300005434 | Bacteria | 714 |
| 84 | Ga0070709_10985969 | 3300005434 | Bacteria | 670 |
| 85 | Ga0070714_100002475 | 3300005435 | Bacteria | 13625 |
| 86 | Ga0070714_100058996 | 3300005435 | Bacteria | 3289 |
| 87 | Ga0070714_100066539 | 3300005435 | Bacteria | 3105 |
| 88 | Ga0070714_100937885 | 3300005435 | Bacteria | 841 |
| 89 | Ga0070713_100016516 | 3300005436 | Bacteria | 5551 |
| 90 | Ga0070713_100034524 | 3300005436 | Bacteria | 4065 |
| 91 | Ga0070713_100533926 | 3300005436 | Bacteria | 1109 |
| 92 | Ga0070710_10003075 | 3300005437 | Bacteria | 7926 |
| 93 | Ga0070710_10030941 | 3300005437 | Bacteria | 2884 |
| 94 | Ga0070710_11332738 | 3300005437 | Bacteria | 535 |
| 95 | Ga0070701_10110115 | 3300005438 | Bacteria | 1538 |
| 96 | Ga0070711_100006263 | 3300005439 | Bacteria | 7167 |
| 97 | Ga0070711_100022019 | 3300005439 | Bacteria | 4126 |
| 98 | Ga0070711_100150274 | 3300005439 | Bacteria | 1755 |
| 99 | Ga0070711_101083321 | 3300005439 | Bacteria | 690 |
| 100 | Ga0070711_101998848 | 3300005439 | Bacteria | 510 |
| 101 | Ga0070705_100306555 | 3300005440 | Bacteria | 1140 |
| 102 | Ga0070705_100348583 | 3300005440 | Bacteria | 1079 |
| 103 | Ga0070700_100051471 | 3300005441 | Bacteria | 2563 |
| 104 | Ga0070700_101581133 | 3300005441 | Bacteria | 560 |
| 105 | Ga0070663_100059209 | 3300005455 | Bacteria | 2753 |
| 106 | Ga0070663_100059935 | 3300005455 | Bacteria | 2736 |
| 107 | Ga0070663_100241130 | 3300005455 | Bacteria | 1427 |
| 108 | Ga0070663_100372867 | 3300005455 | Bacteria | 1160 |
| 109 | Ga0070663_100409223 | 3300005455 | Bacteria | 1110 |
| 110 | Ga0070663_100419178 | 3300005455 | Bacteria | 1098 |
| 111 | Ga0070663_100702748 | 3300005455 | Bacteria | 859 |
| 112 | Ga0070663_101534964 | 3300005455 | Bacteria | 593 |
| 113 | Ga0070678_100170830 | 3300005456 | Bacteria | 1771 |
| 114 | Ga0070678_100713201 | 3300005456 | Bacteria | 905 |
| 115 | Ga0070678_100869356 | 3300005456 | Bacteria | 822 |
| 116 | Ga0070678_101804424 | 3300005456 | Bacteria | 577 |
| 117 | Ga0070662_100126386 | 3300005457 | Bacteria | 1966 |
| 118 | Ga0070662_100322160 | 3300005457 | Bacteria | 1260 |
| 119 | Ga0070681_10084335 | 3300005458 | Bacteria | 3129 |
| 120 | Ga0070681_10096897 | 3300005458 | Bacteria | 2897 |
| 121 | Ga0070681_10262844 | 3300005458 | Bacteria | 1638 |
| 122 | Ga0070681_10660549 | 3300005458 | Bacteria | 960 |
| 123 | Ga0070681_10747395 | 3300005458 | Bacteria | 894 |
| 124 | Ga0070681_11441717 | 3300005458 | Bacteria | 612 |
| 125 | Ga0068867_100233906 | 3300005459 | Bacteria | 1487 |
| 126 | Ga0068867_101855550 | 3300005459 | Bacteria | 568 |
| 127 | Ga0070685_11182605 | 3300005466 | Bacteria | 580 |
| 128 | Ga0070706_100116094 | 3300005467 | Bacteria | 2493 |
| 129 | Ga0070706_100317605 | 3300005467 | Bacteria | 1453 |
| 130 | Ga0070707_101459110 | 3300005468 | Bacteria | 651 |
| 131 | Ga0070698_100476302 | 3300005471 | Bacteria | 1185 |
| 132 | Ga0070699_100771608 | 3300005518 | Bacteria | 879 |
| 133 | Ga0070679_100087318 | 3300005530 | Bacteria | 3106 |
| 134 | Ga0070679_100126650 | 3300005530 | Bacteria | 2536 |
| 135 | Ga0070679_100200770 | 3300005530 | Bacteria | 1960 |
| 136 | Ga0070679_100579527 | 3300005530 | Bacteria | 1065 |
| 137 | Ga0070679_100669564 | 3300005530 | Bacteria | 980 |
| 138 | Ga0070684_100212950 | 3300005535 | Bacteria | 1761 |
| 139 | Ga0070684_100237885 | 3300005535 | Bacteria | 1663 |
| 140 | Ga0070684_100674972 | 3300005535 | Bacteria | 963 |
| 141 | Ga0070684_100747921 | 3300005535 | Bacteria | 913 |
| 142 | Ga0070684_101231826 | 3300005535 | Bacteria | 704 |
| 143 | Ga0070684_101786378 | 3300005535 | Bacteria | 580 |
| 144 | Ga0070697_101686728 | 3300005536 | Bacteria | 567 |
| 145 | Ga0068853_100015392 | 3300005539 | Bacteria | 6283 |
| 146 | Ga0068853_100302927 | 3300005539 | Bacteria | 1478 |
| 147 | Ga0068853_101019774 | 3300005539 | Bacteria | 797 |
| 148 | Ga0068853_101174988 | 3300005539 | Bacteria | 741 |
| 149 | Ga0068853_101311547 | 3300005539 | Bacteria | 700 |
| 150 | Ga0068853_101755410 | 3300005539 | Bacteria | 602 |
| 151 | Ga0068853_102313219 | 3300005539 | Bacteria | 521 |
| 152 | Ga0070672_100790270 | 3300005543 | Bacteria | 835 |
| 153 | Ga0070695_101447313 | 3300005545 | Bacteria | 571 |
| 154 | Ga0070693_100570730 | 3300005547 | Bacteria | 813 |
| 155 | Ga0070693_101027490 | 3300005547 | Bacteria | 625 |
| 156 | Ga0070693_101531489 | 3300005547 | Bacteria | 522 |
| 157 | Ga0070665_100092371 | 3300005548 | Bacteria | 3031 |
| 158 | Ga0070665_100127107 | 3300005548 | Bacteria | 2551 |
| 159 | Ga0070665_100330442 | 3300005548 | Bacteria | 1529 |
| 160 | Ga0070665_101208911 | 3300005548 | Bacteria | 766 |
| 161 | Ga0070665_101529383 | 3300005548 | Bacteria | 676 |
| 162 | Ga0070704_101578851 | 3300005549 | Bacteria | 605 |
| 163 | Ga0068855_100008396 | 3300005563 | Bacteria | 12491 |
| 164 | Ga0068855_100124660 | 3300005563 | Bacteria | 2946 |
| 165 | Ga0068855_100384532 | 3300005563 | Bacteria | 1540 |
| 166 | Ga0068855_100649624 | 3300005563 | Bacteria | 1133 |
| 167 | Ga0068855_100653885 | 3300005563 | Bacteria | 1128 |
| 168 | Ga0068855_100789492 | 3300005563 | Bacteria | 1010 |
| 169 | Ga0068855_100981151 | 3300005563 | Bacteria | 888 |
| 170 | Ga0068855_101141820 | 3300005563 | Bacteria | 813 |
| 171 | Ga0068855_101451879 | 3300005563 | Bacteria | 705 |
| 172 | Ga0068855_101912426 | 3300005563 | Bacteria | 601 |
| 173 | Ga0070664_100736471 | 3300005564 | Bacteria | 920 |
| 174 | Ga0070664_101654769 | 3300005564 | Bacteria | 606 |
| 175 | Ga0070664_101954281 | 3300005564 | Bacteria | 557 |
| 176 | Ga0068857_100073217 | 3300005577 | Bacteria | 3052 |
| 177 | Ga0068857_100556865 | 3300005577 | Bacteria | 1081 |
| 178 | Ga0068857_100897611 | 3300005577 | Bacteria | 850 |
| 179 | Ga0068854_100019162 | 3300005578 | Bacteria | 4607 |
| 180 | Ga0068854_100099336 | 3300005578 | Bacteria | 2180 |
| 181 | Ga0068854_100699635 | 3300005578 | Bacteria | 875 |
| 182 | Ga0068854_100720306 | 3300005578 | Bacteria | 863 |
| 183 | Ga0068856_100000434 | 3300005614 | Bacteria | 45889 |
| 184 | Ga0068856_100005400 | 3300005614 | Bacteria | 12602 |
| 185 | Ga0068856_100061916 | 3300005614 | Bacteria | 3696 |
| 186 | Ga0068856_100743754 | 3300005614 | Bacteria | 1001 |
| 187 | Ga0068856_101057347 | 3300005614 | Bacteria | 829 |
| 188 | Ga0068856_101189174 | 3300005614 | Bacteria | 779 |
| 189 | Ga0068856_101318671 | 3300005614 | Bacteria | 737 |
| 190 | Ga0068856_102443135 | 3300005614 | Bacteria | 530 |
| 191 | Ga0070702_100249335 | 3300005615 | Bacteria | 1203 |
| 192 | Ga0070702_100634662 | 3300005615 | Bacteria | 806 |
| 193 | Ga0068852_100132591 | 3300005616 | Bacteria | 2296 |
| 194 | Ga0068852_100527483 | 3300005616 | Bacteria | 1179 |
| 195 | Ga0068852_100789814 | 3300005616 | Bacteria | 963 |
| 196 | Ga0068852_100805237 | 3300005616 | Bacteria | 954 |
| 197 | Ga0068852_101325965 | 3300005616 | Bacteria | 741 |
| 198 | Ga0068852_102771576 | 3300005616 | Bacteria | 509 |
| 199 | Ga0068859_100267086 | 3300005617 | Bacteria | 1803 |
| 200 | Ga0068859_100771897 | 3300005617 | Bacteria | 1049 |
| 201 | Ga0068859_101278078 | 3300005617 | Bacteria | 809 |
| 202 | Ga0068859_101337940 | 3300005617 | Bacteria | 790 |
| 203 | Ga0068864_100044659 | 3300005618 | Bacteria | 3799 |
| 204 | Ga0068864_101146526 | 3300005618 | Bacteria | 775 |
| 205 | Ga0068864_101589712 | 3300005618 | Bacteria | 658 |
| 206 | Ga0068864_101986355 | 3300005618 | Bacteria | 588 |
| 207 | Ga0068866_10098727 | 3300005718 | Bacteria | 1607 |
| 208 | Ga0068861_100121270 | 3300005719 | Bacteria | 2110 |
| 209 | Ga0068861_100416119 | 3300005719 | Bacteria | 1196 |
| 210 | Ga0068861_100952346 | 3300005719 | Bacteria | 816 |
| 211 | Ga0068861_102615341 | 3300005719 | Bacteria | 509 |
| 212 | Ga0068851_10481872 | 3300005834 | Bacteria | 741 |
| 213 | Ga0068851_10529726 | 3300005834 | Bacteria | 710 |
| 214 | Ga0068851_10626367 | 3300005834 | Bacteria | 657 |
| 215 | Ga0068851_10646483 | 3300005834 | Bacteria | 647 |
| 216 | Ga0068870_11344868 | 3300005840 | Bacteria | 522 |
| 217 | Ga0068863_101910023 | 3300005841 | Bacteria | 604 |
| 218 | Ga0068858_100352559 | 3300005842 | Bacteria | 1410 |
| 219 | Ga0068858_100352925 | 3300005842 | Bacteria | 1409 |
| 220 | Ga0068858_100457297 | 3300005842 | Bacteria | 1231 |
| 221 | Ga0068858_101916626 | 3300005842 | Bacteria | 586 |
| 222 | Ga0068860_100094368 | 3300005843 | Bacteria | 2852 |
| 223 | Ga0068860_100181953 | 3300005843 | Bacteria | 2031 |
| 224 | Ga0068860_100516941 | 3300005843 | Bacteria | 1193 |
| 225 | Ga0068860_100582840 | 3300005843 | Bacteria | 1123 |
| 226 | Ga0068860_101744102 | 3300005843 | Bacteria | 644 |
| 227 | Ga0068860_102133163 | 3300005843 | Bacteria | 581 |
| 228 | Ga0068860_102796618 | 3300005843 | Bacteria | 506 |
| 229 | Ga0068862_100464415 | 3300005844 | Bacteria | 1195 |
| 230 | Ga0068862_100750303 | 3300005844 | Bacteria | 949 |
| 231 | Ga0068862_100783975 | 3300005844 | Bacteria | 930 |
| 232 | Ga0068862_100947776 | 3300005844 | Bacteria | 849 |
| 233 | Ga0068862_100983825 | 3300005844 | Bacteria | 833 |
| 234 | Ga0068862_101693133 | 3300005844 | Bacteria | 641 |
| 235 | Ga0068862_102234268 | 3300005844 | Bacteria | 559 |
| 236 | Ga0068862_102504649 | 3300005844 | Bacteria | 528 |
| 237 | Ga0081455_10062610 | 3300005937 | Bacteria | 3126 |
| 238 | Ga0081455_10071493 | 3300005937 | Bacteria | 2876 |
| 239 | Ga0081540_1001986 | 3300005983 | Bacteria | 17063 |
| 240 | Ga0081540_1010395 | 3300005983 | Bacteria | 6309 |
| 241 | Ga0081540_1011052 | 3300005983 | Bacteria | 6062 |
| 242 | Ga0081540_1016453 | 3300005983 | Bacteria | 4627 |
| 243 | Ga0081540_1023463 | 3300005983 | Bacteria | 3607 |
| 244 | Ga0081540_1041957 | 3300005983 | Bacteria | 2366 |
| 245 | Ga0081540_1071971 | 3300005983 | Bacteria | 1595 |
| 246 | Ga0081540_1092814 | 3300005983 | Bacteria | 1324 |
| 247 | Ga0081540_1145351 | 3300005983 | Bacteria | 945 |
| 248 | Ga0081539_10013759 | 3300005985 | Bacteria | 6065 |
| 249 | Ga0081539_10396844 | 3300005985 | Bacteria | 574 |
| 250 | Ga0070717_10065842 | 3300006028 | Bacteria | 3012 |
| 251 | Ga0075365_10097363 | 3300006038 | Bacteria | 2011 |
| 252 | Ga0075365_10107287 | 3300006038 | Bacteria | 1917 |
| 253 | Ga0075365_11345418 | 3300006038 | Bacteria | 502 |
| 254 | Ga0075368_10056260 | 3300006042 | Bacteria | 1569 |
| 255 | Ga0075368_10092443 | 3300006042 | Bacteria | 1238 |
| 256 | Ga0075368_10274453 | 3300006042 | Bacteria | 724 |
| 257 | Ga0075363_101062091 | 3300006048 | Bacteria | 501 |
| 258 | Ga0075364_10190920 | 3300006051 | Bacteria | 1387 |
| 259 | Ga0075364_10468852 | 3300006051 | Bacteria | 861 |
| 260 | Ga0075364_10936206 | 3300006051 | Bacteria | 590 |
| 261 | Ga0075432_10492276 | 3300006058 | Bacteria | 545 |
| 262 | Ga0070715_10043512 | 3300006163 | Bacteria | 1894 |
| 263 | Ga0070715_10295213 | 3300006163 | Bacteria | 865 |
| 264 | Ga0070716_100016118 | 3300006173 | Bacteria | 3852 |
| 265 | Ga0070716_100185644 | 3300006173 | Bacteria | 1369 |
| 266 | Ga0070716_101275788 | 3300006173 | Bacteria | 593 |
| 267 | Ga0070712_100050760 | 3300006175 | Bacteria | 2887 |
| 268 | Ga0070712_100575869 | 3300006175 | Bacteria | 951 |
| 269 | Ga0070712_101135649 | 3300006175 | Bacteria | 679 |
| 270 | Ga0075362_10059567 | 3300006177 | Bacteria | 1724 |
| 271 | Ga0075362_10598861 | 3300006177 | Bacteria | 569 |
| 272 | Ga0075367_10148611 | 3300006178 | Bacteria | 1453 |
| 273 | Ga0075367_10312304 | 3300006178 | Bacteria | 990 |
| 274 | Ga0075367_10740338 | 3300006178 | Bacteria | 626 |
| 275 | Ga0075367_11122976 | 3300006178 | Bacteria | 503 |
| 276 | Ga0075369_10146678 | 3300006186 | Bacteria | 1078 |
| 277 | Ga0075369_10186348 | 3300006186 | Bacteria | 956 |
| 278 | Ga0075369_10300467 | 3300006186 | Bacteria | 749 |
| 279 | Ga0075369_10319411 | 3300006186 | Bacteria | 726 |
| 280 | Ga0075369_10540560 | 3300006186 | Bacteria | 555 |
| 281 | Ga0075366_10005462 | 3300006195 | Bacteria | 6889 |
| 282 | Ga0097621_101499515 | 3300006237 | Bacteria | 640 |
| 283 | Ga0097621_102125256 | 3300006237 | Bacteria | 537 |
| 284 | Ga0097621_102135595 | 3300006237 | Bacteria | 536 |
| 285 | Ga0075370_10073378 | 3300006353 | Bacteria | 1959 |
| 286 | Ga0075370_10228233 | 3300006353 | Bacteria | 1101 |
| 287 | Ga0075370_10628003 | 3300006353 | Bacteria | 651 |
| 288 | Ga0068871_100145881 | 3300006358 | Bacteria | 2015 |
| 289 | Ga0068871_101527357 | 3300006358 | Bacteria | 631 |
| 290 | Ga0075428_101200724 | 3300006844 | Bacteria | 800 |
| 291 | Ga0075430_101764075 | 3300006846 | Bacteria | 508 |
| 292 | Ga0075431_101584803 | 3300006847 | Bacteria | 613 |
| 293 | Ga0075434_100234820 | 3300006871 | Bacteria | 1854 |
| 294 | Ga0068865_100872936 | 3300006881 | Bacteria | 781 |
| 295 | Ga0068865_101162736 | 3300006881 | Bacteria | 682 |
| 296 | Ga0068865_102066046 | 3300006881 | Bacteria | 518 |
| 297 | Ga0097620_100267064 | 3300006931 | Bacteria | 1803 |
| 298 | Ga0097620_100771877 | 3300006931 | Bacteria | 1049 |
| 299 | Ga0097620_101277975 | 3300006931 | Bacteria | 809 |
| 300 | Ga0097620_101337906 | 3300006931 | Bacteria | 790 |
| 301 | Ga0099823_1027763 | 3300006944 | Bacteria | 4912 |
| 302 | Ga0099794_10638545 | 3300007265 | Bacteria | 565 |
| 303 | Ga0105251_10116124 | 3300009011 | Bacteria | 1217 |
| 304 | Ga0105240_10020447 | 3300009093 | Bacteria | 8829 |
| 305 | Ga0105240_10032668 | 3300009093 | Bacteria | 6735 |
| 306 | Ga0105240_10067994 | 3300009093 | Bacteria | 4414 |
| 307 | Ga0105240_10123204 | 3300009093 | Bacteria | 3119 |
| 308 | Ga0105240_11384214 | 3300009093 | Bacteria | 740 |
| 309 | Ga0111539_10214088 | 3300009094 | Bacteria | 2245 |
| 310 | Ga0105245_10031801 | 3300009098 | Bacteria | 4672 |
| 311 | Ga0105245_10315878 | 3300009098 | Bacteria | 1538 |
| 312 | Ga0105245_10626271 | 3300009098 | Bacteria | 1104 |
| 313 | Ga0105245_10795918 | 3300009098 | Bacteria | 983 |
| 314 | Ga0105245_12480324 | 3300009098 | Bacteria | 572 |
| 315 | Ga0105247_10066555 | 3300009101 | Bacteria | 2244 |
| 316 | Ga0105247_10118677 | 3300009101 | Bacteria | 1711 |
| 317 | Ga0105247_10330792 | 3300009101 | Bacteria | 1066 |
| 318 | Ga0105247_10409673 | 3300009101 | Bacteria | 968 |
| 319 | Ga0114129_10476531 | 3300009147 | Bacteria | 1634 |
| 320 | Ga0105243_10031732 | 3300009148 | Bacteria | 4075 |
| 321 | Ga0105243_10097091 | 3300009148 | Bacteria | 2439 |
| 322 | Ga0105243_10708020 | 3300009148 | Bacteria | 982 |
| 323 | Ga0105243_10912673 | 3300009148 | Bacteria | 874 |
| 324 | Ga0105243_11491850 | 3300009148 | Bacteria | 699 |
| 325 | Ga0105243_11803389 | 3300009148 | Bacteria | 643 |
| 326 | Ga0105241_10051103 | 3300009174 | Bacteria | 3151 |
| 327 | Ga0105241_10141894 | 3300009174 | Bacteria | 1957 |
| 328 | Ga0105241_10191140 | 3300009174 | Bacteria | 1704 |
| 329 | Ga0105241_10257250 | 3300009174 | Bacteria | 1483 |
| 330 | Ga0105241_10422692 | 3300009174 | Bacteria | 1173 |
| 331 | Ga0105241_11075203 | 3300009174 | Bacteria | 756 |
| 332 | Ga0105241_11303280 | 3300009174 | Bacteria | 692 |
| 333 | Ga0105241_11444864 | 3300009174 | Bacteria | 660 |
| 334 | Ga0105242_10405686 | 3300009176 | Bacteria | 1273 |
| 335 | Ga0105242_10911093 | 3300009176 | Bacteria | 880 |
| 336 | Ga0105248_10495852 | 3300009177 | Bacteria | 1377 |
| 337 | Ga0105248_10704512 | 3300009177 | Bacteria | 1139 |
| 338 | Ga0105248_11416245 | 3300009177 | Bacteria | 786 |
| 339 | Ga0105248_12942386 | 3300009177 | Bacteria | 543 |
| 340 | Ga0105237_10068396 | 3300009545 | Bacteria | 3545 |
| 341 | Ga0105237_10202106 | 3300009545 | Bacteria | 1987 |
| 342 | Ga0105237_10349957 | 3300009545 | Bacteria | 1482 |
| 343 | Ga0105237_10739361 | 3300009545 | Bacteria | 990 |
| 344 | Ga0105237_11679668 | 3300009545 | Bacteria | 642 |
| 345 | Ga0105237_11971455 | 3300009545 | Bacteria | 592 |
| 346 | Ga0105237_12139234 | 3300009545 | Bacteria | 569 |
| 347 | Ga0105237_12358215 | 3300009545 | Bacteria | 542 |
| 348 | Ga0105238_10069444 | 3300009551 | Bacteria | 3523 |
| 349 | Ga0105238_10076960 | 3300009551 | Bacteria | 3329 |
| 350 | Ga0105238_10678338 | 3300009551 | Bacteria | 1042 |
| 351 | Ga0105238_10885517 | 3300009551 | Bacteria | 911 |
| 352 | Ga0105238_11797443 | 3300009551 | Bacteria | 645 |
| 353 | Ga0105238_12228493 | 3300009551 | Bacteria | 583 |
| 354 | Ga0105238_12447305 | 3300009551 | Bacteria | 558 |
| 355 | Ga0105238_12489346 | 3300009551 | Bacteria | 553 |
| 356 | Ga0105249_10143905 | 3300009553 | Bacteria | 2289 |
| 357 | Ga0105249_10707366 | 3300009553 | Bacteria | 1068 |
| 358 | Ga0105249_11300009 | 3300009553 | Bacteria | 799 |
| 359 | Ga0105249_11762875 | 3300009553 | Bacteria | 692 |
| 360 | Ga0105249_12482901 | 3300009553 | Bacteria | 591 |
| 361 | Ga0105239_10136576 | 3300010375 | Bacteria | 2730 |
| 362 | Ga0105239_10252645 | 3300010375 | Bacteria | 1980 |
| 363 | Ga0105239_10295488 | 3300010375 | Bacteria | 1824 |
| 364 | Ga0105239_10467899 | 3300010375 | Bacteria | 1431 |
| 365 | Ga0105239_10910537 | 3300010375 | Bacteria | 1009 |
| 366 | Ga0105239_11114301 | 3300010375 | Bacteria | 909 |
| 367 | Ga0105239_11254122 | 3300010375 | Bacteria | 855 |
| 368 | Ga0105239_11813511 | 3300010375 | Bacteria | 707 |
| 369 | Ga0105239_12687794 | 3300010375 | Bacteria | 581 |
| 370 | Ga0105239_12819868 | 3300010375 | Bacteria | 567 |
| 371 | Ga0105246_10114181 | 3300011119 | Bacteria | 1990 |
| 372 | Ga0105246_10218354 | 3300011119 | Bacteria | 1493 |
| 373 | Ga0105246_10872372 | 3300011119 | Bacteria | 805 |
| 374 | Ga0105246_11483025 | 3300011119 | Bacteria | 636 |
| 375 | Ga0157339_1034756 | 3300012505 | Bacteria | 607 |
| 376 | Ga0157373_11425573 | 3300013100 | Bacteria | 527 |
| 377 | Ga0157371_10348472 | 3300013102 | Bacteria | 1078 |
| 378 | Ga0157371_11320995 | 3300013102 | Bacteria | 558 |
| 379 | Ga0157370_10090911 | 3300013104 | Bacteria | 2866 |
| 380 | Ga0157370_10140430 | 3300013104 | Bacteria | 2251 |
| 381 | Ga0157370_10401657 | 3300013104 | Bacteria | 1261 |
| 382 | Ga0157370_11166473 | 3300013104 | Bacteria | 695 |
| 383 | Ga0157370_11663209 | 3300013104 | Bacteria | 573 |
| 384 | Ga0157370_11918328 | 3300013104 | Bacteria | 531 |
| 385 | Ga0157369_10048658 | 3300013105 | Bacteria | 4600 |
| 386 | Ga0157369_10118638 | 3300013105 | Bacteria | 2808 |
| 387 | Ga0157369_10185391 | 3300013105 | Bacteria | 2188 |
| 388 | Ga0157369_11543996 | 3300013105 | Bacteria | 675 |
| 389 | Ga0157369_12228347 | 3300013105 | Bacteria | 555 |
| 390 | Ga0157374_10529953 | 3300013296 | Bacteria | 1184 |
| 391 | Ga0157374_10749612 | 3300013296 | Bacteria | 991 |
| 392 | Ga0157374_11375641 | 3300013296 | Bacteria | 728 |
| 393 | Ga0157374_12321793 | 3300013296 | Bacteria | 564 |
| 394 | Ga0157378_10014728 | 3300013297 | Bacteria | 6851 |
| 395 | Ga0157378_10491703 | 3300013297 | Bacteria | 1224 |
| 396 | Ga0157378_11221061 | 3300013297 | Bacteria | 792 |
| 397 | Ga0157378_11528315 | 3300013297 | Bacteria | 712 |
| 398 | Ga0157378_12182810 | 3300013297 | Bacteria | 605 |
| 399 | Ga0157378_13165040 | 3300013297 | Bacteria | 511 |
| 400 | Ga0163162_10291076 | 3300013306 | Bacteria | 1765 |
| 401 | Ga0163162_10460734 | 3300013306 | Bacteria | 1403 |
| 402 | Ga0163162_10770747 | 3300013306 | Bacteria | 1080 |
| 403 | Ga0163162_11033690 | 3300013306 | Bacteria | 930 |
| 404 | Ga0157372_10202040 | 3300013307 | Bacteria | 2302 |
| 405 | Ga0157372_10595679 | 3300013307 | Bacteria | 1288 |
| 406 | Ga0157372_12152679 | 3300013307 | Bacteria | 641 |
| 407 | Ga0157372_12222735 | 3300013307 | Bacteria | 630 |
| 408 | Ga0157375_10304167 | 3300013308 | Bacteria | 1758 |
| 409 | Ga0157375_10488402 | 3300013308 | Bacteria | 1396 |
| 410 | Ga0157375_10518059 | 3300013308 | Bacteria | 1356 |
| 411 | Ga0157375_11551865 | 3300013308 | Bacteria | 782 |
| 412 | Ga0157375_12717917 | 3300013308 | Bacteria | 592 |
| 413 | Ga0163163_10012414 | 3300014325 | Bacteria | 7761 |
| 414 | Ga0163163_10117591 | 3300014325 | Bacteria | 2690 |
| 415 | Ga0163163_10376207 | 3300014325 | Bacteria | 1478 |
| 416 | Ga0163163_10552941 | 3300014325 | Bacteria | 1213 |
| 417 | Ga0163163_11405763 | 3300014325 | Bacteria | 759 |
| 418 | Ga0163163_12015612 | 3300014325 | Bacteria | 637 |
| 419 | Ga0157380_10238260 | 3300014326 | Bacteria | 1639 |
| 420 | Ga0157380_10257963 | 3300014326 | Bacteria | 1582 |
| 421 | Ga0157380_12748899 | 3300014326 | Bacteria | 559 |
| 422 | Ga0182008_10229719 | 3300014497 | Bacteria | 951 |
| 423 | Ga0182008_10421868 | 3300014497 | Bacteria | 720 |
| 424 | Ga0157377_10160804 | 3300014745 | Bacteria | 1396 |
| 425 | Ga0157377_10285293 | 3300014745 | Bacteria | 1084 |
| 426 | Ga0157379_10265737 | 3300014968 | Bacteria | 1560 |
| 427 | Ga0157379_10537004 | 3300014968 | Bacteria | 1087 |
| 428 | Ga0157379_11006002 | 3300014968 | Bacteria | 795 |
| 429 | Ga0157379_12175361 | 3300014968 | Bacteria | 551 |
| 430 | Ga0157376_10183873 | 3300014969 | Bacteria | 1912 |
| 431 | Ga0157376_10330872 | 3300014969 | Bacteria | 1451 |
| 432 | Ga0157376_10513130 | 3300014969 | Bacteria | 1180 |
| 433 | Ga0157376_10709027 | 3300014969 | Bacteria | 1012 |
| 434 | Ga0157376_12077369 | 3300014969 | Bacteria | 606 |
| 435 | Ga0157376_12209839 | 3300014969 | Bacteria | 589 |
| 436 | Ga0157376_12931498 | 3300014969 | Bacteria | 516 |
| 437 | Ga0182007_10325147 | 3300015262 | Bacteria | 571 |
| 438 | Ga0163161_10137351 | 3300017792 | Bacteria | 1849 |
| 439 | Ga0163161_10352321 | 3300017792 | Bacteria | 1170 |
| 440 | Ga0163161_11299496 | 3300017792 | Bacteria | 632 |
| 441 | Ga0206356_10486896 | 3300020070 | Bacteria | 1623 |
| 442 | Ga0206349_1412442 | 3300020075 | Bacteria | 531 |
| 443 | Ga0206351_10094307 | 3300020077 | Bacteria | 740 |
| 444 | Ga0206353_11896996 | 3300020082 | Bacteria | 1411 |
| 445 | Ga0206353_12028210 | 3300020082 | Bacteria | 1797 |
| 446 | Ga0214542_1022513 | 3300021321 | Bacteria | 4021 |
| 447 | Ga0214545_1013953 | 3300021324 | Bacteria | 9654 |
| 448 | Ga0213873_10014380 | 3300021358 | Bacteria | 1753 |
| 449 | Ga0213874_10007250 | 3300021377 | Bacteria | 2654 |
| 450 | Ga0213874_10237960 | 3300021377 | Bacteria | 667 |
| 451 | Ga0213874_10291617 | 3300021377 | Bacteria | 612 |
| 452 | Ga0213876_10001341 | 3300021384 | Bacteria | 15407 |
| 453 | Ga0213876_10622122 | 3300021384 | Bacteria | 575 |
| 454 | Ga0213871_10006629 | 3300021441 | Bacteria | 2460 |
| 455 | Ga0213871_10027378 | 3300021441 | Bacteria | 1464 |
| 456 | Ga0213871_10043318 | 3300021441 | Bacteria | 1214 |
| 457 | Ga0224712_10002831 | 3300022467 | Bacteria | 4372 |
| 458 | Ga0224712_10191098 | 3300022467 | Bacteria | 927 |
| 459 | Ga0224712_10556904 | 3300022467 | Bacteria | 557 |
| 460 | Ga0224575_103157 | 3300023224 | Bacteria | 892 |
| 461 | Ga0228598_1067208 | 3300024227 | Bacteria | 716 |
| 462 | Ga0209563_109801 | 3300025230 | Bacteria | 1431 |
| 463 | Ga0209677_101244 | 3300025253 | Bacteria | 11496 |
| 464 | Ga0209677_120171 | 3300025253 | Bacteria | 783 |
| 465 | Ga0209148_1000253 | 3300025254 | Bacteria | 84643 |
| 466 | Ga0209233_1001970 | 3300025261 | Bacteria | 7805 |
| 467 | Ga0209233_1009212 | 3300025261 | Bacteria | 3015 |
| 468 | Ga0209233_1015628 | 3300025261 | Bacteria | 2110 |
| 469 | Ga0209233_1020333 | 3300025261 | Bacteria | 1744 |
| 470 | Ga0209233_1032320 | 3300025261 | Bacteria | 1211 |
| 471 | Ga0209233_1033133 | 3300025261 | Bacteria | 1188 |
| 472 | Ga0209455_1005205 | 3300025272 | Bacteria | 4072 |
| 473 | Ga0209455_1016606 | 3300025272 | Bacteria | 1576 |
| 474 | Ga0209673_1073918 | 3300025273 | Bacteria | 802 |
| 475 | Ga0209564_1011001 | 3300025295 | Bacteria | 4099 |
| 476 | Ga0209564_1035938 | 3300025295 | Bacteria | 1424 |
| 477 | Ga0209564_1072669 | 3300025295 | Bacteria | 707 |
| 478 | Ga0209758_1000026 | 3300025297 | Bacteria | 582706 |
| 479 | Ga0209758_1000318 | 3300025297 | Bacteria | 92807 |
| 480 | Ga0209758_1001679 | 3300025297 | Bacteria | 24954 |
| 481 | Ga0209758_1002424 | 3300025297 | Bacteria | 19060 |
| 482 | Ga0209758_1003005 | 3300025297 | Bacteria | 16142 |
| 483 | Ga0209758_1012954 | 3300025297 | Bacteria | 4603 |
| 484 | Ga0209758_1040472 | 3300025297 | Bacteria | 1757 |
| 485 | Ga0209758_1055859 | 3300025297 | Bacteria | 1337 |
| 486 | Ga0209758_1085245 | 3300025297 | Bacteria | 942 |
| 487 | Ga0209758_1097908 | 3300025297 | Bacteria | 842 |
| 488 | Ga0209256_1013879 | 3300025299 | Bacteria | 2954 |
| 489 | Ga0209256_1048828 | 3300025299 | Bacteria | 1034 |
| 490 | Ga0207426_1000425 | 3300025302 | Bacteria | 69088 |
| 491 | Ga0207426_1001506 | 3300025302 | Bacteria | 19028 |
| 492 | Ga0207426_1019633 | 3300025302 | Bacteria | 2360 |
| 493 | Ga0207426_1023817 | 3300025302 | Bacteria | 2085 |
| 494 | Ga0207426_1047970 | 3300025302 | Bacteria | 1285 |
| 495 | Ga0207426_1066358 | 3300025302 | Bacteria | 1020 |
| 496 | Ga0207426_1130684 | 3300025302 | Bacteria | 609 |
| 497 | Ga0209257_1002846 | 3300025304 | Bacteria | 16199 |
| 498 | Ga0207697_10067874 | 3300025315 | Bacteria | 1491 |
| 499 | Ga0207697_10269782 | 3300025315 | Bacteria | 754 |
| 500 | Ga0207656_10049075 | 3300025321 | Bacteria | 1819 |
| 501 | Ga0207656_10267790 | 3300025321 | Bacteria | 840 |
| 502 | Ga0207656_10699567 | 3300025321 | Bacteria | 519 |
| 503 | Ga0207696_1173139 | 3300025711 | Bacteria | 572 |
| 504 | Ga0207692_10000488 | 3300025898 | Bacteria | 13997 |
| 505 | Ga0207692_10004266 | 3300025898 | Bacteria | 5651 |
| 506 | Ga0207692_10620122 | 3300025898 | Bacteria | 697 |
| 507 | Ga0207642_10058752 | 3300025899 | Bacteria | 1776 |
| 508 | Ga0207642_11101738 | 3300025899 | Bacteria | 513 |
| 509 | Ga0207710_10113669 | 3300025900 | Bacteria | 1287 |
| 510 | Ga0207710_10126255 | 3300025900 | Bacteria | 1226 |
| 511 | Ga0207710_10261894 | 3300025900 | Bacteria | 867 |
| 512 | Ga0207688_10104624 | 3300025901 | Bacteria | 1638 |
| 513 | Ga0207688_10114482 | 3300025901 | Bacteria | 1569 |
| 514 | Ga0207688_10154387 | 3300025901 | Bacteria | 1358 |
| 515 | Ga0207688_10269127 | 3300025901 | Bacteria | 1036 |
| 516 | Ga0207688_10484299 | 3300025901 | Bacteria | 774 |
| 517 | Ga0207688_10656004 | 3300025901 | Bacteria | 662 |
| 518 | Ga0207680_10343403 | 3300025903 | Bacteria | 1048 |
| 519 | Ga0207680_10979788 | 3300025903 | Bacteria | 606 |
| 520 | Ga0207647_10163198 | 3300025904 | Bacteria | 1299 |
| 521 | Ga0207647_10169812 | 3300025904 | Bacteria | 1270 |
| 522 | Ga0207647_10330416 | 3300025904 | Bacteria | 865 |
| 523 | Ga0207647_10592334 | 3300025904 | Bacteria | 612 |
| 524 | Ga0207685_10004113 | 3300025905 | Bacteria | 3648 |
| 525 | Ga0207685_10016129 | 3300025905 | Bacteria | 2384 |
| 526 | Ga0207685_10199438 | 3300025905 | Bacteria | 939 |
| 527 | Ga0207685_10652935 | 3300025905 | Bacteria | 569 |
| 528 | Ga0207699_10001075 | 3300025906 | Bacteria | 12927 |
| 529 | Ga0207699_10003139 | 3300025906 | Bacteria | 7855 |
| 530 | Ga0207699_10030662 | 3300025906 | Bacteria | 3011 |
| 531 | Ga0207699_10302086 | 3300025906 | Bacteria | 1118 |
| 532 | Ga0207645_10335603 | 3300025907 | Bacteria | 1010 |
| 533 | Ga0207645_10877704 | 3300025907 | Bacteria | 609 |
| 534 | Ga0207643_10076892 | 3300025908 | Bacteria | 1929 |
| 535 | Ga0207705_10207299 | 3300025909 | Bacteria | 1486 |
| 536 | Ga0207705_10410217 | 3300025909 | Bacteria | 1048 |
| 537 | Ga0207684_10131596 | 3300025910 | Bacteria | 2147 |
| 538 | Ga0207684_10201683 | 3300025910 | Bacteria | 1716 |
| 539 | Ga0207654_10000069 | 3300025911 | Bacteria | 67460 |
| 540 | Ga0207654_10049050 | 3300025911 | Bacteria | 2419 |
| 541 | Ga0207654_10125513 | 3300025911 | Bacteria | 1618 |
| 542 | Ga0207654_10387742 | 3300025911 | Bacteria | 969 |
| 543 | Ga0207654_10553072 | 3300025911 | Bacteria | 818 |
| 544 | Ga0207707_10001008 | 3300025912 | Bacteria | 27003 |
| 545 | Ga0207707_10076991 | 3300025912 | Bacteria | 2911 |
| 546 | Ga0207707_10171584 | 3300025912 | Bacteria | 1895 |
| 547 | Ga0207707_10451508 | 3300025912 | Bacteria | 1100 |
| 548 | Ga0207707_10482075 | 3300025912 | Bacteria | 1059 |
| 549 | Ga0207695_10000634 | 3300025913 | Bacteria | 70325 |
| 550 | Ga0207695_10000713 | 3300025913 | Bacteria | 64808 |
| 551 | Ga0207695_10134863 | 3300025913 | Bacteria | 2423 |
| 552 | Ga0207695_10250227 | 3300025913 | Bacteria | 1672 |
| 553 | Ga0207671_10026824 | 3300025914 | Bacteria | 4310 |
| 554 | Ga0207671_10077083 | 3300025914 | Bacteria | 2495 |
| 555 | Ga0207671_10172829 | 3300025914 | Bacteria | 1679 |
| 556 | Ga0207671_10187483 | 3300025914 | Bacteria | 1612 |
| 557 | Ga0207671_10255812 | 3300025914 | Bacteria | 1377 |
| 558 | Ga0207671_10443630 | 3300025914 | Bacteria | 1033 |
| 559 | Ga0207671_10736072 | 3300025914 | Bacteria | 784 |
| 560 | Ga0207671_10865203 | 3300025914 | Bacteria | 715 |
| 561 | Ga0207671_11241561 | 3300025914 | Bacteria | 582 |
| 562 | Ga0207693_10011789 | 3300025915 | Bacteria | 7066 |
| 563 | Ga0207693_10061410 | 3300025915 | Bacteria | 2943 |
| 564 | Ga0207693_10243103 | 3300025915 | Bacteria | 1413 |
| 565 | Ga0207693_10402422 | 3300025915 | Bacteria | 1070 |
| 566 | Ga0207693_11063703 | 3300025915 | Bacteria | 616 |
| 567 | Ga0207663_10000176 | 3300025916 | Bacteria | 28557 |
| 568 | Ga0207663_10006929 | 3300025916 | Bacteria | 5840 |
| 569 | Ga0207663_10029467 | 3300025916 | Bacteria | 3224 |
| 570 | Ga0207662_10128088 | 3300025918 | Bacteria | 1598 |
| 571 | Ga0207662_10520782 | 3300025918 | Bacteria | 821 |
| 572 | Ga0207657_10196812 | 3300025919 | Bacteria | 1623 |
| 573 | Ga0207657_10769229 | 3300025919 | Bacteria | 745 |
| 574 | Ga0207657_11031825 | 3300025919 | Bacteria | 630 |
| 575 | Ga0207649_10316811 | 3300025920 | Bacteria | 1145 |
| 576 | Ga0207649_11197226 | 3300025920 | Bacteria | 600 |
| 577 | Ga0207649_11210314 | 3300025920 | Bacteria | 597 |
| 578 | Ga0207649_11574737 | 3300025920 | Bacteria | 520 |
| 579 | Ga0207652_10140370 | 3300025921 | Bacteria | 2160 |
| 580 | Ga0207652_10223057 | 3300025921 | Bacteria | 1698 |
| 581 | Ga0207652_10364529 | 3300025921 | Bacteria | 1304 |
| 582 | Ga0207652_10892897 | 3300025921 | Bacteria | 785 |
| 583 | Ga0207646_11354399 | 3300025922 | Bacteria | 620 |
| 584 | Ga0207681_10806142 | 3300025923 | Bacteria | 784 |
| 585 | Ga0207681_10891447 | 3300025923 | Bacteria | 745 |
| 586 | Ga0207681_10990638 | 3300025923 | Bacteria | 705 |
| 587 | Ga0207694_10000155 | 3300025924 | Bacteria | 70678 |
| 588 | Ga0207694_10231438 | 3300025924 | Bacteria | 1509 |
| 589 | Ga0207694_10260097 | 3300025924 | Bacteria | 1422 |
| 590 | Ga0207694_10474368 | 3300025924 | Bacteria | 1046 |
| 591 | Ga0207694_10980962 | 3300025924 | Bacteria | 715 |
| 592 | Ga0207694_11835372 | 3300025924 | Bacteria | 509 |
| 593 | Ga0207650_10223213 | 3300025925 | Bacteria | 1517 |
| 594 | Ga0207659_11442012 | 3300025926 | Bacteria | 590 |
| 595 | Ga0207687_10167142 | 3300025927 | Bacteria | 1693 |
| 596 | Ga0207687_10180178 | 3300025927 | Bacteria | 1636 |
| 597 | Ga0207687_11454019 | 3300025927 | Bacteria | 589 |
| 598 | Ga0207700_10012901 | 3300025928 | Bacteria | 5409 |
| 599 | Ga0207700_10022426 | 3300025928 | Bacteria | 4333 |
| 600 | Ga0207700_10045905 | 3300025928 | Bacteria | 3228 |
| 601 | Ga0207700_10183378 | 3300025928 | Bacteria | 1754 |
| 602 | Ga0207664_10070672 | 3300025929 | Bacteria | 2810 |
| 603 | Ga0207664_10140833 | 3300025929 | Bacteria | 2040 |
| 604 | Ga0207664_10226807 | 3300025929 | Bacteria | 1622 |
| 605 | Ga0207664_11867614 | 3300025929 | Bacteria | 523 |
| 606 | Ga0207644_11213206 | 3300025931 | Bacteria | 634 |
| 607 | Ga0207690_10230733 | 3300025932 | Bacteria | 1421 |
| 608 | Ga0207690_10398681 | 3300025932 | Bacteria | 1097 |
| 609 | Ga0207690_10561633 | 3300025932 | Bacteria | 928 |
| 610 | Ga0207690_10848689 | 3300025932 | Bacteria | 756 |
| 611 | Ga0207706_10207834 | 3300025933 | Bacteria | 1716 |
| 612 | Ga0207706_10220011 | 3300025933 | Bacteria | 1663 |
| 613 | Ga0207706_10464841 | 3300025933 | Bacteria | 1094 |
| 614 | Ga0207706_10467450 | 3300025933 | Bacteria | 1090 |
| 615 | Ga0207686_10125545 | 3300025934 | Bacteria | 1753 |
| 616 | Ga0207686_11003370 | 3300025934 | Bacteria | 677 |
| 617 | Ga0207686_11106996 | 3300025934 | Bacteria | 646 |
| 618 | Ga0207709_10033563 | 3300025935 | Bacteria | 3015 |
| 619 | Ga0207709_10114819 | 3300025935 | Bacteria | 1807 |
| 620 | Ga0207709_10838008 | 3300025935 | Bacteria | 744 |
| 621 | Ga0207670_10226453 | 3300025936 | Bacteria | 1434 |
| 622 | Ga0207670_10245647 | 3300025936 | Bacteria | 1381 |
| 623 | Ga0207669_10017298 | 3300025937 | Bacteria | 3693 |
| 624 | Ga0207669_11146030 | 3300025937 | Bacteria | 657 |
| 625 | Ga0207669_11264936 | 3300025937 | Bacteria | 626 |
| 626 | Ga0207669_11556613 | 3300025937 | Bacteria | 564 |
| 627 | Ga0207704_10623632 | 3300025938 | Bacteria | 885 |
| 628 | Ga0207704_11383112 | 3300025938 | Bacteria | 603 |
| 629 | Ga0207665_10018204 | 3300025939 | Bacteria | 4615 |
| 630 | Ga0207665_10022725 | 3300025939 | Bacteria | 4129 |
| 631 | Ga0207665_11188231 | 3300025939 | Bacteria | 608 |
| 632 | Ga0207665_11300700 | 3300025939 | Bacteria | 580 |
| 633 | Ga0207691_10753754 | 3300025940 | Bacteria | 820 |
| 634 | Ga0207691_11601429 | 3300025940 | Bacteria | 530 |
| 635 | Ga0207711_10678197 | 3300025941 | Bacteria | 961 |
| 636 | Ga0207711_11520831 | 3300025941 | Bacteria | 612 |
| 637 | Ga0207689_10142627 | 3300025942 | Bacteria | 1974 |
| 638 | Ga0207689_10199718 | 3300025942 | Bacteria | 1650 |
| 639 | Ga0207689_10264167 | 3300025942 | Bacteria | 1424 |
| 640 | Ga0207689_10431518 | 3300025942 | Bacteria | 1100 |
| 641 | Ga0207661_10114303 | 3300025944 | Bacteria | 2288 |
| 642 | Ga0207661_10774099 | 3300025944 | Bacteria | 883 |
| 643 | Ga0207661_10839094 | 3300025944 | Bacteria | 846 |
| 644 | Ga0207679_10146728 | 3300025945 | Bacteria | 1915 |
| 645 | Ga0207679_10457724 | 3300025945 | Bacteria | 1132 |
| 646 | Ga0207679_11439960 | 3300025945 | Bacteria | 632 |
| 647 | Ga0207667_10045630 | 3300025949 | Bacteria | 4640 |
| 648 | Ga0207667_10142283 | 3300025949 | Bacteria | 2470 |
| 649 | Ga0207667_10260251 | 3300025949 | Bacteria | 1774 |
| 650 | Ga0207667_10280445 | 3300025949 | Bacteria | 1703 |
| 651 | Ga0207667_10558203 | 3300025949 | Bacteria | 1158 |
| 652 | Ga0207667_10842939 | 3300025949 | Bacteria | 911 |
| 653 | Ga0207667_10968386 | 3300025949 | Bacteria | 839 |
| 654 | Ga0207667_11094169 | 3300025949 | Bacteria | 780 |
| 655 | Ga0207667_11108821 | 3300025949 | Bacteria | 774 |
| 656 | Ga0207667_11284919 | 3300025949 | Bacteria | 709 |
| 657 | Ga0207667_11466417 | 3300025949 | Bacteria | 654 |
| 658 | Ga0207651_10322380 | 3300025960 | Bacteria | 1292 |
| 659 | Ga0207651_11257891 | 3300025960 | Bacteria | 665 |
| 660 | Ga0207712_10126263 | 3300025961 | Bacteria | 1942 |
| 661 | Ga0207712_10223617 | 3300025961 | Bacteria | 1506 |
| 662 | Ga0207712_10634862 | 3300025961 | Bacteria | 927 |
| 663 | Ga0207712_11057998 | 3300025961 | Bacteria | 721 |
| 664 | Ga0207712_11246021 | 3300025961 | Bacteria | 664 |
| 665 | Ga0207712_12058734 | 3300025961 | Bacteria | 511 |
| 666 | Ga0207668_10024406 | 3300025972 | Bacteria | 3901 |
| 667 | Ga0207668_10095320 | 3300025972 | Bacteria | 2196 |
| 668 | Ga0207668_10180217 | 3300025972 | Bacteria | 1665 |
| 669 | Ga0207668_10295614 | 3300025972 | Bacteria | 1334 |
| 670 | Ga0207668_10548987 | 3300025972 | Bacteria | 1001 |
| 671 | Ga0207668_10961898 | 3300025972 | Bacteria | 762 |
| 672 | Ga0207668_11183750 | 3300025972 | Bacteria | 686 |
| 673 | Ga0207668_11244159 | 3300025972 | Bacteria | 669 |
| 674 | Ga0207668_11354534 | 3300025972 | Bacteria | 641 |
| 675 | Ga0207668_12055681 | 3300025972 | Bacteria | 514 |
| 676 | Ga0207640_10082513 | 3300025981 | Bacteria | 2201 |
| 677 | Ga0207640_10118979 | 3300025981 | Bacteria | 1888 |
| 678 | Ga0207640_10206084 | 3300025981 | Bacteria | 1494 |
| 679 | Ga0207640_10281722 | 3300025981 | Bacteria | 1306 |
| 680 | Ga0207640_10613305 | 3300025981 | Bacteria | 923 |
| 681 | Ga0207640_10685081 | 3300025981 | Bacteria | 877 |
| 682 | Ga0207640_11835322 | 3300025981 | Bacteria | 548 |
| 683 | Ga0207658_10337465 | 3300025986 | Bacteria | 1309 |
| 684 | Ga0207658_10454621 | 3300025986 | Bacteria | 1134 |
| 685 | Ga0207677_10104387 | 3300026023 | Bacteria | 2094 |
| 686 | Ga0207677_12267214 | 3300026023 | Bacteria | 505 |
| 687 | Ga0207703_10150217 | 3300026035 | Bacteria | 2031 |
| 688 | Ga0207703_11091263 | 3300026035 | Bacteria | 767 |
| 689 | Ga0207703_11416451 | 3300026035 | Bacteria | 668 |
| 690 | Ga0207703_11493505 | 3300026035 | Bacteria | 650 |
| 691 | Ga0207703_11956922 | 3300026035 | Bacteria | 562 |
| 692 | Ga0207639_10004418 | 3300026041 | Bacteria | 9486 |
| 693 | Ga0207639_10141940 | 3300026041 | Bacteria | 2002 |
| 694 | Ga0207639_10500380 | 3300026041 | Bacteria | 1110 |
| 695 | Ga0207639_10646018 | 3300026041 | Bacteria | 978 |
| 696 | Ga0207639_10656720 | 3300026041 | Bacteria | 970 |
| 697 | Ga0207639_11045700 | 3300026041 | Bacteria | 765 |
| 698 | Ga0207639_11083596 | 3300026041 | Bacteria | 751 |
| 699 | Ga0207639_11316267 | 3300026041 | Bacteria | 678 |
| 700 | Ga0207639_11367158 | 3300026041 | Bacteria | 665 |
| 701 | Ga0207678_10012307 | 3300026067 | Bacteria | 7512 |
| 702 | Ga0207678_10023967 | 3300026067 | Bacteria | 5335 |
| 703 | Ga0207678_10089381 | 3300026067 | Bacteria | 2633 |
| 704 | Ga0207678_10136672 | 3300026067 | Bacteria | 2091 |
| 705 | Ga0207678_10198754 | 3300026067 | Bacteria | 1714 |
| 706 | Ga0207678_10232478 | 3300026067 | Bacteria | 1579 |
| 707 | Ga0207678_11121585 | 3300026067 | Bacteria | 696 |
| 708 | Ga0207708_10175374 | 3300026075 | Bacteria | 1700 |
| 709 | Ga0207708_10833671 | 3300026075 | Bacteria | 795 |
| 710 | Ga0207702_10000022 | 3300026078 | Bacteria | 192961 |
| 711 | Ga0207702_10000041 | 3300026078 | Bacteria | 150754 |
| 712 | Ga0207702_10007733 | 3300026078 | Bacteria | 9125 |
| 713 | Ga0207702_10231775 | 3300026078 | Bacteria | 1726 |
| 714 | Ga0207702_10429437 | 3300026078 | Bacteria | 1279 |
| 715 | Ga0207702_10683805 | 3300026078 | Bacteria | 1010 |
| 716 | Ga0207702_10776245 | 3300026078 | Bacteria | 947 |
| 717 | Ga0207702_11607249 | 3300026078 | Bacteria | 643 |
| 718 | Ga0207641_11935164 | 3300026088 | Bacteria | 591 |
| 719 | Ga0207648_10588750 | 3300026089 | Bacteria | 1025 |
| 720 | Ga0207648_11865645 | 3300026089 | Bacteria | 563 |
| 721 | Ga0207676_10052651 | 3300026095 | Bacteria | 3183 |
| 722 | Ga0207676_10265205 | 3300026095 | Bacteria | 1553 |
| 723 | Ga0207676_11337168 | 3300026095 | Bacteria | 712 |
| 724 | Ga0207674_10005530 | 3300026116 | Bacteria | 15001 |
| 725 | Ga0207674_10015337 | 3300026116 | Bacteria | 8421 |
| 726 | Ga0207674_10453889 | 3300026116 | Bacteria | 1239 |
| 727 | Ga0207674_10540765 | 3300026116 | Bacteria | 1125 |
| 728 | Ga0207674_11134082 | 3300026116 | Bacteria | 751 |
| 729 | Ga0207675_100278865 | 3300026118 | Bacteria | 1624 |
| 730 | Ga0207675_100860964 | 3300026118 | Bacteria | 921 |
| 731 | Ga0207675_101613031 | 3300026118 | Bacteria | 669 |
| 732 | Ga0207675_102358049 | 3300026118 | Bacteria | 545 |
| 733 | Ga0207675_102687273 | 3300026118 | Bacteria | 506 |
| 734 | Ga0207683_10074762 | 3300026121 | Bacteria | 2998 |
| 735 | Ga0207683_10189497 | 3300026121 | Bacteria | 1867 |
| 736 | Ga0207683_10381817 | 3300026121 | Bacteria | 1295 |
| 737 | Ga0207683_10550499 | 3300026121 | Bacteria | 1067 |
| 738 | Ga0207683_10753534 | 3300026121 | Bacteria | 903 |
| 739 | Ga0207683_11103154 | 3300026121 | Bacteria | 736 |
| 740 | Ga0207683_11943502 | 3300026121 | Bacteria | 537 |
| 741 | Ga0207683_12085848 | 3300026121 | Bacteria | 515 |
| 742 | Ga0207698_10044442 | 3300026142 | Bacteria | 3338 |
| 743 | Ga0207698_10078408 | 3300026142 | Bacteria | 2652 |
| 744 | Ga0207698_10100030 | 3300026142 | Bacteria | 2400 |
| 745 | Ga0207698_10146286 | 3300026142 | Bacteria | 2044 |
| 746 | Ga0207698_10186652 | 3300026142 | Bacteria | 1842 |
| 747 | Ga0207698_10358025 | 3300026142 | Bacteria | 1381 |
| 748 | Ga0207698_10722581 | 3300026142 | Bacteria | 993 |
| 749 | Ga0207698_10851081 | 3300026142 | Bacteria | 917 |
| 750 | Ga0207698_11308398 | 3300026142 | Bacteria | 739 |
| 751 | Ga0207698_12302692 | 3300026142 | Bacteria | 551 |
| 752 | Ga0207698_12526919 | 3300026142 | Bacteria | 524 |
| 753 | Ga0209389_1000090 | 3300027296 | Bacteria | 83470 |
| 754 | Ga0209389_1000119 | 3300027296 | Bacteria | 70614 |
| 755 | Ga0209589_1000010 | 3300027357 | Bacteria | 237657 |
| 756 | Ga0209489_100011 | 3300027361 | Bacteria | 244710 |
| 757 | Ga0209489_100385 | 3300027361 | Bacteria | 79532 |
| 758 | Ga0209700_100013 | 3300027363 | Bacteria | 341906 |
| 759 | Ga0268266_10359041 | 3300028379 | Bacteria | 1370 |
| 760 | Ga0268266_10537219 | 3300028379 | Bacteria | 1119 |
| 761 | Ga0268266_10614064 | 3300028379 | Bacteria | 1045 |
| 762 | Ga0268266_10653711 | 3300028379 | Bacteria | 1012 |
| 763 | Ga0268266_10720069 | 3300028379 | Bacteria | 962 |
| 764 | Ga0268266_10803928 | 3300028379 | Bacteria | 908 |
| 765 | Ga0268266_11157136 | 3300028379 | Bacteria | 748 |
| 766 | Ga0268266_12202753 | 3300028379 | Bacteria | 523 |
| 767 | Ga0268265_10241475 | 3300028380 | Bacteria | 1594 |
| 768 | Ga0268265_10557126 | 3300028380 | Bacteria | 1089 |
| 769 | Ga0268265_10654088 | 3300028380 | Bacteria | 1010 |
| 770 | Ga0268265_10702484 | 3300028380 | Bacteria | 977 |
| 771 | Ga0268265_11026983 | 3300028380 | Bacteria | 815 |
| 772 | Ga0268265_11562283 | 3300028380 | Bacteria | 664 |
| 773 | Ga0268264_10368029 | 3300028381 | Bacteria | 1373 |
| 774 | Ga0268264_10466858 | 3300028381 | Bacteria | 1225 |
| 775 | Ga0268264_10764227 | 3300028381 | Bacteria | 964 |
| 776 | Ga0268264_12202815 | 3300028381 | Bacteria | 559 |
| 777 | Ga0265319_1052575 | 3300028563 | Bacteria | 1340 |
| 778 | Ga0265334_10003794 | 3300028573 | Bacteria | 6832 |
| 779 | Ga0265318_10040278 | 3300028577 | Bacteria | 1779 |
| 780 | Ga0265323_10000529 | 3300028653 | Bacteria | 21172 |
| 781 | Ga0265322_10065558 | 3300028654 | Bacteria | 1029 |
| 782 | Ga0265336_10000169 | 3300028666 | Bacteria | 45875 |
| 783 | Ga0307517_10291326 | 3300028786 | Bacteria | 922 |
| 784 | Ga0307517_10445842 | 3300028786 | Bacteria | 672 |
| 785 | Ga0307517_10610590 | 3300028786 | Bacteria | 536 |
| 786 | Ga0307515_10467366 | 3300028794 | Bacteria | 875 |
| 787 | Ga0307515_10659510 | 3300028794 | Bacteria | 659 |
| 788 | Ga0265338_10000624 | 3300028800 | Bacteria | 61670 |
| 789 | Ga0265338_11229494 | 3300028800 | Bacteria | 502 |
| 790 | Ga0265324_10015145 | 3300029957 | Bacteria | 2840 |
| 791 | Ga0265762_1052602 | 3300030760 | Bacteria | 821 |
| 792 | Ga0265770_1131010 | 3300030878 | Bacteria | 536 |
| 793 | Ga0265330_10109331 | 3300031235 | Bacteria | 1181 |
| 794 | Ga0265339_10000560 | 3300031249 | Bacteria | 29070 |
| 795 | Ga0307513_10290462 | 3300031456 | Bacteria | 1407 |
| 796 | Ga0307513_10925441 | 3300031456 | Bacteria | 580 |
| 797 | Ga0307509_10227270 | 3300031507 | Bacteria | 1672 |
| 798 | Ga0307509_10281389 | 3300031507 | Bacteria | 1424 |
| 799 | Ga0307408_101255530 | 3300031548 | Bacteria | 693 |
| 800 | Ga0307508_10000501 | 3300031616 | Bacteria | 46845 |
| 801 | Ga0265314_10202597 | 3300031711 | Bacteria | 1172 |
| 802 | Ga0265342_10051874 | 3300031712 | Bacteria | 2446 |
| 803 | Ga0316576_10306653 | 3300031727 | Bacteria | 1186 |
| 804 | Ga0316578_10079450 | 3300031728 | Bacteria | 1950 |
| 805 | Ga0307516_10001650 | 3300031730 | Bacteria | 30691 |
| 806 | Ga0307516_10510548 | 3300031730 | Bacteria | 856 |
| 807 | Ga0307516_10661080 | 3300031730 | Bacteria | 700 |
| 808 | Ga0307405_10683454 | 3300031731 | Bacteria | 848 |
| 809 | Ga0307412_10585445 | 3300031911 | Bacteria | 943 |
| 810 | Ga0307409_102146997 | 3300031995 | Bacteria | 588 |
| 811 | Ga0307416_100572688 | 3300032002 | Bacteria | 1205 |
| 812 | Ga0307416_101770426 | 3300032002 | Bacteria | 722 |
| 813 | Ga0307416_102033650 | 3300032002 | Bacteria | 677 |
| 814 | Ga0307416_102483445 | 3300032002 | Bacteria | 617 |
| 815 | Ga0307414_11344956 | 3300032004 | Bacteria | 663 |
| 816 | Ga0307411_10097452 | 3300032005 | Bacteria | 2070 |
| 817 | Ga0307415_101195387 | 3300032126 | Bacteria | 716 |
| 818 | Ga0307415_101990863 | 3300032126 | Bacteria | 565 |
| 819 | Ga0307415_102057431 | 3300032126 | Bacteria | 557 |
| 820 | Ga0307507_10327900 | 3300033179 | Bacteria | 916 |
| 821 | Ga0307510_10024022 | 3300033180 | Bacteria | 7052 |
| 822 | Ga0307510_10108332 | 3300033180 | Bacteria | 2532 |
| 823 | Ga0307510_10605599 | 3300033180 | Bacteria | 548 |
| 824 | Ga0316213_1009054 | 3300033546 | Bacteria | 677 |
| 825 | Ga0373930_0166493 | 3300034816 | Bacteria | 560 |
| 826 | Ga0373959_0069579 | 3300034820 | Bacteria | 793 |
| 827 | Ga0373940_0148226 | 3300035088 | Bacteria | 746 |
| 828 | Ga0373936_0035462 | 3300035113 | Bacteria | 1986 |
| 829 | Ga0373936_0214927 | 3300035113 | Bacteria | 852 |
| 830 | Ga0373953_0197960 | 3300035117 | Bacteria | 869 |
| 831 | Ga0373954_0094970 | 3300035118 | Bacteria | 1435 |
| 832 | Ga0373943_0056308 | 3300035170 | Bacteria | 1951 |
| 833 | Ga0373946_0178003 | 3300035171 | Bacteria | 1008 |
| 834 | Ga0373946_0418679 | 3300035171 | Bacteria | 678 |
| 835 | Ga0373955_0921895 | 3300035172 | Bacteria | 538 |
| 836 | Ga0373942_0224127 | 3300035207 | Bacteria | 631 |
| 837 | Ga0316574_0000583 | 3300035398 | Bacteria | 15122 |
| 838 | Ga0373931_0906821 | 3300035691 | Bacteria | 593 |
| 839 | Ga0373935_0026604 | 3300035692 | Bacteria | 3572 |
| 840 | Ga0373935_1273631 | 3300035692 | Bacteria | 549 |
| 841 | Ga0373927_0044931 | 3300035695 | Bacteria | 2858 |
| 842 | Ga0373927_0125525 | 3300035695 | Bacteria | 1675 |
| 843 | Ga0373947_0331303 | 3300035725 | Bacteria | 1019 |
| 844 | Ga0373937_0116233 | 3300036401 | Bacteria | 2491 |
| 845 | Ga0373937_0277661 | 3300036401 | Bacteria | 1582 |
| 846 | Ga0316582_0032095 | 3300036647 | Bacteria | 3215 |
| 847 | Ga0316584_0061834 | 3300036712 | Bacteria | 2804 |
| 848 | Ga0373925_0141633 | 3300037068 | Bacteria | 1882 |
| 849 | Ga0373925_1345794 | 3300037068 | Bacteria | 585 |
| 850 | Ga0395900_0048961 | 3300037418 | Bacteria | 4353 |
| 851 | Ga0395900_1241213 | 3300037418 | Bacteria | 660 |
| 852 | Ga0395900_1356633 | 3300037418 | Bacteria | 624 |
| 853 | Ga0395900_1490874 | 3300037418 | Bacteria | 588 |
| 854 | Ga0395898_0017014 | 3300037466 | Bacteria | 7425 |
| 855 | Ga0395898_0120258 | 3300037466 | Bacteria | 2516 |
| 856 | Ga0395898_0138115 | 3300037466 | Bacteria | 2334 |
| 857 | Ga0395905_0003720 | 3300037471 | Bacteria | 16158 |
| 858 | Ga0395905_0620276 | 3300037471 | Bacteria | 983 |
| 859 | Ga0395905_0771829 | 3300037471 | Bacteria | 864 |
| 860 | Ga0395905_0903283 | 3300037471 | Bacteria | 786 |
| 861 | Ga0395905_1287791 | 3300037471 | Bacteria | 635 |
| 862 | Ga0436364_0061231 | 3300037853 | Bacteria | 3861 |
| 863 | Ga0436364_0154333 | 3300037853 | Bacteria | 564 |
| 864 | Ga0436364_0888765 | 3300037853 | Bacteria | 857 |
| 865 | Ga0395901_0058832 | 3300038443 | Bacteria | 3998 |
| 866 | Ga0395901_0163797 | 3300038443 | Bacteria | 2335 |
| 867 | Ga0395901_0302538 | 3300038443 | Bacteria | 1658 |
| 868 | Ga0395901_0582478 | 3300038443 | Bacteria | 1130 |
| 869 | Ga0395901_0922077 | 3300038443 | Bacteria | 854 |
| 870 | Ga0436365_0112862 | 3300039437 | Bacteria | 811 |
| 871 | Ga0436365_0147464 | 3300039437 | Bacteria | 875 |
| 872 | Ga0436365_0717568 | 3300039437 | Bacteria | 517 |
| 873 | Ga0436365_0773004 | 3300039437 | Bacteria | 3824 |
| 874 | Ga0436365_1050534 | 3300039437 | Bacteria | 11907 |
| 875 | Ga0436365_1278112 | 3300039437 | Bacteria | 933 |
| 876 | Ga0436365_1850099 | 3300039437 | Bacteria | 1303 |
| 877 | Ga0436360_0328780 | 3300039438 | Bacteria | 3141 |
| 878 | Ga0436360_0366484 | 3300039438 | Bacteria | 1608 |
| 879 | Ga0436360_0582586 | 3300039438 | Bacteria | 645 |
| 880 | Ga0436360_1055724 | 3300039438 | Bacteria | 1074 |
| 881 | Ga0436361_0213272 | 3300039447 | Bacteria | 1733 |
| 882 | Ga0436361_0226150 | 3300039447 | Bacteria | 536 |
| 883 | Ga0436361_0293025 | 3300039447 | Bacteria | 1815 |
| 884 | Ga0436361_0510320 | 3300039447 | Bacteria | 2081 |
| 885 | Ga0436363_0170815 | 3300039450 | Bacteria | 543 |
| 886 | Ga0436363_0275971 | 3300039450 | Bacteria | 772 |
| 887 | Ga0436363_0348712 | 3300039450 | Bacteria | 3226 |
| 888 | Ga0436363_0398948 | 3300039450 | Bacteria | 531 |
| 889 | Ga0436363_0611524 | 3300039450 | Bacteria | 1674 |
| 890 | Ga0436362_0492403 | 3300039453 | Bacteria | 2893 |
| 891 | Ga0439465_0042388 | 3300041413 | Bacteria | 1475 |
| 892 | Ga0439465_0086175 | 3300041413 | Bacteria | 1070 |
| 893 | Ga0451793_1661917 | 3300041452 | Bacteria | 583 |
| 894 | Ga0451798_0847575 | 3300041458 | Bacteria | 737 |
| 895 | Ga0451800_0175728 | 3300041459 | Bacteria | 882 |
| 896 | Ga0451802_1442244 | 3300041460 | Bacteria | 567 |
| 897 | Ga0451804_0447390 | 3300041463 | Bacteria | 512 |
| 898 | Ga0451833_1093963 | 3300041491 | Bacteria | 644 |
| 899 | Ga0451835_0365809 | 3300041492 | Bacteria | 625 |
| 900 | Ga0451835_1082516 | 3300041492 | Bacteria | 631 |
| 901 | Ga0451839_0906687 | 3300041496 | Bacteria | 556 |
| 902 | Ga0451845_0500577 | 3300041501 | Bacteria | 767 |
| 903 | Ga0451853_0815963 | 3300041512 | Bacteria | 1273 |
| 904 | Ga0451853_2237783 | 3300041512 | Bacteria | 836 |
| 905 | Ga0451853_4007085 | 3300041512 | Bacteria | 852 |
| 906 | Ga0439431_0123146 | 3300041997 | Bacteria | 724 |
| 907 | Ga0439455_0106809 | 3300042012 | Bacteria | 777 |
| 908 | Ga0439455_0236112 | 3300042012 | Bacteria | 534 |
| 909 | Ga0439459_0093668 | 3300042438 | Bacteria | 726 |
| 910 | Ga0466969_0029006 | 3300044656 | Bacteria | 2828 |
| 911 | Ga0466972_0168300 | 3300044658 | Bacteria | 1029 |
| 912 | Ga0466972_0343020 | 3300044658 | Bacteria | 698 |
| 913 | Ga0466965_0293779 | 3300044683 | Bacteria | 880 |
| 914 | Ga0466965_0470058 | 3300044683 | Bacteria | 702 |
| 915 | Ga0466966_0008640 | 3300044684 | Bacteria | 6741 |
| 916 | Ga0466966_0688573 | 3300044684 | Bacteria | 616 |
| 917 | Ga0466961_0000081 | 3300044693 | Bacteria | 59450 |
| 918 | Ga0466964_0151362 | 3300044706 | Bacteria | 1076 |
| 919 | Ga0466964_0236700 | 3300044706 | Bacteria | 894 |
| 920 | Ga0466968_0005304 | 3300044735 | Bacteria | 4827 |
| 921 | Ga0466968_0095078 | 3300044735 | Bacteria | 1325 |
| 922 | Ga0466957_0176292 | 3300044842 | Bacteria | 1394 |
| 923 | Ga0466957_1310508 | 3300044842 | Bacteria | 526 |
| 924 | Ga0466957_1343418 | 3300044842 | Bacteria | 519 |
| 925 | Ga0466960_0285292 | 3300044901 | Bacteria | 926 |
| 926 | Ga0466959_0004686 | 3300045049 | Bacteria | 9205 |
| 927 | Ga0466959_0387416 | 3300045049 | Bacteria | 951 |
| 928 | Ga0466967_0182204 | 3300045976 | Bacteria | 1982 |
| 929 | Ga0466967_0365028 | 3300045976 | Bacteria | 1400 |
| 930 | Ga0466967_0444509 | 3300045976 | Bacteria | 1266 |
| 931 | Ga0466967_0601462 | 3300045976 | Bacteria | 1085 |
| 932 | Ga0466967_0849029 | 3300045976 | Bacteria | 907 |
| 933 | Ga0466967_1209013 | 3300045976 | Bacteria | 753 |
| 934 | Ga0466967_1853724 | 3300045976 | Bacteria | 600 |
| 935 | Ga0495617_056784 | 3300046452 | Bacteria | 1298 |
| 936 | Ga0495617_159856 | 3300046452 | Bacteria | 714 |
| 937 | Ga0495592_0250305 | 3300046454 | Bacteria | 1171 |
| 938 | Ga0495592_0426018 | 3300046454 | Bacteria | 836 |
| 939 | Ga0495603_0091684 | 3300046455 | Bacteria | 1776 |
| 940 | Ga0495603_0149919 | 3300046455 | Bacteria | 1355 |
| 941 | Ga0495603_0385311 | 3300046455 | Bacteria | 804 |
| 942 | Ga0495590_0059434 | 3300046457 | Bacteria | 1337 |
| 943 | Ga0495629_0024603 | 3300046459 | Bacteria | 4287 |
| 944 | Ga0495629_0919495 | 3300046459 | Bacteria | 573 |
| 945 | Ga0495638_0009527 | 3300046460 | Bacteria | 6809 |
| 946 | Ga0495638_0014000 | 3300046460 | Bacteria | 5438 |
| 947 | Ga0495638_0342996 | 3300046460 | Bacteria | 791 |
| 948 | Ga0495638_0384130 | 3300046460 | Bacteria | 733 |
| 949 | Ga0495641_0139396 | 3300046461 | Bacteria | 1083 |
| 950 | Ga0495651_0168634 | 3300046462 | Bacteria | 1561 |
| 951 | Ga0495651_0187642 | 3300046462 | Bacteria | 1457 |
| 952 | Ga0495651_0190989 | 3300046462 | Bacteria | 1441 |
| 953 | Ga0495651_0247248 | 3300046462 | Bacteria | 1220 |
| 954 | Ga0495651_0387732 | 3300046462 | Bacteria | 915 |
| 955 | Ga0495653_0320701 | 3300046463 | Bacteria | 1004 |
| 956 | Ga0495653_0443919 | 3300046463 | Bacteria | 817 |
| 957 | Ga0495650_0034490 | 3300046471 | Bacteria | 2239 |
| 958 | Ga0495650_0289854 | 3300046471 | Bacteria | 550 |
| 959 | Ga0495582_0086029 | 3300046473 | Bacteria | 1749 |
| 960 | Ga0495582_0139963 | 3300046473 | Bacteria | 1371 |
| 961 | Ga0495605_0213752 | 3300046474 | Bacteria | 836 |
| 962 | Ga0495605_0234764 | 3300046474 | Bacteria | 789 |
| 963 | Ga0495639_0701919 | 3300046475 | Bacteria | 523 |
| 964 | Ga0495584_0279548 | 3300046491 | Bacteria | 848 |
| 965 | Ga0495584_0290941 | 3300046491 | Bacteria | 830 |
| 966 | Ga0495584_0417858 | 3300046491 | Bacteria | 682 |
| 967 | Ga0495585_0024609 | 3300046492 | Bacteria | 3451 |
| 968 | Ga0495585_0243734 | 3300046492 | Bacteria | 899 |
| 969 | Ga0495596_0079868 | 3300046500 | Bacteria | 1270 |
| 970 | Ga0495596_0235061 | 3300046500 | Bacteria | 712 |
| 971 | Ga0495596_0446972 | 3300046500 | Bacteria | 504 |
| 972 | Ga0495607_0489531 | 3300046501 | Bacteria | 547 |
| 973 | Ga0495583_0205045 | 3300046506 | Bacteria | 800 |
| 974 | Ga0495606_0069216 | 3300046507 | Bacteria | 2229 |
| 975 | Ga0495606_0405212 | 3300046507 | Bacteria | 709 |
| 976 | Ga0495608_0029753 | 3300046511 | Bacteria | 3702 |
| 977 | Ga0495608_0158095 | 3300046511 | Bacteria | 1442 |
| 978 | Ga0495610_0099015 | 3300046512 | Bacteria | 1309 |
| 979 | Ga0495610_0218571 | 3300046512 | Bacteria | 771 |
| 980 | Ga0495616_0120781 | 3300046513 | Bacteria | 1210 |
| 981 | Ga0495618_0361310 | 3300046514 | Bacteria | 893 |
| 982 | Ga0495620_0163260 | 3300046515 | Bacteria | 865 |
| 983 | Ga0495620_0183300 | 3300046515 | Bacteria | 809 |
| 984 | Ga0495628_0115335 | 3300046516 | Bacteria | 2063 |
| 985 | Ga0495628_0753942 | 3300046516 | Bacteria | 684 |
| 986 | Ga0495631_0252460 | 3300046518 | Bacteria | 752 |
| 987 | Ga0495632_0092363 | 3300046519 | Bacteria | 1434 |
| 988 | Ga0495632_0109574 | 3300046519 | Bacteria | 1297 |
| 989 | Ga0495632_0330965 | 3300046519 | Bacteria | 672 |
| 990 | Ga0495632_0354550 | 3300046519 | Bacteria | 645 |
| 991 | Ga0495643_0035822 | 3300046522 | Bacteria | 2730 |
| 992 | Ga0495643_0133030 | 3300046522 | Bacteria | 1247 |
| 993 | Ga0495643_0259844 | 3300046522 | Bacteria | 807 |
| 994 | Ga0495644_0123374 | 3300046523 | Bacteria | 986 |
| 995 | Ga0495644_0445567 | 3300046523 | Bacteria | 515 |
| 996 | Ga0495648_0023829 | 3300046524 | Bacteria | 4181 |
| 997 | Ga0495648_0266880 | 3300046524 | Bacteria | 818 |
| 998 | Ga0495648_0361423 | 3300046524 | Bacteria | 660 |
| 999 | Ga0495648_0427506 | 3300046524 | Bacteria | 585 |
| 1000 | Ga0495648_0513921 | 3300046524 | Bacteria | 511 |
| 1001 | Ga0495666_0178585 | 3300046526 | Bacteria | 981 |
| 1002 | Ga0495642_0206450 | 3300046528 | Bacteria | 857 |
| 1003 | Ga0495652_0102786 | 3300046529 | Bacteria | 2314 |
| 1004 | Ga0495652_0204173 | 3300046529 | Bacteria | 1497 |
| 1005 | Ga0495652_0816958 | 3300046529 | Bacteria | 620 |
| 1006 | Ga0495652_0838814 | 3300046529 | Bacteria | 610 |
| 1007 | Ga0495654_0285913 | 3300046530 | Bacteria | 677 |
| 1008 | Ga0495654_0449482 | 3300046530 | Bacteria | 507 |
| 1009 | Ga0495665_0656276 | 3300046531 | Bacteria | 522 |
| 1010 | Ga0495640_0014514 | 3300046533 | Bacteria | 5956 |
| 1011 | Ga0495640_0125542 | 3300046533 | Bacteria | 1664 |
| 1012 | Ga0495640_0258285 | 3300046533 | Bacteria | 1089 |
| 1013 | Ga0495587_0025877 | 3300046536 | Bacteria | 3582 |
| 1014 | Ga0495598_0313365 | 3300046537 | Bacteria | 596 |
| 1015 | Ga0495609_0147350 | 3300046538 | Bacteria | 1002 |
| 1016 | Ga0495597_0284289 | 3300046542 | Bacteria | 644 |
| 1017 | Ga0495645_0036139 | 3300046543 | Bacteria | 3601 |
| 1018 | Ga0495622_0022232 | 3300046557 | Bacteria | 2954 |
| 1019 | Ga0495622_0089044 | 3300046557 | Bacteria | 1418 |
| 1020 | Ga0495622_0128995 | 3300046557 | Bacteria | 1152 |
| 1021 | Ga0495622_0230055 | 3300046557 | Bacteria | 819 |
| 1022 | Ga0495633_0150729 | 3300046558 | Bacteria | 1074 |
| 1023 | Ga0495633_0299987 | 3300046558 | Bacteria | 730 |
| 1024 | Ga0495667_0077362 | 3300046559 | Bacteria | 2164 |
| 1025 | Ga0495667_0748095 | 3300046559 | Bacteria | 604 |
| 1026 | Ga0495656_0495681 | 3300046615 | Bacteria | 647 |
| 1027 | Ga0495656_0514720 | 3300046615 | Bacteria | 635 |
| 1028 | Ga0495668_0028861 | 3300046616 | Bacteria | 3136 |
| 1029 | Ga0495668_0225902 | 3300046616 | Bacteria | 1025 |
| 1030 | Ga0495668_0295785 | 3300046616 | Bacteria | 887 |
| 1031 | Ga0495634_0140276 | 3300046642 | Bacteria | 1535 |
| 1032 | Ga0495634_0408543 | 3300046642 | Bacteria | 805 |
| 1033 | Ga0495611_0288134 | 3300046648 | Bacteria | 758 |
| 1034 | Ga0495611_0439586 | 3300046648 | Bacteria | 595 |
| 1035 | Ga0495625_0105077 | 3300046660 | Bacteria | 1935 |
| 1036 | Ga0495625_0235848 | 3300046660 | Bacteria | 1193 |
| 1037 | Ga0495635_0007905 | 3300046663 | Bacteria | 7430 |
| 1038 | Ga0495659_0341152 | 3300046664 | Bacteria | 639 |
| 1039 | Ga0495661_0395626 | 3300046665 | Bacteria | 673 |
| 1040 | Ga0495588_0097033 | 3300046674 | Bacteria | 1546 |
| 1041 | Ga0495588_0187238 | 3300046674 | Bacteria | 1093 |
| 1042 | Ga0495657_0027075 | 3300046675 | Bacteria | 4051 |
| 1043 | Ga0495657_0062847 | 3300046675 | Bacteria | 2451 |
| 1044 | Ga0495599_0046271 | 3300046678 | Bacteria | 2728 |
| 1045 | Ga0495599_0369443 | 3300046678 | Bacteria | 858 |
| 1046 | Ga0495599_0730760 | 3300046678 | Bacteria | 569 |
| 1047 | Ga0495623_0127320 | 3300046679 | Bacteria | 1528 |
| 1048 | Ga0495646_0085468 | 3300046680 | Bacteria | 1831 |
| 1049 | Ga0495646_0108703 | 3300046680 | Bacteria | 1581 |
| 1050 | Ga0495647_0171488 | 3300046681 | Bacteria | 940 |
| 1051 | Ga0495658_0270039 | 3300046683 | Bacteria | 1072 |
| 1052 | Ga0495669_0184968 | 3300046684 | Bacteria | 993 |
| 1053 | Ga0495669_0466936 | 3300046684 | Bacteria | 613 |
| 1054 | Ga0495669_0515531 | 3300046684 | Bacteria | 581 |
| 1055 | Ga0495613_0116232 | 3300046689 | Bacteria | 1924 |
| 1056 | Ga0495624_0031167 | 3300046690 | Bacteria | 3470 |
| 1057 | Ga0495624_0236070 | 3300046690 | Bacteria | 1107 |
| 1058 | Ga0495670_0051666 | 3300046691 | Bacteria | 2057 |
| 1059 | Ga0495670_0762993 | 3300046691 | Bacteria | 528 |
| 1060 | Ga0495671_0367108 | 3300046692 | Bacteria | 690 |
| 1061 | Ga0495671_0482081 | 3300046692 | Bacteria | 592 |
| 1062 | Ga0495671_0538198 | 3300046692 | Bacteria | 556 |
| 1063 | Ga0495649_0354352 | 3300046694 | Bacteria | 741 |
| 1064 | Ga0495649_0451530 | 3300046694 | Bacteria | 642 |
| 1065 | Ga0495649_0649106 | 3300046694 | Bacteria | 519 |
| 1066 | Ga0495589_0374266 | 3300046794 | Bacteria | 655 |
| 1067 | Ga0495589_0493735 | 3300046794 | Bacteria | 559 |
| 1068 | Ga0495589_0581547 | 3300046794 | Bacteria | 510 |
| 1069 | Ga0495600_0004475 | 3300046809 | Bacteria | 8371 |
| 1070 | Ga0495600_0287033 | 3300046809 | Bacteria | 1040 |
| 1071 | Ga0495581_0128377 | 3300047315 | Bacteria | 1477 |
| 1072 | Ga0495581_0365218 | 3300047315 | Bacteria | 842 |
| 1073 | Ga0495581_0564230 | 3300047315 | Bacteria | 660 |
| 1074 | Ga0495604_0043292 | 3300047317 | Bacteria | 3525 |
| 1075 | Ga0495604_0091524 | 3300047317 | Bacteria | 2255 |
| 1076 | Ga0495636_0133871 | 3300047318 | Bacteria | 1104 |
| 1077 | Ga0495636_0482937 | 3300047318 | Bacteria | 598 |
| 1078 | Ga0495674_0561591 | 3300047319 | Bacteria | 907 |
| 1079 | Ga0495676_0084775 | 3300047321 | Bacteria | 2389 |
| 1080 | Ga0495676_0098435 | 3300047321 | Bacteria | 2170 |
| 1081 | Ga0495676_0262010 | 3300047321 | Bacteria | 1176 |
| 1082 | Ga0495680_0009018 | 3300047322 | Bacteria | 9012 |
| 1083 | Ga0495680_1035939 | 3300047322 | Bacteria | 522 |
| 1084 | Ga0495683_0242924 | 3300047323 | Bacteria | 793 |
| 1085 | Ga0495683_0380932 | 3300047323 | Bacteria | 590 |
| 1086 | Ga0495687_091181 | 3300047443 | Bacteria | 1166 |
| 1087 | Ga0495673_0135152 | 3300047469 | Bacteria | 966 |
| 1088 | Ga0495684_0958812 | 3300047471 | Bacteria | 546 |
| 1089 | Ga0495686_0133491 | 3300047472 | Bacteria | 1470 |
| 1090 | Ga0495686_0258063 | 3300047472 | Bacteria | 977 |
| 1091 | Ga0495686_0475817 | 3300047472 | Bacteria | 661 |
| 1092 | Ga0495686_0563747 | 3300047472 | Bacteria | 593 |
| 1093 | Ga0495686_0627315 | 3300047472 | Bacteria | 554 |
| 1094 | Ga0495686_0628047 | 3300047472 | Bacteria | 554 |
| 1095 | Ga0495602_0032368 | 3300048088 | Bacteria | 4923 |
| 1096 | Ga0495602_0299515 | 3300048088 | Bacteria | 1177 |
| 1097 | Ga0495602_0552744 | 3300048088 | Bacteria | 798 |
| 1098 | Ga0495602_0614275 | 3300048088 | Bacteria | 746 |
| 1099 | Ga0495602_0773225 | 3300048088 | Bacteria | 647 |
| 1100 | Ga0495602_1029560 | 3300048088 | Bacteria | 542 |
| 1101 | Ga0495614_0062589 | 3300048089 | Bacteria | 1599 |
| 1102 | Ga0495615_0077593 | 3300048090 | Bacteria | 906 |
| 1103 | Ga0495626_0252059 | 3300048091 | Bacteria | 708 |
| 1104 | Ga0495626_0311727 | 3300048091 | Bacteria | 620 |
| 1105 | Ga0496100_0042551 | 3300048903 | Bacteria | 2901 |
| 1106 | Ga0496100_0516987 | 3300048903 | Bacteria | 921 |
| 1107 | Ga0496100_0540473 | 3300048903 | Bacteria | 901 |
| 1108 | Ga0496100_0596700 | 3300048903 | Bacteria | 857 |
| 1109 | Ga0496100_1332029 | 3300048903 | Bacteria | 567 |
| 1110 | Ga0496101_0107602 | 3300048904 | Bacteria | 2095 |
| 1111 | Ga0496101_0212233 | 3300048904 | Bacteria | 1500 |
| 1112 | Ga0496102_0028006 | 3300048905 | Bacteria | 5034 |
| 1113 | Ga0496102_0106868 | 3300048905 | Bacteria | 2605 |
| 1114 | Ga0496102_0255989 | 3300048905 | Bacteria | 1650 |
| 1115 | Ga0496102_0278718 | 3300048905 | Bacteria | 1576 |
| 1116 | Ga0496102_0357178 | 3300048905 | Bacteria | 1375 |
| 1117 | Ga0496102_0738886 | 3300048905 | Bacteria | 907 |
| 1118 | Ga0496102_0976772 | 3300048905 | Bacteria | 768 |
| 1119 | Ga0496102_1682421 | 3300048905 | Bacteria | 552 |
| 1120 | Ga0496103_0049599 | 3300048906 | Bacteria | 2596 |
| 1121 | Ga0496103_0143036 | 3300048906 | Bacteria | 1530 |
| 1122 | Ga0496103_0510430 | 3300048906 | Bacteria | 769 |
| 1123 | Ga0496104_0018741 | 3300048907 | Bacteria | 6319 |
| 1124 | Ga0496104_0041918 | 3300048907 | Bacteria | 4293 |
| 1125 | Ga0496104_0043661 | 3300048907 | Bacteria | 4210 |
| 1126 | Ga0496104_0094155 | 3300048907 | Bacteria | 2865 |
| 1127 | Ga0496104_0140780 | 3300048907 | Bacteria | 2317 |
| 1128 | Ga0496104_0416169 | 3300048907 | Bacteria | 1256 |
| 1129 | Ga0496104_0530966 | 3300048907 | Bacteria | 1088 |
| 1130 | Ga0496104_1019352 | 3300048907 | Bacteria | 732 |
| 1131 | Ga0496105_0039541 | 3300048908 | Bacteria | 3887 |
| 1132 | Ga0496105_0060956 | 3300048908 | Bacteria | 3113 |
| 1133 | Ga0496105_0252007 | 3300048908 | Bacteria | 1430 |
| 1134 | Ga0496105_0460032 | 3300048908 | Bacteria | 1003 |
| 1135 | Ga0496105_0487220 | 3300048908 | Bacteria | 969 |
| 1136 | Ga0496105_1335248 | 3300048908 | Bacteria | 522 |
| 1137 | Ga0496106_0006170 | 3300048909 | Bacteria | 8863 |
| 1138 | Ga0496106_0039043 | 3300048909 | Bacteria | 3555 |
| 1139 | Ga0496106_0075362 | 3300048909 | Bacteria | 2584 |
| 1140 | Ga0496106_1572846 | 3300048909 | Bacteria | 504 |
| 1141 | Ga0496107_0060730 | 3300048910 | Bacteria | 2736 |
| 1142 | Ga0496107_0062828 | 3300048910 | Bacteria | 2690 |
| 1143 | Ga0496107_0134560 | 3300048910 | Bacteria | 1826 |
| 1144 | Ga0496107_0864194 | 3300048910 | Bacteria | 660 |
| 1145 | Ga0496107_1131605 | 3300048910 | Bacteria | 565 |
| 1146 | Ga0496108_0071617 | 3300048911 | Bacteria | 2925 |
| 1147 | Ga0496108_0162249 | 3300048911 | Bacteria | 1932 |
| 1148 | Ga0496108_1363439 | 3300048911 | Bacteria | 594 |
| 1149 | Ga0496109_0042787 | 3300048912 | Bacteria | 4105 |
| 1150 | Ga0496109_0145680 | 3300048912 | Bacteria | 2216 |
| 1151 | Ga0496109_0176731 | 3300048912 | Bacteria | 2004 |
| 1152 | Ga0496109_0813365 | 3300048912 | Bacteria | 872 |
| 1153 | Ga0496109_1206051 | 3300048912 | Bacteria | 693 |
| 1154 | Ga0496110_0034286 | 3300048913 | Bacteria | 4396 |
| 1155 | Ga0496110_0502943 | 3300048913 | Bacteria | 1103 |
| 1156 | Ga0496110_0549991 | 3300048913 | Bacteria | 1049 |
| 1157 | Ga0496110_0706620 | 3300048913 | Bacteria | 910 |
| 1158 | Ga0496110_0773640 | 3300048913 | Bacteria | 864 |
| 1159 | Ga0496110_0992476 | 3300048913 | Bacteria | 747 |
| 1160 | Ga0496111_0278837 | 3300048914 | Bacteria | 1240 |
| 1161 | Ga0496111_0958958 | 3300048914 | Bacteria | 614 |
| 1162 | Ga0496112_0001776 | 3300048915 | Bacteria | 16939 |
| 1163 | Ga0496112_0094695 | 3300048915 | Bacteria | 2957 |
| 1164 | Ga0496112_0111276 | 3300048915 | Bacteria | 2708 |
| 1165 | Ga0496112_0288919 | 3300048915 | Bacteria | 1586 |
| 1166 | Ga0496112_1041874 | 3300048915 | Bacteria | 737 |
| 1167 | Ga0496112_1612360 | 3300048915 | Bacteria | 562 |
| 1168 | Ga0496113_0058041 | 3300048916 | Bacteria | 2911 |
| 1169 | Ga0496113_0237395 | 3300048916 | Bacteria | 1454 |
| 1170 | Ga0496113_0519934 | 3300048916 | Bacteria | 955 |
| 1171 | Ga0496113_1080644 | 3300048916 | Bacteria | 630 |
| 1172 | Ga0496113_1453351 | 3300048916 | Bacteria | 530 |
| 1173 | Ga0496114_0080842 | 3300048917 | Bacteria | 2745 |
| 1174 | Ga0496114_0299327 | 3300048917 | Bacteria | 1420 |
| 1175 | Ga0496114_0680231 | 3300048917 | Bacteria | 903 |
| 1176 | Ga0496114_0991073 | 3300048917 | Bacteria | 723 |
| 1177 | Ga0496115_0040830 | 3300048918 | Bacteria | 3690 |
| 1178 | Ga0496115_0052762 | 3300048918 | Bacteria | 3262 |
| 1179 | Ga0496115_0230629 | 3300048918 | Bacteria | 1527 |
| 1180 | Ga0496115_0383282 | 3300048918 | Bacteria | 1143 |
| 1181 | Ga0496115_0893024 | 3300048918 | Bacteria | 686 |
| 1182 | Ga0496116_0054625 | 3300048919 | Bacteria | 2629 |
| 1183 | Ga0496116_0119043 | 3300048919 | Bacteria | 1533 |
| 1184 | Ga0496117_0013120 | 3300048920 | Bacteria | 7252 |
| 1185 | Ga0496117_0112655 | 3300048920 | Bacteria | 1691 |
| 1186 | Ga0496117_0183873 | 3300048920 | Bacteria | 1198 |
| 1187 | Ga0496117_0334740 | 3300048920 | Bacteria | 788 |
| 1188 | Ga0496118_0019171 | 3300048921 | Bacteria | 6125 |
| 1189 | Ga0496118_0060764 | 3300048921 | Bacteria | 2804 |
| 1190 | Ga0496118_0121550 | 3300048921 | Bacteria | 1701 |
| 1191 | Ga0496118_0140440 | 3300048921 | Bacteria | 1532 |
| 1192 | Ga0496118_0305456 | 3300048921 | Bacteria | 871 |
| 1193 | Ga0496118_0494318 | 3300048921 | Bacteria | 610 |
| 1194 | Ga0496119_0026612 | 3300048922 | Bacteria | 4005 |
| 1195 | Ga0496119_0245977 | 3300048922 | Bacteria | 904 |
| 1196 | Ga0496119_0276265 | 3300048922 | Bacteria | 837 |
| 1197 | Ga0496120_0153397 | 3300048923 | Bacteria | 1155 |
| 1198 | Ga0496120_0231290 | 3300048923 | Bacteria | 878 |
| 1199 | Ga0496121_0000476 | 3300048924 | Bacteria | 78015 |
| 1200 | Ga0496121_0026025 | 3300048924 | Bacteria | 5531 |
| 1201 | Ga0496121_0038564 | 3300048924 | Bacteria | 4227 |
| 1202 | Ga0496121_0056344 | 3300048924 | Bacteria | 3265 |
| 1203 | Ga0496121_0089908 | 3300048924 | Bacteria | 2402 |
| 1204 | Ga0496121_0163045 | 3300048924 | Bacteria | 1628 |
| 1205 | Ga0496121_0183568 | 3300048924 | Bacteria | 1507 |
| 1206 | Ga0496121_0278514 | 3300048924 | Bacteria | 1145 |
| 1207 | Ga0496121_0279455 | 3300048924 | Bacteria | 1143 |
| 1208 | Ga0496121_0331969 | 3300048924 | Bacteria | 1020 |
| 1209 | Ga0496121_0453710 | 3300048924 | Bacteria | 825 |
| 1210 | Ga0496121_0490523 | 3300048924 | Bacteria | 782 |
| 1211 | Ga0496121_0685172 | 3300048924 | Bacteria | 619 |
| 1212 | Ga0496121_0715258 | 3300048924 | Bacteria | 600 |
| 1213 | Ga0496121_0847828 | 3300048924 | Bacteria | 532 |
| 1214 | Ga0496122_0132189 | 3300048925 | Bacteria | 1583 |
| 1215 | Ga0496122_0255293 | 3300048925 | Bacteria | 977 |
| 1216 | Ga0496124_0001454 | 3300048927 | Bacteria | 34934 |
| 1217 | Ga0496124_0139065 | 3300048927 | Bacteria | 1918 |
| 1218 | Ga0496124_0175900 | 3300048927 | Bacteria | 1652 |
| 1219 | Ga0496124_0203172 | 3300048927 | Bacteria | 1505 |
| 1220 | Ga0496124_0307464 | 3300048927 | Bacteria | 1142 |
| 1221 | Ga0496124_0351155 | 3300048927 | Bacteria | 1043 |
| 1222 | Ga0496124_0717062 | 3300048927 | Bacteria | 632 |
| 1223 | Ga0496124_0741521 | 3300048927 | Bacteria | 617 |
| 1224 | Ga0496124_0981477 | 3300048927 | Bacteria | 505 |
| 1225 | Ga0496125_0061879 | 3300048928 | Bacteria | 2999 |
| 1226 | Ga0496125_0073279 | 3300048928 | Bacteria | 2663 |
| 1227 | Ga0496125_0146627 | 3300048928 | Bacteria | 1630 |
| 1228 | Ga0496125_0163067 | 3300048928 | Bacteria | 1511 |
| 1229 | Ga0496125_0163867 | 3300048928 | Bacteria | 1505 |
| 1230 | Ga0496125_0275893 | 3300048928 | Bacteria | 1044 |
| 1231 | Ga0496125_0321889 | 3300048928 | Bacteria | 937 |
| 1232 | Ga0496125_0489620 | 3300048928 | Bacteria | 695 |
| 1233 | Ga0496125_0516319 | 3300048928 | Bacteria | 669 |
| 1234 | Ga0496126_0019467 | 3300048929 | Bacteria | 6684 |
| 1235 | Ga0496126_0027761 | 3300048929 | Bacteria | 5401 |
| 1236 | Ga0496126_0117726 | 3300048929 | Bacteria | 2307 |
| 1237 | Ga0496126_0175410 | 3300048929 | Bacteria | 1823 |
| 1238 | Ga0496126_0215446 | 3300048929 | Bacteria | 1615 |
| 1239 | Ga0496126_0251395 | 3300048929 | Bacteria | 1473 |
| 1240 | Ga0496126_0285143 | 3300048929 | Bacteria | 1367 |
| 1241 | Ga0496126_0317976 | 3300048929 | Bacteria | 1280 |
| 1242 | Ga0496126_0330694 | 3300048929 | Bacteria | 1250 |
| 1243 | Ga0496126_0334443 | 3300048929 | Bacteria | 1242 |
| 1244 | Ga0496126_0352018 | 3300048929 | Bacteria | 1204 |
| 1245 | Ga0496126_0364062 | 3300048929 | Bacteria | 1180 |
| 1246 | Ga0496126_0384273 | 3300048929 | Bacteria | 1142 |
| 1247 | Ga0496126_0424449 | 3300048929 | Bacteria | 1074 |
| 1248 | Ga0496126_0735264 | 3300048929 | Bacteria | 763 |
| 1249 | Ga0496126_0980258 | 3300048929 | Bacteria | 636 |
| 1250 | Ga0496126_1200739 | 3300048929 | Bacteria | 558 |
| 1251 | Ga0495682_0151797 | 3300049460 | Bacteria | 826 |
| 1252 | Ga0495682_0199800 | 3300049460 | Bacteria | 709 |
| 1253 | Ga0501031_0026577 | 3300049568 | Bacteria | 3773 |
| 1254 | Ga0501031_0049902 | 3300049568 | Bacteria | 2727 |
| 1255 | Ga0501031_0196759 | 3300049568 | Bacteria | 1315 |
| 1256 | Ga0501031_0202304 | 3300049568 | Bacteria | 1296 |
| 1257 | Ga0501032_0000144 | 3300049569 | Bacteria | 58016 |
| 1258 | Ga0501032_0014510 | 3300049569 | Bacteria | 5577 |
| 1259 | Ga0501032_0057465 | 3300049569 | Bacteria | 2614 |
| 1260 | Ga0501032_0192045 | 3300049569 | Bacteria | 1334 |
| 1261 | Ga0501032_0346849 | 3300049569 | Bacteria | 956 |
| 1262 | Ga0501032_0394081 | 3300049569 | Bacteria | 890 |
| 1263 | Ga0501032_0417895 | 3300049569 | Bacteria | 860 |
| 1264 | Ga0501032_0765370 | 3300049569 | Bacteria | 610 |
| 1265 | Ga0501032_1027299 | 3300049569 | Bacteria | 517 |
| 1266 | Ga0501033_0000206 | 3300049570 | Bacteria | 56405 |
| 1267 | Ga0501033_0004699 | 3300049570 | Bacteria | 10929 |
| 1268 | Ga0501033_0026495 | 3300049570 | Bacteria | 4363 |
| 1269 | Ga0501033_0068200 | 3300049570 | Bacteria | 2615 |
| 1270 | Ga0501033_0113310 | 3300049570 | Bacteria | 1972 |
| 1271 | Ga0501033_0377655 | 3300049570 | Bacteria | 990 |
| 1272 | Ga0501033_0476628 | 3300049570 | Bacteria | 865 |
| 1273 | Ga0501033_0550910 | 3300049570 | Bacteria | 794 |
| 1274 | Ga0501033_0984062 | 3300049570 | Bacteria | 564 |
| 1275 | Ga0501034_0000159 | 3300049571 | Bacteria | 127397 |
| 1276 | Ga0501034_0124339 | 3300049571 | Bacteria | 2565 |
| 1277 | Ga0501034_0164022 | 3300049571 | Bacteria | 2191 |
| 1278 | Ga0501034_0252462 | 3300049571 | Bacteria | 1708 |
| 1279 | Ga0501034_0315731 | 3300049571 | Bacteria | 1496 |
| 1280 | Ga0501034_0491898 | 3300049571 | Bacteria | 1141 |
| 1281 | Ga0501034_0874979 | 3300049571 | Bacteria | 787 |
| 1282 | Ga0501034_1044069 | 3300049571 | Bacteria | 700 |
| 1283 | Ga0501036_0000179 | 3300049572 | Bacteria | 41780 |
| 1284 | Ga0501036_0082429 | 3300049572 | Bacteria | 2718 |
| 1285 | Ga0501036_0374440 | 3300049572 | Bacteria | 1188 |
| 1286 | Ga0501036_0407138 | 3300049572 | Bacteria | 1134 |
| 1287 | Ga0501036_0606771 | 3300049572 | Bacteria | 907 |
| 1288 | Ga0501036_1478930 | 3300049572 | Bacteria | 550 |
| 1289 | Ga0501037_0000112 | 3300049573 | Bacteria | 75698 |
| 1290 | Ga0501037_0000396 | 3300049573 | Bacteria | 36209 |
| 1291 | Ga0501037_0021148 | 3300049573 | Bacteria | 4807 |
| 1292 | Ga0501037_0032014 | 3300049573 | Bacteria | 3882 |
| 1293 | Ga0501037_0060449 | 3300049573 | Bacteria | 2763 |
| 1294 | Ga0501037_0117435 | 3300049573 | Bacteria | 1914 |
| 1295 | Ga0501037_0280347 | 3300049573 | Bacteria | 1161 |
| 1296 | Ga0501038_0000160 | 3300049574 | Bacteria | 57443 |
| 1297 | Ga0501038_0002046 | 3300049574 | Bacteria | 18655 |
| 1298 | Ga0501038_0004875 | 3300049574 | Bacteria | 12463 |
| 1299 | Ga0501038_0017078 | 3300049574 | Bacteria | 6564 |
| 1300 | Ga0501038_0327405 | 3300049574 | Bacteria | 1197 |
| 1301 | Ga0501038_0571820 | 3300049574 | Bacteria | 858 |
| 1302 | Ga0501038_0813963 | 3300049574 | Bacteria | 693 |
| 1303 | Ga0501039_0006453 | 3300049575 | Bacteria | 8914 |
| 1304 | Ga0501039_0041142 | 3300049575 | Bacteria | 3568 |
| 1305 | Ga0501039_0076205 | 3300049575 | Bacteria | 2607 |
| 1306 | Ga0501039_0094817 | 3300049575 | Bacteria | 2326 |
| 1307 | Ga0501039_0125694 | 3300049575 | Bacteria | 2011 |
| 1308 | Ga0501039_0622724 | 3300049575 | Bacteria | 845 |
| 1309 | Ga0501039_0832860 | 3300049575 | Bacteria | 719 |
| 1310 | Ga0501039_1200758 | 3300049575 | Bacteria | 587 |
| 1311 | Ga0501039_1366954 | 3300049575 | Bacteria | 545 |
| 1312 | Ga0501040_0050414 | 3300049576 | Bacteria | 2847 |
| 1313 | Ga0501041_0349615 | 3300049577 | Bacteria | 934 |
| 1314 | Ga0501042_0010829 | 3300049578 | Bacteria | 6132 |
| 1315 | Ga0501042_0473621 | 3300049578 | Bacteria | 908 |
| 1316 | Ga0501042_0964217 | 3300049578 | Bacteria | 621 |
| 1317 | Ga0501043_0000613 | 3300049579 | Bacteria | 31566 |
| 1318 | Ga0501043_0009493 | 3300049579 | Bacteria | 7630 |
| 1319 | Ga0501043_0084716 | 3300049579 | Bacteria | 2491 |
| 1320 | Ga0501043_0256683 | 3300049579 | Bacteria | 1345 |
| 1321 | Ga0501043_0386644 | 3300049579 | Bacteria | 1059 |
| 1322 | Ga0501043_0400925 | 3300049579 | Bacteria | 1036 |
| 1323 | Ga0501043_0538755 | 3300049579 | Bacteria | 868 |
| 1324 | Ga0501043_0597453 | 3300049579 | Bacteria | 815 |
| 1325 | Ga0501043_0620172 | 3300049579 | Bacteria | 797 |
| 1326 | Ga0501043_0982873 | 3300049579 | Bacteria | 601 |
| 1327 | Ga0501043_0988557 | 3300049579 | Bacteria | 599 |
| 1328 | Ga0501046_0000397 | 3300049580 | Bacteria | 43539 |
| 1329 | Ga0501046_0011234 | 3300049580 | Bacteria | 7666 |
| 1330 | Ga0501046_0110470 | 3300049580 | Bacteria | 2101 |
| 1331 | Ga0501046_0283931 | 3300049580 | Bacteria | 1212 |
| 1332 | Ga0501046_0545095 | 3300049580 | Bacteria | 827 |
| 1333 | Ga0501046_0765875 | 3300049580 | Bacteria | 677 |
| 1334 | Ga0501046_1111881 | 3300049580 | Bacteria | 545 |
| 1335 | Ga0501047_0000288 | 3300049581 | Bacteria | 57965 |
| 1336 | Ga0501047_0084506 | 3300049581 | Bacteria | 3050 |
| 1337 | Ga0501047_0109325 | 3300049581 | Bacteria | 2647 |
| 1338 | Ga0501047_0118857 | 3300049581 | Bacteria | 2525 |
| 1339 | Ga0501047_0290235 | 3300049581 | Bacteria | 1479 |
| 1340 | Ga0501047_0464868 | 3300049581 | Bacteria | 1094 |
| 1341 | Ga0501047_0806945 | 3300049581 | Bacteria | 753 |
| 1342 | Ga0501048_0009783 | 3300049582 | Bacteria | 7188 |
| 1343 | Ga0501048_0049560 | 3300049582 | Bacteria | 2992 |
| 1344 | Ga0501048_0182214 | 3300049582 | Bacteria | 1489 |
| 1345 | Ga0501048_0183876 | 3300049582 | Bacteria | 1482 |
| 1346 | Ga0501067_0000783 | 3300049583 | Bacteria | 17104 |
| 1347 | Ga0501067_0008905 | 3300049583 | Bacteria | 5560 |
| 1348 | Ga0501067_0063692 | 3300049583 | Bacteria | 2042 |
| 1349 | Ga0501067_0255613 | 3300049583 | Bacteria | 975 |
| 1350 | Ga0501067_0265092 | 3300049583 | Bacteria | 956 |
| 1351 | Ga0501067_0278534 | 3300049583 | Bacteria | 931 |
| 1352 | Ga0501067_0428474 | 3300049583 | Bacteria | 738 |
| 1353 | Ga0501068_0001676 | 3300049584 | Bacteria | 11832 |
| 1354 | Ga0501068_0060477 | 3300049584 | Bacteria | 2300 |
| 1355 | Ga0501068_0308656 | 3300049584 | Bacteria | 1013 |
| 1356 | Ga0501069_0012782 | 3300049585 | Bacteria | 4470 |
| 1357 | Ga0501069_0201730 | 3300049585 | Bacteria | 1153 |
| 1358 | Ga0501069_0428445 | 3300049585 | Bacteria | 785 |
| 1359 | Ga0501070_0002241 | 3300049586 | Bacteria | 16986 |
| 1360 | Ga0501070_0025427 | 3300049586 | Bacteria | 4966 |
| 1361 | Ga0501070_0123705 | 3300049586 | Bacteria | 2137 |
| 1362 | Ga0501070_0146370 | 3300049586 | Bacteria | 1950 |
| 1363 | Ga0501070_0184967 | 3300049586 | Bacteria | 1714 |
| 1364 | Ga0501070_0608136 | 3300049586 | Bacteria | 871 |
| 1365 | Ga0501071_0022783 | 3300049587 | Bacteria | 4369 |
| 1366 | Ga0501071_0646088 | 3300049587 | Bacteria | 814 |
| 1367 | Ga0501072_0001612 | 3300049588 | Bacteria | 16857 |
| 1368 | Ga0501072_0125554 | 3300049588 | Bacteria | 2044 |
| 1369 | Ga0501072_0167759 | 3300049588 | Bacteria | 1752 |
| 1370 | Ga0501072_0971011 | 3300049588 | Bacteria | 663 |
| 1371 | Ga0501073_0000034 | 3300049589 | Bacteria | 95224 |
| 1372 | Ga0501073_0036008 | 3300049589 | Bacteria | 3517 |
| 1373 | Ga0501073_0040397 | 3300049589 | Bacteria | 3302 |
| 1374 | Ga0501073_0081502 | 3300049589 | Bacteria | 2251 |
| 1375 | Ga0501073_0101096 | 3300049589 | Bacteria | 2002 |
| 1376 | Ga0501073_0439018 | 3300049589 | Bacteria | 902 |
| 1377 | Ga0501074_0000532 | 3300049590 | Bacteria | 23403 |
| 1378 | Ga0501074_0069854 | 3300049590 | Bacteria | 2525 |
| 1379 | Ga0501074_0174380 | 3300049590 | Bacteria | 1535 |
| 1380 | Ga0501074_0979950 | 3300049590 | Bacteria | 594 |
| 1381 | Ga0501076_0607235 | 3300049592 | Bacteria | 902 |
| 1382 | Ga0501076_1312298 | 3300049592 | Bacteria | 595 |
| 1383 | Ga0501076_1326636 | 3300049592 | Bacteria | 592 |
| 1384 | Ga0501077_0238763 | 3300049593 | Bacteria | 1155 |
| 1385 | Ga0501079_0036257 | 3300049741 | Bacteria | 3799 |
| 1386 | Ga0501079_0204286 | 3300049741 | Bacteria | 1543 |
| 1387 | Ga0501079_0355961 | 3300049741 | Bacteria | 1147 |
| 1388 | Ga0501079_0433135 | 3300049741 | Bacteria | 1032 |
| 1389 | Ga0501080_0000765 | 3300049742 | Bacteria | 26123 |
| 1390 | Ga0501080_0079464 | 3300049742 | Bacteria | 3049 |
| 1391 | Ga0501080_0265054 | 3300049742 | Bacteria | 1564 |
| 1392 | Ga0501080_0421248 | 3300049742 | Bacteria | 1199 |
| 1393 | Ga0501080_0730366 | 3300049742 | Bacteria | 872 |
| 1394 | Ga0501080_1282939 | 3300049742 | Bacteria | 628 |
| 1395 | Ga0501080_1511182 | 3300049742 | Bacteria | 570 |
| 1396 | Ga0501083_0004806 | 3300049744 | Bacteria | 9547 |
| 1397 | Ga0501083_0019398 | 3300049744 | Bacteria | 4738 |
| 1398 | Ga0501083_0078015 | 3300049744 | Bacteria | 2197 |
| 1399 | Ga0501035_0000137 | 3300049822 | Bacteria | 89273 |
| 1400 | Ga0501035_0005535 | 3300049822 | Bacteria | 11936 |
| 1401 | Ga0501035_0031309 | 3300049822 | Bacteria | 4845 |
| 1402 | Ga0501035_0095678 | 3300049822 | Bacteria | 2610 |
| 1403 | Ga0501035_0109894 | 3300049822 | Bacteria | 2416 |
| 1404 | Ga0501035_0209261 | 3300049822 | Bacteria | 1669 |
| 1405 | Ga0501035_0324283 | 3300049822 | Bacteria | 1293 |
| 1406 | Ga0501035_0499943 | 3300049822 | Bacteria | 1001 |
| 1407 | Ga0501035_0525655 | 3300049822 | Bacteria | 971 |
| 1408 | Ga0501035_0902991 | 3300049822 | Bacteria | 699 |
| 1409 | Ga0501044_0000418 | 3300049823 | Bacteria | 52554 |
| 1410 | Ga0501044_0075279 | 3300049823 | Bacteria | 3427 |
| 1411 | Ga0501044_0087043 | 3300049823 | Bacteria | 3155 |
| 1412 | Ga0501044_0158153 | 3300049823 | Bacteria | 2244 |
| 1413 | Ga0501044_0185241 | 3300049823 | Bacteria | 2047 |
| 1414 | Ga0501044_0207440 | 3300049823 | Bacteria | 1915 |
| 1415 | Ga0501044_0211357 | 3300049823 | Bacteria | 1894 |
| 1416 | Ga0501044_0221756 | 3300049823 | Bacteria | 1841 |
| 1417 | Ga0501044_0297239 | 3300049823 | Bacteria | 1544 |
| 1418 | Ga0501044_0492465 | 3300049823 | Bacteria | 1128 |
| 1419 | Ga0501044_0911981 | 3300049823 | Bacteria | 753 |
| 1420 | Ga0501044_0959638 | 3300049823 | Bacteria | 728 |
| 1421 | Ga0501045_0025556 | 3300049824 | Bacteria | 4247 |
| 1422 | Ga0501045_0061052 | 3300049824 | Bacteria | 2764 |
| 1423 | Ga0501045_0376518 | 3300049824 | Bacteria | 1057 |
| 1424 | Ga0501045_0467245 | 3300049824 | Bacteria | 937 |
| 1425 | Ga0501045_0716547 | 3300049824 | Bacteria | 738 |
| 1426 | nmdc:mga03683_551904_c1 | 3300050489 | Bacteria | 561 |
| 1427 | nmdc:mga03683_567034_c1 | 3300050489 | Bacteria | 554 |
| 1428 | nmdc:mga03n38_880704_c1 | 3300050490 | Bacteria | 525 |
| 1429 | nmdc:mga00v17_309679_c1 | 3300050491 | Bacteria | 1026 |
| 1430 | nmdc:mga00v17_617866_c1 | 3300050491 | Bacteria | 698 |
| 1431 | nmdc:mga0yw44_435741_c1 | 3300050492 | Bacteria | 888 |
| 1432 | nmdc:mga0yw44_437546_c1 | 3300050492 | Bacteria | 886 |
| 1433 | nmdc:mga0yw44_492493_c1 | 3300050492 | Bacteria | 832 |
| 1434 | nmdc:mga0yw44_569093_c1 | 3300050492 | Bacteria | 769 |
| 1435 | nmdc:mga0yw44_7902_c1 | 3300050492 | Bacteria | 5268 |
| 1436 | nmdc:mga0k408_337867_c1 | 3300050493 | Bacteria | 898 |
| 1437 | nmdc:mga0k408_46554_c1 | 3300050493 | Bacteria | 2505 |
| 1438 | nmdc:mga06z11_242908_c1 | 3300050494 | Bacteria | 1058 |
| 1439 | nmdc:mga06z11_424919_c1 | 3300050494 | Bacteria | 801 |
| 1440 | nmdc:mga07m45_334107_c1 | 3300050496 | Bacteria | 881 |
| 1441 | nmdc:mga07m45_52800_c1 | 3300050496 | Bacteria | 2296 |
| 1442 | nmdc:mga07m45_90754_c1 | 3300050496 | Bacteria | 1750 |
| 1443 | nmdc:mga05p37_737745_c1 | 3300050507 | Bacteria | 1088 |
| 1444 | nmdc:mga08y16_430231_c1 | 3300050511 | Bacteria | 1348 |
| 1445 | nmdc:mga0n895_352105_c1 | 3300050512 | Bacteria | 1491 |
| 1446 | nmdc:mga08x19_1289035_c1 | 3300050514 | Bacteria | 517 |
| 1447 | nmdc:mga0sz30_119866_c1 | 3300050516 | Bacteria | 1156 |
| 1448 | nmdc:mga0sz30_330701_c1 | 3300050516 | Bacteria | 681 |
| 1449 | nmdc:mga0sz30_54271_c1 | 3300050516 | Bacteria | 1704 |
| 1450 | Ga0495601_0362503 | 3300053077 | Bacteria | 942 |
| 1451 | Ga0500610_0189783 | 3300053079 | Bacteria | 999 |
| 1452 | Ga0500635_0007763 | 3300053080 | Bacteria | 2918 |
| 1453 | Ga0500635_0227243 | 3300053080 | Bacteria | 729 |
| 1454 | Ga0495655_0098408 | 3300053083 | Bacteria | 863 |
| 1455 | Ga0495595_0585374 | 3300053084 | Bacteria | 570 |
| 1456 | Ga0495619_0125960 | 3300053085 | Bacteria | 1758 |
| 1457 | Ga0495619_0498997 | 3300053085 | Bacteria | 837 |
| 1458 | Ga0500578_0650027 | 3300053086 | Bacteria | 573 |
| 1459 | Ga0500643_000057 | 3300053087 | Bacteria | 131401 |
| 1460 | Ga0500644_0043348 | 3300053088 | Bacteria | 1505 |
| 1461 | Ga0500644_0211529 | 3300053088 | Bacteria | 806 |
| 1462 | Ga0500581_352340 | 3300053089 | Bacteria | 557 |
| 1463 | Ga0500646_0110080 | 3300053090 | Bacteria | 875 |
| 1464 | Ga0500646_0167253 | 3300053090 | Bacteria | 738 |
| 1465 | Ga0500647_0049399 | 3300053091 | Bacteria | 2023 |
| 1466 | Ga0500647_0195614 | 3300053091 | Bacteria | 920 |
| 1467 | Ga0500583_0168593 | 3300053092 | Bacteria | 1090 |
| 1468 | Ga0500583_0341165 | 3300053092 | Bacteria | 727 |
| 1469 | Ga0500651_0212251 | 3300053093 | Bacteria | 1138 |
| 1470 | Ga0500651_0762061 | 3300053093 | Bacteria | 513 |
| 1471 | Ga0500566_0071724 | 3300053094 | Bacteria | 1943 |
| 1472 | Ga0500648_315450 | 3300053097 | Bacteria | 671 |
| 1473 | Ga0500555_004324 | 3300053103 | Bacteria | 4037 |
| 1474 | Ga0500555_032811 | 3300053103 | Bacteria | 1466 |
| 1475 | Ga0500556_0004646 | 3300053104 | Bacteria | 3899 |
| 1476 | Ga0500557_000225 | 3300053105 | Bacteria | 8786 |
| 1477 | Ga0500562_106131 | 3300053108 | Bacteria | 765 |
| 1478 | Ga0500569_004900 | 3300053109 | Bacteria | 2845 |
| 1479 | Ga0500572_001353 | 3300053111 | Bacteria | 6795 |
| 1480 | Ga0500572_163094 | 3300053111 | Bacteria | 729 |
| 1481 | Ga0500592_055921 | 3300053116 | Bacteria | 644 |
| 1482 | Ga0500595_023912 | 3300053119 | Bacteria | 2140 |
| 1483 | Ga0500595_176244 | 3300053119 | Bacteria | 593 |
| 1484 | Ga0500597_215728 | 3300053120 | Bacteria | 800 |
| 1485 | Ga0500608_367083 | 3300053122 | Bacteria | 503 |
| 1486 | Ga0500614_048160 | 3300053123 | Bacteria | 1109 |
| 1487 | Ga0500618_144197 | 3300053125 | Bacteria | 543 |
| 1488 | Ga0500626_343788 | 3300053128 | Bacteria | 504 |
| 1489 | Ga0500642_0075818 | 3300053130 | Bacteria | 1537 |
| 1490 | Ga0500655_088752 | 3300053133 | Bacteria | 641 |
| 1491 | Ga0500658_0141802 | 3300053134 | Bacteria | 1078 |
| 1492 | Ga0500658_0213151 | 3300053134 | Bacteria | 884 |
| 1493 | Ga0500658_0434165 | 3300053134 | Bacteria | 599 |
| 1494 | Ga0500559_0003520 | 3300053136 | Bacteria | 7668 |
| 1495 | Ga0500559_0009353 | 3300053136 | Bacteria | 4247 |
| 1496 | Ga0500559_0014510 | 3300053136 | Bacteria | 3329 |
| 1497 | Ga0500559_0206447 | 3300053136 | Bacteria | 926 |
| 1498 | Ga0500568_0064654 | 3300053139 | Bacteria | 1409 |
| 1499 | Ga0500573_0014263 | 3300053140 | Bacteria | 4492 |
| 1500 | Ga0500577_0197479 | 3300053142 | Bacteria | 867 |
| 1501 | Ga0500577_0366846 | 3300053142 | Bacteria | 630 |
| 1502 | Ga0500588_0364375 | 3300053146 | Bacteria | 550 |
| 1503 | Ga0500589_124616 | 3300053147 | Bacteria | 1086 |
| 1504 | Ga0500590_121068 | 3300053148 | Bacteria | 1226 |
| 1505 | Ga0500590_200681 | 3300053148 | Bacteria | 844 |
| 1506 | Ga0500590_297504 | 3300053148 | Bacteria | 609 |
| 1507 | Ga0500603_007768 | 3300053150 | Bacteria | 2361 |
| 1508 | Ga0500604_0344311 | 3300053151 | Bacteria | 518 |
| 1509 | Ga0500616_0050905 | 3300053153 | Bacteria | 2185 |
| 1510 | Ga0500622_0143836 | 3300053156 | Bacteria | 1134 |
| 1511 | Ga0500624_029966 | 3300053157 | Bacteria | 930 |
| 1512 | Ga0500627_0185650 | 3300053158 | Bacteria | 935 |
| 1513 | Ga0500633_0244469 | 3300053160 | Bacteria | 667 |
| 1514 | Ga0500634_0194570 | 3300053161 | Bacteria | 897 |
| 1515 | Ga0500638_198954 | 3300053162 | Bacteria | 849 |
| 1516 | Ga0500638_357321 | 3300053162 | Bacteria | 539 |
| 1517 | Ga0500638_391643 | 3300053162 | Bacteria | 501 |
| 1518 | Ga0500639_059100 | 3300053163 | Bacteria | 1980 |
| 1519 | Ga0500639_077714 | 3300053163 | Bacteria | 1678 |
| 1520 | Ga0500636_0032501 | 3300053177 | Bacteria | 3088 |
| 1521 | Ga0500636_0120323 | 3300053177 | Bacteria | 1473 |
| 1522 | Ga0500636_0166410 | 3300053177 | Bacteria | 1197 |
| 1523 | Ga0500636_0217347 | 3300053177 | Bacteria | 998 |
| 1524 | Ga0500636_0415581 | 3300053177 | Bacteria | 619 |
| 1525 | Ga0500637_0324824 | 3300053178 | Bacteria | 829 |
| 1526 | Ga0500637_0568362 | 3300053178 | Bacteria | 545 |
| 1527 | Ga0500625_015449 | 3300053729 | Bacteria | 3542 |
| 1528 | Ga0500625_189416 | 3300053729 | Bacteria | 707 |
| 1529 | Ga0500552_005353 | 3300053733 | Bacteria | 1395 |
| 1530 | Ga0500552_028666 | 3300053733 | Bacteria | 844 |
| 1531 | Ga0500596_003631 | 3300053735 | Bacteria | 2907 |
| 1532 | Ga0500596_006493 | 3300053735 | Bacteria | 1973 |
| 1533 | Ga0500599_021068 | 3300053736 | Bacteria | 925 |
| 1534 | Ga0501084_0005309 | 3300054114 | Bacteria | 10549 |
| 1535 | Ga0500661_017797 | 3300055283 | Bacteria | 1268 |
| 1536 | Ga0500661_048414 | 3300055283 | Bacteria | 757 |
| 1537 | Ga0587082_147885 | 3300059504 | Bacteria | 553 |
| 1538 | Ga0501082_0002188 | 3300060353 | Bacteria | 17112 |
| 1539 | Ga0501082_0179469 | 3300060353 | Bacteria | 1841 |
| 1540 | Ga0501082_0205711 | 3300060353 | Bacteria | 1712 |
| 1541 | Ga0501082_1191903 | 3300060353 | Bacteria | 665 |
| 1542 | Ga0530510_0923909 | 3300061734 | Bacteria | 667 |
| 1543 | Ga0530510_1317479 | 3300061734 | Bacteria | 554 |
| 1544 | 2507511075 | 2507262055 | Bacteria | 8048963 |
| 1545 | 2508544892 | 2508501009 | Bacteria | 7784016 |
| 1546 | 2508696882 | 2508501042 | Bacteria | 8719808 |
| 1547 | 2509151821 | 2508501128 | Bacteria | 8613869 |
| 1548 | 2511400413 | 2511231028 | Bacteria | 8046582 |
| 1549 | 2513623537 | 2513237092 | Bacteria | 8341956 |
| 1550 | 2513637415 | 2513237094 | Bacteria | 8789602 |
| 1551 | 2513649738 | 2513237095 | Bacteria | 8976980 |
| 1552 | 2513655091 | 2513237096 | Bacteria | 8722461 |
| 1553 | 2513679601 | 2513237098 | Bacteria | 9902361 |
| 1554 | 2513696512 | 2513237101 | Bacteria | 7952346 |
| 1555 | 2513701150 | 2513237102 | Bacteria | 7703324 |
| 1556 | 2513716971 | 2513237104 | Bacteria | 10034502 |
| 1557 | 2513874704 | 2513237139 | Bacteria | 8737671 |
| 1558 | 2513915886 | 2513237145 | Bacteria | 8979722 |
| 1559 | 2514010578 | 2513237161 | Bacteria | 8871253 |
| 1560 | 2515625353 | 2515154112 | Bacteria | 8294334 |
| 1561 | 2517100645 | 2517093001 | Bacteria | 9002274 |
| 1562 | 2517894809 | 2517572143 | Bacteria | 9484767 |
| 1563 | 2524438132 | 2524023205 | Bacteria | 8918781 |
| 1564 | 2524471408 | 2524023210 | Bacteria | 9029266 |
| 1565 | 2524534576 | 2524023228 | Bacteria | 10118060 |
| 1566 | 2528857588 | 2528768022 | Bacteria | 10457665 |
| 1567 | 2617353285 | 2617270735 | Bacteria | 9163226 |
| 1568 | 2617373200 | 2617270741 | Bacteria | 8201522 |
| 1569 | 2644289479 | 2643221651 | Bacteria | 4798932 |
| 1570 | 2671119225 | 2667528175 | Bacteria | 7532676 |
| 1571 | 2723843019 | 2721755755 | Bacteria | 8322773 |
| 1572 | 2728747532 | 2728368998 | Bacteria | 8720350 |
| 1573 | 2745076987 | 2744054633 | Bacteria | 8678936 |
| 1574 | 2793066021 | 2791355196 | Bacteria | 7323613 |
| 1575 | 2793071283 | 2791355197 | Bacteria | 8420563 |
| 1576 | 2793084041 | |||
| 1577 | 2805916703 | 2802429603 | Bacteria | 8777136 |
| 1578 | 2818238210 | 2816332527 | Bacteria | 8933356 |
| 1579 | 2824607536 | 2824600985 | Bacteria | 8488197 |
| 1580 | 2824617052 | 2824609381 | Bacteria | 8672835 |
| 1581 | 2824625916 | 2824617872 | Bacteria | 8814715 |
| 1582 | 2824634672 | 2824626560 | Bacteria | 8813858 |
| 1583 | 2824642730 | 2824635225 | Bacteria | 8785348 |
| 1584 | 2824650646 | 2824644064 | Bacteria | 8743947 |
| 1585 | 2824658767 | 2824653114 | Bacteria | 8493680 |
| 1586 | 2824667965 | 2824661429 | Bacteria | 9877870 |
| 1587 | 2824678542 | 2824671348 | Bacteria | 8369588 |
| 1588 | 2824694990 | 2824687955 | Bacteria | 8360029 |
| 1589 | 2824702857 | 2824696289 | Bacteria | 8335049 |
| 1590 | 2824712090 | 2824704595 | Bacteria | 9667483 |
| 1591 | 2824721431 | 2824714736 | Bacteria | 8717648 |
| 1592 | 2824730741 | 2824723954 | Bacteria | 8758240 |
| 1593 | 2824738719 | 2824732956 | Bacteria | 7810675 |
| 1594 | 2824761472 | 2824753945 | Bacteria | 9787441 |
| 1595 | 2824771365 | 2824763712 | Bacteria | 9792355 |
| 1596 | 2824780495 | 2824773399 | Bacteria | 8360218 |
| 1597 | 2838127950 | 2838122688 | Bacteria | 8803140 |
| 1598 | 2841943244 | 2841941048 | Bacteria | 8688029 |
| 1599 | 2841954024 | 2841949485 | Bacteria | 8680857 |
| 1600 | 2841961934 | 2841957949 | Bacteria | 8652217 |
| 1601 | 2841968116 | 2841966195 | Bacteria | 8673214 |
| 1602 | 2841976675 | 2841974524 | Bacteria | 8931498 |
| 1603 | 2841988047 | 2841983080 | Bacteria | 8395090 |
| 1604 | 2844316857 | 2844315083 | Bacteria | 8138177 |
| 1605 | 2847938618 | 2847930680 | Bacteria | 9342022 |
| 1606 | 2847944183 | 2847939898 | Bacteria | 8606328 |
| 1607 | 2849081591 | 2849076700 | Bacteria | 7039503 |
| 1608 | 2857512245 | 2857509624 | Bacteria | 7472071 |
| 1609 | 2874597808 | 2874590934 | Bacteria | 8299676 |
| 1610 | 2874612648 | 2874604998 | Bacteria | 7834745 |
| 1611 | 2874616865 | 2874612657 | Bacteria | 8252029 |
| 1612 | 2874623379 | 2874620515 | Bacteria | 8290088 |
| 1613 | 2874634207 | 2874628541 | Bacteria | 8630250 |
| 1614 | 2874651337 | 2874645413 | Bacteria | 8214782 |
| 1615 | 2876764059 | 2876761206 | Bacteria | 10111113 |
| 1616 | 2876776408 | 2876771140 | Bacteria | 8287509 |
| 1617 | 2876820976 | 2876818435 | Bacteria | 8274608 |
| 1618 | 2879081729 | 2879074833 | Bacteria | 8279565 |
| 1619 | 2879088406 | 2879083081 | Bacteria | 8587928 |
| 1620 | 2879108861 | 2879099564 | Bacteria | 10442239 |
| 1621 | 2879130443 | 2879127579 | Bacteria | 8294491 |
| 1622 | 2879146329 | 2879142872 | Bacteria | 8267021 |
| 1623 | 2881370735 | 2881364244 | Bacteria | 7710352 |
| 1624 | 2881671282 | 2881665667 | Bacteria | 8175609 |
| 1625 | 2885366881 | 2885366525 | Bacteria | 8326213 |
| 1626 | 2885376964 | 2885374607 | Bacteria | 8927485 |
| 1627 | 2885389349 | 2885383462 | Bacteria | 9473874 |
| 1628 | 2885411865 | 2885409591 | Bacteria | 9235467 |
| 1629 | 2888381468 | 2888378607 | Bacteria | 9652610 |
| 1630 | 2888389177 | 2888388044 | Bacteria | 7304136 |
| 1631 | 2888421871 | 2888419890 | Bacteria | 7857137 |
| 1632 | 2889033688 | 2889033259 | Bacteria | 9099371 |
| 1633 | 2903733908 | 2903727486 | Bacteria | 8281579 |
| 1634 | 2903754744 | 2903748898 | Bacteria | 9972761 |
| 1635 | 2903773208 | 2903768456 | Bacteria | 9749579 |
| 1636 | 2904672690 | 2904666416 | Bacteria | 8226587 |
| 1637 | 2904697799 | 2904690495 | Bacteria | 9412302 |
| 1638 | 2904719293 | 2904711408 | Bacteria | 9771557 |
| 1639 | 2906604524 | 2906602504 | Bacteria | 8295279 |
| 1640 | 2906611537 | |||
| 1641 | 2906635231 | 2906626472 | Bacteria | 8826946 |
| 1642 | 2908745117 | 2908739725 | Bacteria | 8628932 |
| 1643 | 2908756437 | 2908756301 | Bacteria | 8864324 |
| 1644 | 2908781656 | 2908775508 | Bacteria | 8092255 |
| 1645 | 2922367046 | 2922361189 | Bacteria | 7436256 |
| 1646 | 2922371122 | |||
| 1647 | 2922390176 | 2922386360 | Bacteria | 7017218 |
| 1648 | 2922427818 | |||
| 1649 | 2929619519 | 2929615660 | Bacteria | 9193770 |
| 1650 | 2929628011 | 2929624759 | Bacteria | 9339455 |
| 1651 | 2932785843 | 2932784394 | Bacteria | 9704911 |
| 1652 | 2932801087 | 2932794094 | Bacteria | 7915132 |
| 1653 | 2932804165 | 2932801729 | Bacteria | 7987968 |
| 1654 | 2932813591 | 2932809354 | Bacteria | 9135765 |
| 1655 | 2932830888 | 2932828146 | Bacteria | 9745859 |
| 1656 | 2933581440 | 2933577622 | Bacteria | 9116884 |
| 1657 | 2935612693 | 2935608549 | Bacteria | 8203142 |
| 1658 | 2935620930 | 2935616580 | Bacteria | 9032984 |
| 1659 | 2935632248 | 2935630451 | Bacteria | 8169952 |
| 1660 | 2935640014 | 2935638405 | Bacteria | 10015038 |
| 1661 | 2935655190 | 2935648319 | Bacteria | 8801166 |
| 1662 | 2935664071 | 2935656913 | Bacteria | 8965014 |
| 1663 | 2935667132 | 2935665750 | Bacteria | 9571747 |
| 1664 | 2935677809 | 2935675223 | Bacteria | 9928132 |
| 1665 | 2935690262 | 2935684952 | Bacteria | 9590419 |
| 1666 | 2935697403 | 2935694250 | Bacteria | 9291695 |
| 1667 | 2935704888 | 2935703347 | Bacteria | 10242284 |
| 1668 | 2935718042 | 2935713505 | Bacteria | 9608509 |
| 1669 | 2935726808 | 2935722832 | Bacteria | 9608746 |
| 1670 | 2935735578 | 2935732158 | Bacteria | 9706831 |
| 1671 | 2935745151 | 2935741537 | Bacteria | 9707219 |
| 1672 | 2935755272 | 2935750917 | Bacteria | 9590372 |
| 1673 | 2935762206 | 2935760218 | Bacteria | 9817913 |
| 1674 | 2935773586 | 2935769743 | Bacteria | 7878163 |
| 1675 | 2935780146 | 2935777560 | Bacteria | 8077691 |
| 1676 | 2935788509 | 2935785616 | Bacteria | 7962367 |
| 1677 | 2935796665 | 2935793552 | Bacteria | 8012592 |
| 1678 | 2935803710 | 2935801545 | Bacteria | 9301974 |
| 1679 | 2935811623 | 2935810662 | Bacteria | 9401221 |
| 1680 | 2935824182 | 2935819856 | Bacteria | 8261050 |
| 1681 | 2935829497 | 2935827899 | Bacteria | 10038562 |
| 1682 | 2935842526 | 2935837841 | Bacteria | 9454360 |
| 1683 | 2935852671 | 2935847175 | Bacteria | 8228321 |
| 1684 | 2935858738 | 2935855204 | Bacteria | 9035059 |
| 1685 | 2935866840 | 2935864058 | Bacteria | 9784707 |
| 1686 | 2935876971 | 2935873716 | Bacteria | 9632195 |
| 1687 | 2935884026 | 2935883170 | Bacteria | 7964738 |
| 1688 | 2935912178 | 2935908558 | Bacteria | 8568796 |
| 1689 | 2935922391 | 2935916978 | Bacteria | 9113783 |
| 1690 | 2935929207 | 2935926038 | Bacteria | 8601059 |
| 1691 | 2935935838 | 2935934488 | Bacteria | 8602579 |
| 1692 | 2935947404 | 2935942939 | Bacteria | 8599779 |
| 1693 | 2935953501 | 2935951376 | Bacteria | 8602333 |
| 1694 | 2935961985 | 2935959822 | Bacteria | 7869783 |
| 1695 | 2935968527 | 2935967501 | Bacteria | 8603075 |
| 1696 | 2935976711 | 2935975950 | Bacteria | 8347125 |
| 1697 | 2935990666 | 2935984226 | Bacteria | 8302647 |
| 1698 | 2935993390 | 2935992306 | Bacteria | 9802711 |
| 1699 | 2936004285 | 2936002035 | Bacteria | 9362176 |
| 1700 | 2936015431 | 2936011229 | Bacteria | 8801034 |
| 1701 | 2936024065 | 2936019824 | Bacteria | 8804134 |
| 1702 | 2936033080 | 2936028420 | Bacteria | 8965941 |
| 1703 | 2936038205 | 2936037263 | Bacteria | 9446081 |
| 1704 | 2936051173 | 2936046547 | Bacteria | 8903709 |
| 1705 | 2936058551 | 2936055302 | Bacteria | 8785755 |
| 1706 | 2940561447 | 2940556831 | Bacteria | 9590747 |
| 1707 | 2941508196 | 2941507105 | Bacteria | 8166816 |
| 1708 | 2941515298 | 2941515067 | Bacteria | 8166720 |
| 1709 | 2941524126 | 2941523033 | Bacteria | 8169134 |
| 1710 | 2941533638 | 2941531003 | Bacteria | 7653939 |
| 1711 | 2941544627 | 2941538514 | Bacteria | 9402094 |
| 1712 | 3005477531 | 3005474847 | Bacteria | 9259049 |
| 1713 | 3005489778 | 3005483717 | Bacteria | 7877331 |
| 1714 | 3005507072 | 3005506211 | Bacteria | 6943378 |
| 1715 | 3005593033 | 3005587118 | Bacteria | 7794411 |
| 1716 | 3005596486 | 3005594810 | Bacteria | 8716512 |
| 1717 | 3005712555 | 3005710791 | Bacteria | 7622528 |
| 1718 | 3005719615 | 3005718088 | Bacteria | 8283608 |
| 1719 | 8006966581 | 8006964411 | Bacteria | 8966052 |
| 1720 | 8006989427 | 8006984368 | Bacteria | 9651211 |
| 1721 | 8006997896 | 8006994254 | Bacteria | 8309700 |
| 1722 | 8016516500 | 8016511872 | Bacteria | 9921665 |
| 1723 | 8016523911 | 8016522445 | Bacteria | 8156687 |
| 1724 | 8016537440 | 8016530956 | Bacteria | 8155261 |
| 1725 | 8016541712 | 8016539877 | Bacteria | 8155419 |
| 1726 | 8016551561 | 8016548790 | Bacteria | 8155074 |
| 1727 | 8016559942 | 8016557553 | Bacteria | 8154380 |
| 1728 | 8016567097 | 8016566248 | Bacteria | 8158151 |
| 1729 | 8016579815 | 8016575299 | Bacteria | 8154085 |
| 1730 | 8016589066 | 8016583857 | Bacteria | 10421953 |
| 1731 | 8016597874 | 8016595262 | Bacteria | 8149947 |
| 1732 | 8016604012 | 8016603502 | Bacteria | 8731218 |
| 1733 | 8016620595 | 8016613128 | Bacteria | 8794220 |
| 1734 | 8016629399 | 8016622563 | Bacteria | 7999408 |
| 1735 | 8016633911 | 8016630954 | Bacteria | 9217207 |
| 1736 | 8017060039 | 8017057580 | Bacteria | 10023680 |
| 1737 | 8019537125 | 8019530166 | Bacteria | 8155624 |
| 1738 | 8019542423 | 8019538911 | Bacteria | 7872763 |
| 1739 | 8019548337 | 8019547302 | Bacteria | 7996444 |
| 1740 | 8019559635 | 8019555841 | Bacteria | 9642137 |
| 1741 | 8019569742 | 8019565922 | Bacteria | 9639779 |
| 1742 | 8019579543 | 8019576017 | Bacteria | 10049540 |
| 1743 | 8019587254 | 8019586578 | Bacteria | 10212056 |
| 1744 | 8019604085 | 8019597564 | Bacteria | 10041141 |
| 1745 | 8019614445 | 8019608314 | Bacteria | 10042931 |
| 1746 | 8019625074 | 8019619141 | Bacteria | 9218857 |
| 1747 | 8019637107 | 8019629233 | Bacteria | 8687553 |
| 1748 | 8019642494 | 8019638758 | Bacteria | 9062356 |
| 1749 | 8019650085 | 8019648815 | Bacteria | 10014479 |
| 1750 | 8019664974 | 8019659431 | Bacteria | 8577854 |
| 1751 | 8019674510 | 8019668869 | Bacteria | 8791617 |
| 1752 | 8019681594 | 8019678201 | Bacteria | 8863603 |
| 1753 | 8019694180 | 8019687851 | Bacteria | 8712826 |
| 1754 | 8055749223 | 8055742211 | Bacteria | 9226248 |
| 1755 | 8056674927 | 8056673599 | Bacteria | 7871253 |
| 1756 | 8056695227 | 8056689827 | Bacteria | 6712655 |
| 1757 | 8056969657 | 8056967851 | Bacteria | 9038162 |
| 1758 | Ga0501031_0109985 | |||
| 1759 | JGI24741J21665_1039409 | |||
| 1760 | JGI24740J21852_10003892 | |||
| 1761 | JGI24737J22298_10064718 | |||
| 1762 | JGI24735J21928_10060318 | |||
| 1763 | JGI24738J21930_10096861 | |||
| 1764 | JGI24742J22300_10027093 | |||
| 1765 | JGI25165J46597_1029680 | |||
| 1766 | JGI25165J46597_1040290 | |||
| 1767 | JGI25153J46596_10013493 | |||
| 1768 | JGI25153J46596_10014078 | |||
| 1769 | JGI25153J46596_10070966 | |||
| 1770 | JGI25160J50197_1003238 | |||
| 1771 | JGI25160J50197_1020072 | |||
| 1772 | JGI25404J52841_10003406 | |||
| 1773 | JGI25404J52841_10026407 | |||
| 1774 | Ga0055525_1009691 | |||
| 1775 | Ga0055542_1005917 | |||
| 1776 | Ga0055529_1037036 | |||
| 1777 | Ga0055526_1094550 | |||
| 1778 | Ga0055524_1051419 | |||
| 1779 | Ga0055531_10033850 | |||
| 1780 | Ga0055543_1002483 | |||
| 1781 | Ga0055543_1017973 | |||
| 1782 | Ga0065165_1000866 | |||
| 1783 | Ga0065165_1010304 | |||
| 1784 | Ga0065165_1011062 | |||
| 1785 | Ga0065165_1022843 | |||
| 1786 | Ga0065165_1023762 | |||
| 1787 | Ga0065165_1126985 | |||
| 1788 | Ga0070658_10204771 | |||
| 1789 | Ga0070658_10221713 | |||
| 1790 | Ga0070658_10570579 | |||
| 1791 | Ga0070683_100080343 | |||
| 1792 | Ga0070683_100574399 | |||
| 1793 | Ga0070683_100591401 | |||
| 1794 | Ga0070690_100402238 | |||
| 1795 | Ga0070670_101356060 | |||
| 1796 | Ga0068869_100334072 | |||
| 1797 | Ga0068869_101316200 | |||
| 1798 | Ga0070666_11089069 | |||
| 1799 | Ga0070680_100184081 | |||
| 1800 | Ga0070680_100323344 | |||
| 1801 | Ga0070682_100022257 | |||
| 1802 | Ga0070682_100065301 | |||
| 1803 | Ga0070682_100719122 | |||
| 1804 | Ga0070682_101008069 | |||
| 1805 | Ga0070682_101723733 | |||
| 1806 | Ga0068868_100678638 | |||
| 1807 | Ga0070660_100674651 | |||
| 1808 | Ga0070660_100757012 | |||
| 1809 | Ga0070660_101065446 | |||
| 1810 | Ga0070689_100243712 | |||
| 1811 | Ga0070689_100626786 | |||
| 1812 | Ga0070691_10344385 | |||
| 1813 | Ga0070687_101146268 | |||
| 1814 | Ga0070661_101425714 | |||
| 1815 | Ga0070668_100027110 | |||
| 1816 | Ga0070668_100103345 | |||
| 1817 | Ga0070668_100225475 | |||
| 1818 | Ga0070668_100676450 | |||
| 1819 | Ga0070668_100709753 | |||
| 1820 | Ga0070668_101156388 | |||
| 1821 | Ga0070668_101213991 | |||
| 1822 | Ga0070668_101326768 | |||
| 1823 | Ga0070669_100641980 | |||
| 1824 | Ga0070669_101570086 | |||
| 1825 | Ga0070675_100268798 | |||
| 1826 | Ga0070675_101532882 | |||
| 1827 | Ga0070671_101027901 | |||
| 1828 | Ga0070671_101369625 | |||
| 1829 | Ga0070671_101379069 | |||
| 1830 | Ga0070674_100036028 | |||
| 1831 | Ga0070673_100380173 | |||
| 1832 | Ga0070673_100717943 | |||
| 1833 | Ga0070673_101548483 | |||
| 1834 | Ga0070673_101603820 | |||
| 1835 | Ga0070688_100549144 | |||
| 1836 | Ga0070659_100633869 | |||
| 1837 | Ga0070667_100523159 | |||
| 1838 | Ga0070667_101912606 | |||
| 1839 | Ga0070709_10017774 | |||
| 1840 | Ga0070709_10861234 | |||
| 1841 | Ga0070709_10985969 | |||
| 1842 | Ga0070714_100002475 | |||
| 1843 | Ga0070714_100058996 | |||
| 1844 | Ga0070714_100066539 | |||
| 1845 | Ga0070714_100937885 | |||
| 1846 | Ga0070713_100016516 | |||
| 1847 | Ga0070713_100034524 | |||
| 1848 | Ga0070713_100533926 | |||
| 1849 | Ga0070710_10003075 | |||
| 1850 | Ga0070710_10030941 | |||
| 1851 | Ga0070710_11332738 | |||
| 1852 | Ga0070701_10110115 | |||
| 1853 | Ga0070711_100006263 | |||
| 1854 | Ga0070711_100022019 | |||
| 1855 | Ga0070711_100150274 | |||
| 1856 | Ga0070711_101083321 | |||
| 1857 | Ga0070711_101998848 | |||
| 1858 | Ga0070705_100306555 | |||
| 1859 | Ga0070705_100348583 | |||
| 1860 | Ga0070700_100051471 | |||
| 1861 | Ga0070700_101581133 | |||
| 1862 | Ga0070663_100059209 | |||
| 1863 | Ga0070663_100059935 | |||
| 1864 | Ga0070663_100241130 | |||
| 1865 | Ga0070663_100372867 | |||
| 1866 | Ga0070663_100409223 | |||
| 1867 | Ga0070663_100419178 | |||
| 1868 | Ga0070663_100702748 | |||
| 1869 | Ga0070663_101534964 | |||
| 1870 | Ga0070678_100170830 | |||
| 1871 | Ga0070678_100713201 | |||
| 1872 | Ga0070678_100869356 | |||
| 1873 | Ga0070678_101804424 | |||
| 1874 | Ga0070662_100126386 | |||
| 1875 | Ga0070662_100322160 | |||
| 1876 | Ga0070681_10084335 | |||
| 1877 | Ga0070681_10096897 | |||
| 1878 | Ga0070681_10262844 | |||
| 1879 | Ga0070681_10660549 | |||
| 1880 | Ga0070681_10747395 | |||
| 1881 | Ga0070681_11441717 | |||
| 1882 | Ga0068867_100233906 | |||
| 1883 | Ga0068867_101855550 | |||
| 1884 | Ga0070685_11182605 | |||
| 1885 | Ga0070706_100116094 | |||
| 1886 | Ga0070706_100317605 | |||
| 1887 | Ga0070707_101459110 | |||
| 1888 | Ga0070698_100476302 | |||
| 1889 | Ga0070699_100771608 | |||
| 1890 | Ga0070679_100087318 | |||
| 1891 | Ga0070679_100126650 | |||
| 1892 | Ga0070679_100200770 | |||
| 1893 | Ga0070679_100579527 | |||
| 1894 | Ga0070679_100669564 | |||
| 1895 | Ga0070684_100212950 | |||
| 1896 | Ga0070684_100237885 | |||
| 1897 | Ga0070684_100674972 | |||
| 1898 | Ga0070684_100747921 | |||
| 1899 | Ga0070684_101231826 | |||
| 1900 | Ga0070684_101786378 | |||
| 1901 | Ga0070697_101686728 | |||
| 1902 | Ga0068853_100015392 | |||
| 1903 | Ga0068853_100302927 | |||
| 1904 | Ga0068853_101019774 | |||
| 1905 | Ga0068853_101174988 | |||
| 1906 | Ga0068853_101311547 | |||
| 1907 | Ga0068853_101755410 | |||
| 1908 | Ga0068853_102313219 | |||
| 1909 | Ga0070672_100790270 | |||
| 1910 | Ga0070695_101447313 | |||
| 1911 | Ga0070693_100570730 | |||
| 1912 | Ga0070693_101027490 | |||
| 1913 | Ga0070693_101531489 | |||
| 1914 | Ga0070665_100092371 | |||
| 1915 | Ga0070665_100127107 | |||
| 1916 | Ga0070665_100330442 | |||
| 1917 | Ga0070665_101208911 | |||
| 1918 | Ga0070665_101529383 | |||
| 1919 | Ga0070704_101578851 | |||
| 1920 | Ga0068855_100008396 | |||
| 1921 | Ga0068855_100124660 | |||
| 1922 | Ga0068855_100384532 | |||
| 1923 | Ga0068855_100649624 | |||
| 1924 | Ga0068855_100653885 | |||
| 1925 | Ga0068855_100789492 | |||
| 1926 | Ga0068855_100981151 | |||
| 1927 | Ga0068855_101141820 | |||
| 1928 | Ga0068855_101451879 | |||
| 1929 | Ga0068855_101912426 | |||
| 1930 | Ga0070664_100736471 | |||
| 1931 | Ga0070664_101654769 | |||
| 1932 | Ga0070664_101954281 | |||
| 1933 | Ga0068857_100073217 | |||
| 1934 | Ga0068857_100556865 | |||
| 1935 | Ga0068857_100897611 | |||
| 1936 | Ga0068854_100019162 | |||
| 1937 | Ga0068854_100099336 | |||
| 1938 | Ga0068854_100699635 | |||
| 1939 | Ga0068854_100720306 | |||
| 1940 | Ga0068856_100000434 | |||
| 1941 | Ga0068856_100005400 | |||
| 1942 | Ga0068856_100061916 | |||
| 1943 | Ga0068856_100743754 | |||
| 1944 | Ga0068856_101057347 | |||
| 1945 | Ga0068856_101189174 | |||
| 1946 | Ga0068856_101318671 | |||
| 1947 | Ga0068856_102443135 | |||
| 1948 | Ga0070702_100249335 | |||
| 1949 | Ga0070702_100634662 | |||
| 1950 | Ga0068852_100132591 | |||
| 1951 | Ga0068852_100527483 | |||
| 1952 | Ga0068852_100789814 | |||
| 1953 | Ga0068852_100805237 | |||
| 1954 | Ga0068852_101325965 | |||
| 1955 | Ga0068852_102771576 | |||
| 1956 | Ga0068859_100267086 | |||
| 1957 | Ga0068859_100771897 | |||
| 1958 | Ga0068859_101278078 | |||
| 1959 | Ga0068859_101337940 | |||
| 1960 | Ga0068864_100044659 | |||
| 1961 | Ga0068864_101146526 | |||
| 1962 | Ga0068864_101589712 | |||
| 1963 | Ga0068864_101986355 | |||
| 1964 | Ga0068866_10098727 | |||
| 1965 | Ga0068861_100121270 | |||
| 1966 | Ga0068861_100416119 | |||
| 1967 | Ga0068861_100952346 | |||
| 1968 | Ga0068861_102615341 | |||
| 1969 | Ga0068851_10481872 | |||
| 1970 | Ga0068851_10529726 | |||
| 1971 | Ga0068851_10626367 | |||
| 1972 | Ga0068851_10646483 | |||
| 1973 | Ga0068870_11344868 | |||
| 1974 | Ga0068863_101910023 | |||
| 1975 | Ga0068858_100352559 | |||
| 1976 | Ga0068858_100352925 | |||
| 1977 | Ga0068858_100457297 | |||
| 1978 | Ga0068858_101916626 | |||
| 1979 | Ga0068860_100094368 | |||
| 1980 | Ga0068860_100181953 | |||
| 1981 | Ga0068860_100516941 | |||
| 1982 | Ga0068860_100582840 | |||
| 1983 | Ga0068860_101744102 | |||
| 1984 | Ga0068860_102133163 | |||
| 1985 | Ga0068860_102796618 | |||
| 1986 | Ga0068862_100464415 | |||
| 1987 | Ga0068862_100750303 | |||
| 1988 | Ga0068862_100783975 | |||
| 1989 | Ga0068862_100947776 | |||
| 1990 | Ga0068862_100983825 | |||
| 1991 | Ga0068862_101693133 | |||
| 1992 | Ga0068862_102234268 | |||
| 1993 | Ga0068862_102504649 | |||
| 1994 | Ga0081455_10062610 | |||
| 1995 | Ga0081455_10071493 | |||
| 1996 | Ga0081540_1001986 | |||
| 1997 | Ga0081540_1010395 | |||
| 1998 | Ga0081540_1011052 | |||
| 1999 | Ga0081540_1016453 | |||
| 2000 | Ga0081540_1023463 | |||
| 2001 | Ga0081540_1041957 | |||
| 2002 | Ga0081540_1071971 | |||
| 2003 | Ga0081540_1092814 | |||
| 2004 | Ga0081540_1145351 | |||
| 2005 | Ga0081539_10013759 | |||
| 2006 | Ga0081539_10396844 | |||
| 2007 | Ga0070717_10065842 | |||
| 2008 | Ga0075365_10097363 | |||
| 2009 | Ga0075365_10107287 | |||
| 2010 | Ga0075365_11345418 | |||
| 2011 | Ga0075368_10056260 | |||
| 2012 | Ga0075368_10092443 | |||
| 2013 | Ga0075368_10274453 | |||
| 2014 | Ga0075363_101062091 | |||
| 2015 | Ga0075364_10190920 | |||
| 2016 | Ga0075364_10468852 | |||
| 2017 | Ga0075364_10936206 | |||
| 2018 | Ga0075432_10492276 | |||
| 2019 | Ga0070715_10043512 | |||
| 2020 | Ga0070715_10295213 | |||
| 2021 | Ga0070716_100016118 | |||
| 2022 | Ga0070716_100185644 | |||
| 2023 | Ga0070716_101275788 | |||
| 2024 | Ga0070712_100050760 | |||
| 2025 | Ga0070712_100575869 | |||
| 2026 | Ga0070712_101135649 | |||
| 2027 | Ga0075362_10059567 | |||
| 2028 | Ga0075362_10598861 | |||
| 2029 | Ga0075367_10148611 | |||
| 2030 | Ga0075367_10312304 | |||
| 2031 | Ga0075367_10740338 | |||
| 2032 | Ga0075367_11122976 | |||
| 2033 | Ga0075369_10146678 | |||
| 2034 | Ga0075369_10186348 | |||
| 2035 | Ga0075369_10300467 | |||
| 2036 | Ga0075369_10319411 | |||
| 2037 | Ga0075369_10540560 | |||
| 2038 | Ga0075366_10005462 | |||
| 2039 | Ga0097621_101499515 | |||
| 2040 | Ga0097621_102125256 | |||
| 2041 | Ga0097621_102135595 | |||
| 2042 | Ga0075370_10073378 | |||
| 2043 | Ga0075370_10228233 | |||
| 2044 | Ga0075370_10628003 | |||
| 2045 | Ga0068871_100145881 | |||
| 2046 | Ga0068871_101527357 | |||
| 2047 | Ga0075428_101200724 | |||
| 2048 | Ga0075430_101764075 | |||
| 2049 | Ga0075431_101584803 | |||
| 2050 | Ga0075434_100234820 | |||
| 2051 | Ga0068865_100872936 | |||
| 2052 | Ga0068865_101162736 | |||
| 2053 | Ga0068865_102066046 | |||
| 2054 | Ga0097620_100267064 | |||
| 2055 | Ga0097620_100771877 | |||
| 2056 | Ga0097620_101277975 | |||
| 2057 | Ga0097620_101337906 | |||
| 2058 | Ga0099823_1027763 | |||
| 2059 | Ga0099794_10638545 | |||
| 2060 | Ga0105251_10116124 | |||
| 2061 | Ga0105240_10020447 | |||
| 2062 | Ga0105240_10032668 | |||
| 2063 | Ga0105240_10067994 | |||
| 2064 | Ga0105240_10123204 | |||
| 2065 | Ga0105240_11384214 | |||
| 2066 | Ga0111539_10214088 | |||
| 2067 | Ga0105245_10031801 | |||
| 2068 | Ga0105245_10315878 | |||
| 2069 | Ga0105245_10626271 | |||
| 2070 | Ga0105245_10795918 | |||
| 2071 | Ga0105245_12480324 | |||
| 2072 | Ga0105247_10066555 | |||
| 2073 | Ga0105247_10118677 | |||
| 2074 | Ga0105247_10330792 | |||
| 2075 | Ga0105247_10409673 | |||
| 2076 | Ga0114129_10476531 | |||
| 2077 | Ga0105243_10031732 | |||
| 2078 | Ga0105243_10097091 | |||
| 2079 | Ga0105243_10708020 | |||
| 2080 | Ga0105243_10912673 | |||
| 2081 | Ga0105243_11491850 | |||
| 2082 | Ga0105243_11803389 | |||
| 2083 | Ga0105241_10051103 | |||
| 2084 | Ga0105241_10141894 | |||
| 2085 | Ga0105241_10191140 | |||
| 2086 | Ga0105241_10257250 | |||
| 2087 | Ga0105241_10422692 | |||
| 2088 | Ga0105241_11075203 | |||
| 2089 | Ga0105241_11303280 | |||
| 2090 | Ga0105241_11444864 | |||
| 2091 | Ga0105242_10405686 | |||
| 2092 | Ga0105242_10911093 | |||
| 2093 | Ga0105248_10495852 | |||
| 2094 | Ga0105248_10704512 | |||
| 2095 | Ga0105248_11416245 | |||
| 2096 | Ga0105248_12942386 | |||
| 2097 | Ga0105237_10068396 | |||
| 2098 | Ga0105237_10202106 | |||
| 2099 | Ga0105237_10349957 | |||
| 2100 | Ga0105237_10739361 | |||
| 2101 | Ga0105237_11679668 | |||
| 2102 | Ga0105237_11971455 | |||
| 2103 | Ga0105237_12139234 | |||
| 2104 | Ga0105237_12358215 | |||
| 2105 | Ga0105238_10069444 | |||
| 2106 | Ga0105238_10076960 | |||
| 2107 | Ga0105238_10678338 | |||
| 2108 | Ga0105238_10885517 | |||
| 2109 | Ga0105238_11797443 | |||
| 2110 | Ga0105238_12228493 | |||
| 2111 | Ga0105238_12447305 | |||
| 2112 | Ga0105238_12489346 | |||
| 2113 | Ga0105249_10143905 | |||
| 2114 | Ga0105249_10707366 | |||
| 2115 | Ga0105249_11300009 | |||
| 2116 | Ga0105249_11762875 | |||
| 2117 | Ga0105249_12482901 | |||
| 2118 | Ga0105239_10136576 | |||
| 2119 | Ga0105239_10252645 | |||
| 2120 | Ga0105239_10295488 | |||
| 2121 | Ga0105239_10467899 | |||
| 2122 | Ga0105239_10910537 | |||
| 2123 | Ga0105239_11114301 | |||
| 2124 | Ga0105239_11254122 | |||
| 2125 | Ga0105239_11813511 | |||
| 2126 | Ga0105239_12687794 | |||
| 2127 | Ga0105239_12819868 | |||
| 2128 | Ga0105246_10114181 | |||
| 2129 | Ga0105246_10218354 | |||
| 2130 | Ga0105246_10872372 | |||
| 2131 | Ga0105246_11483025 | |||
| 2132 | Ga0157339_1034756 | |||
| 2133 | Ga0157373_11425573 | |||
| 2134 | Ga0157371_10348472 | |||
| 2135 | Ga0157371_11320995 | |||
| 2136 | Ga0157370_10090911 | |||
| 2137 | Ga0157370_10140430 | |||
| 2138 | Ga0157370_10401657 | |||
| 2139 | Ga0157370_11166473 | |||
| 2140 | Ga0157370_11663209 | |||
| 2141 | Ga0157370_11918328 | |||
| 2142 | Ga0157369_10048658 | |||
| 2143 | Ga0157369_10118638 | |||
| 2144 | Ga0157369_10185391 | |||
| 2145 | Ga0157369_11543996 | |||
| 2146 | Ga0157369_12228347 | |||
| 2147 | Ga0157374_10529953 | |||
| 2148 | Ga0157374_10749612 | |||
| 2149 | Ga0157374_11375641 | |||
| 2150 | Ga0157374_12321793 | |||
| 2151 | Ga0157378_10014728 | |||
| 2152 | Ga0157378_10491703 | |||
| 2153 | Ga0157378_11221061 | |||
| 2154 | Ga0157378_11528315 | |||
| 2155 | Ga0157378_12182810 | |||
| 2156 | Ga0157378_13165040 | |||
| 2157 | Ga0163162_10291076 | |||
| 2158 | Ga0163162_10460734 | |||
| 2159 | Ga0163162_10770747 | |||
| 2160 | Ga0163162_11033690 | |||
| 2161 | Ga0157372_10202040 | |||
| 2162 | Ga0157372_10595679 | |||
| 2163 | Ga0157372_12152679 | |||
| 2164 | Ga0157372_12222735 | |||
| 2165 | Ga0157375_10304167 | |||
| 2166 | Ga0157375_10488402 | |||
| 2167 | Ga0157375_10518059 | |||
| 2168 | Ga0157375_11551865 | |||
| 2169 | Ga0157375_12717917 | |||
| 2170 | Ga0163163_10012414 | |||
| 2171 | Ga0163163_10117591 | |||
| 2172 | Ga0163163_10376207 | |||
| 2173 | Ga0163163_10552941 | |||
| 2174 | Ga0163163_11405763 | |||
| 2175 | Ga0163163_12015612 | |||
| 2176 | Ga0157380_10238260 | |||
| 2177 | Ga0157380_10257963 | |||
| 2178 | Ga0157380_12748899 | |||
| 2179 | Ga0182008_10229719 | |||
| 2180 | Ga0182008_10421868 | |||
| 2181 | Ga0157377_10160804 | |||
| 2182 | Ga0157377_10285293 | |||
| 2183 | Ga0157379_10265737 | |||
| 2184 | Ga0157379_10537004 | |||
| 2185 | Ga0157379_11006002 | |||
| 2186 | Ga0157379_12175361 | |||
| 2187 | Ga0157376_10183873 | |||
| 2188 | Ga0157376_10330872 | |||
| 2189 | Ga0157376_10513130 | |||
| 2190 | Ga0157376_10709027 | |||
| 2191 | Ga0157376_12077369 | |||
| 2192 | Ga0157376_12209839 | |||
| 2193 | Ga0157376_12931498 | |||
| 2194 | Ga0182007_10325147 | |||
| 2195 | Ga0163161_10137351 | |||
| 2196 | Ga0163161_10352321 | |||
| 2197 | Ga0163161_11299496 | |||
| 2198 | Ga0206356_10486896 | |||
| 2199 | Ga0206349_1412442 | |||
| 2200 | Ga0206351_10094307 | |||
| 2201 | Ga0206353_11896996 | |||
| 2202 | Ga0206353_12028210 | |||
| 2203 | Ga0214542_1022513 | |||
| 2204 | Ga0214545_1013953 | |||
| 2205 | Ga0213873_10014380 | |||
| 2206 | Ga0213874_10007250 | |||
| 2207 | Ga0213874_10237960 | |||
| 2208 | Ga0213874_10291617 | |||
| 2209 | Ga0213876_10001341 | |||
| 2210 | Ga0213876_10622122 | |||
| 2211 | Ga0213871_10006629 | |||
| 2212 | Ga0213871_10027378 | |||
| 2213 | Ga0213871_10043318 | |||
| 2214 | Ga0224712_10002831 | |||
| 2215 | Ga0224712_10191098 | |||
| 2216 | Ga0224712_10556904 | |||
| 2217 | Ga0224575_103157 | |||
| 2218 | Ga0228598_1067208 | |||
| 2219 | Ga0209563_109801 | |||
| 2220 | Ga0209677_101244 | |||
| 2221 | Ga0209677_120171 | |||
| 2222 | Ga0209148_1000253 | |||
| 2223 | Ga0209233_1001970 | |||
| 2224 | Ga0209233_1009212 | |||
| 2225 | Ga0209233_1015628 | |||
| 2226 | Ga0209233_1020333 | |||
| 2227 | Ga0209233_1032320 | |||
| 2228 | Ga0209233_1033133 | |||
| 2229 | Ga0209455_1005205 | |||
| 2230 | Ga0209455_1016606 | |||
| 2231 | Ga0209673_1073918 | |||
| 2232 | Ga0209564_1011001 | |||
| 2233 | Ga0209564_1035938 | |||
| 2234 | Ga0209564_1072669 | |||
| 2235 | Ga0209758_1000026 | |||
| 2236 | Ga0209758_1000318 | |||
| 2237 | Ga0209758_1001679 | |||
| 2238 | Ga0209758_1002424 | |||
| 2239 | Ga0209758_1003005 | |||
| 2240 | Ga0209758_1012954 | |||
| 2241 | Ga0209758_1040472 | |||
| 2242 | Ga0209758_1055859 | |||
| 2243 | Ga0209758_1085245 | |||
| 2244 | Ga0209758_1097908 | |||
| 2245 | Ga0209256_1013879 | |||
| 2246 | Ga0209256_1048828 | |||
| 2247 | Ga0207426_1000425 | |||
| 2248 | Ga0207426_1001506 | |||
| 2249 | Ga0207426_1019633 | |||
| 2250 | Ga0207426_1023817 | |||
| 2251 | Ga0207426_1047970 | |||
| 2252 | Ga0207426_1066358 | |||
| 2253 | Ga0207426_1130684 | |||
| 2254 | Ga0209257_1002846 | |||
| 2255 | Ga0207697_10067874 | |||
| 2256 | Ga0207697_10269782 | |||
| 2257 | Ga0207656_10049075 | |||
| 2258 | Ga0207656_10267790 | |||
| 2259 | Ga0207656_10699567 | |||
| 2260 | Ga0207696_1173139 | |||
| 2261 | Ga0207692_10000488 | |||
| 2262 | Ga0207692_10004266 | |||
| 2263 | Ga0207692_10620122 | |||
| 2264 | Ga0207642_10058752 | |||
| 2265 | Ga0207642_11101738 | |||
| 2266 | Ga0207710_10113669 | |||
| 2267 | Ga0207710_10126255 | |||
| 2268 | Ga0207710_10261894 | |||
| 2269 | Ga0207688_10104624 | |||
| 2270 | Ga0207688_10114482 | |||
| 2271 | Ga0207688_10154387 | |||
| 2272 | Ga0207688_10269127 | |||
| 2273 | Ga0207688_10484299 | |||
| 2274 | Ga0207688_10656004 | |||
| 2275 | Ga0207680_10343403 | |||
| 2276 | Ga0207680_10979788 | |||
| 2277 | Ga0207647_10163198 | |||
| 2278 | Ga0207647_10169812 | |||
| 2279 | Ga0207647_10330416 | |||
| 2280 | Ga0207647_10592334 | |||
| 2281 | Ga0207685_10004113 | |||
| 2282 | Ga0207685_10016129 | |||
| 2283 | Ga0207685_10199438 | |||
| 2284 | Ga0207685_10652935 | |||
| 2285 | Ga0207699_10001075 | |||
| 2286 | Ga0207699_10003139 | |||
| 2287 | Ga0207699_10030662 | |||
| 2288 | Ga0207699_10302086 | |||
| 2289 | Ga0207645_10335603 | |||
| 2290 | Ga0207645_10877704 | |||
| 2291 | Ga0207643_10076892 | |||
| 2292 | Ga0207705_10207299 | |||
| 2293 | Ga0207705_10410217 | |||
| 2294 | Ga0207684_10131596 | |||
| 2295 | Ga0207684_10201683 | |||
| 2296 | Ga0207654_10000069 | |||
| 2297 | Ga0207654_10049050 | |||
| 2298 | Ga0207654_10125513 | |||
| 2299 | Ga0207654_10387742 | |||
| 2300 | Ga0207654_10553072 | |||
| 2301 | Ga0207707_10001008 | |||
| 2302 | Ga0207707_10076991 | |||
| 2303 | Ga0207707_10171584 | |||
| 2304 | Ga0207707_10451508 | |||
| 2305 | Ga0207707_10482075 | |||
| 2306 | Ga0207695_10000634 | |||
| 2307 | Ga0207695_10000713 | |||
| 2308 | Ga0207695_10134863 | |||
| 2309 | Ga0207695_10250227 | |||
| 2310 | Ga0207671_10026824 | |||
| 2311 | Ga0207671_10077083 | |||
| 2312 | Ga0207671_10172829 | |||
| 2313 | Ga0207671_10187483 | |||
| 2314 | Ga0207671_10255812 | |||
| 2315 | Ga0207671_10443630 | |||
| 2316 | Ga0207671_10736072 | |||
| 2317 | Ga0207671_10865203 | |||
| 2318 | Ga0207671_11241561 | |||
| 2319 | Ga0207693_10011789 | |||
| 2320 | Ga0207693_10061410 | |||
| 2321 | Ga0207693_10243103 | |||
| 2322 | Ga0207693_10402422 | |||
| 2323 | Ga0207693_11063703 | |||
| 2324 | Ga0207663_10000176 | |||
| 2325 | Ga0207663_10006929 | |||
| 2326 | Ga0207663_10029467 | |||
| 2327 | Ga0207662_10128088 | |||
| 2328 | Ga0207662_10520782 | |||
| 2329 | Ga0207657_10196812 | |||
| 2330 | Ga0207657_10769229 | |||
| 2331 | Ga0207657_11031825 | |||
| 2332 | Ga0207649_10316811 | |||
| 2333 | Ga0207649_11197226 | |||
| 2334 | Ga0207649_11210314 | |||
| 2335 | Ga0207649_11574737 | |||
| 2336 | Ga0207652_10140370 | |||
| 2337 | Ga0207652_10223057 | |||
| 2338 | Ga0207652_10364529 | |||
| 2339 | Ga0207652_10892897 | |||
| 2340 | Ga0207646_11354399 | |||
| 2341 | Ga0207681_10806142 | |||
| 2342 | Ga0207681_10891447 | |||
| 2343 | Ga0207681_10990638 | |||
| 2344 | Ga0207694_10000155 | |||
| 2345 | Ga0207694_10231438 | |||
| 2346 | Ga0207694_10260097 | |||
| 2347 | Ga0207694_10474368 | |||
| 2348 | Ga0207694_10980962 | |||
| 2349 | Ga0207694_11835372 | |||
| 2350 | Ga0207650_10223213 | |||
| 2351 | Ga0207659_11442012 | |||
| 2352 | Ga0207687_10167142 | |||
| 2353 | Ga0207687_10180178 | |||
| 2354 | Ga0207687_11454019 | |||
| 2355 | Ga0207700_10012901 | |||
| 2356 | Ga0207700_10022426 | |||
| 2357 | Ga0207700_10045905 | |||
| 2358 | Ga0207700_10183378 | |||
| 2359 | Ga0207664_10070672 | |||
| 2360 | Ga0207664_10140833 | |||
| 2361 | Ga0207664_10226807 | |||
| 2362 | Ga0207664_11867614 | |||
| 2363 | Ga0207644_11213206 | |||
| 2364 | Ga0207690_10230733 | |||
| 2365 | Ga0207690_10398681 | |||
| 2366 | Ga0207690_10561633 | |||
| 2367 | Ga0207690_10848689 | |||
| 2368 | Ga0207706_10207834 | |||
| 2369 | Ga0207706_10220011 | |||
| 2370 | Ga0207706_10464841 | |||
| 2371 | Ga0207706_10467450 | |||
| 2372 | Ga0207686_10125545 | |||
| 2373 | Ga0207686_11003370 | |||
| 2374 | Ga0207686_11106996 | |||
| 2375 | Ga0207709_10033563 | |||
| 2376 | Ga0207709_10114819 | |||
| 2377 | Ga0207709_10838008 | |||
| 2378 | Ga0207670_10226453 | |||
| 2379 | Ga0207670_10245647 | |||
| 2380 | Ga0207669_10017298 | |||
| 2381 | Ga0207669_11146030 | |||
| 2382 | Ga0207669_11264936 | |||
| 2383 | Ga0207669_11556613 | |||
| 2384 | Ga0207704_10623632 | |||
| 2385 | Ga0207704_11383112 | |||
| 2386 | Ga0207665_10018204 | |||
| 2387 | Ga0207665_10022725 | |||
| 2388 | Ga0207665_11188231 | |||
| 2389 | Ga0207665_11300700 | |||
| 2390 | Ga0207691_10753754 | |||
| 2391 | Ga0207691_11601429 | |||
| 2392 | Ga0207711_10678197 | |||
| 2393 | Ga0207711_11520831 | |||
| 2394 | Ga0207689_10142627 | |||
| 2395 | Ga0207689_10199718 | |||
| 2396 | Ga0207689_10264167 | |||
| 2397 | Ga0207689_10431518 | |||
| 2398 | Ga0207661_10114303 | |||
| 2399 | Ga0207661_10774099 | |||
| 2400 | Ga0207661_10839094 | |||
| 2401 | Ga0207679_10146728 | |||
| 2402 | Ga0207679_10457724 | |||
| 2403 | Ga0207679_11439960 | |||
| 2404 | Ga0207667_10045630 | |||
| 2405 | Ga0207667_10142283 | |||
| 2406 | Ga0207667_10260251 | |||
| 2407 | Ga0207667_10280445 | |||
| 2408 | Ga0207667_10558203 | |||
| 2409 | Ga0207667_10842939 | |||
| 2410 | Ga0207667_10968386 | |||
| 2411 | Ga0207667_11094169 | |||
| 2412 | Ga0207667_11108821 | |||
| 2413 | Ga0207667_11284919 | |||
| 2414 | Ga0207667_11466417 | |||
| 2415 | Ga0207651_10322380 | |||
| 2416 | Ga0207651_11257891 | |||
| 2417 | Ga0207712_10126263 | |||
| 2418 | Ga0207712_10223617 | |||
| 2419 | Ga0207712_10634862 | |||
| 2420 | Ga0207712_11057998 | |||
| 2421 | Ga0207712_11246021 | |||
| 2422 | Ga0207712_12058734 | |||
| 2423 | Ga0207668_10024406 | |||
| 2424 | Ga0207668_10095320 | |||
| 2425 | Ga0207668_10180217 | |||
| 2426 | Ga0207668_10295614 | |||
| 2427 | Ga0207668_10548987 | |||
| 2428 | Ga0207668_10961898 | |||
| 2429 | Ga0207668_11183750 | |||
| 2430 | Ga0207668_11244159 | |||
| 2431 | Ga0207668_11354534 | |||
| 2432 | Ga0207668_12055681 | |||
| 2433 | Ga0207640_10082513 | |||
| 2434 | Ga0207640_10118979 | |||
| 2435 | Ga0207640_10206084 | |||
| 2436 | Ga0207640_10281722 | |||
| 2437 | Ga0207640_10613305 | |||
| 2438 | Ga0207640_10685081 | |||
| 2439 | Ga0207640_11835322 | |||
| 2440 | Ga0207658_10337465 | |||
| 2441 | Ga0207658_10454621 | |||
| 2442 | Ga0207677_10104387 | |||
| 2443 | Ga0207677_12267214 | |||
| 2444 | Ga0207703_10150217 | |||
| 2445 | Ga0207703_11091263 | |||
| 2446 | Ga0207703_11416451 | |||
| 2447 | Ga0207703_11493505 | |||
| 2448 | Ga0207703_11956922 | |||
| 2449 | Ga0207639_10004418 | |||
| 2450 | Ga0207639_10141940 | |||
| 2451 | Ga0207639_10500380 | |||
| 2452 | Ga0207639_10646018 | |||
| 2453 | Ga0207639_10656720 | |||
| 2454 | Ga0207639_11045700 | |||
| 2455 | Ga0207639_11083596 | |||
| 2456 | Ga0207639_11316267 | |||
| 2457 | Ga0207639_11367158 | |||
| 2458 | Ga0207678_10012307 | |||
| 2459 | Ga0207678_10023967 | |||
| 2460 | Ga0207678_10089381 | |||
| 2461 | Ga0207678_10136672 | |||
| 2462 | Ga0207678_10198754 | |||
| 2463 | Ga0207678_10232478 | |||
| 2464 | Ga0207678_11121585 | |||
| 2465 | Ga0207708_10175374 | |||
| 2466 | Ga0207708_10833671 | |||
| 2467 | Ga0207702_10000022 | |||
| 2468 | Ga0207702_10000041 | |||
| 2469 | Ga0207702_10007733 | |||
| 2470 | Ga0207702_10231775 | |||
| 2471 | Ga0207702_10429437 | |||
| 2472 | Ga0207702_10683805 | |||
| 2473 | Ga0207702_10776245 | |||
| 2474 | Ga0207702_11607249 | |||
| 2475 | Ga0207641_11935164 | |||
| 2476 | Ga0207648_10588750 | |||
| 2477 | Ga0207648_11865645 | |||
| 2478 | Ga0207676_10052651 | |||
| 2479 | Ga0207676_10265205 | |||
| 2480 | Ga0207676_11337168 | |||
| 2481 | Ga0207674_10005530 | |||
| 2482 | Ga0207674_10015337 | |||
| 2483 | Ga0207674_10453889 | |||
| 2484 | Ga0207674_10540765 | |||
| 2485 | Ga0207674_11134082 | |||
| 2486 | Ga0207675_100278865 | |||
| 2487 | Ga0207675_100860964 | |||
| 2488 | Ga0207675_101613031 | |||
| 2489 | Ga0207675_102358049 | |||
| 2490 | Ga0207675_102687273 | |||
| 2491 | Ga0207683_10074762 | |||
| 2492 | Ga0207683_10189497 | |||
| 2493 | Ga0207683_10381817 | |||
| 2494 | Ga0207683_10550499 | |||
| 2495 | Ga0207683_10753534 | |||
| 2496 | Ga0207683_11103154 | |||
| 2497 | Ga0207683_11943502 | |||
| 2498 | Ga0207683_12085848 | |||
| 2499 | Ga0207698_10044442 | |||
| 2500 | Ga0207698_10078408 | |||
| 2501 | Ga0207698_10100030 | |||
| 2502 | Ga0207698_10146286 | |||
| 2503 | Ga0207698_10186652 | |||
| 2504 | Ga0207698_10358025 | |||
| 2505 | Ga0207698_10722581 | |||
| 2506 | Ga0207698_10851081 | |||
| 2507 | Ga0207698_11308398 | |||
| 2508 | Ga0207698_12302692 | |||
| 2509 | Ga0207698_12526919 | |||
| 2510 | Ga0209389_1000090 | |||
| 2511 | Ga0209389_1000119 | |||
| 2512 | Ga0209589_1000010 | |||
| 2513 | Ga0209489_100011 | |||
| 2514 | Ga0209489_100385 | |||
| 2515 | Ga0209700_100013 | |||
| 2516 | Ga0268266_10359041 | |||
| 2517 | Ga0268266_10537219 | |||
| 2518 | Ga0268266_10614064 | |||
| 2519 | Ga0268266_10653711 | |||
| 2520 | Ga0268266_10720069 | |||
| 2521 | Ga0268266_10803928 | |||
| 2522 | Ga0268266_11157136 | |||
| 2523 | Ga0268266_12202753 | |||
| 2524 | Ga0268265_10241475 | |||
| 2525 | Ga0268265_10557126 | |||
| 2526 | Ga0268265_10654088 | |||
| 2527 | Ga0268265_10702484 | |||
| 2528 | Ga0268265_11026983 | |||
| 2529 | Ga0268265_11562283 | |||
| 2530 | Ga0268264_10368029 | |||
| 2531 | Ga0268264_10466858 | |||
| 2532 | Ga0268264_10764227 | |||
| 2533 | Ga0268264_12202815 | |||
| 2534 | Ga0265319_1052575 | |||
| 2535 | Ga0265334_10003794 | |||
| 2536 | Ga0265318_10040278 | |||
| 2537 | Ga0265323_10000529 | |||
| 2538 | Ga0265322_10065558 | |||
| 2539 | Ga0265336_10000169 | |||
| 2540 | Ga0307517_10291326 | |||
| 2541 | Ga0307517_10445842 | |||
| 2542 | Ga0307517_10610590 | |||
| 2543 | Ga0307515_10467366 | |||
| 2544 | Ga0307515_10659510 | |||
| 2545 | Ga0265338_10000624 | |||
| 2546 | Ga0265338_11229494 | |||
| 2547 | Ga0265324_10015145 | |||
| 2548 | Ga0265762_1052602 | |||
| 2549 | Ga0265770_1131010 | |||
| 2550 | Ga0265330_10109331 | |||
| 2551 | Ga0265339_10000560 | |||
| 2552 | Ga0307513_10290462 | |||
| 2553 | Ga0307513_10925441 | |||
| 2554 | Ga0307509_10227270 | |||
| 2555 | Ga0307509_10281389 | |||
| 2556 | Ga0307408_101255530 | |||
| 2557 | Ga0307508_10000501 | |||
| 2558 | Ga0265314_10202597 | |||
| 2559 | Ga0265342_10051874 | |||
| 2560 | Ga0316576_10306653 | |||
| 2561 | Ga0316578_10079450 | |||
| 2562 | Ga0307516_10001650 | |||
| 2563 | Ga0307516_10510548 | |||
| 2564 | Ga0307516_10661080 | |||
| 2565 | Ga0307405_10683454 | |||
| 2566 | Ga0307412_10585445 | |||
| 2567 | Ga0307409_102146997 | |||
| 2568 | Ga0307416_100572688 | |||
| 2569 | Ga0307416_101770426 | |||
| 2570 | Ga0307416_102033650 | |||
| 2571 | Ga0307416_102483445 | |||
| 2572 | Ga0307414_11344956 | |||
| 2573 | Ga0307411_10097452 | |||
| 2574 | Ga0307415_101195387 | |||
| 2575 | Ga0307415_101990863 | |||
| 2576 | Ga0307415_102057431 | |||
| 2577 | Ga0307507_10327900 | |||
| 2578 | Ga0307510_10024022 | |||
| 2579 | Ga0307510_10108332 | |||
| 2580 | Ga0307510_10605599 | |||
| 2581 | Ga0316213_1009054 | |||
| 2582 | Ga0373930_0166493 | |||
| 2583 | Ga0373959_0069579 | |||
| 2584 | Ga0373940_0148226 | |||
| 2585 | Ga0373936_0035462 | |||
| 2586 | Ga0373936_0214927 | |||
| 2587 | Ga0373953_0197960 | |||
| 2588 | Ga0373954_0094970 | |||
| 2589 | Ga0373943_0056308 | |||
| 2590 | Ga0373946_0178003 | |||
| 2591 | Ga0373946_0418679 | |||
| 2592 | Ga0373955_0921895 | |||
| 2593 | Ga0373942_0224127 | |||
| 2594 | Ga0316574_0000583 | |||
| 2595 | Ga0373931_0906821 | |||
| 2596 | Ga0373935_0026604 | |||
| 2597 | Ga0373935_1273631 | |||
| 2598 | Ga0373927_0044931 | |||
| 2599 | Ga0373927_0125525 | |||
| 2600 | Ga0373947_0331303 | |||
| 2601 | Ga0373937_0116233 | |||
| 2602 | Ga0373937_0277661 | |||
| 2603 | Ga0316582_0032095 | |||
| 2604 | Ga0316584_0061834 | |||
| 2605 | Ga0373925_0141633 | |||
| 2606 | Ga0373925_1345794 | |||
| 2607 | Ga0395900_0048961 | |||
| 2608 | Ga0395900_1241213 | |||
| 2609 | Ga0395900_1356633 | |||
| 2610 | Ga0395900_1490874 | |||
| 2611 | Ga0395898_0017014 | |||
| 2612 | Ga0395898_0120258 | |||
| 2613 | Ga0395898_0138115 | |||
| 2614 | Ga0395905_0003720 | |||
| 2615 | Ga0395905_0620276 | |||
| 2616 | Ga0395905_0771829 | |||
| 2617 | Ga0395905_0903283 | |||
| 2618 | Ga0395905_1287791 | |||
| 2619 | Ga0436364_0061231 | |||
| 2620 | Ga0436364_0154333 | |||
| 2621 | Ga0436364_0888765 | |||
| 2622 | Ga0395901_0058832 | |||
| 2623 | Ga0395901_0163797 | |||
| 2624 | Ga0395901_0302538 | |||
| 2625 | Ga0395901_0582478 | |||
| 2626 | Ga0395901_0922077 | |||
| 2627 | Ga0436365_0112862 | |||
| 2628 | Ga0436365_0147464 | |||
| 2629 | Ga0436365_0717568 | |||
| 2630 | Ga0436365_0773004 | |||
| 2631 | Ga0436365_1050534 | |||
| 2632 | Ga0436365_1278112 | |||
| 2633 | Ga0436365_1850099 | |||
| 2634 | Ga0436360_0328780 | |||
| 2635 | Ga0436360_0366484 | |||
| 2636 | Ga0436360_0582586 | |||
| 2637 | Ga0436360_1055724 | |||
| 2638 | Ga0436361_0213272 | |||
| 2639 | Ga0436361_0226150 | |||
| 2640 | Ga0436361_0293025 | |||
| 2641 | Ga0436361_0510320 | |||
| 2642 | Ga0436363_0170815 | |||
| 2643 | Ga0436363_0275971 | |||
| 2644 | Ga0436363_0348712 | |||
| 2645 | Ga0436363_0398948 | |||
| 2646 | Ga0436363_0611524 | |||
| 2647 | Ga0436362_0492403 | |||
| 2648 | Ga0439465_0042388 | |||
| 2649 | Ga0439465_0086175 | |||
| 2650 | Ga0451793_1661917 | |||
| 2651 | Ga0451798_0847575 | |||
| 2652 | Ga0451800_0175728 | |||
| 2653 | Ga0451802_1442244 | |||
| 2654 | Ga0451804_0447390 | |||
| 2655 | Ga0451833_1093963 | |||
| 2656 | Ga0451835_0365809 | |||
| 2657 | Ga0451835_1082516 | |||
| 2658 | Ga0451839_0906687 | |||
| 2659 | Ga0451845_0500577 | |||
| 2660 | Ga0451853_0815963 | |||
| 2661 | Ga0451853_2237783 | |||
| 2662 | Ga0451853_4007085 | |||
| 2663 | Ga0439431_0123146 | |||
| 2664 | Ga0439455_0106809 | |||
| 2665 | Ga0439455_0236112 | |||
| 2666 | Ga0439459_0093668 | |||
| 2667 | Ga0466969_0029006 | |||
| 2668 | Ga0466972_0168300 | |||
| 2669 | Ga0466972_0343020 | |||
| 2670 | Ga0466965_0293779 | |||
| 2671 | Ga0466965_0470058 | |||
| 2672 | Ga0466966_0008640 | |||
| 2673 | Ga0466966_0688573 | |||
| 2674 | Ga0466961_0000081 | |||
| 2675 | Ga0466964_0151362 | |||
| 2676 | Ga0466964_0236700 | |||
| 2677 | Ga0466968_0005304 | |||
| 2678 | Ga0466968_0095078 | |||
| 2679 | Ga0466957_0176292 | |||
| 2680 | Ga0466957_1310508 | |||
| 2681 | Ga0466957_1343418 | |||
| 2682 | Ga0466960_0285292 | |||
| 2683 | Ga0466959_0004686 | |||
| 2684 | Ga0466959_0387416 | |||
| 2685 | Ga0466967_0182204 | |||
| 2686 | Ga0466967_0365028 | |||
| 2687 | Ga0466967_0444509 | |||
| 2688 | Ga0466967_0601462 | |||
| 2689 | Ga0466967_0849029 | |||
| 2690 | Ga0466967_1209013 | |||
| 2691 | Ga0466967_1853724 | |||
| 2692 | Ga0495617_056784 | |||
| 2693 | Ga0495617_159856 | |||
| 2694 | Ga0495592_0250305 | |||
| 2695 | Ga0495592_0426018 | |||
| 2696 | Ga0495603_0091684 | |||
| 2697 | Ga0495603_0149919 | |||
| 2698 | Ga0495603_0385311 | |||
| 2699 | Ga0495590_0059434 | |||
| 2700 | Ga0495629_0024603 | |||
| 2701 | Ga0495629_0919495 | |||
| 2702 | Ga0495638_0009527 | |||
| 2703 | Ga0495638_0014000 | |||
| 2704 | Ga0495638_0342996 | |||
| 2705 | Ga0495638_0384130 | |||
| 2706 | Ga0495641_0139396 | |||
| 2707 | Ga0495651_0168634 | |||
| 2708 | Ga0495651_0187642 | |||
| 2709 | Ga0495651_0190989 | |||
| 2710 | Ga0495651_0247248 | |||
| 2711 | Ga0495651_0387732 | |||
| 2712 | Ga0495653_0320701 | |||
| 2713 | Ga0495653_0443919 | |||
| 2714 | Ga0495650_0034490 | |||
| 2715 | Ga0495650_0289854 | |||
| 2716 | Ga0495582_0086029 | |||
| 2717 | Ga0495582_0139963 | |||
| 2718 | Ga0495605_0213752 | |||
| 2719 | Ga0495605_0234764 | |||
| 2720 | Ga0495639_0701919 | |||
| 2721 | Ga0495584_0279548 | |||
| 2722 | Ga0495584_0290941 | |||
| 2723 | Ga0495584_0417858 | |||
| 2724 | Ga0495585_0024609 | |||
| 2725 | Ga0495585_0243734 | |||
| 2726 | Ga0495596_0079868 | |||
| 2727 | Ga0495596_0235061 | |||
| 2728 | Ga0495596_0446972 | |||
| 2729 | Ga0495607_0489531 | |||
| 2730 | Ga0495583_0205045 | |||
| 2731 | Ga0495606_0069216 | |||
| 2732 | Ga0495606_0405212 | |||
| 2733 | Ga0495608_0029753 | |||
| 2734 | Ga0495608_0158095 | |||
| 2735 | Ga0495610_0099015 | |||
| 2736 | Ga0495610_0218571 | |||
| 2737 | Ga0495616_0120781 | |||
| 2738 | Ga0495618_0361310 | |||
| 2739 | Ga0495620_0163260 | |||
| 2740 | Ga0495620_0183300 | |||
| 2741 | Ga0495628_0115335 | |||
| 2742 | Ga0495628_0753942 | |||
| 2743 | Ga0495631_0252460 | |||
| 2744 | Ga0495632_0092363 | |||
| 2745 | Ga0495632_0109574 | |||
| 2746 | Ga0495632_0330965 | |||
| 2747 | Ga0495632_0354550 | |||
| 2748 | Ga0495643_0035822 | |||
| 2749 | Ga0495643_0133030 | |||
| 2750 | Ga0495643_0259844 | |||
| 2751 | Ga0495644_0123374 | |||
| 2752 | Ga0495644_0445567 | |||
| 2753 | Ga0495648_0023829 | |||
| 2754 | Ga0495648_0266880 | |||
| 2755 | Ga0495648_0361423 | |||
| 2756 | Ga0495648_0427506 | |||
| 2757 | Ga0495648_0513921 | |||
| 2758 | Ga0495666_0178585 | |||
| 2759 | Ga0495642_0206450 | |||
| 2760 | Ga0495652_0102786 | |||
| 2761 | Ga0495652_0204173 | |||
| 2762 | Ga0495652_0816958 | |||
| 2763 | Ga0495652_0838814 | |||
| 2764 | Ga0495654_0285913 | |||
| 2765 | Ga0495654_0449482 | |||
| 2766 | Ga0495665_0656276 | |||
| 2767 | Ga0495640_0014514 | |||
| 2768 | Ga0495640_0125542 | |||
| 2769 | Ga0495640_0258285 | |||
| 2770 | Ga0495587_0025877 | |||
| 2771 | Ga0495598_0313365 | |||
| 2772 | Ga0495609_0147350 | |||
| 2773 | Ga0495597_0284289 | |||
| 2774 | Ga0495645_0036139 | |||
| 2775 | Ga0495622_0022232 | |||
| 2776 | Ga0495622_0089044 | |||
| 2777 | Ga0495622_0128995 | |||
| 2778 | Ga0495622_0230055 | |||
| 2779 | Ga0495633_0150729 | |||
| 2780 | Ga0495633_0299987 | |||
| 2781 | Ga0495667_0077362 | |||
| 2782 | Ga0495667_0748095 | |||
| 2783 | Ga0495656_0495681 | |||
| 2784 | Ga0495656_0514720 | |||
| 2785 | Ga0495668_0028861 | |||
| 2786 | Ga0495668_0225902 | |||
| 2787 | Ga0495668_0295785 | |||
| 2788 | Ga0495634_0140276 | |||
| 2789 | Ga0495634_0408543 | |||
| 2790 | Ga0495611_0288134 | |||
| 2791 | Ga0495611_0439586 | |||
| 2792 | Ga0495625_0105077 | |||
| 2793 | Ga0495625_0235848 | |||
| 2794 | Ga0495635_0007905 | |||
| 2795 | Ga0495659_0341152 | |||
| 2796 | Ga0495661_0395626 | |||
| 2797 | Ga0495588_0097033 | |||
| 2798 | Ga0495588_0187238 | |||
| 2799 | Ga0495657_0027075 | |||
| 2800 | Ga0495657_0062847 | |||
| 2801 | Ga0495599_0046271 | |||
| 2802 | Ga0495599_0369443 | |||
| 2803 | Ga0495599_0730760 | |||
| 2804 | Ga0495623_0127320 | |||
| 2805 | Ga0495646_0085468 | |||
| 2806 | Ga0495646_0108703 | |||
| 2807 | Ga0495647_0171488 | |||
| 2808 | Ga0495658_0270039 | |||
| 2809 | Ga0495669_0184968 | |||
| 2810 | Ga0495669_0466936 | |||
| 2811 | Ga0495669_0515531 | |||
| 2812 | Ga0495613_0116232 | |||
| 2813 | Ga0495624_0031167 | |||
| 2814 | Ga0495624_0236070 | |||
| 2815 | Ga0495670_0051666 | |||
| 2816 | Ga0495670_0762993 | |||
| 2817 | Ga0495671_0367108 | |||
| 2818 | Ga0495671_0482081 | |||
| 2819 | Ga0495671_0538198 | |||
| 2820 | Ga0495649_0354352 | |||
| 2821 | Ga0495649_0451530 | |||
| 2822 | Ga0495649_0649106 | |||
| 2823 | Ga0495589_0374266 | |||
| 2824 | Ga0495589_0493735 | |||
| 2825 | Ga0495589_0581547 | |||
| 2826 | Ga0495600_0004475 | |||
| 2827 | Ga0495600_0287033 | |||
| 2828 | Ga0495581_0128377 | |||
| 2829 | Ga0495581_0365218 | |||
| 2830 | Ga0495581_0564230 | |||
| 2831 | Ga0495604_0043292 | |||
| 2832 | Ga0495604_0091524 | |||
| 2833 | Ga0495636_0133871 | |||
| 2834 | Ga0495636_0482937 | |||
| 2835 | Ga0495674_0561591 | |||
| 2836 | Ga0495676_0084775 | |||
| 2837 | Ga0495676_0098435 | |||
| 2838 | Ga0495676_0262010 | |||
| 2839 | Ga0495680_0009018 | |||
| 2840 | Ga0495680_1035939 | |||
| 2841 | Ga0495683_0242924 | |||
| 2842 | Ga0495683_0380932 | |||
| 2843 | Ga0495687_091181 | |||
| 2844 | Ga0495673_0135152 | |||
| 2845 | Ga0495684_0958812 | |||
| 2846 | Ga0495686_0133491 | |||
| 2847 | Ga0495686_0258063 | |||
| 2848 | Ga0495686_0475817 | |||
| 2849 | Ga0495686_0563747 | |||
| 2850 | Ga0495686_0627315 | |||
| 2851 | Ga0495686_0628047 | |||
| 2852 | Ga0495602_0032368 | |||
| 2853 | Ga0495602_0299515 | |||
| 2854 | Ga0495602_0552744 | |||
| 2855 | Ga0495602_0614275 | |||
| 2856 | Ga0495602_0773225 | |||
| 2857 | Ga0495602_1029560 | |||
| 2858 | Ga0495614_0062589 | |||
| 2859 | Ga0495615_0077593 | |||
| 2860 | Ga0495626_0252059 | |||
| 2861 | Ga0495626_0311727 | |||
| 2862 | Ga0496100_0042551 | |||
| 2863 | Ga0496100_0516987 | |||
| 2864 | Ga0496100_0540473 | |||
| 2865 | Ga0496100_0596700 | |||
| 2866 | Ga0496100_1332029 | |||
| 2867 | Ga0496101_0107602 | |||
| 2868 | Ga0496101_0212233 | |||
| 2869 | Ga0496102_0028006 | |||
| 2870 | Ga0496102_0106868 | |||
| 2871 | Ga0496102_0255989 | |||
| 2872 | Ga0496102_0278718 | |||
| 2873 | Ga0496102_0357178 | |||
| 2874 | Ga0496102_0738886 | |||
| 2875 | Ga0496102_0976772 | |||
| 2876 | Ga0496102_1682421 | |||
| 2877 | Ga0496103_0049599 | |||
| 2878 | Ga0496103_0143036 | |||
| 2879 | Ga0496103_0510430 | |||
| 2880 | Ga0496104_0018741 | |||
| 2881 | Ga0496104_0041918 | |||
| 2882 | Ga0496104_0043661 | |||
| 2883 | Ga0496104_0094155 | |||
| 2884 | Ga0496104_0140780 | |||
| 2885 | Ga0496104_0416169 | |||
| 2886 | Ga0496104_0530966 | |||
| 2887 | Ga0496104_1019352 | |||
| 2888 | Ga0496105_0039541 | |||
| 2889 | Ga0496105_0060956 | |||
| 2890 | Ga0496105_0252007 | |||
| 2891 | Ga0496105_0460032 | |||
| 2892 | Ga0496105_0487220 | |||
| 2893 | Ga0496105_1335248 | |||
| 2894 | Ga0496106_0006170 | |||
| 2895 | Ga0496106_0039043 | |||
| 2896 | Ga0496106_0075362 | |||
| 2897 | Ga0496106_1572846 | |||
| 2898 | Ga0496107_0060730 | |||
| 2899 | Ga0496107_0062828 | |||
| 2900 | Ga0496107_0134560 | |||
| 2901 | Ga0496107_0864194 | |||
| 2902 | Ga0496107_1131605 | |||
| 2903 | Ga0496108_0071617 | |||
| 2904 | Ga0496108_0162249 | |||
| 2905 | Ga0496108_1363439 | |||
| 2906 | Ga0496109_0042787 | |||
| 2907 | Ga0496109_0145680 | |||
| 2908 | Ga0496109_0176731 | |||
| 2909 | Ga0496109_0813365 | |||
| 2910 | Ga0496109_1206051 | |||
| 2911 | Ga0496110_0034286 | |||
| 2912 | Ga0496110_0502943 | |||
| 2913 | Ga0496110_0549991 | |||
| 2914 | Ga0496110_0706620 | |||
| 2915 | Ga0496110_0773640 | |||
| 2916 | Ga0496110_0992476 | |||
| 2917 | Ga0496111_0278837 | |||
| 2918 | Ga0496111_0958958 | |||
| 2919 | Ga0496112_0001776 | |||
| 2920 | Ga0496112_0094695 | |||
| 2921 | Ga0496112_0111276 | |||
| 2922 | Ga0496112_0288919 | |||
| 2923 | Ga0496112_1041874 | |||
| 2924 | Ga0496112_1612360 | |||
| 2925 | Ga0496113_0058041 | |||
| 2926 | Ga0496113_0237395 | |||
| 2927 | Ga0496113_0519934 | |||
| 2928 | Ga0496113_1080644 | |||
| 2929 | Ga0496113_1453351 | |||
| 2930 | Ga0496114_0080842 | |||
| 2931 | Ga0496114_0299327 | |||
| 2932 | Ga0496114_0680231 | |||
| 2933 | Ga0496114_0991073 | |||
| 2934 | Ga0496115_0040830 | |||
| 2935 | Ga0496115_0052762 | |||
| 2936 | Ga0496115_0230629 | |||
| 2937 | Ga0496115_0383282 | |||
| 2938 | Ga0496115_0893024 | |||
| 2939 | Ga0496116_0054625 | |||
| 2940 | Ga0496116_0119043 | |||
| 2941 | Ga0496117_0013120 | |||
| 2942 | Ga0496117_0112655 | |||
| 2943 | Ga0496117_0183873 | |||
| 2944 | Ga0496117_0334740 | |||
| 2945 | Ga0496118_0019171 | |||
| 2946 | Ga0496118_0060764 | |||
| 2947 | Ga0496118_0121550 | |||
| 2948 | Ga0496118_0140440 | |||
| 2949 | Ga0496118_0305456 | |||
| 2950 | Ga0496118_0494318 | |||
| 2951 | Ga0496119_0026612 | |||
| 2952 | Ga0496119_0245977 | |||
| 2953 | Ga0496119_0276265 | |||
| 2954 | Ga0496120_0153397 | |||
| 2955 | Ga0496120_0231290 | |||
| 2956 | Ga0496121_0000476 | |||
| 2957 | Ga0496121_0026025 | |||
| 2958 | Ga0496121_0038564 | |||
| 2959 | Ga0496121_0056344 | |||
| 2960 | Ga0496121_0089908 | |||
| 2961 | Ga0496121_0163045 | |||
| 2962 | Ga0496121_0183568 | |||
| 2963 | Ga0496121_0278514 | |||
| 2964 | Ga0496121_0279455 | |||
| 2965 | Ga0496121_0331969 | |||
| 2966 | Ga0496121_0453710 | |||
| 2967 | Ga0496121_0490523 | |||
| 2968 | Ga0496121_0685172 | |||
| 2969 | Ga0496121_0715258 | |||
| 2970 | Ga0496121_0847828 | |||
| 2971 | Ga0496122_0132189 | |||
| 2972 | Ga0496122_0255293 | |||
| 2973 | Ga0496124_0001454 | |||
| 2974 | Ga0496124_0139065 | |||
| 2975 | Ga0496124_0175900 | |||
| 2976 | Ga0496124_0203172 | |||
| 2977 | Ga0496124_0307464 | |||
| 2978 | Ga0496124_0351155 | |||
| 2979 | Ga0496124_0717062 | |||
| 2980 | Ga0496124_0741521 | |||
| 2981 | Ga0496124_0981477 | |||
| 2982 | Ga0496125_0061879 | |||
| 2983 | Ga0496125_0073279 | |||
| 2984 | Ga0496125_0146627 | |||
| 2985 | Ga0496125_0163067 | |||
| 2986 | Ga0496125_0163867 | |||
| 2987 | Ga0496125_0275893 | |||
| 2988 | Ga0496125_0321889 | |||
| 2989 | Ga0496125_0489620 | |||
| 2990 | Ga0496125_0516319 | |||
| 2991 | Ga0496126_0019467 | |||
| 2992 | Ga0496126_0027761 | |||
| 2993 | Ga0496126_0117726 | |||
| 2994 | Ga0496126_0175410 | |||
| 2995 | Ga0496126_0215446 | |||
| 2996 | Ga0496126_0251395 | |||
| 2997 | Ga0496126_0285143 | |||
| 2998 | Ga0496126_0317976 | |||
| 2999 | Ga0496126_0330694 | |||
| 3000 | Ga0496126_0334443 | |||
| 3001 | Ga0496126_0352018 | |||
| 3002 | Ga0496126_0364062 | |||
| 3003 | Ga0496126_0384273 | |||
| 3004 | Ga0496126_0424449 | |||
| 3005 | Ga0496126_0735264 | |||
| 3006 | Ga0496126_0980258 | |||
| 3007 | Ga0496126_1200739 | |||
| 3008 | Ga0495682_0151797 | |||
| 3009 | Ga0495682_0199800 | |||
| 3010 | Ga0501031_0026577 | |||
| 3011 | Ga0501031_0049902 | |||
| 3012 | Ga0501031_0196759 | |||
| 3013 | Ga0501031_0202304 | |||
| 3014 | Ga0501032_0000144 | |||
| 3015 | Ga0501032_0014510 | |||
| 3016 | Ga0501032_0057465 | |||
| 3017 | Ga0501032_0192045 | |||
| 3018 | Ga0501032_0346849 | |||
| 3019 | Ga0501032_0394081 | |||
| 3020 | Ga0501032_0417895 | |||
| 3021 | Ga0501032_0765370 | |||
| 3022 | Ga0501032_1027299 | |||
| 3023 | Ga0501033_0000206 | |||
| 3024 | Ga0501033_0004699 | |||
| 3025 | Ga0501033_0026495 | |||
| 3026 | Ga0501033_0068200 | |||
| 3027 | Ga0501033_0113310 | |||
| 3028 | Ga0501033_0377655 | |||
| 3029 | Ga0501033_0476628 | |||
| 3030 | Ga0501033_0550910 | |||
| 3031 | Ga0501033_0984062 | |||
| 3032 | Ga0501034_0000159 | |||
| 3033 | Ga0501034_0124339 | |||
| 3034 | Ga0501034_0164022 | |||
| 3035 | Ga0501034_0252462 | |||
| 3036 | Ga0501034_0315731 | |||
| 3037 | Ga0501034_0491898 | |||
| 3038 | Ga0501034_0874979 | |||
| 3039 | Ga0501034_1044069 | |||
| 3040 | Ga0501036_0000179 | |||
| 3041 | Ga0501036_0082429 | |||
| 3042 | Ga0501036_0374440 | |||
| 3043 | Ga0501036_0407138 | |||
| 3044 | Ga0501036_0606771 | |||
| 3045 | Ga0501036_1478930 | |||
| 3046 | Ga0501037_0000112 | |||
| 3047 | Ga0501037_0000396 | |||
| 3048 | Ga0501037_0021148 | |||
| 3049 | Ga0501037_0032014 | |||
| 3050 | Ga0501037_0060449 | |||
| 3051 | Ga0501037_0117435 | |||
| 3052 | Ga0501037_0280347 | |||
| 3053 | Ga0501038_0000160 | |||
| 3054 | Ga0501038_0002046 | |||
| 3055 | Ga0501038_0004875 | |||
| 3056 | Ga0501038_0017078 | |||
| 3057 | Ga0501038_0327405 | |||
| 3058 | Ga0501038_0571820 | |||
| 3059 | Ga0501038_0813963 | |||
| 3060 | Ga0501039_0006453 | |||
| 3061 | Ga0501039_0041142 | |||
| 3062 | Ga0501039_0076205 | |||
| 3063 | Ga0501039_0094817 | |||
| 3064 | Ga0501039_0125694 | |||
| 3065 | Ga0501039_0622724 | |||
| 3066 | Ga0501039_0832860 | |||
| 3067 | Ga0501039_1200758 | |||
| 3068 | Ga0501039_1366954 | |||
| 3069 | Ga0501040_0050414 | |||
| 3070 | Ga0501041_0349615 | |||
| 3071 | Ga0501042_0010829 | |||
| 3072 | Ga0501042_0473621 | |||
| 3073 | Ga0501042_0964217 | |||
| 3074 | Ga0501043_0000613 | |||
| 3075 | Ga0501043_0009493 | |||
| 3076 | Ga0501043_0084716 | |||
| 3077 | Ga0501043_0256683 | |||
| 3078 | Ga0501043_0386644 | |||
| 3079 | Ga0501043_0400925 | |||
| 3080 | Ga0501043_0538755 | |||
| 3081 | Ga0501043_0597453 | |||
| 3082 | Ga0501043_0620172 | |||
| 3083 | Ga0501043_0982873 | |||
| 3084 | Ga0501043_0988557 | |||
| 3085 | Ga0501046_0000397 | |||
| 3086 | Ga0501046_0011234 | |||
| 3087 | Ga0501046_0110470 | |||
| 3088 | Ga0501046_0283931 | |||
| 3089 | Ga0501046_0545095 | |||
| 3090 | Ga0501046_0765875 | |||
| 3091 | Ga0501046_1111881 | |||
| 3092 | Ga0501047_0000288 | |||
| 3093 | Ga0501047_0084506 | |||
| 3094 | Ga0501047_0109325 | |||
| 3095 | Ga0501047_0118857 | |||
| 3096 | Ga0501047_0290235 | |||
| 3097 | Ga0501047_0464868 | |||
| 3098 | Ga0501047_0806945 | |||
| 3099 | Ga0501048_0009783 | |||
| 3100 | Ga0501048_0049560 | |||
| 3101 | Ga0501048_0182214 | |||
| 3102 | Ga0501048_0183876 | |||
| 3103 | Ga0501067_0000783 | |||
| 3104 | Ga0501067_0008905 | |||
| 3105 | Ga0501067_0063692 | |||
| 3106 | Ga0501067_0255613 | |||
| 3107 | Ga0501067_0265092 | |||
| 3108 | Ga0501067_0278534 | |||
| 3109 | Ga0501067_0428474 | |||
| 3110 | Ga0501068_0001676 | |||
| 3111 | Ga0501068_0060477 | |||
| 3112 | Ga0501068_0308656 | |||
| 3113 | Ga0501069_0012782 | |||
| 3114 | Ga0501069_0201730 | |||
| 3115 | Ga0501069_0428445 | |||
| 3116 | Ga0501070_0002241 | |||
| 3117 | Ga0501070_0025427 | |||
| 3118 | Ga0501070_0123705 | |||
| 3119 | Ga0501070_0146370 | |||
| 3120 | Ga0501070_0184967 | |||
| 3121 | Ga0501070_0608136 | |||
| 3122 | Ga0501071_0022783 | |||
| 3123 | Ga0501071_0646088 | |||
| 3124 | Ga0501072_0001612 | |||
| 3125 | Ga0501072_0125554 | |||
| 3126 | Ga0501072_0167759 | |||
| 3127 | Ga0501072_0971011 | |||
| 3128 | Ga0501073_0000034 | |||
| 3129 | Ga0501073_0036008 | |||
| 3130 | Ga0501073_0040397 | |||
| 3131 | Ga0501073_0081502 | |||
| 3132 | Ga0501073_0101096 | |||
| 3133 | Ga0501073_0439018 | |||
| 3134 | Ga0501074_0000532 | |||
| 3135 | Ga0501074_0069854 | |||
| 3136 | Ga0501074_0174380 | |||
| 3137 | Ga0501074_0979950 | |||
| 3138 | Ga0501076_0607235 | |||
| 3139 | Ga0501076_1312298 | |||
| 3140 | Ga0501076_1326636 | |||
| 3141 | Ga0501077_0238763 | |||
| 3142 | Ga0501079_0036257 | |||
| 3143 | Ga0501079_0204286 | |||
| 3144 | Ga0501079_0355961 | |||
| 3145 | Ga0501079_0433135 | |||
| 3146 | Ga0501080_0000765 | |||
| 3147 | Ga0501080_0079464 | |||
| 3148 | Ga0501080_0265054 | |||
| 3149 | Ga0501080_0421248 | |||
| 3150 | Ga0501080_0730366 | |||
| 3151 | Ga0501080_1282939 | |||
| 3152 | Ga0501080_1511182 | |||
| 3153 | Ga0501083_0004806 | |||
| 3154 | Ga0501083_0019398 | |||
| 3155 | Ga0501083_0078015 | |||
| 3156 | Ga0501035_0000137 | |||
| 3157 | Ga0501035_0005535 | |||
| 3158 | Ga0501035_0031309 | |||
| 3159 | Ga0501035_0095678 | |||
| 3160 | Ga0501035_0109894 | |||
| 3161 | Ga0501035_0209261 | |||
| 3162 | Ga0501035_0324283 | |||
| 3163 | Ga0501035_0499943 | |||
| 3164 | Ga0501035_0525655 | |||
| 3165 | Ga0501035_0902991 | |||
| 3166 | Ga0501044_0000418 | |||
| 3167 | Ga0501044_0075279 | |||
| 3168 | Ga0501044_0087043 | |||
| 3169 | Ga0501044_0158153 | |||
| 3170 | Ga0501044_0185241 | |||
| 3171 | Ga0501044_0207440 | |||
| 3172 | Ga0501044_0211357 | |||
| 3173 | Ga0501044_0221756 | |||
| 3174 | Ga0501044_0297239 | |||
| 3175 | Ga0501044_0492465 | |||
| 3176 | Ga0501044_0911981 | |||
| 3177 | Ga0501044_0959638 | |||
| 3178 | Ga0501045_0025556 | |||
| 3179 | Ga0501045_0061052 | |||
| 3180 | Ga0501045_0376518 | |||
| 3181 | Ga0501045_0467245 | |||
| 3182 | Ga0501045_0716547 | |||
| 3183 | nmdc:mga03683_551904_c1 | |||
| 3184 | nmdc:mga03683_567034_c1 | |||
| 3185 | nmdc:mga03n38_880704_c1 | |||
| 3186 | nmdc:mga00v17_309679_c1 | |||
| 3187 | nmdc:mga00v17_617866_c1 | |||
| 3188 | nmdc:mga0yw44_435741_c1 | |||
| 3189 | nmdc:mga0yw44_437546_c1 | |||
| 3190 | nmdc:mga0yw44_492493_c1 | |||
| 3191 | nmdc:mga0yw44_569093_c1 | |||
| 3192 | nmdc:mga0yw44_7902_c1 | |||
| 3193 | nmdc:mga0k408_337867_c1 | |||
| 3194 | nmdc:mga0k408_46554_c1 | |||
| 3195 | nmdc:mga06z11_242908_c1 | |||
| 3196 | nmdc:mga06z11_424919_c1 | |||
| 3197 | nmdc:mga07m45_334107_c1 | |||
| 3198 | nmdc:mga07m45_52800_c1 | |||
| 3199 | nmdc:mga07m45_90754_c1 | |||
| 3200 | nmdc:mga05p37_737745_c1 | |||
| 3201 | nmdc:mga08y16_430231_c1 | |||
| 3202 | nmdc:mga0n895_352105_c1 | |||
| 3203 | nmdc:mga08x19_1289035_c1 | |||
| 3204 | nmdc:mga0sz30_119866_c1 | |||
| 3205 | nmdc:mga0sz30_330701_c1 | |||
| 3206 | nmdc:mga0sz30_54271_c1 | |||
| 3207 | Ga0495601_0362503 | |||
| 3208 | Ga0500610_0189783 | |||
| 3209 | Ga0500635_0007763 | |||
| 3210 | Ga0500635_0227243 | |||
| 3211 | Ga0495655_0098408 | |||
| 3212 | Ga0495595_0585374 | |||
| 3213 | Ga0495619_0125960 | |||
| 3214 | Ga0495619_0498997 | |||
| 3215 | Ga0500578_0650027 | |||
| 3216 | Ga0500643_000057 | |||
| 3217 | Ga0500644_0043348 | |||
| 3218 | Ga0500644_0211529 | |||
| 3219 | Ga0500581_352340 | |||
| 3220 | Ga0500646_0110080 | |||
| 3221 | Ga0500646_0167253 | |||
| 3222 | Ga0500647_0049399 | |||
| 3223 | Ga0500647_0195614 | |||
| 3224 | Ga0500583_0168593 | |||
| 3225 | Ga0500583_0341165 | |||
| 3226 | Ga0500651_0212251 | |||
| 3227 | Ga0500651_0762061 | |||
| 3228 | Ga0500566_0071724 | |||
| 3229 | Ga0500648_315450 | |||
| 3230 | Ga0500555_004324 | |||
| 3231 | Ga0500555_032811 | |||
| 3232 | Ga0500556_0004646 | |||
| 3233 | Ga0500557_000225 | |||
| 3234 | Ga0500562_106131 | |||
| 3235 | Ga0500569_004900 | |||
| 3236 | Ga0500572_001353 | |||
| 3237 | Ga0500572_163094 | |||
| 3238 | Ga0500592_055921 | |||
| 3239 | Ga0500595_023912 | |||
| 3240 | Ga0500595_176244 | |||
| 3241 | Ga0500597_215728 | |||
| 3242 | Ga0500608_367083 | |||
| 3243 | Ga0500614_048160 | |||
| 3244 | Ga0500618_144197 | |||
| 3245 | Ga0500626_343788 | |||
| 3246 | Ga0500642_0075818 | |||
| 3247 | Ga0500655_088752 | |||
| 3248 | Ga0500658_0141802 | |||
| 3249 | Ga0500658_0213151 | |||
| 3250 | Ga0500658_0434165 | |||
| 3251 | Ga0500559_0003520 | |||
| 3252 | Ga0500559_0009353 | |||
| 3253 | Ga0500559_0014510 | |||
| 3254 | Ga0500559_0206447 | |||
| 3255 | Ga0500568_0064654 | |||
| 3256 | Ga0500573_0014263 | |||
| 3257 | Ga0500577_0197479 | |||
| 3258 | Ga0500577_0366846 | |||
| 3259 | Ga0500588_0364375 | |||
| 3260 | Ga0500589_124616 | |||
| 3261 | Ga0500590_121068 | |||
| 3262 | Ga0500590_200681 | |||
| 3263 | Ga0500590_297504 | |||
| 3264 | Ga0500603_007768 | |||
| 3265 | Ga0500604_0344311 | |||
| 3266 | Ga0500616_0050905 | |||
| 3267 | Ga0500622_0143836 | |||
| 3268 | Ga0500624_029966 | |||
| 3269 | Ga0500627_0185650 | |||
| 3270 | Ga0500633_0244469 | |||
| 3271 | Ga0500634_0194570 | |||
| 3272 | Ga0500638_198954 | |||
| 3273 | Ga0500638_357321 | |||
| 3274 | Ga0500638_391643 | |||
| 3275 | Ga0500639_059100 | |||
| 3276 | Ga0500639_077714 | |||
| 3277 | Ga0500636_0032501 | |||
| 3278 | Ga0500636_0120323 | |||
| 3279 | Ga0500636_0166410 | |||
| 3280 | Ga0500636_0217347 | |||
| 3281 | Ga0500636_0415581 | |||
| 3282 | Ga0500637_0324824 | |||
| 3283 | Ga0500637_0568362 | |||
| 3284 | Ga0500625_015449 | |||
| 3285 | Ga0500625_189416 | |||
| 3286 | Ga0500552_005353 | |||
| 3287 | Ga0500552_028666 | |||
| 3288 | Ga0500596_003631 | |||
| 3289 | Ga0500596_006493 | |||
| 3290 | Ga0500599_021068 | |||
| 3291 | Ga0501084_0005309 | |||
| 3292 | Ga0500661_017797 | |||
| 3293 | Ga0500661_048414 | |||
| 3294 | Ga0587082_147885 | |||
| 3295 | Ga0501082_0002188 | |||
| 3296 | Ga0501082_0179469 | |||
| 3297 | Ga0501082_0205711 | |||
| 3298 | Ga0501082_1191903 | |||
| 3299 | Ga0530510_0923909 | |||
| 3300 | Ga0530510_1317479 | |||
| 3301 | 2507511075 | |||
| 3302 | 2508544892 | |||
| 3303 | 2508696882 | |||
| 3304 | 2509151821 | |||
| 3305 | 2511400413 | |||
| 3306 | 2513623537 | |||
| 3307 | 2513637415 | |||
| 3308 | 2513649738 | |||
| 3309 | 2513655091 | |||
| 3310 | 2513679601 | |||
| 3311 | 2513696512 | |||
| 3312 | 2513701150 | |||
| 3313 | 2513716971 | |||
| 3314 | 2513874704 | |||
| 3315 | 2513915886 | |||
| 3316 | 2514010578 | |||
| 3317 | 2515625353 | |||
| 3318 | 2517100645 | |||
| 3319 | 2517894809 | |||
| 3320 | 2524438132 | |||
| 3321 | 2524471408 | |||
| 3322 | 2524534576 | |||
| 3323 | 2528857588 | |||
| 3324 | 2617353285 | |||
| 3325 | 2617373200 | |||
| 3326 | 2644289479 | |||
| 3327 | 2671119225 | |||
| 3328 | 2723843019 | |||
| 3329 | 2728747532 | |||
| 3330 | 2745076987 | |||
| 3331 | 2793066021 | |||
| 3332 | 2793071283 | |||
| 3333 | 2793084041 | |||
| 3334 | 2805916703 | |||
| 3335 | 2818238210 | |||
| 3336 | 2824607536 | |||
| 3337 | 2824617052 | |||
| 3338 | 2824625916 | |||
| 3339 | 2824634672 | |||
| 3340 | 2824642730 | |||
| 3341 | 2824650646 | |||
| 3342 | 2824658767 | |||
| 3343 | 2824667965 | |||
| 3344 | 2824678542 | |||
| 3345 | 2824694990 | |||
| 3346 | 2824702857 | |||
| 3347 | 2824712090 | |||
| 3348 | 2824721431 | |||
| 3349 | 2824730741 | |||
| 3350 | 2824738719 | |||
| 3351 | 2824761472 | |||
| 3352 | 2824771365 | |||
| 3353 | 2824780495 | |||
| 3354 | 2838127950 | |||
| 3355 | 2841943244 | |||
| 3356 | 2841954024 | |||
| 3357 | 2841961934 | |||
| 3358 | 2841968116 | |||
| 3359 | 2841976675 | |||
| 3360 | 2841988047 | |||
| 3361 | 2844316857 | |||
| 3362 | 2847938618 | |||
| 3363 | 2847944183 | |||
| 3364 | 2849081591 | |||
| 3365 | 2857512245 | |||
| 3366 | 2874597808 | |||
| 3367 | 2874612648 | |||
| 3368 | 2874616865 | |||
| 3369 | 2874623379 | |||
| 3370 | 2874634207 | |||
| 3371 | 2874651337 | |||
| 3372 | 2876764059 | |||
| 3373 | 2876776408 | |||
| 3374 | 2876820976 | |||
| 3375 | 2879081729 | |||
| 3376 | 2879088406 | |||
| 3377 | 2879108861 | |||
| 3378 | 2879130443 | |||
| 3379 | 2879146329 | |||
| 3380 | 2881370735 | |||
| 3381 | 2881671282 | |||
| 3382 | 2885366881 | |||
| 3383 | 2885376964 | |||
| 3384 | 2885389349 | |||
| 3385 | 2885411865 | |||
| 3386 | 2888381468 | |||
| 3387 | 2888389177 | |||
| 3388 | 2888421871 | |||
| 3389 | 2889033688 | |||
| 3390 | 2903733908 | |||
| 3391 | 2903754744 | |||
| 3392 | 2903773208 | |||
| 3393 | 2904672690 | |||
| 3394 | 2904697799 | |||
| 3395 | 2904719293 | |||
| 3396 | 2906604524 | |||
| 3397 | 2906611537 | |||
| 3398 | 2906635231 | |||
| 3399 | 2908745117 | |||
| 3400 | 2908756437 | |||
| 3401 | 2908781656 | |||
| 3402 | 2922367046 | |||
| 3403 | 2922371122 | |||
| 3404 | 2922390176 | |||
| 3405 | 2922427818 | |||
| 3406 | 2929619519 | |||
| 3407 | 2929628011 | |||
| 3408 | 2932785843 | |||
| 3409 | 2932801087 | |||
| 3410 | 2932804165 | |||
| 3411 | 2932813591 | |||
| 3412 | 2932830888 | |||
| 3413 | 2933581440 | |||
| 3414 | 2935612693 | |||
| 3415 | 2935620930 | |||
| 3416 | 2935632248 | |||
| 3417 | 2935640014 | |||
| 3418 | 2935655190 | |||
| 3419 | 2935664071 | |||
| 3420 | 2935667132 | |||
| 3421 | 2935677809 | |||
| 3422 | 2935690262 | |||
| 3423 | 2935697403 | |||
| 3424 | 2935704888 | |||
| 3425 | 2935718042 | |||
| 3426 | 2935726808 | |||
| 3427 | 2935735578 | |||
| 3428 | 2935745151 | |||
| 3429 | 2935755272 | |||
| 3430 | 2935762206 | |||
| 3431 | 2935773586 | |||
| 3432 | 2935780146 | |||
| 3433 | 2935788509 | |||
| 3434 | 2935796665 | |||
| 3435 | 2935803710 | |||
| 3436 | 2935811623 | |||
| 3437 | 2935824182 | |||
| 3438 | 2935829497 | |||
| 3439 | 2935842526 | |||
| 3440 | 2935852671 | |||
| 3441 | 2935858738 | |||
| 3442 | 2935866840 | |||
| 3443 | 2935876971 | |||
| 3444 | 2935884026 | |||
| 3445 | 2935912178 | |||
| 3446 | 2935922391 | |||
| 3447 | 2935929207 | |||
| 3448 | 2935935838 | |||
| 3449 | 2935947404 | |||
| 3450 | 2935953501 | |||
| 3451 | 2935961985 | |||
| 3452 | 2935968527 | |||
| 3453 | 2935976711 | |||
| 3454 | 2935990666 | |||
| 3455 | 2935993390 | |||
| 3456 | 2936004285 | |||
| 3457 | 2936015431 | |||
| 3458 | 2936024065 | |||
| 3459 | 2936033080 | |||
| 3460 | 2936038205 | |||
| 3461 | 2936051173 | |||
| 3462 | 2936058551 | |||
| 3463 | 2940561447 | |||
| 3464 | 2941508196 | |||
| 3465 | 2941515298 | |||
| 3466 | 2941524126 | |||
| 3467 | 2941533638 | |||
| 3468 | 2941544627 | |||
| 3469 | 3005477531 | |||
| 3470 | 3005489778 | |||
| 3471 | 3005507072 | |||
| 3472 | 3005593033 | |||
| 3473 | 3005596486 | |||
| 3474 | 3005712555 | |||
| 3475 | 3005719615 | |||
| 3476 | 8006966581 | |||
| 3477 | 8006989427 | |||
| 3478 | 8006997896 | |||
| 3479 | 8016516500 | |||
| 3480 | 8016523911 | |||
| 3481 | 8016537440 | |||
| 3482 | 8016541712 | |||
| 3483 | 8016551561 | |||
| 3484 | 8016559942 | |||
| 3485 | 8016567097 | |||
| 3486 | 8016579815 | |||
| 3487 | 8016589066 | |||
| 3488 | 8016597874 | |||
| 3489 | 8016604012 | |||
| 3490 | 8016620595 | |||
| 3491 | 8016629399 | |||
| 3492 | 8016633911 | |||
| 3493 | 8017060039 | |||
| 3494 | 8019537125 | |||
| 3495 | 8019542423 | |||
| 3496 | 8019548337 | |||
| 3497 | 8019559635 | |||
| 3498 | 8019569742 | |||
| 3499 | 8019579543 | |||
| 3500 | 8019587254 | |||
| 3501 | 8019604085 | |||
| 3502 | 8019614445 | |||
| 3503 | 8019625074 | |||
| 3504 | 8019637107 | |||
| 3505 | 8019642494 | |||
| 3506 | 8019650085 | |||
| 3507 | 8019664974 | |||
| 3508 | 8019674510 | |||
| 3509 | 8019681594 | |||
| 3510 | 8019694180 | |||
| 3511 | 8055749223 | |||
| 3512 | 8056674927 | |||
| 3513 | 8056695227 | |||
| 3514 | 8056969657 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zud-assembly1.cif.gz_4 | structure of this-thif protein complex | 0.9161 | 1 | 65 |
| 1zud-assembly1.cif.gz_4 | structure of this-thif protein complex | 0.9032 | 1 | 65 |
| 2lek-assembly1.cif.gz_A | solution nmr structure of a thiamine biosynthesis (this) protein rpa3574 from rhodopseudomonas palustris refined with nh rdcs. northeast structural genomics consortium target rpr325 | 0.893 | 1 | 65 |
| 3cwi-assembly1.cif.gz_A | crystal structure of thiamine biosynthesis protein (this) from geobacter metallireducens. northeast structural genomics consortium target gmr137 | 0.8833 | 1 | 65 |
| 2lek-assembly1.cif.gz_A | solution nmr structure of a thiamine biosynthesis (this) protein rpa3574 from rhodopseudomonas palustris refined with nh rdcs. northeast structural genomics consortium target rpr325 | 0.8806 | 1 | 65 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1zud200 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9162 | 3 | 65 | 3.10.20.30 |
| 2lekA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.893 | 1 | 65 | 3.10.20.30 |
| 3cwiA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.883 | 3 | 64 | 3.10.20.30 |
| 2lekA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8806 | 1 | 65 | 3.10.20.30 |
| 3cwiA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8328 | 3 | 64 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537R1X2-F1-model_v4 | Sulfur carrier protein ThiS | 1.001 | 1 | 55 |
|
| AF-F6DB21-F1-model_v4 | Thiamine biosynthesis protein ThiS | 0.9821 | 1 | 65 |
|
| AF-A0A8B3C665-F1-model_v4 | Sulfur carrier protein ThiS | 0.982 | 1 | 65 |
|
| AF-A0A1I7B0K5-F1-model_v4 | Sulfur carrier protein ThiS | 0.9777 | 1 | 65 |
|
| AF-A0A1H6Y9Y6-F1-model_v4 | Sulfur carrier protein | 0.977 | 1 | 65 |
|