F495592

General Info

Members Datasets Scaffolds Average Seq Length
1757 755 3514 65

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0109985|Ga0501031_0109985_1301_1510
Length 69
Sequence MQVTRQVIVNGERREIAAQTVDALLTELDYEGTHFAIAVNFDVLPKSRWAETALNSGDEIEIITPRQGG

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
93 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
96 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
102 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
113 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
114 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
130 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
139 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
140 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
141 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
142 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
145 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
152 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
153 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
154 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
155 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
156 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
157 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300023224 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU4 Metagenome Unclassified
159 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
160 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
164 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
168 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
170 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
238 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
239 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
240 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
241 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
245 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
246 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
247 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
248 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
249 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
250 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
251 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
252 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
253 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
254 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
257 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
258 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
259 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
260 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
261 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
262 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
263 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
264 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
265 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
266 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
267 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
268 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
269 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
270 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
271 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
272 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
273 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
274 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
275 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
276 3300033546 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 Metagenome Unclassified
277 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
278 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
279 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
280 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
281 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
282 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
283 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
284 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
285 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
286 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
287 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
288 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
289 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
290 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
291 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
292 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
293 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
294 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
295 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
296 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
297 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
298 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
299 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
300 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
301 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
302 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
303 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
304 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
305 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
306 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
307 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
308 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
309 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
310 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
311 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
312 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
313 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
314 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
315 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
316 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
317 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
318 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
319 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
320 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
321 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
322 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
323 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
324 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
325 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
326 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
327 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
328 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
329 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
330 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
331 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
332 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
333 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
334 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
335 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
336 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
337 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
338 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
339 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
340 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
341 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
342 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
343 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
344 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
345 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
346 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
347 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
348 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
349 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
350 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
351 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
352 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
353 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
354 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
355 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
356 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
357 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
358 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
359 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
360 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
361 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
362 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
363 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
364 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
365 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
366 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
367 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
368 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
369 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
370 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
371 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
372 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
373 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
374 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
375 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
376 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
377 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
378 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
379 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
380 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
381 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
382 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
383 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
384 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
385 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
386 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
387 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
388 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
389 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
390 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
391 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
392 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
393 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
394 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
395 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
396 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
397 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
398 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
399 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
400 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
401 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
402 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
403 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
404 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
405 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
406 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
407 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
408 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
409 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
410 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
411 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
412 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
413 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
414 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
415 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
416 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
417 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
418 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
419 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
420 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
421 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
422 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
423 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
424 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
425 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
426 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
427 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
428 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
429 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
430 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
431 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
432 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
433 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
434 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
435 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
436 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
437 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
438 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
439 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
440 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
448 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
450 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
454 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
455 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
456 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
457 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
458 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
459 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
460 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
461 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
462 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
463 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
464 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
465 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
466 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
467 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
470 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
471 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
472 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
473 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
474 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
475 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
476 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
477 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
478 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
479 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
480 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
481 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
482 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
483 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
484 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
485 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
486 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
487 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
488 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
489 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
490 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
491 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
492 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
493 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
494 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
495 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
496 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
497 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
498 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
499 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
500 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
501 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
502 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
503 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
504 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
505 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
506 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
507 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
508 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
509 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
510 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
511 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
512 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
513 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
514 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
515 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
516 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
517 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
518 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
519 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
520 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
521 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
522 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
523 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
524 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
525 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
526 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
527 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
528 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
529 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
530 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
531 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
532 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
533 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
534 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
535 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
536 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
537 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
538 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
539 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
541 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
542 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
543 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
544 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
545 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
546 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
547 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
548 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
549 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
550 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
551 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
552 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
553 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
554 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
555 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
556 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
557 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
558 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
559 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
560 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
561 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
562 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
563 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
564 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
565 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
566 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
567 2643221651 Afipia sp. Root123D2 Isolate Unclassified
568 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
569 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
570 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
571 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
572 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
573 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
574 2791355199
575 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
576 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
577 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
578 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
579 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
580 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
581 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
582 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
583 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
584 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
585 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
586 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
587 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
588 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
589 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
590 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
591 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
592 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
593 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
594 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
595 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
596 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
597 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
598 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
599 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
600 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
601 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
602 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
603 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
604 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
605 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
606 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
607 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
608 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
609 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
610 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
611 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
612 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
613 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
614 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
615 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
616 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
617 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
618 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
619 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
620 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
621 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
622 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
623 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
624 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
625 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
626 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
627 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
628 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
629 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
630 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
631 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
632 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
633 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
634 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
635 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
636 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
637 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
638 2906610324
639 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
640 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
641 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
642 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
643 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
644 2922368715
645 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
646 2922425934
647 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
648 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
649 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
650 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
651 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
652 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
653 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
654 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
655 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
656 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
657 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
658 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
659 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
660 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
661 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
662 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
663 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
664 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
665 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
666 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
667 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
668 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
669 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
670 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
671 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
672 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
673 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
674 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
675 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
676 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
677 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
678 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
679 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
680 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
681 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
682 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
683 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
684 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
685 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
686 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
687 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
688 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
689 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
690 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
691 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
692 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
693 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
694 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
695 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
696 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
697 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
698 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
699 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
700 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
701 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
702 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
703 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
704 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
705 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
706 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
707 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
708 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
709 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
710 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
711 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
712 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
713 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
714 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
715 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
716 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
717 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
718 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
719 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
720 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
721 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
722 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
723 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
724 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
725 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
726 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
727 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
728 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
729 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
730 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
731 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
732 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
733 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
734 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
735 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
736 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
737 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
738 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
739 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
740 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
741 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
742 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
743 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
744 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
745 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
746 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
747 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
748 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
749 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
750 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
751 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
752 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
753 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
754 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
755 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.39
Metatranscriptomes 0.63
Isolates 11.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.42
Nodule 9.56
Rhizoplane 4.72
Rhizosphere 65.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0109985 3300049568 Bacteria 1799
2 JGI24741J21665_1039409 3300001915 Bacteria 698
3 JGI24740J21852_10003892 3300001979 Bacteria 6483
4 JGI24737J22298_10064718 3300001990 Bacteria 1097
5 JGI24735J21928_10060318 3300002067 Bacteria 1090
6 JGI24738J21930_10096861 3300002075 Bacteria 628
7 JGI24742J22300_10027093 3300002244 Bacteria 993
8 JGI25165J46597_1029680 3300003214 Bacteria 706
9 JGI25165J46597_1040290 3300003214 Bacteria 600
10 JGI25153J46596_10013493 3300003215 Bacteria 3448
11 JGI25153J46596_10014078 3300003215 Bacteria 3345
12 JGI25153J46596_10070966 3300003215 Bacteria 902
13 JGI25160J50197_1003238 3300003354 Bacteria 7344
14 JGI25160J50197_1020072 3300003354 Bacteria 2028
15 JGI25404J52841_10003406 3300003659 Bacteria 3139
16 JGI25404J52841_10026407 3300003659 Bacteria 1249
17 Ga0055525_1009691 3300003759 Bacteria 813
18 Ga0055542_1005917 3300003762 Bacteria 2681
19 Ga0055529_1037036 3300003763 Bacteria 594
20 Ga0055526_1094550 3300003771 Bacteria 558
21 Ga0055524_1051419 3300003775 Bacteria 930
22 Ga0055531_10033850 3300003794 Bacteria 1635
23 Ga0055543_1002483 3300004625 Bacteria 6074
24 Ga0055543_1017973 3300004625 Bacteria 1324
25 Ga0065165_1000866 3300005262 Bacteria 39512
26 Ga0065165_1010304 3300005262 Bacteria 4058
27 Ga0065165_1011062 3300005262 Bacteria 3817
28 Ga0065165_1022843 3300005262 Bacteria 2133
29 Ga0065165_1023762 3300005262 Bacteria 2071
30 Ga0065165_1126985 3300005262 Bacteria 613
31 Ga0070658_10204771 3300005327 Bacteria 1666
32 Ga0070658_10221713 3300005327 Bacteria 1599
33 Ga0070658_10570579 3300005327 Bacteria 980
34 Ga0070683_100080343 3300005329 Bacteria 3052
35 Ga0070683_100574399 3300005329 Bacteria 1078
36 Ga0070683_100591401 3300005329 Bacteria 1062
37 Ga0070690_100402238 3300005330 Bacteria 1006
38 Ga0070670_101356060 3300005331 Bacteria 652
39 Ga0068869_100334072 3300005334 Bacteria 1232
40 Ga0068869_101316200 3300005334 Bacteria 638
41 Ga0070666_11089069 3300005335 Bacteria 594
42 Ga0070680_100184081 3300005336 Bacteria 1759
43 Ga0070680_100323344 3300005336 Bacteria 1309
44 Ga0070682_100022257 3300005337 Bacteria 3753
45 Ga0070682_100065301 3300005337 Bacteria 2312
46 Ga0070682_100719122 3300005337 Bacteria 803
47 Ga0070682_101008069 3300005337 Bacteria 691
48 Ga0070682_101723733 3300005337 Bacteria 545
49 Ga0068868_100678638 3300005338 Bacteria 920
50 Ga0070660_100674651 3300005339 Bacteria 866
51 Ga0070660_100757012 3300005339 Bacteria 816
52 Ga0070660_101065446 3300005339 Bacteria 684
53 Ga0070689_100243712 3300005340 Bacteria 1481
54 Ga0070689_100626786 3300005340 Bacteria 934
55 Ga0070691_10344385 3300005341 Bacteria 826
56 Ga0070687_101146268 3300005343 Bacteria 571
57 Ga0070661_101425714 3300005344 Bacteria 583
58 Ga0070668_100027110 3300005347 Bacteria 4348
59 Ga0070668_100103345 3300005347 Bacteria 2260
60 Ga0070668_100225475 3300005347 Bacteria 1547
61 Ga0070668_100676450 3300005347 Bacteria 908
62 Ga0070668_100709753 3300005347 Bacteria 887
63 Ga0070668_101156388 3300005347 Bacteria 700
64 Ga0070668_101213991 3300005347 Bacteria 683
65 Ga0070668_101326768 3300005347 Bacteria 654
66 Ga0070669_100641980 3300005353 Bacteria 892
67 Ga0070669_101570086 3300005353 Bacteria 573
68 Ga0070675_100268798 3300005354 Bacteria 1496
69 Ga0070675_101532882 3300005354 Bacteria 615
70 Ga0070671_101027901 3300005355 Bacteria 722
71 Ga0070671_101369625 3300005355 Bacteria 625
72 Ga0070671_101379069 3300005355 Bacteria 622
73 Ga0070674_100036028 3300005356 Bacteria 3318
74 Ga0070673_100380173 3300005364 Bacteria 1259
75 Ga0070673_100717943 3300005364 Bacteria 919
76 Ga0070673_101548483 3300005364 Bacteria 626
77 Ga0070673_101603820 3300005364 Bacteria 615
78 Ga0070688_100549144 3300005365 Bacteria 878
79 Ga0070659_100633869 3300005366 Bacteria 920
80 Ga0070667_100523159 3300005367 Bacteria 1089
81 Ga0070667_101912606 3300005367 Bacteria 559
82 Ga0070709_10017774 3300005434 Bacteria 4085
83 Ga0070709_10861234 3300005434 Bacteria 714
84 Ga0070709_10985969 3300005434 Bacteria 670
85 Ga0070714_100002475 3300005435 Bacteria 13625
86 Ga0070714_100058996 3300005435 Bacteria 3289
87 Ga0070714_100066539 3300005435 Bacteria 3105
88 Ga0070714_100937885 3300005435 Bacteria 841
89 Ga0070713_100016516 3300005436 Bacteria 5551
90 Ga0070713_100034524 3300005436 Bacteria 4065
91 Ga0070713_100533926 3300005436 Bacteria 1109
92 Ga0070710_10003075 3300005437 Bacteria 7926
93 Ga0070710_10030941 3300005437 Bacteria 2884
94 Ga0070710_11332738 3300005437 Bacteria 535
95 Ga0070701_10110115 3300005438 Bacteria 1538
96 Ga0070711_100006263 3300005439 Bacteria 7167
97 Ga0070711_100022019 3300005439 Bacteria 4126
98 Ga0070711_100150274 3300005439 Bacteria 1755
99 Ga0070711_101083321 3300005439 Bacteria 690
100 Ga0070711_101998848 3300005439 Bacteria 510
101 Ga0070705_100306555 3300005440 Bacteria 1140
102 Ga0070705_100348583 3300005440 Bacteria 1079
103 Ga0070700_100051471 3300005441 Bacteria 2563
104 Ga0070700_101581133 3300005441 Bacteria 560
105 Ga0070663_100059209 3300005455 Bacteria 2753
106 Ga0070663_100059935 3300005455 Bacteria 2736
107 Ga0070663_100241130 3300005455 Bacteria 1427
108 Ga0070663_100372867 3300005455 Bacteria 1160
109 Ga0070663_100409223 3300005455 Bacteria 1110
110 Ga0070663_100419178 3300005455 Bacteria 1098
111 Ga0070663_100702748 3300005455 Bacteria 859
112 Ga0070663_101534964 3300005455 Bacteria 593
113 Ga0070678_100170830 3300005456 Bacteria 1771
114 Ga0070678_100713201 3300005456 Bacteria 905
115 Ga0070678_100869356 3300005456 Bacteria 822
116 Ga0070678_101804424 3300005456 Bacteria 577
117 Ga0070662_100126386 3300005457 Bacteria 1966
118 Ga0070662_100322160 3300005457 Bacteria 1260
119 Ga0070681_10084335 3300005458 Bacteria 3129
120 Ga0070681_10096897 3300005458 Bacteria 2897
121 Ga0070681_10262844 3300005458 Bacteria 1638
122 Ga0070681_10660549 3300005458 Bacteria 960
123 Ga0070681_10747395 3300005458 Bacteria 894
124 Ga0070681_11441717 3300005458 Bacteria 612
125 Ga0068867_100233906 3300005459 Bacteria 1487
126 Ga0068867_101855550 3300005459 Bacteria 568
127 Ga0070685_11182605 3300005466 Bacteria 580
128 Ga0070706_100116094 3300005467 Bacteria 2493
129 Ga0070706_100317605 3300005467 Bacteria 1453
130 Ga0070707_101459110 3300005468 Bacteria 651
131 Ga0070698_100476302 3300005471 Bacteria 1185
132 Ga0070699_100771608 3300005518 Bacteria 879
133 Ga0070679_100087318 3300005530 Bacteria 3106
134 Ga0070679_100126650 3300005530 Bacteria 2536
135 Ga0070679_100200770 3300005530 Bacteria 1960
136 Ga0070679_100579527 3300005530 Bacteria 1065
137 Ga0070679_100669564 3300005530 Bacteria 980
138 Ga0070684_100212950 3300005535 Bacteria 1761
139 Ga0070684_100237885 3300005535 Bacteria 1663
140 Ga0070684_100674972 3300005535 Bacteria 963
141 Ga0070684_100747921 3300005535 Bacteria 913
142 Ga0070684_101231826 3300005535 Bacteria 704
143 Ga0070684_101786378 3300005535 Bacteria 580
144 Ga0070697_101686728 3300005536 Bacteria 567
145 Ga0068853_100015392 3300005539 Bacteria 6283
146 Ga0068853_100302927 3300005539 Bacteria 1478
147 Ga0068853_101019774 3300005539 Bacteria 797
148 Ga0068853_101174988 3300005539 Bacteria 741
149 Ga0068853_101311547 3300005539 Bacteria 700
150 Ga0068853_101755410 3300005539 Bacteria 602
151 Ga0068853_102313219 3300005539 Bacteria 521
152 Ga0070672_100790270 3300005543 Bacteria 835
153 Ga0070695_101447313 3300005545 Bacteria 571
154 Ga0070693_100570730 3300005547 Bacteria 813
155 Ga0070693_101027490 3300005547 Bacteria 625
156 Ga0070693_101531489 3300005547 Bacteria 522
157 Ga0070665_100092371 3300005548 Bacteria 3031
158 Ga0070665_100127107 3300005548 Bacteria 2551
159 Ga0070665_100330442 3300005548 Bacteria 1529
160 Ga0070665_101208911 3300005548 Bacteria 766
161 Ga0070665_101529383 3300005548 Bacteria 676
162 Ga0070704_101578851 3300005549 Bacteria 605
163 Ga0068855_100008396 3300005563 Bacteria 12491
164 Ga0068855_100124660 3300005563 Bacteria 2946
165 Ga0068855_100384532 3300005563 Bacteria 1540
166 Ga0068855_100649624 3300005563 Bacteria 1133
167 Ga0068855_100653885 3300005563 Bacteria 1128
168 Ga0068855_100789492 3300005563 Bacteria 1010
169 Ga0068855_100981151 3300005563 Bacteria 888
170 Ga0068855_101141820 3300005563 Bacteria 813
171 Ga0068855_101451879 3300005563 Bacteria 705
172 Ga0068855_101912426 3300005563 Bacteria 601
173 Ga0070664_100736471 3300005564 Bacteria 920
174 Ga0070664_101654769 3300005564 Bacteria 606
175 Ga0070664_101954281 3300005564 Bacteria 557
176 Ga0068857_100073217 3300005577 Bacteria 3052
177 Ga0068857_100556865 3300005577 Bacteria 1081
178 Ga0068857_100897611 3300005577 Bacteria 850
179 Ga0068854_100019162 3300005578 Bacteria 4607
180 Ga0068854_100099336 3300005578 Bacteria 2180
181 Ga0068854_100699635 3300005578 Bacteria 875
182 Ga0068854_100720306 3300005578 Bacteria 863
183 Ga0068856_100000434 3300005614 Bacteria 45889
184 Ga0068856_100005400 3300005614 Bacteria 12602
185 Ga0068856_100061916 3300005614 Bacteria 3696
186 Ga0068856_100743754 3300005614 Bacteria 1001
187 Ga0068856_101057347 3300005614 Bacteria 829
188 Ga0068856_101189174 3300005614 Bacteria 779
189 Ga0068856_101318671 3300005614 Bacteria 737
190 Ga0068856_102443135 3300005614 Bacteria 530
191 Ga0070702_100249335 3300005615 Bacteria 1203
192 Ga0070702_100634662 3300005615 Bacteria 806
193 Ga0068852_100132591 3300005616 Bacteria 2296
194 Ga0068852_100527483 3300005616 Bacteria 1179
195 Ga0068852_100789814 3300005616 Bacteria 963
196 Ga0068852_100805237 3300005616 Bacteria 954
197 Ga0068852_101325965 3300005616 Bacteria 741
198 Ga0068852_102771576 3300005616 Bacteria 509
199 Ga0068859_100267086 3300005617 Bacteria 1803
200 Ga0068859_100771897 3300005617 Bacteria 1049
201 Ga0068859_101278078 3300005617 Bacteria 809
202 Ga0068859_101337940 3300005617 Bacteria 790
203 Ga0068864_100044659 3300005618 Bacteria 3799
204 Ga0068864_101146526 3300005618 Bacteria 775
205 Ga0068864_101589712 3300005618 Bacteria 658
206 Ga0068864_101986355 3300005618 Bacteria 588
207 Ga0068866_10098727 3300005718 Bacteria 1607
208 Ga0068861_100121270 3300005719 Bacteria 2110
209 Ga0068861_100416119 3300005719 Bacteria 1196
210 Ga0068861_100952346 3300005719 Bacteria 816
211 Ga0068861_102615341 3300005719 Bacteria 509
212 Ga0068851_10481872 3300005834 Bacteria 741
213 Ga0068851_10529726 3300005834 Bacteria 710
214 Ga0068851_10626367 3300005834 Bacteria 657
215 Ga0068851_10646483 3300005834 Bacteria 647
216 Ga0068870_11344868 3300005840 Bacteria 522
217 Ga0068863_101910023 3300005841 Bacteria 604
218 Ga0068858_100352559 3300005842 Bacteria 1410
219 Ga0068858_100352925 3300005842 Bacteria 1409
220 Ga0068858_100457297 3300005842 Bacteria 1231
221 Ga0068858_101916626 3300005842 Bacteria 586
222 Ga0068860_100094368 3300005843 Bacteria 2852
223 Ga0068860_100181953 3300005843 Bacteria 2031
224 Ga0068860_100516941 3300005843 Bacteria 1193
225 Ga0068860_100582840 3300005843 Bacteria 1123
226 Ga0068860_101744102 3300005843 Bacteria 644
227 Ga0068860_102133163 3300005843 Bacteria 581
228 Ga0068860_102796618 3300005843 Bacteria 506
229 Ga0068862_100464415 3300005844 Bacteria 1195
230 Ga0068862_100750303 3300005844 Bacteria 949
231 Ga0068862_100783975 3300005844 Bacteria 930
232 Ga0068862_100947776 3300005844 Bacteria 849
233 Ga0068862_100983825 3300005844 Bacteria 833
234 Ga0068862_101693133 3300005844 Bacteria 641
235 Ga0068862_102234268 3300005844 Bacteria 559
236 Ga0068862_102504649 3300005844 Bacteria 528
237 Ga0081455_10062610 3300005937 Bacteria 3126
238 Ga0081455_10071493 3300005937 Bacteria 2876
239 Ga0081540_1001986 3300005983 Bacteria 17063
240 Ga0081540_1010395 3300005983 Bacteria 6309
241 Ga0081540_1011052 3300005983 Bacteria 6062
242 Ga0081540_1016453 3300005983 Bacteria 4627
243 Ga0081540_1023463 3300005983 Bacteria 3607
244 Ga0081540_1041957 3300005983 Bacteria 2366
245 Ga0081540_1071971 3300005983 Bacteria 1595
246 Ga0081540_1092814 3300005983 Bacteria 1324
247 Ga0081540_1145351 3300005983 Bacteria 945
248 Ga0081539_10013759 3300005985 Bacteria 6065
249 Ga0081539_10396844 3300005985 Bacteria 574
250 Ga0070717_10065842 3300006028 Bacteria 3012
251 Ga0075365_10097363 3300006038 Bacteria 2011
252 Ga0075365_10107287 3300006038 Bacteria 1917
253 Ga0075365_11345418 3300006038 Bacteria 502
254 Ga0075368_10056260 3300006042 Bacteria 1569
255 Ga0075368_10092443 3300006042 Bacteria 1238
256 Ga0075368_10274453 3300006042 Bacteria 724
257 Ga0075363_101062091 3300006048 Bacteria 501
258 Ga0075364_10190920 3300006051 Bacteria 1387
259 Ga0075364_10468852 3300006051 Bacteria 861
260 Ga0075364_10936206 3300006051 Bacteria 590
261 Ga0075432_10492276 3300006058 Bacteria 545
262 Ga0070715_10043512 3300006163 Bacteria 1894
263 Ga0070715_10295213 3300006163 Bacteria 865
264 Ga0070716_100016118 3300006173 Bacteria 3852
265 Ga0070716_100185644 3300006173 Bacteria 1369
266 Ga0070716_101275788 3300006173 Bacteria 593
267 Ga0070712_100050760 3300006175 Bacteria 2887
268 Ga0070712_100575869 3300006175 Bacteria 951
269 Ga0070712_101135649 3300006175 Bacteria 679
270 Ga0075362_10059567 3300006177 Bacteria 1724
271 Ga0075362_10598861 3300006177 Bacteria 569
272 Ga0075367_10148611 3300006178 Bacteria 1453
273 Ga0075367_10312304 3300006178 Bacteria 990
274 Ga0075367_10740338 3300006178 Bacteria 626
275 Ga0075367_11122976 3300006178 Bacteria 503
276 Ga0075369_10146678 3300006186 Bacteria 1078
277 Ga0075369_10186348 3300006186 Bacteria 956
278 Ga0075369_10300467 3300006186 Bacteria 749
279 Ga0075369_10319411 3300006186 Bacteria 726
280 Ga0075369_10540560 3300006186 Bacteria 555
281 Ga0075366_10005462 3300006195 Bacteria 6889
282 Ga0097621_101499515 3300006237 Bacteria 640
283 Ga0097621_102125256 3300006237 Bacteria 537
284 Ga0097621_102135595 3300006237 Bacteria 536
285 Ga0075370_10073378 3300006353 Bacteria 1959
286 Ga0075370_10228233 3300006353 Bacteria 1101
287 Ga0075370_10628003 3300006353 Bacteria 651
288 Ga0068871_100145881 3300006358 Bacteria 2015
289 Ga0068871_101527357 3300006358 Bacteria 631
290 Ga0075428_101200724 3300006844 Bacteria 800
291 Ga0075430_101764075 3300006846 Bacteria 508
292 Ga0075431_101584803 3300006847 Bacteria 613
293 Ga0075434_100234820 3300006871 Bacteria 1854
294 Ga0068865_100872936 3300006881 Bacteria 781
295 Ga0068865_101162736 3300006881 Bacteria 682
296 Ga0068865_102066046 3300006881 Bacteria 518
297 Ga0097620_100267064 3300006931 Bacteria 1803
298 Ga0097620_100771877 3300006931 Bacteria 1049
299 Ga0097620_101277975 3300006931 Bacteria 809
300 Ga0097620_101337906 3300006931 Bacteria 790
301 Ga0099823_1027763 3300006944 Bacteria 4912
302 Ga0099794_10638545 3300007265 Bacteria 565
303 Ga0105251_10116124 3300009011 Bacteria 1217
304 Ga0105240_10020447 3300009093 Bacteria 8829
305 Ga0105240_10032668 3300009093 Bacteria 6735
306 Ga0105240_10067994 3300009093 Bacteria 4414
307 Ga0105240_10123204 3300009093 Bacteria 3119
308 Ga0105240_11384214 3300009093 Bacteria 740
309 Ga0111539_10214088 3300009094 Bacteria 2245
310 Ga0105245_10031801 3300009098 Bacteria 4672
311 Ga0105245_10315878 3300009098 Bacteria 1538
312 Ga0105245_10626271 3300009098 Bacteria 1104
313 Ga0105245_10795918 3300009098 Bacteria 983
314 Ga0105245_12480324 3300009098 Bacteria 572
315 Ga0105247_10066555 3300009101 Bacteria 2244
316 Ga0105247_10118677 3300009101 Bacteria 1711
317 Ga0105247_10330792 3300009101 Bacteria 1066
318 Ga0105247_10409673 3300009101 Bacteria 968
319 Ga0114129_10476531 3300009147 Bacteria 1634
320 Ga0105243_10031732 3300009148 Bacteria 4075
321 Ga0105243_10097091 3300009148 Bacteria 2439
322 Ga0105243_10708020 3300009148 Bacteria 982
323 Ga0105243_10912673 3300009148 Bacteria 874
324 Ga0105243_11491850 3300009148 Bacteria 699
325 Ga0105243_11803389 3300009148 Bacteria 643
326 Ga0105241_10051103 3300009174 Bacteria 3151
327 Ga0105241_10141894 3300009174 Bacteria 1957
328 Ga0105241_10191140 3300009174 Bacteria 1704
329 Ga0105241_10257250 3300009174 Bacteria 1483
330 Ga0105241_10422692 3300009174 Bacteria 1173
331 Ga0105241_11075203 3300009174 Bacteria 756
332 Ga0105241_11303280 3300009174 Bacteria 692
333 Ga0105241_11444864 3300009174 Bacteria 660
334 Ga0105242_10405686 3300009176 Bacteria 1273
335 Ga0105242_10911093 3300009176 Bacteria 880
336 Ga0105248_10495852 3300009177 Bacteria 1377
337 Ga0105248_10704512 3300009177 Bacteria 1139
338 Ga0105248_11416245 3300009177 Bacteria 786
339 Ga0105248_12942386 3300009177 Bacteria 543
340 Ga0105237_10068396 3300009545 Bacteria 3545
341 Ga0105237_10202106 3300009545 Bacteria 1987
342 Ga0105237_10349957 3300009545 Bacteria 1482
343 Ga0105237_10739361 3300009545 Bacteria 990
344 Ga0105237_11679668 3300009545 Bacteria 642
345 Ga0105237_11971455 3300009545 Bacteria 592
346 Ga0105237_12139234 3300009545 Bacteria 569
347 Ga0105237_12358215 3300009545 Bacteria 542
348 Ga0105238_10069444 3300009551 Bacteria 3523
349 Ga0105238_10076960 3300009551 Bacteria 3329
350 Ga0105238_10678338 3300009551 Bacteria 1042
351 Ga0105238_10885517 3300009551 Bacteria 911
352 Ga0105238_11797443 3300009551 Bacteria 645
353 Ga0105238_12228493 3300009551 Bacteria 583
354 Ga0105238_12447305 3300009551 Bacteria 558
355 Ga0105238_12489346 3300009551 Bacteria 553
356 Ga0105249_10143905 3300009553 Bacteria 2289
357 Ga0105249_10707366 3300009553 Bacteria 1068
358 Ga0105249_11300009 3300009553 Bacteria 799
359 Ga0105249_11762875 3300009553 Bacteria 692
360 Ga0105249_12482901 3300009553 Bacteria 591
361 Ga0105239_10136576 3300010375 Bacteria 2730
362 Ga0105239_10252645 3300010375 Bacteria 1980
363 Ga0105239_10295488 3300010375 Bacteria 1824
364 Ga0105239_10467899 3300010375 Bacteria 1431
365 Ga0105239_10910537 3300010375 Bacteria 1009
366 Ga0105239_11114301 3300010375 Bacteria 909
367 Ga0105239_11254122 3300010375 Bacteria 855
368 Ga0105239_11813511 3300010375 Bacteria 707
369 Ga0105239_12687794 3300010375 Bacteria 581
370 Ga0105239_12819868 3300010375 Bacteria 567
371 Ga0105246_10114181 3300011119 Bacteria 1990
372 Ga0105246_10218354 3300011119 Bacteria 1493
373 Ga0105246_10872372 3300011119 Bacteria 805
374 Ga0105246_11483025 3300011119 Bacteria 636
375 Ga0157339_1034756 3300012505 Bacteria 607
376 Ga0157373_11425573 3300013100 Bacteria 527
377 Ga0157371_10348472 3300013102 Bacteria 1078
378 Ga0157371_11320995 3300013102 Bacteria 558
379 Ga0157370_10090911 3300013104 Bacteria 2866
380 Ga0157370_10140430 3300013104 Bacteria 2251
381 Ga0157370_10401657 3300013104 Bacteria 1261
382 Ga0157370_11166473 3300013104 Bacteria 695
383 Ga0157370_11663209 3300013104 Bacteria 573
384 Ga0157370_11918328 3300013104 Bacteria 531
385 Ga0157369_10048658 3300013105 Bacteria 4600
386 Ga0157369_10118638 3300013105 Bacteria 2808
387 Ga0157369_10185391 3300013105 Bacteria 2188
388 Ga0157369_11543996 3300013105 Bacteria 675
389 Ga0157369_12228347 3300013105 Bacteria 555
390 Ga0157374_10529953 3300013296 Bacteria 1184
391 Ga0157374_10749612 3300013296 Bacteria 991
392 Ga0157374_11375641 3300013296 Bacteria 728
393 Ga0157374_12321793 3300013296 Bacteria 564
394 Ga0157378_10014728 3300013297 Bacteria 6851
395 Ga0157378_10491703 3300013297 Bacteria 1224
396 Ga0157378_11221061 3300013297 Bacteria 792
397 Ga0157378_11528315 3300013297 Bacteria 712
398 Ga0157378_12182810 3300013297 Bacteria 605
399 Ga0157378_13165040 3300013297 Bacteria 511
400 Ga0163162_10291076 3300013306 Bacteria 1765
401 Ga0163162_10460734 3300013306 Bacteria 1403
402 Ga0163162_10770747 3300013306 Bacteria 1080
403 Ga0163162_11033690 3300013306 Bacteria 930
404 Ga0157372_10202040 3300013307 Bacteria 2302
405 Ga0157372_10595679 3300013307 Bacteria 1288
406 Ga0157372_12152679 3300013307 Bacteria 641
407 Ga0157372_12222735 3300013307 Bacteria 630
408 Ga0157375_10304167 3300013308 Bacteria 1758
409 Ga0157375_10488402 3300013308 Bacteria 1396
410 Ga0157375_10518059 3300013308 Bacteria 1356
411 Ga0157375_11551865 3300013308 Bacteria 782
412 Ga0157375_12717917 3300013308 Bacteria 592
413 Ga0163163_10012414 3300014325 Bacteria 7761
414 Ga0163163_10117591 3300014325 Bacteria 2690
415 Ga0163163_10376207 3300014325 Bacteria 1478
416 Ga0163163_10552941 3300014325 Bacteria 1213
417 Ga0163163_11405763 3300014325 Bacteria 759
418 Ga0163163_12015612 3300014325 Bacteria 637
419 Ga0157380_10238260 3300014326 Bacteria 1639
420 Ga0157380_10257963 3300014326 Bacteria 1582
421 Ga0157380_12748899 3300014326 Bacteria 559
422 Ga0182008_10229719 3300014497 Bacteria 951
423 Ga0182008_10421868 3300014497 Bacteria 720
424 Ga0157377_10160804 3300014745 Bacteria 1396
425 Ga0157377_10285293 3300014745 Bacteria 1084
426 Ga0157379_10265737 3300014968 Bacteria 1560
427 Ga0157379_10537004 3300014968 Bacteria 1087
428 Ga0157379_11006002 3300014968 Bacteria 795
429 Ga0157379_12175361 3300014968 Bacteria 551
430 Ga0157376_10183873 3300014969 Bacteria 1912
431 Ga0157376_10330872 3300014969 Bacteria 1451
432 Ga0157376_10513130 3300014969 Bacteria 1180
433 Ga0157376_10709027 3300014969 Bacteria 1012
434 Ga0157376_12077369 3300014969 Bacteria 606
435 Ga0157376_12209839 3300014969 Bacteria 589
436 Ga0157376_12931498 3300014969 Bacteria 516
437 Ga0182007_10325147 3300015262 Bacteria 571
438 Ga0163161_10137351 3300017792 Bacteria 1849
439 Ga0163161_10352321 3300017792 Bacteria 1170
440 Ga0163161_11299496 3300017792 Bacteria 632
441 Ga0206356_10486896 3300020070 Bacteria 1623
442 Ga0206349_1412442 3300020075 Bacteria 531
443 Ga0206351_10094307 3300020077 Bacteria 740
444 Ga0206353_11896996 3300020082 Bacteria 1411
445 Ga0206353_12028210 3300020082 Bacteria 1797
446 Ga0214542_1022513 3300021321 Bacteria 4021
447 Ga0214545_1013953 3300021324 Bacteria 9654
448 Ga0213873_10014380 3300021358 Bacteria 1753
449 Ga0213874_10007250 3300021377 Bacteria 2654
450 Ga0213874_10237960 3300021377 Bacteria 667
451 Ga0213874_10291617 3300021377 Bacteria 612
452 Ga0213876_10001341 3300021384 Bacteria 15407
453 Ga0213876_10622122 3300021384 Bacteria 575
454 Ga0213871_10006629 3300021441 Bacteria 2460
455 Ga0213871_10027378 3300021441 Bacteria 1464
456 Ga0213871_10043318 3300021441 Bacteria 1214
457 Ga0224712_10002831 3300022467 Bacteria 4372
458 Ga0224712_10191098 3300022467 Bacteria 927
459 Ga0224712_10556904 3300022467 Bacteria 557
460 Ga0224575_103157 3300023224 Bacteria 892
461 Ga0228598_1067208 3300024227 Bacteria 716
462 Ga0209563_109801 3300025230 Bacteria 1431
463 Ga0209677_101244 3300025253 Bacteria 11496
464 Ga0209677_120171 3300025253 Bacteria 783
465 Ga0209148_1000253 3300025254 Bacteria 84643
466 Ga0209233_1001970 3300025261 Bacteria 7805
467 Ga0209233_1009212 3300025261 Bacteria 3015
468 Ga0209233_1015628 3300025261 Bacteria 2110
469 Ga0209233_1020333 3300025261 Bacteria 1744
470 Ga0209233_1032320 3300025261 Bacteria 1211
471 Ga0209233_1033133 3300025261 Bacteria 1188
472 Ga0209455_1005205 3300025272 Bacteria 4072
473 Ga0209455_1016606 3300025272 Bacteria 1576
474 Ga0209673_1073918 3300025273 Bacteria 802
475 Ga0209564_1011001 3300025295 Bacteria 4099
476 Ga0209564_1035938 3300025295 Bacteria 1424
477 Ga0209564_1072669 3300025295 Bacteria 707
478 Ga0209758_1000026 3300025297 Bacteria 582706
479 Ga0209758_1000318 3300025297 Bacteria 92807
480 Ga0209758_1001679 3300025297 Bacteria 24954
481 Ga0209758_1002424 3300025297 Bacteria 19060
482 Ga0209758_1003005 3300025297 Bacteria 16142
483 Ga0209758_1012954 3300025297 Bacteria 4603
484 Ga0209758_1040472 3300025297 Bacteria 1757
485 Ga0209758_1055859 3300025297 Bacteria 1337
486 Ga0209758_1085245 3300025297 Bacteria 942
487 Ga0209758_1097908 3300025297 Bacteria 842
488 Ga0209256_1013879 3300025299 Bacteria 2954
489 Ga0209256_1048828 3300025299 Bacteria 1034
490 Ga0207426_1000425 3300025302 Bacteria 69088
491 Ga0207426_1001506 3300025302 Bacteria 19028
492 Ga0207426_1019633 3300025302 Bacteria 2360
493 Ga0207426_1023817 3300025302 Bacteria 2085
494 Ga0207426_1047970 3300025302 Bacteria 1285
495 Ga0207426_1066358 3300025302 Bacteria 1020
496 Ga0207426_1130684 3300025302 Bacteria 609
497 Ga0209257_1002846 3300025304 Bacteria 16199
498 Ga0207697_10067874 3300025315 Bacteria 1491
499 Ga0207697_10269782 3300025315 Bacteria 754
500 Ga0207656_10049075 3300025321 Bacteria 1819
501 Ga0207656_10267790 3300025321 Bacteria 840
502 Ga0207656_10699567 3300025321 Bacteria 519
503 Ga0207696_1173139 3300025711 Bacteria 572
504 Ga0207692_10000488 3300025898 Bacteria 13997
505 Ga0207692_10004266 3300025898 Bacteria 5651
506 Ga0207692_10620122 3300025898 Bacteria 697
507 Ga0207642_10058752 3300025899 Bacteria 1776
508 Ga0207642_11101738 3300025899 Bacteria 513
509 Ga0207710_10113669 3300025900 Bacteria 1287
510 Ga0207710_10126255 3300025900 Bacteria 1226
511 Ga0207710_10261894 3300025900 Bacteria 867
512 Ga0207688_10104624 3300025901 Bacteria 1638
513 Ga0207688_10114482 3300025901 Bacteria 1569
514 Ga0207688_10154387 3300025901 Bacteria 1358
515 Ga0207688_10269127 3300025901 Bacteria 1036
516 Ga0207688_10484299 3300025901 Bacteria 774
517 Ga0207688_10656004 3300025901 Bacteria 662
518 Ga0207680_10343403 3300025903 Bacteria 1048
519 Ga0207680_10979788 3300025903 Bacteria 606
520 Ga0207647_10163198 3300025904 Bacteria 1299
521 Ga0207647_10169812 3300025904 Bacteria 1270
522 Ga0207647_10330416 3300025904 Bacteria 865
523 Ga0207647_10592334 3300025904 Bacteria 612
524 Ga0207685_10004113 3300025905 Bacteria 3648
525 Ga0207685_10016129 3300025905 Bacteria 2384
526 Ga0207685_10199438 3300025905 Bacteria 939
527 Ga0207685_10652935 3300025905 Bacteria 569
528 Ga0207699_10001075 3300025906 Bacteria 12927
529 Ga0207699_10003139 3300025906 Bacteria 7855
530 Ga0207699_10030662 3300025906 Bacteria 3011
531 Ga0207699_10302086 3300025906 Bacteria 1118
532 Ga0207645_10335603 3300025907 Bacteria 1010
533 Ga0207645_10877704 3300025907 Bacteria 609
534 Ga0207643_10076892 3300025908 Bacteria 1929
535 Ga0207705_10207299 3300025909 Bacteria 1486
536 Ga0207705_10410217 3300025909 Bacteria 1048
537 Ga0207684_10131596 3300025910 Bacteria 2147
538 Ga0207684_10201683 3300025910 Bacteria 1716
539 Ga0207654_10000069 3300025911 Bacteria 67460
540 Ga0207654_10049050 3300025911 Bacteria 2419
541 Ga0207654_10125513 3300025911 Bacteria 1618
542 Ga0207654_10387742 3300025911 Bacteria 969
543 Ga0207654_10553072 3300025911 Bacteria 818
544 Ga0207707_10001008 3300025912 Bacteria 27003
545 Ga0207707_10076991 3300025912 Bacteria 2911
546 Ga0207707_10171584 3300025912 Bacteria 1895
547 Ga0207707_10451508 3300025912 Bacteria 1100
548 Ga0207707_10482075 3300025912 Bacteria 1059
549 Ga0207695_10000634 3300025913 Bacteria 70325
550 Ga0207695_10000713 3300025913 Bacteria 64808
551 Ga0207695_10134863 3300025913 Bacteria 2423
552 Ga0207695_10250227 3300025913 Bacteria 1672
553 Ga0207671_10026824 3300025914 Bacteria 4310
554 Ga0207671_10077083 3300025914 Bacteria 2495
555 Ga0207671_10172829 3300025914 Bacteria 1679
556 Ga0207671_10187483 3300025914 Bacteria 1612
557 Ga0207671_10255812 3300025914 Bacteria 1377
558 Ga0207671_10443630 3300025914 Bacteria 1033
559 Ga0207671_10736072 3300025914 Bacteria 784
560 Ga0207671_10865203 3300025914 Bacteria 715
561 Ga0207671_11241561 3300025914 Bacteria 582
562 Ga0207693_10011789 3300025915 Bacteria 7066
563 Ga0207693_10061410 3300025915 Bacteria 2943
564 Ga0207693_10243103 3300025915 Bacteria 1413
565 Ga0207693_10402422 3300025915 Bacteria 1070
566 Ga0207693_11063703 3300025915 Bacteria 616
567 Ga0207663_10000176 3300025916 Bacteria 28557
568 Ga0207663_10006929 3300025916 Bacteria 5840
569 Ga0207663_10029467 3300025916 Bacteria 3224
570 Ga0207662_10128088 3300025918 Bacteria 1598
571 Ga0207662_10520782 3300025918 Bacteria 821
572 Ga0207657_10196812 3300025919 Bacteria 1623
573 Ga0207657_10769229 3300025919 Bacteria 745
574 Ga0207657_11031825 3300025919 Bacteria 630
575 Ga0207649_10316811 3300025920 Bacteria 1145
576 Ga0207649_11197226 3300025920 Bacteria 600
577 Ga0207649_11210314 3300025920 Bacteria 597
578 Ga0207649_11574737 3300025920 Bacteria 520
579 Ga0207652_10140370 3300025921 Bacteria 2160
580 Ga0207652_10223057 3300025921 Bacteria 1698
581 Ga0207652_10364529 3300025921 Bacteria 1304
582 Ga0207652_10892897 3300025921 Bacteria 785
583 Ga0207646_11354399 3300025922 Bacteria 620
584 Ga0207681_10806142 3300025923 Bacteria 784
585 Ga0207681_10891447 3300025923 Bacteria 745
586 Ga0207681_10990638 3300025923 Bacteria 705
587 Ga0207694_10000155 3300025924 Bacteria 70678
588 Ga0207694_10231438 3300025924 Bacteria 1509
589 Ga0207694_10260097 3300025924 Bacteria 1422
590 Ga0207694_10474368 3300025924 Bacteria 1046
591 Ga0207694_10980962 3300025924 Bacteria 715
592 Ga0207694_11835372 3300025924 Bacteria 509
593 Ga0207650_10223213 3300025925 Bacteria 1517
594 Ga0207659_11442012 3300025926 Bacteria 590
595 Ga0207687_10167142 3300025927 Bacteria 1693
596 Ga0207687_10180178 3300025927 Bacteria 1636
597 Ga0207687_11454019 3300025927 Bacteria 589
598 Ga0207700_10012901 3300025928 Bacteria 5409
599 Ga0207700_10022426 3300025928 Bacteria 4333
600 Ga0207700_10045905 3300025928 Bacteria 3228
601 Ga0207700_10183378 3300025928 Bacteria 1754
602 Ga0207664_10070672 3300025929 Bacteria 2810
603 Ga0207664_10140833 3300025929 Bacteria 2040
604 Ga0207664_10226807 3300025929 Bacteria 1622
605 Ga0207664_11867614 3300025929 Bacteria 523
606 Ga0207644_11213206 3300025931 Bacteria 634
607 Ga0207690_10230733 3300025932 Bacteria 1421
608 Ga0207690_10398681 3300025932 Bacteria 1097
609 Ga0207690_10561633 3300025932 Bacteria 928
610 Ga0207690_10848689 3300025932 Bacteria 756
611 Ga0207706_10207834 3300025933 Bacteria 1716
612 Ga0207706_10220011 3300025933 Bacteria 1663
613 Ga0207706_10464841 3300025933 Bacteria 1094
614 Ga0207706_10467450 3300025933 Bacteria 1090
615 Ga0207686_10125545 3300025934 Bacteria 1753
616 Ga0207686_11003370 3300025934 Bacteria 677
617 Ga0207686_11106996 3300025934 Bacteria 646
618 Ga0207709_10033563 3300025935 Bacteria 3015
619 Ga0207709_10114819 3300025935 Bacteria 1807
620 Ga0207709_10838008 3300025935 Bacteria 744
621 Ga0207670_10226453 3300025936 Bacteria 1434
622 Ga0207670_10245647 3300025936 Bacteria 1381
623 Ga0207669_10017298 3300025937 Bacteria 3693
624 Ga0207669_11146030 3300025937 Bacteria 657
625 Ga0207669_11264936 3300025937 Bacteria 626
626 Ga0207669_11556613 3300025937 Bacteria 564
627 Ga0207704_10623632 3300025938 Bacteria 885
628 Ga0207704_11383112 3300025938 Bacteria 603
629 Ga0207665_10018204 3300025939 Bacteria 4615
630 Ga0207665_10022725 3300025939 Bacteria 4129
631 Ga0207665_11188231 3300025939 Bacteria 608
632 Ga0207665_11300700 3300025939 Bacteria 580
633 Ga0207691_10753754 3300025940 Bacteria 820
634 Ga0207691_11601429 3300025940 Bacteria 530
635 Ga0207711_10678197 3300025941 Bacteria 961
636 Ga0207711_11520831 3300025941 Bacteria 612
637 Ga0207689_10142627 3300025942 Bacteria 1974
638 Ga0207689_10199718 3300025942 Bacteria 1650
639 Ga0207689_10264167 3300025942 Bacteria 1424
640 Ga0207689_10431518 3300025942 Bacteria 1100
641 Ga0207661_10114303 3300025944 Bacteria 2288
642 Ga0207661_10774099 3300025944 Bacteria 883
643 Ga0207661_10839094 3300025944 Bacteria 846
644 Ga0207679_10146728 3300025945 Bacteria 1915
645 Ga0207679_10457724 3300025945 Bacteria 1132
646 Ga0207679_11439960 3300025945 Bacteria 632
647 Ga0207667_10045630 3300025949 Bacteria 4640
648 Ga0207667_10142283 3300025949 Bacteria 2470
649 Ga0207667_10260251 3300025949 Bacteria 1774
650 Ga0207667_10280445 3300025949 Bacteria 1703
651 Ga0207667_10558203 3300025949 Bacteria 1158
652 Ga0207667_10842939 3300025949 Bacteria 911
653 Ga0207667_10968386 3300025949 Bacteria 839
654 Ga0207667_11094169 3300025949 Bacteria 780
655 Ga0207667_11108821 3300025949 Bacteria 774
656 Ga0207667_11284919 3300025949 Bacteria 709
657 Ga0207667_11466417 3300025949 Bacteria 654
658 Ga0207651_10322380 3300025960 Bacteria 1292
659 Ga0207651_11257891 3300025960 Bacteria 665
660 Ga0207712_10126263 3300025961 Bacteria 1942
661 Ga0207712_10223617 3300025961 Bacteria 1506
662 Ga0207712_10634862 3300025961 Bacteria 927
663 Ga0207712_11057998 3300025961 Bacteria 721
664 Ga0207712_11246021 3300025961 Bacteria 664
665 Ga0207712_12058734 3300025961 Bacteria 511
666 Ga0207668_10024406 3300025972 Bacteria 3901
667 Ga0207668_10095320 3300025972 Bacteria 2196
668 Ga0207668_10180217 3300025972 Bacteria 1665
669 Ga0207668_10295614 3300025972 Bacteria 1334
670 Ga0207668_10548987 3300025972 Bacteria 1001
671 Ga0207668_10961898 3300025972 Bacteria 762
672 Ga0207668_11183750 3300025972 Bacteria 686
673 Ga0207668_11244159 3300025972 Bacteria 669
674 Ga0207668_11354534 3300025972 Bacteria 641
675 Ga0207668_12055681 3300025972 Bacteria 514
676 Ga0207640_10082513 3300025981 Bacteria 2201
677 Ga0207640_10118979 3300025981 Bacteria 1888
678 Ga0207640_10206084 3300025981 Bacteria 1494
679 Ga0207640_10281722 3300025981 Bacteria 1306
680 Ga0207640_10613305 3300025981 Bacteria 923
681 Ga0207640_10685081 3300025981 Bacteria 877
682 Ga0207640_11835322 3300025981 Bacteria 548
683 Ga0207658_10337465 3300025986 Bacteria 1309
684 Ga0207658_10454621 3300025986 Bacteria 1134
685 Ga0207677_10104387 3300026023 Bacteria 2094
686 Ga0207677_12267214 3300026023 Bacteria 505
687 Ga0207703_10150217 3300026035 Bacteria 2031
688 Ga0207703_11091263 3300026035 Bacteria 767
689 Ga0207703_11416451 3300026035 Bacteria 668
690 Ga0207703_11493505 3300026035 Bacteria 650
691 Ga0207703_11956922 3300026035 Bacteria 562
692 Ga0207639_10004418 3300026041 Bacteria 9486
693 Ga0207639_10141940 3300026041 Bacteria 2002
694 Ga0207639_10500380 3300026041 Bacteria 1110
695 Ga0207639_10646018 3300026041 Bacteria 978
696 Ga0207639_10656720 3300026041 Bacteria 970
697 Ga0207639_11045700 3300026041 Bacteria 765
698 Ga0207639_11083596 3300026041 Bacteria 751
699 Ga0207639_11316267 3300026041 Bacteria 678
700 Ga0207639_11367158 3300026041 Bacteria 665
701 Ga0207678_10012307 3300026067 Bacteria 7512
702 Ga0207678_10023967 3300026067 Bacteria 5335
703 Ga0207678_10089381 3300026067 Bacteria 2633
704 Ga0207678_10136672 3300026067 Bacteria 2091
705 Ga0207678_10198754 3300026067 Bacteria 1714
706 Ga0207678_10232478 3300026067 Bacteria 1579
707 Ga0207678_11121585 3300026067 Bacteria 696
708 Ga0207708_10175374 3300026075 Bacteria 1700
709 Ga0207708_10833671 3300026075 Bacteria 795
710 Ga0207702_10000022 3300026078 Bacteria 192961
711 Ga0207702_10000041 3300026078 Bacteria 150754
712 Ga0207702_10007733 3300026078 Bacteria 9125
713 Ga0207702_10231775 3300026078 Bacteria 1726
714 Ga0207702_10429437 3300026078 Bacteria 1279
715 Ga0207702_10683805 3300026078 Bacteria 1010
716 Ga0207702_10776245 3300026078 Bacteria 947
717 Ga0207702_11607249 3300026078 Bacteria 643
718 Ga0207641_11935164 3300026088 Bacteria 591
719 Ga0207648_10588750 3300026089 Bacteria 1025
720 Ga0207648_11865645 3300026089 Bacteria 563
721 Ga0207676_10052651 3300026095 Bacteria 3183
722 Ga0207676_10265205 3300026095 Bacteria 1553
723 Ga0207676_11337168 3300026095 Bacteria 712
724 Ga0207674_10005530 3300026116 Bacteria 15001
725 Ga0207674_10015337 3300026116 Bacteria 8421
726 Ga0207674_10453889 3300026116 Bacteria 1239
727 Ga0207674_10540765 3300026116 Bacteria 1125
728 Ga0207674_11134082 3300026116 Bacteria 751
729 Ga0207675_100278865 3300026118 Bacteria 1624
730 Ga0207675_100860964 3300026118 Bacteria 921
731 Ga0207675_101613031 3300026118 Bacteria 669
732 Ga0207675_102358049 3300026118 Bacteria 545
733 Ga0207675_102687273 3300026118 Bacteria 506
734 Ga0207683_10074762 3300026121 Bacteria 2998
735 Ga0207683_10189497 3300026121 Bacteria 1867
736 Ga0207683_10381817 3300026121 Bacteria 1295
737 Ga0207683_10550499 3300026121 Bacteria 1067
738 Ga0207683_10753534 3300026121 Bacteria 903
739 Ga0207683_11103154 3300026121 Bacteria 736
740 Ga0207683_11943502 3300026121 Bacteria 537
741 Ga0207683_12085848 3300026121 Bacteria 515
742 Ga0207698_10044442 3300026142 Bacteria 3338
743 Ga0207698_10078408 3300026142 Bacteria 2652
744 Ga0207698_10100030 3300026142 Bacteria 2400
745 Ga0207698_10146286 3300026142 Bacteria 2044
746 Ga0207698_10186652 3300026142 Bacteria 1842
747 Ga0207698_10358025 3300026142 Bacteria 1381
748 Ga0207698_10722581 3300026142 Bacteria 993
749 Ga0207698_10851081 3300026142 Bacteria 917
750 Ga0207698_11308398 3300026142 Bacteria 739
751 Ga0207698_12302692 3300026142 Bacteria 551
752 Ga0207698_12526919 3300026142 Bacteria 524
753 Ga0209389_1000090 3300027296 Bacteria 83470
754 Ga0209389_1000119 3300027296 Bacteria 70614
755 Ga0209589_1000010 3300027357 Bacteria 237657
756 Ga0209489_100011 3300027361 Bacteria 244710
757 Ga0209489_100385 3300027361 Bacteria 79532
758 Ga0209700_100013 3300027363 Bacteria 341906
759 Ga0268266_10359041 3300028379 Bacteria 1370
760 Ga0268266_10537219 3300028379 Bacteria 1119
761 Ga0268266_10614064 3300028379 Bacteria 1045
762 Ga0268266_10653711 3300028379 Bacteria 1012
763 Ga0268266_10720069 3300028379 Bacteria 962
764 Ga0268266_10803928 3300028379 Bacteria 908
765 Ga0268266_11157136 3300028379 Bacteria 748
766 Ga0268266_12202753 3300028379 Bacteria 523
767 Ga0268265_10241475 3300028380 Bacteria 1594
768 Ga0268265_10557126 3300028380 Bacteria 1089
769 Ga0268265_10654088 3300028380 Bacteria 1010
770 Ga0268265_10702484 3300028380 Bacteria 977
771 Ga0268265_11026983 3300028380 Bacteria 815
772 Ga0268265_11562283 3300028380 Bacteria 664
773 Ga0268264_10368029 3300028381 Bacteria 1373
774 Ga0268264_10466858 3300028381 Bacteria 1225
775 Ga0268264_10764227 3300028381 Bacteria 964
776 Ga0268264_12202815 3300028381 Bacteria 559
777 Ga0265319_1052575 3300028563 Bacteria 1340
778 Ga0265334_10003794 3300028573 Bacteria 6832
779 Ga0265318_10040278 3300028577 Bacteria 1779
780 Ga0265323_10000529 3300028653 Bacteria 21172
781 Ga0265322_10065558 3300028654 Bacteria 1029
782 Ga0265336_10000169 3300028666 Bacteria 45875
783 Ga0307517_10291326 3300028786 Bacteria 922
784 Ga0307517_10445842 3300028786 Bacteria 672
785 Ga0307517_10610590 3300028786 Bacteria 536
786 Ga0307515_10467366 3300028794 Bacteria 875
787 Ga0307515_10659510 3300028794 Bacteria 659
788 Ga0265338_10000624 3300028800 Bacteria 61670
789 Ga0265338_11229494 3300028800 Bacteria 502
790 Ga0265324_10015145 3300029957 Bacteria 2840
791 Ga0265762_1052602 3300030760 Bacteria 821
792 Ga0265770_1131010 3300030878 Bacteria 536
793 Ga0265330_10109331 3300031235 Bacteria 1181
794 Ga0265339_10000560 3300031249 Bacteria 29070
795 Ga0307513_10290462 3300031456 Bacteria 1407
796 Ga0307513_10925441 3300031456 Bacteria 580
797 Ga0307509_10227270 3300031507 Bacteria 1672
798 Ga0307509_10281389 3300031507 Bacteria 1424
799 Ga0307408_101255530 3300031548 Bacteria 693
800 Ga0307508_10000501 3300031616 Bacteria 46845
801 Ga0265314_10202597 3300031711 Bacteria 1172
802 Ga0265342_10051874 3300031712 Bacteria 2446
803 Ga0316576_10306653 3300031727 Bacteria 1186
804 Ga0316578_10079450 3300031728 Bacteria 1950
805 Ga0307516_10001650 3300031730 Bacteria 30691
806 Ga0307516_10510548 3300031730 Bacteria 856
807 Ga0307516_10661080 3300031730 Bacteria 700
808 Ga0307405_10683454 3300031731 Bacteria 848
809 Ga0307412_10585445 3300031911 Bacteria 943
810 Ga0307409_102146997 3300031995 Bacteria 588
811 Ga0307416_100572688 3300032002 Bacteria 1205
812 Ga0307416_101770426 3300032002 Bacteria 722
813 Ga0307416_102033650 3300032002 Bacteria 677
814 Ga0307416_102483445 3300032002 Bacteria 617
815 Ga0307414_11344956 3300032004 Bacteria 663
816 Ga0307411_10097452 3300032005 Bacteria 2070
817 Ga0307415_101195387 3300032126 Bacteria 716
818 Ga0307415_101990863 3300032126 Bacteria 565
819 Ga0307415_102057431 3300032126 Bacteria 557
820 Ga0307507_10327900 3300033179 Bacteria 916
821 Ga0307510_10024022 3300033180 Bacteria 7052
822 Ga0307510_10108332 3300033180 Bacteria 2532
823 Ga0307510_10605599 3300033180 Bacteria 548
824 Ga0316213_1009054 3300033546 Bacteria 677
825 Ga0373930_0166493 3300034816 Bacteria 560
826 Ga0373959_0069579 3300034820 Bacteria 793
827 Ga0373940_0148226 3300035088 Bacteria 746
828 Ga0373936_0035462 3300035113 Bacteria 1986
829 Ga0373936_0214927 3300035113 Bacteria 852
830 Ga0373953_0197960 3300035117 Bacteria 869
831 Ga0373954_0094970 3300035118 Bacteria 1435
832 Ga0373943_0056308 3300035170 Bacteria 1951
833 Ga0373946_0178003 3300035171 Bacteria 1008
834 Ga0373946_0418679 3300035171 Bacteria 678
835 Ga0373955_0921895 3300035172 Bacteria 538
836 Ga0373942_0224127 3300035207 Bacteria 631
837 Ga0316574_0000583 3300035398 Bacteria 15122
838 Ga0373931_0906821 3300035691 Bacteria 593
839 Ga0373935_0026604 3300035692 Bacteria 3572
840 Ga0373935_1273631 3300035692 Bacteria 549
841 Ga0373927_0044931 3300035695 Bacteria 2858
842 Ga0373927_0125525 3300035695 Bacteria 1675
843 Ga0373947_0331303 3300035725 Bacteria 1019
844 Ga0373937_0116233 3300036401 Bacteria 2491
845 Ga0373937_0277661 3300036401 Bacteria 1582
846 Ga0316582_0032095 3300036647 Bacteria 3215
847 Ga0316584_0061834 3300036712 Bacteria 2804
848 Ga0373925_0141633 3300037068 Bacteria 1882
849 Ga0373925_1345794 3300037068 Bacteria 585
850 Ga0395900_0048961 3300037418 Bacteria 4353
851 Ga0395900_1241213 3300037418 Bacteria 660
852 Ga0395900_1356633 3300037418 Bacteria 624
853 Ga0395900_1490874 3300037418 Bacteria 588
854 Ga0395898_0017014 3300037466 Bacteria 7425
855 Ga0395898_0120258 3300037466 Bacteria 2516
856 Ga0395898_0138115 3300037466 Bacteria 2334
857 Ga0395905_0003720 3300037471 Bacteria 16158
858 Ga0395905_0620276 3300037471 Bacteria 983
859 Ga0395905_0771829 3300037471 Bacteria 864
860 Ga0395905_0903283 3300037471 Bacteria 786
861 Ga0395905_1287791 3300037471 Bacteria 635
862 Ga0436364_0061231 3300037853 Bacteria 3861
863 Ga0436364_0154333 3300037853 Bacteria 564
864 Ga0436364_0888765 3300037853 Bacteria 857
865 Ga0395901_0058832 3300038443 Bacteria 3998
866 Ga0395901_0163797 3300038443 Bacteria 2335
867 Ga0395901_0302538 3300038443 Bacteria 1658
868 Ga0395901_0582478 3300038443 Bacteria 1130
869 Ga0395901_0922077 3300038443 Bacteria 854
870 Ga0436365_0112862 3300039437 Bacteria 811
871 Ga0436365_0147464 3300039437 Bacteria 875
872 Ga0436365_0717568 3300039437 Bacteria 517
873 Ga0436365_0773004 3300039437 Bacteria 3824
874 Ga0436365_1050534 3300039437 Bacteria 11907
875 Ga0436365_1278112 3300039437 Bacteria 933
876 Ga0436365_1850099 3300039437 Bacteria 1303
877 Ga0436360_0328780 3300039438 Bacteria 3141
878 Ga0436360_0366484 3300039438 Bacteria 1608
879 Ga0436360_0582586 3300039438 Bacteria 645
880 Ga0436360_1055724 3300039438 Bacteria 1074
881 Ga0436361_0213272 3300039447 Bacteria 1733
882 Ga0436361_0226150 3300039447 Bacteria 536
883 Ga0436361_0293025 3300039447 Bacteria 1815
884 Ga0436361_0510320 3300039447 Bacteria 2081
885 Ga0436363_0170815 3300039450 Bacteria 543
886 Ga0436363_0275971 3300039450 Bacteria 772
887 Ga0436363_0348712 3300039450 Bacteria 3226
888 Ga0436363_0398948 3300039450 Bacteria 531
889 Ga0436363_0611524 3300039450 Bacteria 1674
890 Ga0436362_0492403 3300039453 Bacteria 2893
891 Ga0439465_0042388 3300041413 Bacteria 1475
892 Ga0439465_0086175 3300041413 Bacteria 1070
893 Ga0451793_1661917 3300041452 Bacteria 583
894 Ga0451798_0847575 3300041458 Bacteria 737
895 Ga0451800_0175728 3300041459 Bacteria 882
896 Ga0451802_1442244 3300041460 Bacteria 567
897 Ga0451804_0447390 3300041463 Bacteria 512
898 Ga0451833_1093963 3300041491 Bacteria 644
899 Ga0451835_0365809 3300041492 Bacteria 625
900 Ga0451835_1082516 3300041492 Bacteria 631
901 Ga0451839_0906687 3300041496 Bacteria 556
902 Ga0451845_0500577 3300041501 Bacteria 767
903 Ga0451853_0815963 3300041512 Bacteria 1273
904 Ga0451853_2237783 3300041512 Bacteria 836
905 Ga0451853_4007085 3300041512 Bacteria 852
906 Ga0439431_0123146 3300041997 Bacteria 724
907 Ga0439455_0106809 3300042012 Bacteria 777
908 Ga0439455_0236112 3300042012 Bacteria 534
909 Ga0439459_0093668 3300042438 Bacteria 726
910 Ga0466969_0029006 3300044656 Bacteria 2828
911 Ga0466972_0168300 3300044658 Bacteria 1029
912 Ga0466972_0343020 3300044658 Bacteria 698
913 Ga0466965_0293779 3300044683 Bacteria 880
914 Ga0466965_0470058 3300044683 Bacteria 702
915 Ga0466966_0008640 3300044684 Bacteria 6741
916 Ga0466966_0688573 3300044684 Bacteria 616
917 Ga0466961_0000081 3300044693 Bacteria 59450
918 Ga0466964_0151362 3300044706 Bacteria 1076
919 Ga0466964_0236700 3300044706 Bacteria 894
920 Ga0466968_0005304 3300044735 Bacteria 4827
921 Ga0466968_0095078 3300044735 Bacteria 1325
922 Ga0466957_0176292 3300044842 Bacteria 1394
923 Ga0466957_1310508 3300044842 Bacteria 526
924 Ga0466957_1343418 3300044842 Bacteria 519
925 Ga0466960_0285292 3300044901 Bacteria 926
926 Ga0466959_0004686 3300045049 Bacteria 9205
927 Ga0466959_0387416 3300045049 Bacteria 951
928 Ga0466967_0182204 3300045976 Bacteria 1982
929 Ga0466967_0365028 3300045976 Bacteria 1400
930 Ga0466967_0444509 3300045976 Bacteria 1266
931 Ga0466967_0601462 3300045976 Bacteria 1085
932 Ga0466967_0849029 3300045976 Bacteria 907
933 Ga0466967_1209013 3300045976 Bacteria 753
934 Ga0466967_1853724 3300045976 Bacteria 600
935 Ga0495617_056784 3300046452 Bacteria 1298
936 Ga0495617_159856 3300046452 Bacteria 714
937 Ga0495592_0250305 3300046454 Bacteria 1171
938 Ga0495592_0426018 3300046454 Bacteria 836
939 Ga0495603_0091684 3300046455 Bacteria 1776
940 Ga0495603_0149919 3300046455 Bacteria 1355
941 Ga0495603_0385311 3300046455 Bacteria 804
942 Ga0495590_0059434 3300046457 Bacteria 1337
943 Ga0495629_0024603 3300046459 Bacteria 4287
944 Ga0495629_0919495 3300046459 Bacteria 573
945 Ga0495638_0009527 3300046460 Bacteria 6809
946 Ga0495638_0014000 3300046460 Bacteria 5438
947 Ga0495638_0342996 3300046460 Bacteria 791
948 Ga0495638_0384130 3300046460 Bacteria 733
949 Ga0495641_0139396 3300046461 Bacteria 1083
950 Ga0495651_0168634 3300046462 Bacteria 1561
951 Ga0495651_0187642 3300046462 Bacteria 1457
952 Ga0495651_0190989 3300046462 Bacteria 1441
953 Ga0495651_0247248 3300046462 Bacteria 1220
954 Ga0495651_0387732 3300046462 Bacteria 915
955 Ga0495653_0320701 3300046463 Bacteria 1004
956 Ga0495653_0443919 3300046463 Bacteria 817
957 Ga0495650_0034490 3300046471 Bacteria 2239
958 Ga0495650_0289854 3300046471 Bacteria 550
959 Ga0495582_0086029 3300046473 Bacteria 1749
960 Ga0495582_0139963 3300046473 Bacteria 1371
961 Ga0495605_0213752 3300046474 Bacteria 836
962 Ga0495605_0234764 3300046474 Bacteria 789
963 Ga0495639_0701919 3300046475 Bacteria 523
964 Ga0495584_0279548 3300046491 Bacteria 848
965 Ga0495584_0290941 3300046491 Bacteria 830
966 Ga0495584_0417858 3300046491 Bacteria 682
967 Ga0495585_0024609 3300046492 Bacteria 3451
968 Ga0495585_0243734 3300046492 Bacteria 899
969 Ga0495596_0079868 3300046500 Bacteria 1270
970 Ga0495596_0235061 3300046500 Bacteria 712
971 Ga0495596_0446972 3300046500 Bacteria 504
972 Ga0495607_0489531 3300046501 Bacteria 547
973 Ga0495583_0205045 3300046506 Bacteria 800
974 Ga0495606_0069216 3300046507 Bacteria 2229
975 Ga0495606_0405212 3300046507 Bacteria 709
976 Ga0495608_0029753 3300046511 Bacteria 3702
977 Ga0495608_0158095 3300046511 Bacteria 1442
978 Ga0495610_0099015 3300046512 Bacteria 1309
979 Ga0495610_0218571 3300046512 Bacteria 771
980 Ga0495616_0120781 3300046513 Bacteria 1210
981 Ga0495618_0361310 3300046514 Bacteria 893
982 Ga0495620_0163260 3300046515 Bacteria 865
983 Ga0495620_0183300 3300046515 Bacteria 809
984 Ga0495628_0115335 3300046516 Bacteria 2063
985 Ga0495628_0753942 3300046516 Bacteria 684
986 Ga0495631_0252460 3300046518 Bacteria 752
987 Ga0495632_0092363 3300046519 Bacteria 1434
988 Ga0495632_0109574 3300046519 Bacteria 1297
989 Ga0495632_0330965 3300046519 Bacteria 672
990 Ga0495632_0354550 3300046519 Bacteria 645
991 Ga0495643_0035822 3300046522 Bacteria 2730
992 Ga0495643_0133030 3300046522 Bacteria 1247
993 Ga0495643_0259844 3300046522 Bacteria 807
994 Ga0495644_0123374 3300046523 Bacteria 986
995 Ga0495644_0445567 3300046523 Bacteria 515
996 Ga0495648_0023829 3300046524 Bacteria 4181
997 Ga0495648_0266880 3300046524 Bacteria 818
998 Ga0495648_0361423 3300046524 Bacteria 660
999 Ga0495648_0427506 3300046524 Bacteria 585
1000 Ga0495648_0513921 3300046524 Bacteria 511
1001 Ga0495666_0178585 3300046526 Bacteria 981
1002 Ga0495642_0206450 3300046528 Bacteria 857
1003 Ga0495652_0102786 3300046529 Bacteria 2314
1004 Ga0495652_0204173 3300046529 Bacteria 1497
1005 Ga0495652_0816958 3300046529 Bacteria 620
1006 Ga0495652_0838814 3300046529 Bacteria 610
1007 Ga0495654_0285913 3300046530 Bacteria 677
1008 Ga0495654_0449482 3300046530 Bacteria 507
1009 Ga0495665_0656276 3300046531 Bacteria 522
1010 Ga0495640_0014514 3300046533 Bacteria 5956
1011 Ga0495640_0125542 3300046533 Bacteria 1664
1012 Ga0495640_0258285 3300046533 Bacteria 1089
1013 Ga0495587_0025877 3300046536 Bacteria 3582
1014 Ga0495598_0313365 3300046537 Bacteria 596
1015 Ga0495609_0147350 3300046538 Bacteria 1002
1016 Ga0495597_0284289 3300046542 Bacteria 644
1017 Ga0495645_0036139 3300046543 Bacteria 3601
1018 Ga0495622_0022232 3300046557 Bacteria 2954
1019 Ga0495622_0089044 3300046557 Bacteria 1418
1020 Ga0495622_0128995 3300046557 Bacteria 1152
1021 Ga0495622_0230055 3300046557 Bacteria 819
1022 Ga0495633_0150729 3300046558 Bacteria 1074
1023 Ga0495633_0299987 3300046558 Bacteria 730
1024 Ga0495667_0077362 3300046559 Bacteria 2164
1025 Ga0495667_0748095 3300046559 Bacteria 604
1026 Ga0495656_0495681 3300046615 Bacteria 647
1027 Ga0495656_0514720 3300046615 Bacteria 635
1028 Ga0495668_0028861 3300046616 Bacteria 3136
1029 Ga0495668_0225902 3300046616 Bacteria 1025
1030 Ga0495668_0295785 3300046616 Bacteria 887
1031 Ga0495634_0140276 3300046642 Bacteria 1535
1032 Ga0495634_0408543 3300046642 Bacteria 805
1033 Ga0495611_0288134 3300046648 Bacteria 758
1034 Ga0495611_0439586 3300046648 Bacteria 595
1035 Ga0495625_0105077 3300046660 Bacteria 1935
1036 Ga0495625_0235848 3300046660 Bacteria 1193
1037 Ga0495635_0007905 3300046663 Bacteria 7430
1038 Ga0495659_0341152 3300046664 Bacteria 639
1039 Ga0495661_0395626 3300046665 Bacteria 673
1040 Ga0495588_0097033 3300046674 Bacteria 1546
1041 Ga0495588_0187238 3300046674 Bacteria 1093
1042 Ga0495657_0027075 3300046675 Bacteria 4051
1043 Ga0495657_0062847 3300046675 Bacteria 2451
1044 Ga0495599_0046271 3300046678 Bacteria 2728
1045 Ga0495599_0369443 3300046678 Bacteria 858
1046 Ga0495599_0730760 3300046678 Bacteria 569
1047 Ga0495623_0127320 3300046679 Bacteria 1528
1048 Ga0495646_0085468 3300046680 Bacteria 1831
1049 Ga0495646_0108703 3300046680 Bacteria 1581
1050 Ga0495647_0171488 3300046681 Bacteria 940
1051 Ga0495658_0270039 3300046683 Bacteria 1072
1052 Ga0495669_0184968 3300046684 Bacteria 993
1053 Ga0495669_0466936 3300046684 Bacteria 613
1054 Ga0495669_0515531 3300046684 Bacteria 581
1055 Ga0495613_0116232 3300046689 Bacteria 1924
1056 Ga0495624_0031167 3300046690 Bacteria 3470
1057 Ga0495624_0236070 3300046690 Bacteria 1107
1058 Ga0495670_0051666 3300046691 Bacteria 2057
1059 Ga0495670_0762993 3300046691 Bacteria 528
1060 Ga0495671_0367108 3300046692 Bacteria 690
1061 Ga0495671_0482081 3300046692 Bacteria 592
1062 Ga0495671_0538198 3300046692 Bacteria 556
1063 Ga0495649_0354352 3300046694 Bacteria 741
1064 Ga0495649_0451530 3300046694 Bacteria 642
1065 Ga0495649_0649106 3300046694 Bacteria 519
1066 Ga0495589_0374266 3300046794 Bacteria 655
1067 Ga0495589_0493735 3300046794 Bacteria 559
1068 Ga0495589_0581547 3300046794 Bacteria 510
1069 Ga0495600_0004475 3300046809 Bacteria 8371
1070 Ga0495600_0287033 3300046809 Bacteria 1040
1071 Ga0495581_0128377 3300047315 Bacteria 1477
1072 Ga0495581_0365218 3300047315 Bacteria 842
1073 Ga0495581_0564230 3300047315 Bacteria 660
1074 Ga0495604_0043292 3300047317 Bacteria 3525
1075 Ga0495604_0091524 3300047317 Bacteria 2255
1076 Ga0495636_0133871 3300047318 Bacteria 1104
1077 Ga0495636_0482937 3300047318 Bacteria 598
1078 Ga0495674_0561591 3300047319 Bacteria 907
1079 Ga0495676_0084775 3300047321 Bacteria 2389
1080 Ga0495676_0098435 3300047321 Bacteria 2170
1081 Ga0495676_0262010 3300047321 Bacteria 1176
1082 Ga0495680_0009018 3300047322 Bacteria 9012
1083 Ga0495680_1035939 3300047322 Bacteria 522
1084 Ga0495683_0242924 3300047323 Bacteria 793
1085 Ga0495683_0380932 3300047323 Bacteria 590
1086 Ga0495687_091181 3300047443 Bacteria 1166
1087 Ga0495673_0135152 3300047469 Bacteria 966
1088 Ga0495684_0958812 3300047471 Bacteria 546
1089 Ga0495686_0133491 3300047472 Bacteria 1470
1090 Ga0495686_0258063 3300047472 Bacteria 977
1091 Ga0495686_0475817 3300047472 Bacteria 661
1092 Ga0495686_0563747 3300047472 Bacteria 593
1093 Ga0495686_0627315 3300047472 Bacteria 554
1094 Ga0495686_0628047 3300047472 Bacteria 554
1095 Ga0495602_0032368 3300048088 Bacteria 4923
1096 Ga0495602_0299515 3300048088 Bacteria 1177
1097 Ga0495602_0552744 3300048088 Bacteria 798
1098 Ga0495602_0614275 3300048088 Bacteria 746
1099 Ga0495602_0773225 3300048088 Bacteria 647
1100 Ga0495602_1029560 3300048088 Bacteria 542
1101 Ga0495614_0062589 3300048089 Bacteria 1599
1102 Ga0495615_0077593 3300048090 Bacteria 906
1103 Ga0495626_0252059 3300048091 Bacteria 708
1104 Ga0495626_0311727 3300048091 Bacteria 620
1105 Ga0496100_0042551 3300048903 Bacteria 2901
1106 Ga0496100_0516987 3300048903 Bacteria 921
1107 Ga0496100_0540473 3300048903 Bacteria 901
1108 Ga0496100_0596700 3300048903 Bacteria 857
1109 Ga0496100_1332029 3300048903 Bacteria 567
1110 Ga0496101_0107602 3300048904 Bacteria 2095
1111 Ga0496101_0212233 3300048904 Bacteria 1500
1112 Ga0496102_0028006 3300048905 Bacteria 5034
1113 Ga0496102_0106868 3300048905 Bacteria 2605
1114 Ga0496102_0255989 3300048905 Bacteria 1650
1115 Ga0496102_0278718 3300048905 Bacteria 1576
1116 Ga0496102_0357178 3300048905 Bacteria 1375
1117 Ga0496102_0738886 3300048905 Bacteria 907
1118 Ga0496102_0976772 3300048905 Bacteria 768
1119 Ga0496102_1682421 3300048905 Bacteria 552
1120 Ga0496103_0049599 3300048906 Bacteria 2596
1121 Ga0496103_0143036 3300048906 Bacteria 1530
1122 Ga0496103_0510430 3300048906 Bacteria 769
1123 Ga0496104_0018741 3300048907 Bacteria 6319
1124 Ga0496104_0041918 3300048907 Bacteria 4293
1125 Ga0496104_0043661 3300048907 Bacteria 4210
1126 Ga0496104_0094155 3300048907 Bacteria 2865
1127 Ga0496104_0140780 3300048907 Bacteria 2317
1128 Ga0496104_0416169 3300048907 Bacteria 1256
1129 Ga0496104_0530966 3300048907 Bacteria 1088
1130 Ga0496104_1019352 3300048907 Bacteria 732
1131 Ga0496105_0039541 3300048908 Bacteria 3887
1132 Ga0496105_0060956 3300048908 Bacteria 3113
1133 Ga0496105_0252007 3300048908 Bacteria 1430
1134 Ga0496105_0460032 3300048908 Bacteria 1003
1135 Ga0496105_0487220 3300048908 Bacteria 969
1136 Ga0496105_1335248 3300048908 Bacteria 522
1137 Ga0496106_0006170 3300048909 Bacteria 8863
1138 Ga0496106_0039043 3300048909 Bacteria 3555
1139 Ga0496106_0075362 3300048909 Bacteria 2584
1140 Ga0496106_1572846 3300048909 Bacteria 504
1141 Ga0496107_0060730 3300048910 Bacteria 2736
1142 Ga0496107_0062828 3300048910 Bacteria 2690
1143 Ga0496107_0134560 3300048910 Bacteria 1826
1144 Ga0496107_0864194 3300048910 Bacteria 660
1145 Ga0496107_1131605 3300048910 Bacteria 565
1146 Ga0496108_0071617 3300048911 Bacteria 2925
1147 Ga0496108_0162249 3300048911 Bacteria 1932
1148 Ga0496108_1363439 3300048911 Bacteria 594
1149 Ga0496109_0042787 3300048912 Bacteria 4105
1150 Ga0496109_0145680 3300048912 Bacteria 2216
1151 Ga0496109_0176731 3300048912 Bacteria 2004
1152 Ga0496109_0813365 3300048912 Bacteria 872
1153 Ga0496109_1206051 3300048912 Bacteria 693
1154 Ga0496110_0034286 3300048913 Bacteria 4396
1155 Ga0496110_0502943 3300048913 Bacteria 1103
1156 Ga0496110_0549991 3300048913 Bacteria 1049
1157 Ga0496110_0706620 3300048913 Bacteria 910
1158 Ga0496110_0773640 3300048913 Bacteria 864
1159 Ga0496110_0992476 3300048913 Bacteria 747
1160 Ga0496111_0278837 3300048914 Bacteria 1240
1161 Ga0496111_0958958 3300048914 Bacteria 614
1162 Ga0496112_0001776 3300048915 Bacteria 16939
1163 Ga0496112_0094695 3300048915 Bacteria 2957
1164 Ga0496112_0111276 3300048915 Bacteria 2708
1165 Ga0496112_0288919 3300048915 Bacteria 1586
1166 Ga0496112_1041874 3300048915 Bacteria 737
1167 Ga0496112_1612360 3300048915 Bacteria 562
1168 Ga0496113_0058041 3300048916 Bacteria 2911
1169 Ga0496113_0237395 3300048916 Bacteria 1454
1170 Ga0496113_0519934 3300048916 Bacteria 955
1171 Ga0496113_1080644 3300048916 Bacteria 630
1172 Ga0496113_1453351 3300048916 Bacteria 530
1173 Ga0496114_0080842 3300048917 Bacteria 2745
1174 Ga0496114_0299327 3300048917 Bacteria 1420
1175 Ga0496114_0680231 3300048917 Bacteria 903
1176 Ga0496114_0991073 3300048917 Bacteria 723
1177 Ga0496115_0040830 3300048918 Bacteria 3690
1178 Ga0496115_0052762 3300048918 Bacteria 3262
1179 Ga0496115_0230629 3300048918 Bacteria 1527
1180 Ga0496115_0383282 3300048918 Bacteria 1143
1181 Ga0496115_0893024 3300048918 Bacteria 686
1182 Ga0496116_0054625 3300048919 Bacteria 2629
1183 Ga0496116_0119043 3300048919 Bacteria 1533
1184 Ga0496117_0013120 3300048920 Bacteria 7252
1185 Ga0496117_0112655 3300048920 Bacteria 1691
1186 Ga0496117_0183873 3300048920 Bacteria 1198
1187 Ga0496117_0334740 3300048920 Bacteria 788
1188 Ga0496118_0019171 3300048921 Bacteria 6125
1189 Ga0496118_0060764 3300048921 Bacteria 2804
1190 Ga0496118_0121550 3300048921 Bacteria 1701
1191 Ga0496118_0140440 3300048921 Bacteria 1532
1192 Ga0496118_0305456 3300048921 Bacteria 871
1193 Ga0496118_0494318 3300048921 Bacteria 610
1194 Ga0496119_0026612 3300048922 Bacteria 4005
1195 Ga0496119_0245977 3300048922 Bacteria 904
1196 Ga0496119_0276265 3300048922 Bacteria 837
1197 Ga0496120_0153397 3300048923 Bacteria 1155
1198 Ga0496120_0231290 3300048923 Bacteria 878
1199 Ga0496121_0000476 3300048924 Bacteria 78015
1200 Ga0496121_0026025 3300048924 Bacteria 5531
1201 Ga0496121_0038564 3300048924 Bacteria 4227
1202 Ga0496121_0056344 3300048924 Bacteria 3265
1203 Ga0496121_0089908 3300048924 Bacteria 2402
1204 Ga0496121_0163045 3300048924 Bacteria 1628
1205 Ga0496121_0183568 3300048924 Bacteria 1507
1206 Ga0496121_0278514 3300048924 Bacteria 1145
1207 Ga0496121_0279455 3300048924 Bacteria 1143
1208 Ga0496121_0331969 3300048924 Bacteria 1020
1209 Ga0496121_0453710 3300048924 Bacteria 825
1210 Ga0496121_0490523 3300048924 Bacteria 782
1211 Ga0496121_0685172 3300048924 Bacteria 619
1212 Ga0496121_0715258 3300048924 Bacteria 600
1213 Ga0496121_0847828 3300048924 Bacteria 532
1214 Ga0496122_0132189 3300048925 Bacteria 1583
1215 Ga0496122_0255293 3300048925 Bacteria 977
1216 Ga0496124_0001454 3300048927 Bacteria 34934
1217 Ga0496124_0139065 3300048927 Bacteria 1918
1218 Ga0496124_0175900 3300048927 Bacteria 1652
1219 Ga0496124_0203172 3300048927 Bacteria 1505
1220 Ga0496124_0307464 3300048927 Bacteria 1142
1221 Ga0496124_0351155 3300048927 Bacteria 1043
1222 Ga0496124_0717062 3300048927 Bacteria 632
1223 Ga0496124_0741521 3300048927 Bacteria 617
1224 Ga0496124_0981477 3300048927 Bacteria 505
1225 Ga0496125_0061879 3300048928 Bacteria 2999
1226 Ga0496125_0073279 3300048928 Bacteria 2663
1227 Ga0496125_0146627 3300048928 Bacteria 1630
1228 Ga0496125_0163067 3300048928 Bacteria 1511
1229 Ga0496125_0163867 3300048928 Bacteria 1505
1230 Ga0496125_0275893 3300048928 Bacteria 1044
1231 Ga0496125_0321889 3300048928 Bacteria 937
1232 Ga0496125_0489620 3300048928 Bacteria 695
1233 Ga0496125_0516319 3300048928 Bacteria 669
1234 Ga0496126_0019467 3300048929 Bacteria 6684
1235 Ga0496126_0027761 3300048929 Bacteria 5401
1236 Ga0496126_0117726 3300048929 Bacteria 2307
1237 Ga0496126_0175410 3300048929 Bacteria 1823
1238 Ga0496126_0215446 3300048929 Bacteria 1615
1239 Ga0496126_0251395 3300048929 Bacteria 1473
1240 Ga0496126_0285143 3300048929 Bacteria 1367
1241 Ga0496126_0317976 3300048929 Bacteria 1280
1242 Ga0496126_0330694 3300048929 Bacteria 1250
1243 Ga0496126_0334443 3300048929 Bacteria 1242
1244 Ga0496126_0352018 3300048929 Bacteria 1204
1245 Ga0496126_0364062 3300048929 Bacteria 1180
1246 Ga0496126_0384273 3300048929 Bacteria 1142
1247 Ga0496126_0424449 3300048929 Bacteria 1074
1248 Ga0496126_0735264 3300048929 Bacteria 763
1249 Ga0496126_0980258 3300048929 Bacteria 636
1250 Ga0496126_1200739 3300048929 Bacteria 558
1251 Ga0495682_0151797 3300049460 Bacteria 826
1252 Ga0495682_0199800 3300049460 Bacteria 709
1253 Ga0501031_0026577 3300049568 Bacteria 3773
1254 Ga0501031_0049902 3300049568 Bacteria 2727
1255 Ga0501031_0196759 3300049568 Bacteria 1315
1256 Ga0501031_0202304 3300049568 Bacteria 1296
1257 Ga0501032_0000144 3300049569 Bacteria 58016
1258 Ga0501032_0014510 3300049569 Bacteria 5577
1259 Ga0501032_0057465 3300049569 Bacteria 2614
1260 Ga0501032_0192045 3300049569 Bacteria 1334
1261 Ga0501032_0346849 3300049569 Bacteria 956
1262 Ga0501032_0394081 3300049569 Bacteria 890
1263 Ga0501032_0417895 3300049569 Bacteria 860
1264 Ga0501032_0765370 3300049569 Bacteria 610
1265 Ga0501032_1027299 3300049569 Bacteria 517
1266 Ga0501033_0000206 3300049570 Bacteria 56405
1267 Ga0501033_0004699 3300049570 Bacteria 10929
1268 Ga0501033_0026495 3300049570 Bacteria 4363
1269 Ga0501033_0068200 3300049570 Bacteria 2615
1270 Ga0501033_0113310 3300049570 Bacteria 1972
1271 Ga0501033_0377655 3300049570 Bacteria 990
1272 Ga0501033_0476628 3300049570 Bacteria 865
1273 Ga0501033_0550910 3300049570 Bacteria 794
1274 Ga0501033_0984062 3300049570 Bacteria 564
1275 Ga0501034_0000159 3300049571 Bacteria 127397
1276 Ga0501034_0124339 3300049571 Bacteria 2565
1277 Ga0501034_0164022 3300049571 Bacteria 2191
1278 Ga0501034_0252462 3300049571 Bacteria 1708
1279 Ga0501034_0315731 3300049571 Bacteria 1496
1280 Ga0501034_0491898 3300049571 Bacteria 1141
1281 Ga0501034_0874979 3300049571 Bacteria 787
1282 Ga0501034_1044069 3300049571 Bacteria 700
1283 Ga0501036_0000179 3300049572 Bacteria 41780
1284 Ga0501036_0082429 3300049572 Bacteria 2718
1285 Ga0501036_0374440 3300049572 Bacteria 1188
1286 Ga0501036_0407138 3300049572 Bacteria 1134
1287 Ga0501036_0606771 3300049572 Bacteria 907
1288 Ga0501036_1478930 3300049572 Bacteria 550
1289 Ga0501037_0000112 3300049573 Bacteria 75698
1290 Ga0501037_0000396 3300049573 Bacteria 36209
1291 Ga0501037_0021148 3300049573 Bacteria 4807
1292 Ga0501037_0032014 3300049573 Bacteria 3882
1293 Ga0501037_0060449 3300049573 Bacteria 2763
1294 Ga0501037_0117435 3300049573 Bacteria 1914
1295 Ga0501037_0280347 3300049573 Bacteria 1161
1296 Ga0501038_0000160 3300049574 Bacteria 57443
1297 Ga0501038_0002046 3300049574 Bacteria 18655
1298 Ga0501038_0004875 3300049574 Bacteria 12463
1299 Ga0501038_0017078 3300049574 Bacteria 6564
1300 Ga0501038_0327405 3300049574 Bacteria 1197
1301 Ga0501038_0571820 3300049574 Bacteria 858
1302 Ga0501038_0813963 3300049574 Bacteria 693
1303 Ga0501039_0006453 3300049575 Bacteria 8914
1304 Ga0501039_0041142 3300049575 Bacteria 3568
1305 Ga0501039_0076205 3300049575 Bacteria 2607
1306 Ga0501039_0094817 3300049575 Bacteria 2326
1307 Ga0501039_0125694 3300049575 Bacteria 2011
1308 Ga0501039_0622724 3300049575 Bacteria 845
1309 Ga0501039_0832860 3300049575 Bacteria 719
1310 Ga0501039_1200758 3300049575 Bacteria 587
1311 Ga0501039_1366954 3300049575 Bacteria 545
1312 Ga0501040_0050414 3300049576 Bacteria 2847
1313 Ga0501041_0349615 3300049577 Bacteria 934
1314 Ga0501042_0010829 3300049578 Bacteria 6132
1315 Ga0501042_0473621 3300049578 Bacteria 908
1316 Ga0501042_0964217 3300049578 Bacteria 621
1317 Ga0501043_0000613 3300049579 Bacteria 31566
1318 Ga0501043_0009493 3300049579 Bacteria 7630
1319 Ga0501043_0084716 3300049579 Bacteria 2491
1320 Ga0501043_0256683 3300049579 Bacteria 1345
1321 Ga0501043_0386644 3300049579 Bacteria 1059
1322 Ga0501043_0400925 3300049579 Bacteria 1036
1323 Ga0501043_0538755 3300049579 Bacteria 868
1324 Ga0501043_0597453 3300049579 Bacteria 815
1325 Ga0501043_0620172 3300049579 Bacteria 797
1326 Ga0501043_0982873 3300049579 Bacteria 601
1327 Ga0501043_0988557 3300049579 Bacteria 599
1328 Ga0501046_0000397 3300049580 Bacteria 43539
1329 Ga0501046_0011234 3300049580 Bacteria 7666
1330 Ga0501046_0110470 3300049580 Bacteria 2101
1331 Ga0501046_0283931 3300049580 Bacteria 1212
1332 Ga0501046_0545095 3300049580 Bacteria 827
1333 Ga0501046_0765875 3300049580 Bacteria 677
1334 Ga0501046_1111881 3300049580 Bacteria 545
1335 Ga0501047_0000288 3300049581 Bacteria 57965
1336 Ga0501047_0084506 3300049581 Bacteria 3050
1337 Ga0501047_0109325 3300049581 Bacteria 2647
1338 Ga0501047_0118857 3300049581 Bacteria 2525
1339 Ga0501047_0290235 3300049581 Bacteria 1479
1340 Ga0501047_0464868 3300049581 Bacteria 1094
1341 Ga0501047_0806945 3300049581 Bacteria 753
1342 Ga0501048_0009783 3300049582 Bacteria 7188
1343 Ga0501048_0049560 3300049582 Bacteria 2992
1344 Ga0501048_0182214 3300049582 Bacteria 1489
1345 Ga0501048_0183876 3300049582 Bacteria 1482
1346 Ga0501067_0000783 3300049583 Bacteria 17104
1347 Ga0501067_0008905 3300049583 Bacteria 5560
1348 Ga0501067_0063692 3300049583 Bacteria 2042
1349 Ga0501067_0255613 3300049583 Bacteria 975
1350 Ga0501067_0265092 3300049583 Bacteria 956
1351 Ga0501067_0278534 3300049583 Bacteria 931
1352 Ga0501067_0428474 3300049583 Bacteria 738
1353 Ga0501068_0001676 3300049584 Bacteria 11832
1354 Ga0501068_0060477 3300049584 Bacteria 2300
1355 Ga0501068_0308656 3300049584 Bacteria 1013
1356 Ga0501069_0012782 3300049585 Bacteria 4470
1357 Ga0501069_0201730 3300049585 Bacteria 1153
1358 Ga0501069_0428445 3300049585 Bacteria 785
1359 Ga0501070_0002241 3300049586 Bacteria 16986
1360 Ga0501070_0025427 3300049586 Bacteria 4966
1361 Ga0501070_0123705 3300049586 Bacteria 2137
1362 Ga0501070_0146370 3300049586 Bacteria 1950
1363 Ga0501070_0184967 3300049586 Bacteria 1714
1364 Ga0501070_0608136 3300049586 Bacteria 871
1365 Ga0501071_0022783 3300049587 Bacteria 4369
1366 Ga0501071_0646088 3300049587 Bacteria 814
1367 Ga0501072_0001612 3300049588 Bacteria 16857
1368 Ga0501072_0125554 3300049588 Bacteria 2044
1369 Ga0501072_0167759 3300049588 Bacteria 1752
1370 Ga0501072_0971011 3300049588 Bacteria 663
1371 Ga0501073_0000034 3300049589 Bacteria 95224
1372 Ga0501073_0036008 3300049589 Bacteria 3517
1373 Ga0501073_0040397 3300049589 Bacteria 3302
1374 Ga0501073_0081502 3300049589 Bacteria 2251
1375 Ga0501073_0101096 3300049589 Bacteria 2002
1376 Ga0501073_0439018 3300049589 Bacteria 902
1377 Ga0501074_0000532 3300049590 Bacteria 23403
1378 Ga0501074_0069854 3300049590 Bacteria 2525
1379 Ga0501074_0174380 3300049590 Bacteria 1535
1380 Ga0501074_0979950 3300049590 Bacteria 594
1381 Ga0501076_0607235 3300049592 Bacteria 902
1382 Ga0501076_1312298 3300049592 Bacteria 595
1383 Ga0501076_1326636 3300049592 Bacteria 592
1384 Ga0501077_0238763 3300049593 Bacteria 1155
1385 Ga0501079_0036257 3300049741 Bacteria 3799
1386 Ga0501079_0204286 3300049741 Bacteria 1543
1387 Ga0501079_0355961 3300049741 Bacteria 1147
1388 Ga0501079_0433135 3300049741 Bacteria 1032
1389 Ga0501080_0000765 3300049742 Bacteria 26123
1390 Ga0501080_0079464 3300049742 Bacteria 3049
1391 Ga0501080_0265054 3300049742 Bacteria 1564
1392 Ga0501080_0421248 3300049742 Bacteria 1199
1393 Ga0501080_0730366 3300049742 Bacteria 872
1394 Ga0501080_1282939 3300049742 Bacteria 628
1395 Ga0501080_1511182 3300049742 Bacteria 570
1396 Ga0501083_0004806 3300049744 Bacteria 9547
1397 Ga0501083_0019398 3300049744 Bacteria 4738
1398 Ga0501083_0078015 3300049744 Bacteria 2197
1399 Ga0501035_0000137 3300049822 Bacteria 89273
1400 Ga0501035_0005535 3300049822 Bacteria 11936
1401 Ga0501035_0031309 3300049822 Bacteria 4845
1402 Ga0501035_0095678 3300049822 Bacteria 2610
1403 Ga0501035_0109894 3300049822 Bacteria 2416
1404 Ga0501035_0209261 3300049822 Bacteria 1669
1405 Ga0501035_0324283 3300049822 Bacteria 1293
1406 Ga0501035_0499943 3300049822 Bacteria 1001
1407 Ga0501035_0525655 3300049822 Bacteria 971
1408 Ga0501035_0902991 3300049822 Bacteria 699
1409 Ga0501044_0000418 3300049823 Bacteria 52554
1410 Ga0501044_0075279 3300049823 Bacteria 3427
1411 Ga0501044_0087043 3300049823 Bacteria 3155
1412 Ga0501044_0158153 3300049823 Bacteria 2244
1413 Ga0501044_0185241 3300049823 Bacteria 2047
1414 Ga0501044_0207440 3300049823 Bacteria 1915
1415 Ga0501044_0211357 3300049823 Bacteria 1894
1416 Ga0501044_0221756 3300049823 Bacteria 1841
1417 Ga0501044_0297239 3300049823 Bacteria 1544
1418 Ga0501044_0492465 3300049823 Bacteria 1128
1419 Ga0501044_0911981 3300049823 Bacteria 753
1420 Ga0501044_0959638 3300049823 Bacteria 728
1421 Ga0501045_0025556 3300049824 Bacteria 4247
1422 Ga0501045_0061052 3300049824 Bacteria 2764
1423 Ga0501045_0376518 3300049824 Bacteria 1057
1424 Ga0501045_0467245 3300049824 Bacteria 937
1425 Ga0501045_0716547 3300049824 Bacteria 738
1426 nmdc:mga03683_551904_c1 3300050489 Bacteria 561
1427 nmdc:mga03683_567034_c1 3300050489 Bacteria 554
1428 nmdc:mga03n38_880704_c1 3300050490 Bacteria 525
1429 nmdc:mga00v17_309679_c1 3300050491 Bacteria 1026
1430 nmdc:mga00v17_617866_c1 3300050491 Bacteria 698
1431 nmdc:mga0yw44_435741_c1 3300050492 Bacteria 888
1432 nmdc:mga0yw44_437546_c1 3300050492 Bacteria 886
1433 nmdc:mga0yw44_492493_c1 3300050492 Bacteria 832
1434 nmdc:mga0yw44_569093_c1 3300050492 Bacteria 769
1435 nmdc:mga0yw44_7902_c1 3300050492 Bacteria 5268
1436 nmdc:mga0k408_337867_c1 3300050493 Bacteria 898
1437 nmdc:mga0k408_46554_c1 3300050493 Bacteria 2505
1438 nmdc:mga06z11_242908_c1 3300050494 Bacteria 1058
1439 nmdc:mga06z11_424919_c1 3300050494 Bacteria 801
1440 nmdc:mga07m45_334107_c1 3300050496 Bacteria 881
1441 nmdc:mga07m45_52800_c1 3300050496 Bacteria 2296
1442 nmdc:mga07m45_90754_c1 3300050496 Bacteria 1750
1443 nmdc:mga05p37_737745_c1 3300050507 Bacteria 1088
1444 nmdc:mga08y16_430231_c1 3300050511 Bacteria 1348
1445 nmdc:mga0n895_352105_c1 3300050512 Bacteria 1491
1446 nmdc:mga08x19_1289035_c1 3300050514 Bacteria 517
1447 nmdc:mga0sz30_119866_c1 3300050516 Bacteria 1156
1448 nmdc:mga0sz30_330701_c1 3300050516 Bacteria 681
1449 nmdc:mga0sz30_54271_c1 3300050516 Bacteria 1704
1450 Ga0495601_0362503 3300053077 Bacteria 942
1451 Ga0500610_0189783 3300053079 Bacteria 999
1452 Ga0500635_0007763 3300053080 Bacteria 2918
1453 Ga0500635_0227243 3300053080 Bacteria 729
1454 Ga0495655_0098408 3300053083 Bacteria 863
1455 Ga0495595_0585374 3300053084 Bacteria 570
1456 Ga0495619_0125960 3300053085 Bacteria 1758
1457 Ga0495619_0498997 3300053085 Bacteria 837
1458 Ga0500578_0650027 3300053086 Bacteria 573
1459 Ga0500643_000057 3300053087 Bacteria 131401
1460 Ga0500644_0043348 3300053088 Bacteria 1505
1461 Ga0500644_0211529 3300053088 Bacteria 806
1462 Ga0500581_352340 3300053089 Bacteria 557
1463 Ga0500646_0110080 3300053090 Bacteria 875
1464 Ga0500646_0167253 3300053090 Bacteria 738
1465 Ga0500647_0049399 3300053091 Bacteria 2023
1466 Ga0500647_0195614 3300053091 Bacteria 920
1467 Ga0500583_0168593 3300053092 Bacteria 1090
1468 Ga0500583_0341165 3300053092 Bacteria 727
1469 Ga0500651_0212251 3300053093 Bacteria 1138
1470 Ga0500651_0762061 3300053093 Bacteria 513
1471 Ga0500566_0071724 3300053094 Bacteria 1943
1472 Ga0500648_315450 3300053097 Bacteria 671
1473 Ga0500555_004324 3300053103 Bacteria 4037
1474 Ga0500555_032811 3300053103 Bacteria 1466
1475 Ga0500556_0004646 3300053104 Bacteria 3899
1476 Ga0500557_000225 3300053105 Bacteria 8786
1477 Ga0500562_106131 3300053108 Bacteria 765
1478 Ga0500569_004900 3300053109 Bacteria 2845
1479 Ga0500572_001353 3300053111 Bacteria 6795
1480 Ga0500572_163094 3300053111 Bacteria 729
1481 Ga0500592_055921 3300053116 Bacteria 644
1482 Ga0500595_023912 3300053119 Bacteria 2140
1483 Ga0500595_176244 3300053119 Bacteria 593
1484 Ga0500597_215728 3300053120 Bacteria 800
1485 Ga0500608_367083 3300053122 Bacteria 503
1486 Ga0500614_048160 3300053123 Bacteria 1109
1487 Ga0500618_144197 3300053125 Bacteria 543
1488 Ga0500626_343788 3300053128 Bacteria 504
1489 Ga0500642_0075818 3300053130 Bacteria 1537
1490 Ga0500655_088752 3300053133 Bacteria 641
1491 Ga0500658_0141802 3300053134 Bacteria 1078
1492 Ga0500658_0213151 3300053134 Bacteria 884
1493 Ga0500658_0434165 3300053134 Bacteria 599
1494 Ga0500559_0003520 3300053136 Bacteria 7668
1495 Ga0500559_0009353 3300053136 Bacteria 4247
1496 Ga0500559_0014510 3300053136 Bacteria 3329
1497 Ga0500559_0206447 3300053136 Bacteria 926
1498 Ga0500568_0064654 3300053139 Bacteria 1409
1499 Ga0500573_0014263 3300053140 Bacteria 4492
1500 Ga0500577_0197479 3300053142 Bacteria 867
1501 Ga0500577_0366846 3300053142 Bacteria 630
1502 Ga0500588_0364375 3300053146 Bacteria 550
1503 Ga0500589_124616 3300053147 Bacteria 1086
1504 Ga0500590_121068 3300053148 Bacteria 1226
1505 Ga0500590_200681 3300053148 Bacteria 844
1506 Ga0500590_297504 3300053148 Bacteria 609
1507 Ga0500603_007768 3300053150 Bacteria 2361
1508 Ga0500604_0344311 3300053151 Bacteria 518
1509 Ga0500616_0050905 3300053153 Bacteria 2185
1510 Ga0500622_0143836 3300053156 Bacteria 1134
1511 Ga0500624_029966 3300053157 Bacteria 930
1512 Ga0500627_0185650 3300053158 Bacteria 935
1513 Ga0500633_0244469 3300053160 Bacteria 667
1514 Ga0500634_0194570 3300053161 Bacteria 897
1515 Ga0500638_198954 3300053162 Bacteria 849
1516 Ga0500638_357321 3300053162 Bacteria 539
1517 Ga0500638_391643 3300053162 Bacteria 501
1518 Ga0500639_059100 3300053163 Bacteria 1980
1519 Ga0500639_077714 3300053163 Bacteria 1678
1520 Ga0500636_0032501 3300053177 Bacteria 3088
1521 Ga0500636_0120323 3300053177 Bacteria 1473
1522 Ga0500636_0166410 3300053177 Bacteria 1197
1523 Ga0500636_0217347 3300053177 Bacteria 998
1524 Ga0500636_0415581 3300053177 Bacteria 619
1525 Ga0500637_0324824 3300053178 Bacteria 829
1526 Ga0500637_0568362 3300053178 Bacteria 545
1527 Ga0500625_015449 3300053729 Bacteria 3542
1528 Ga0500625_189416 3300053729 Bacteria 707
1529 Ga0500552_005353 3300053733 Bacteria 1395
1530 Ga0500552_028666 3300053733 Bacteria 844
1531 Ga0500596_003631 3300053735 Bacteria 2907
1532 Ga0500596_006493 3300053735 Bacteria 1973
1533 Ga0500599_021068 3300053736 Bacteria 925
1534 Ga0501084_0005309 3300054114 Bacteria 10549
1535 Ga0500661_017797 3300055283 Bacteria 1268
1536 Ga0500661_048414 3300055283 Bacteria 757
1537 Ga0587082_147885 3300059504 Bacteria 553
1538 Ga0501082_0002188 3300060353 Bacteria 17112
1539 Ga0501082_0179469 3300060353 Bacteria 1841
1540 Ga0501082_0205711 3300060353 Bacteria 1712
1541 Ga0501082_1191903 3300060353 Bacteria 665
1542 Ga0530510_0923909 3300061734 Bacteria 667
1543 Ga0530510_1317479 3300061734 Bacteria 554
1544 2507511075 2507262055 Bacteria 8048963
1545 2508544892 2508501009 Bacteria 7784016
1546 2508696882 2508501042 Bacteria 8719808
1547 2509151821 2508501128 Bacteria 8613869
1548 2511400413 2511231028 Bacteria 8046582
1549 2513623537 2513237092 Bacteria 8341956
1550 2513637415 2513237094 Bacteria 8789602
1551 2513649738 2513237095 Bacteria 8976980
1552 2513655091 2513237096 Bacteria 8722461
1553 2513679601 2513237098 Bacteria 9902361
1554 2513696512 2513237101 Bacteria 7952346
1555 2513701150 2513237102 Bacteria 7703324
1556 2513716971 2513237104 Bacteria 10034502
1557 2513874704 2513237139 Bacteria 8737671
1558 2513915886 2513237145 Bacteria 8979722
1559 2514010578 2513237161 Bacteria 8871253
1560 2515625353 2515154112 Bacteria 8294334
1561 2517100645 2517093001 Bacteria 9002274
1562 2517894809 2517572143 Bacteria 9484767
1563 2524438132 2524023205 Bacteria 8918781
1564 2524471408 2524023210 Bacteria 9029266
1565 2524534576 2524023228 Bacteria 10118060
1566 2528857588 2528768022 Bacteria 10457665
1567 2617353285 2617270735 Bacteria 9163226
1568 2617373200 2617270741 Bacteria 8201522
1569 2644289479 2643221651 Bacteria 4798932
1570 2671119225 2667528175 Bacteria 7532676
1571 2723843019 2721755755 Bacteria 8322773
1572 2728747532 2728368998 Bacteria 8720350
1573 2745076987 2744054633 Bacteria 8678936
1574 2793066021 2791355196 Bacteria 7323613
1575 2793071283 2791355197 Bacteria 8420563
1576 2793084041
1577 2805916703 2802429603 Bacteria 8777136
1578 2818238210 2816332527 Bacteria 8933356
1579 2824607536 2824600985 Bacteria 8488197
1580 2824617052 2824609381 Bacteria 8672835
1581 2824625916 2824617872 Bacteria 8814715
1582 2824634672 2824626560 Bacteria 8813858
1583 2824642730 2824635225 Bacteria 8785348
1584 2824650646 2824644064 Bacteria 8743947
1585 2824658767 2824653114 Bacteria 8493680
1586 2824667965 2824661429 Bacteria 9877870
1587 2824678542 2824671348 Bacteria 8369588
1588 2824694990 2824687955 Bacteria 8360029
1589 2824702857 2824696289 Bacteria 8335049
1590 2824712090 2824704595 Bacteria 9667483
1591 2824721431 2824714736 Bacteria 8717648
1592 2824730741 2824723954 Bacteria 8758240
1593 2824738719 2824732956 Bacteria 7810675
1594 2824761472 2824753945 Bacteria 9787441
1595 2824771365 2824763712 Bacteria 9792355
1596 2824780495 2824773399 Bacteria 8360218
1597 2838127950 2838122688 Bacteria 8803140
1598 2841943244 2841941048 Bacteria 8688029
1599 2841954024 2841949485 Bacteria 8680857
1600 2841961934 2841957949 Bacteria 8652217
1601 2841968116 2841966195 Bacteria 8673214
1602 2841976675 2841974524 Bacteria 8931498
1603 2841988047 2841983080 Bacteria 8395090
1604 2844316857 2844315083 Bacteria 8138177
1605 2847938618 2847930680 Bacteria 9342022
1606 2847944183 2847939898 Bacteria 8606328
1607 2849081591 2849076700 Bacteria 7039503
1608 2857512245 2857509624 Bacteria 7472071
1609 2874597808 2874590934 Bacteria 8299676
1610 2874612648 2874604998 Bacteria 7834745
1611 2874616865 2874612657 Bacteria 8252029
1612 2874623379 2874620515 Bacteria 8290088
1613 2874634207 2874628541 Bacteria 8630250
1614 2874651337 2874645413 Bacteria 8214782
1615 2876764059 2876761206 Bacteria 10111113
1616 2876776408 2876771140 Bacteria 8287509
1617 2876820976 2876818435 Bacteria 8274608
1618 2879081729 2879074833 Bacteria 8279565
1619 2879088406 2879083081 Bacteria 8587928
1620 2879108861 2879099564 Bacteria 10442239
1621 2879130443 2879127579 Bacteria 8294491
1622 2879146329 2879142872 Bacteria 8267021
1623 2881370735 2881364244 Bacteria 7710352
1624 2881671282 2881665667 Bacteria 8175609
1625 2885366881 2885366525 Bacteria 8326213
1626 2885376964 2885374607 Bacteria 8927485
1627 2885389349 2885383462 Bacteria 9473874
1628 2885411865 2885409591 Bacteria 9235467
1629 2888381468 2888378607 Bacteria 9652610
1630 2888389177 2888388044 Bacteria 7304136
1631 2888421871 2888419890 Bacteria 7857137
1632 2889033688 2889033259 Bacteria 9099371
1633 2903733908 2903727486 Bacteria 8281579
1634 2903754744 2903748898 Bacteria 9972761
1635 2903773208 2903768456 Bacteria 9749579
1636 2904672690 2904666416 Bacteria 8226587
1637 2904697799 2904690495 Bacteria 9412302
1638 2904719293 2904711408 Bacteria 9771557
1639 2906604524 2906602504 Bacteria 8295279
1640 2906611537
1641 2906635231 2906626472 Bacteria 8826946
1642 2908745117 2908739725 Bacteria 8628932
1643 2908756437 2908756301 Bacteria 8864324
1644 2908781656 2908775508 Bacteria 8092255
1645 2922367046 2922361189 Bacteria 7436256
1646 2922371122
1647 2922390176 2922386360 Bacteria 7017218
1648 2922427818
1649 2929619519 2929615660 Bacteria 9193770
1650 2929628011 2929624759 Bacteria 9339455
1651 2932785843 2932784394 Bacteria 9704911
1652 2932801087 2932794094 Bacteria 7915132
1653 2932804165 2932801729 Bacteria 7987968
1654 2932813591 2932809354 Bacteria 9135765
1655 2932830888 2932828146 Bacteria 9745859
1656 2933581440 2933577622 Bacteria 9116884
1657 2935612693 2935608549 Bacteria 8203142
1658 2935620930 2935616580 Bacteria 9032984
1659 2935632248 2935630451 Bacteria 8169952
1660 2935640014 2935638405 Bacteria 10015038
1661 2935655190 2935648319 Bacteria 8801166
1662 2935664071 2935656913 Bacteria 8965014
1663 2935667132 2935665750 Bacteria 9571747
1664 2935677809 2935675223 Bacteria 9928132
1665 2935690262 2935684952 Bacteria 9590419
1666 2935697403 2935694250 Bacteria 9291695
1667 2935704888 2935703347 Bacteria 10242284
1668 2935718042 2935713505 Bacteria 9608509
1669 2935726808 2935722832 Bacteria 9608746
1670 2935735578 2935732158 Bacteria 9706831
1671 2935745151 2935741537 Bacteria 9707219
1672 2935755272 2935750917 Bacteria 9590372
1673 2935762206 2935760218 Bacteria 9817913
1674 2935773586 2935769743 Bacteria 7878163
1675 2935780146 2935777560 Bacteria 8077691
1676 2935788509 2935785616 Bacteria 7962367
1677 2935796665 2935793552 Bacteria 8012592
1678 2935803710 2935801545 Bacteria 9301974
1679 2935811623 2935810662 Bacteria 9401221
1680 2935824182 2935819856 Bacteria 8261050
1681 2935829497 2935827899 Bacteria 10038562
1682 2935842526 2935837841 Bacteria 9454360
1683 2935852671 2935847175 Bacteria 8228321
1684 2935858738 2935855204 Bacteria 9035059
1685 2935866840 2935864058 Bacteria 9784707
1686 2935876971 2935873716 Bacteria 9632195
1687 2935884026 2935883170 Bacteria 7964738
1688 2935912178 2935908558 Bacteria 8568796
1689 2935922391 2935916978 Bacteria 9113783
1690 2935929207 2935926038 Bacteria 8601059
1691 2935935838 2935934488 Bacteria 8602579
1692 2935947404 2935942939 Bacteria 8599779
1693 2935953501 2935951376 Bacteria 8602333
1694 2935961985 2935959822 Bacteria 7869783
1695 2935968527 2935967501 Bacteria 8603075
1696 2935976711 2935975950 Bacteria 8347125
1697 2935990666 2935984226 Bacteria 8302647
1698 2935993390 2935992306 Bacteria 9802711
1699 2936004285 2936002035 Bacteria 9362176
1700 2936015431 2936011229 Bacteria 8801034
1701 2936024065 2936019824 Bacteria 8804134
1702 2936033080 2936028420 Bacteria 8965941
1703 2936038205 2936037263 Bacteria 9446081
1704 2936051173 2936046547 Bacteria 8903709
1705 2936058551 2936055302 Bacteria 8785755
1706 2940561447 2940556831 Bacteria 9590747
1707 2941508196 2941507105 Bacteria 8166816
1708 2941515298 2941515067 Bacteria 8166720
1709 2941524126 2941523033 Bacteria 8169134
1710 2941533638 2941531003 Bacteria 7653939
1711 2941544627 2941538514 Bacteria 9402094
1712 3005477531 3005474847 Bacteria 9259049
1713 3005489778 3005483717 Bacteria 7877331
1714 3005507072 3005506211 Bacteria 6943378
1715 3005593033 3005587118 Bacteria 7794411
1716 3005596486 3005594810 Bacteria 8716512
1717 3005712555 3005710791 Bacteria 7622528
1718 3005719615 3005718088 Bacteria 8283608
1719 8006966581 8006964411 Bacteria 8966052
1720 8006989427 8006984368 Bacteria 9651211
1721 8006997896 8006994254 Bacteria 8309700
1722 8016516500 8016511872 Bacteria 9921665
1723 8016523911 8016522445 Bacteria 8156687
1724 8016537440 8016530956 Bacteria 8155261
1725 8016541712 8016539877 Bacteria 8155419
1726 8016551561 8016548790 Bacteria 8155074
1727 8016559942 8016557553 Bacteria 8154380
1728 8016567097 8016566248 Bacteria 8158151
1729 8016579815 8016575299 Bacteria 8154085
1730 8016589066 8016583857 Bacteria 10421953
1731 8016597874 8016595262 Bacteria 8149947
1732 8016604012 8016603502 Bacteria 8731218
1733 8016620595 8016613128 Bacteria 8794220
1734 8016629399 8016622563 Bacteria 7999408
1735 8016633911 8016630954 Bacteria 9217207
1736 8017060039 8017057580 Bacteria 10023680
1737 8019537125 8019530166 Bacteria 8155624
1738 8019542423 8019538911 Bacteria 7872763
1739 8019548337 8019547302 Bacteria 7996444
1740 8019559635 8019555841 Bacteria 9642137
1741 8019569742 8019565922 Bacteria 9639779
1742 8019579543 8019576017 Bacteria 10049540
1743 8019587254 8019586578 Bacteria 10212056
1744 8019604085 8019597564 Bacteria 10041141
1745 8019614445 8019608314 Bacteria 10042931
1746 8019625074 8019619141 Bacteria 9218857
1747 8019637107 8019629233 Bacteria 8687553
1748 8019642494 8019638758 Bacteria 9062356
1749 8019650085 8019648815 Bacteria 10014479
1750 8019664974 8019659431 Bacteria 8577854
1751 8019674510 8019668869 Bacteria 8791617
1752 8019681594 8019678201 Bacteria 8863603
1753 8019694180 8019687851 Bacteria 8712826
1754 8055749223 8055742211 Bacteria 9226248
1755 8056674927 8056673599 Bacteria 7871253
1756 8056695227 8056689827 Bacteria 6712655
1757 8056969657 8056967851 Bacteria 9038162
1758 Ga0501031_0109985
1759 JGI24741J21665_1039409
1760 JGI24740J21852_10003892
1761 JGI24737J22298_10064718
1762 JGI24735J21928_10060318
1763 JGI24738J21930_10096861
1764 JGI24742J22300_10027093
1765 JGI25165J46597_1029680
1766 JGI25165J46597_1040290
1767 JGI25153J46596_10013493
1768 JGI25153J46596_10014078
1769 JGI25153J46596_10070966
1770 JGI25160J50197_1003238
1771 JGI25160J50197_1020072
1772 JGI25404J52841_10003406
1773 JGI25404J52841_10026407
1774 Ga0055525_1009691
1775 Ga0055542_1005917
1776 Ga0055529_1037036
1777 Ga0055526_1094550
1778 Ga0055524_1051419
1779 Ga0055531_10033850
1780 Ga0055543_1002483
1781 Ga0055543_1017973
1782 Ga0065165_1000866
1783 Ga0065165_1010304
1784 Ga0065165_1011062
1785 Ga0065165_1022843
1786 Ga0065165_1023762
1787 Ga0065165_1126985
1788 Ga0070658_10204771
1789 Ga0070658_10221713
1790 Ga0070658_10570579
1791 Ga0070683_100080343
1792 Ga0070683_100574399
1793 Ga0070683_100591401
1794 Ga0070690_100402238
1795 Ga0070670_101356060
1796 Ga0068869_100334072
1797 Ga0068869_101316200
1798 Ga0070666_11089069
1799 Ga0070680_100184081
1800 Ga0070680_100323344
1801 Ga0070682_100022257
1802 Ga0070682_100065301
1803 Ga0070682_100719122
1804 Ga0070682_101008069
1805 Ga0070682_101723733
1806 Ga0068868_100678638
1807 Ga0070660_100674651
1808 Ga0070660_100757012
1809 Ga0070660_101065446
1810 Ga0070689_100243712
1811 Ga0070689_100626786
1812 Ga0070691_10344385
1813 Ga0070687_101146268
1814 Ga0070661_101425714
1815 Ga0070668_100027110
1816 Ga0070668_100103345
1817 Ga0070668_100225475
1818 Ga0070668_100676450
1819 Ga0070668_100709753
1820 Ga0070668_101156388
1821 Ga0070668_101213991
1822 Ga0070668_101326768
1823 Ga0070669_100641980
1824 Ga0070669_101570086
1825 Ga0070675_100268798
1826 Ga0070675_101532882
1827 Ga0070671_101027901
1828 Ga0070671_101369625
1829 Ga0070671_101379069
1830 Ga0070674_100036028
1831 Ga0070673_100380173
1832 Ga0070673_100717943
1833 Ga0070673_101548483
1834 Ga0070673_101603820
1835 Ga0070688_100549144
1836 Ga0070659_100633869
1837 Ga0070667_100523159
1838 Ga0070667_101912606
1839 Ga0070709_10017774
1840 Ga0070709_10861234
1841 Ga0070709_10985969
1842 Ga0070714_100002475
1843 Ga0070714_100058996
1844 Ga0070714_100066539
1845 Ga0070714_100937885
1846 Ga0070713_100016516
1847 Ga0070713_100034524
1848 Ga0070713_100533926
1849 Ga0070710_10003075
1850 Ga0070710_10030941
1851 Ga0070710_11332738
1852 Ga0070701_10110115
1853 Ga0070711_100006263
1854 Ga0070711_100022019
1855 Ga0070711_100150274
1856 Ga0070711_101083321
1857 Ga0070711_101998848
1858 Ga0070705_100306555
1859 Ga0070705_100348583
1860 Ga0070700_100051471
1861 Ga0070700_101581133
1862 Ga0070663_100059209
1863 Ga0070663_100059935
1864 Ga0070663_100241130
1865 Ga0070663_100372867
1866 Ga0070663_100409223
1867 Ga0070663_100419178
1868 Ga0070663_100702748
1869 Ga0070663_101534964
1870 Ga0070678_100170830
1871 Ga0070678_100713201
1872 Ga0070678_100869356
1873 Ga0070678_101804424
1874 Ga0070662_100126386
1875 Ga0070662_100322160
1876 Ga0070681_10084335
1877 Ga0070681_10096897
1878 Ga0070681_10262844
1879 Ga0070681_10660549
1880 Ga0070681_10747395
1881 Ga0070681_11441717
1882 Ga0068867_100233906
1883 Ga0068867_101855550
1884 Ga0070685_11182605
1885 Ga0070706_100116094
1886 Ga0070706_100317605
1887 Ga0070707_101459110
1888 Ga0070698_100476302
1889 Ga0070699_100771608
1890 Ga0070679_100087318
1891 Ga0070679_100126650
1892 Ga0070679_100200770
1893 Ga0070679_100579527
1894 Ga0070679_100669564
1895 Ga0070684_100212950
1896 Ga0070684_100237885
1897 Ga0070684_100674972
1898 Ga0070684_100747921
1899 Ga0070684_101231826
1900 Ga0070684_101786378
1901 Ga0070697_101686728
1902 Ga0068853_100015392
1903 Ga0068853_100302927
1904 Ga0068853_101019774
1905 Ga0068853_101174988
1906 Ga0068853_101311547
1907 Ga0068853_101755410
1908 Ga0068853_102313219
1909 Ga0070672_100790270
1910 Ga0070695_101447313
1911 Ga0070693_100570730
1912 Ga0070693_101027490
1913 Ga0070693_101531489
1914 Ga0070665_100092371
1915 Ga0070665_100127107
1916 Ga0070665_100330442
1917 Ga0070665_101208911
1918 Ga0070665_101529383
1919 Ga0070704_101578851
1920 Ga0068855_100008396
1921 Ga0068855_100124660
1922 Ga0068855_100384532
1923 Ga0068855_100649624
1924 Ga0068855_100653885
1925 Ga0068855_100789492
1926 Ga0068855_100981151
1927 Ga0068855_101141820
1928 Ga0068855_101451879
1929 Ga0068855_101912426
1930 Ga0070664_100736471
1931 Ga0070664_101654769
1932 Ga0070664_101954281
1933 Ga0068857_100073217
1934 Ga0068857_100556865
1935 Ga0068857_100897611
1936 Ga0068854_100019162
1937 Ga0068854_100099336
1938 Ga0068854_100699635
1939 Ga0068854_100720306
1940 Ga0068856_100000434
1941 Ga0068856_100005400
1942 Ga0068856_100061916
1943 Ga0068856_100743754
1944 Ga0068856_101057347
1945 Ga0068856_101189174
1946 Ga0068856_101318671
1947 Ga0068856_102443135
1948 Ga0070702_100249335
1949 Ga0070702_100634662
1950 Ga0068852_100132591
1951 Ga0068852_100527483
1952 Ga0068852_100789814
1953 Ga0068852_100805237
1954 Ga0068852_101325965
1955 Ga0068852_102771576
1956 Ga0068859_100267086
1957 Ga0068859_100771897
1958 Ga0068859_101278078
1959 Ga0068859_101337940
1960 Ga0068864_100044659
1961 Ga0068864_101146526
1962 Ga0068864_101589712
1963 Ga0068864_101986355
1964 Ga0068866_10098727
1965 Ga0068861_100121270
1966 Ga0068861_100416119
1967 Ga0068861_100952346
1968 Ga0068861_102615341
1969 Ga0068851_10481872
1970 Ga0068851_10529726
1971 Ga0068851_10626367
1972 Ga0068851_10646483
1973 Ga0068870_11344868
1974 Ga0068863_101910023
1975 Ga0068858_100352559
1976 Ga0068858_100352925
1977 Ga0068858_100457297
1978 Ga0068858_101916626
1979 Ga0068860_100094368
1980 Ga0068860_100181953
1981 Ga0068860_100516941
1982 Ga0068860_100582840
1983 Ga0068860_101744102
1984 Ga0068860_102133163
1985 Ga0068860_102796618
1986 Ga0068862_100464415
1987 Ga0068862_100750303
1988 Ga0068862_100783975
1989 Ga0068862_100947776
1990 Ga0068862_100983825
1991 Ga0068862_101693133
1992 Ga0068862_102234268
1993 Ga0068862_102504649
1994 Ga0081455_10062610
1995 Ga0081455_10071493
1996 Ga0081540_1001986
1997 Ga0081540_1010395
1998 Ga0081540_1011052
1999 Ga0081540_1016453
2000 Ga0081540_1023463
2001 Ga0081540_1041957
2002 Ga0081540_1071971
2003 Ga0081540_1092814
2004 Ga0081540_1145351
2005 Ga0081539_10013759
2006 Ga0081539_10396844
2007 Ga0070717_10065842
2008 Ga0075365_10097363
2009 Ga0075365_10107287
2010 Ga0075365_11345418
2011 Ga0075368_10056260
2012 Ga0075368_10092443
2013 Ga0075368_10274453
2014 Ga0075363_101062091
2015 Ga0075364_10190920
2016 Ga0075364_10468852
2017 Ga0075364_10936206
2018 Ga0075432_10492276
2019 Ga0070715_10043512
2020 Ga0070715_10295213
2021 Ga0070716_100016118
2022 Ga0070716_100185644
2023 Ga0070716_101275788
2024 Ga0070712_100050760
2025 Ga0070712_100575869
2026 Ga0070712_101135649
2027 Ga0075362_10059567
2028 Ga0075362_10598861
2029 Ga0075367_10148611
2030 Ga0075367_10312304
2031 Ga0075367_10740338
2032 Ga0075367_11122976
2033 Ga0075369_10146678
2034 Ga0075369_10186348
2035 Ga0075369_10300467
2036 Ga0075369_10319411
2037 Ga0075369_10540560
2038 Ga0075366_10005462
2039 Ga0097621_101499515
2040 Ga0097621_102125256
2041 Ga0097621_102135595
2042 Ga0075370_10073378
2043 Ga0075370_10228233
2044 Ga0075370_10628003
2045 Ga0068871_100145881
2046 Ga0068871_101527357
2047 Ga0075428_101200724
2048 Ga0075430_101764075
2049 Ga0075431_101584803
2050 Ga0075434_100234820
2051 Ga0068865_100872936
2052 Ga0068865_101162736
2053 Ga0068865_102066046
2054 Ga0097620_100267064
2055 Ga0097620_100771877
2056 Ga0097620_101277975
2057 Ga0097620_101337906
2058 Ga0099823_1027763
2059 Ga0099794_10638545
2060 Ga0105251_10116124
2061 Ga0105240_10020447
2062 Ga0105240_10032668
2063 Ga0105240_10067994
2064 Ga0105240_10123204
2065 Ga0105240_11384214
2066 Ga0111539_10214088
2067 Ga0105245_10031801
2068 Ga0105245_10315878
2069 Ga0105245_10626271
2070 Ga0105245_10795918
2071 Ga0105245_12480324
2072 Ga0105247_10066555
2073 Ga0105247_10118677
2074 Ga0105247_10330792
2075 Ga0105247_10409673
2076 Ga0114129_10476531
2077 Ga0105243_10031732
2078 Ga0105243_10097091
2079 Ga0105243_10708020
2080 Ga0105243_10912673
2081 Ga0105243_11491850
2082 Ga0105243_11803389
2083 Ga0105241_10051103
2084 Ga0105241_10141894
2085 Ga0105241_10191140
2086 Ga0105241_10257250
2087 Ga0105241_10422692
2088 Ga0105241_11075203
2089 Ga0105241_11303280
2090 Ga0105241_11444864
2091 Ga0105242_10405686
2092 Ga0105242_10911093
2093 Ga0105248_10495852
2094 Ga0105248_10704512
2095 Ga0105248_11416245
2096 Ga0105248_12942386
2097 Ga0105237_10068396
2098 Ga0105237_10202106
2099 Ga0105237_10349957
2100 Ga0105237_10739361
2101 Ga0105237_11679668
2102 Ga0105237_11971455
2103 Ga0105237_12139234
2104 Ga0105237_12358215
2105 Ga0105238_10069444
2106 Ga0105238_10076960
2107 Ga0105238_10678338
2108 Ga0105238_10885517
2109 Ga0105238_11797443
2110 Ga0105238_12228493
2111 Ga0105238_12447305
2112 Ga0105238_12489346
2113 Ga0105249_10143905
2114 Ga0105249_10707366
2115 Ga0105249_11300009
2116 Ga0105249_11762875
2117 Ga0105249_12482901
2118 Ga0105239_10136576
2119 Ga0105239_10252645
2120 Ga0105239_10295488
2121 Ga0105239_10467899
2122 Ga0105239_10910537
2123 Ga0105239_11114301
2124 Ga0105239_11254122
2125 Ga0105239_11813511
2126 Ga0105239_12687794
2127 Ga0105239_12819868
2128 Ga0105246_10114181
2129 Ga0105246_10218354
2130 Ga0105246_10872372
2131 Ga0105246_11483025
2132 Ga0157339_1034756
2133 Ga0157373_11425573
2134 Ga0157371_10348472
2135 Ga0157371_11320995
2136 Ga0157370_10090911
2137 Ga0157370_10140430
2138 Ga0157370_10401657
2139 Ga0157370_11166473
2140 Ga0157370_11663209
2141 Ga0157370_11918328
2142 Ga0157369_10048658
2143 Ga0157369_10118638
2144 Ga0157369_10185391
2145 Ga0157369_11543996
2146 Ga0157369_12228347
2147 Ga0157374_10529953
2148 Ga0157374_10749612
2149 Ga0157374_11375641
2150 Ga0157374_12321793
2151 Ga0157378_10014728
2152 Ga0157378_10491703
2153 Ga0157378_11221061
2154 Ga0157378_11528315
2155 Ga0157378_12182810
2156 Ga0157378_13165040
2157 Ga0163162_10291076
2158 Ga0163162_10460734
2159 Ga0163162_10770747
2160 Ga0163162_11033690
2161 Ga0157372_10202040
2162 Ga0157372_10595679
2163 Ga0157372_12152679
2164 Ga0157372_12222735
2165 Ga0157375_10304167
2166 Ga0157375_10488402
2167 Ga0157375_10518059
2168 Ga0157375_11551865
2169 Ga0157375_12717917
2170 Ga0163163_10012414
2171 Ga0163163_10117591
2172 Ga0163163_10376207
2173 Ga0163163_10552941
2174 Ga0163163_11405763
2175 Ga0163163_12015612
2176 Ga0157380_10238260
2177 Ga0157380_10257963
2178 Ga0157380_12748899
2179 Ga0182008_10229719
2180 Ga0182008_10421868
2181 Ga0157377_10160804
2182 Ga0157377_10285293
2183 Ga0157379_10265737
2184 Ga0157379_10537004
2185 Ga0157379_11006002
2186 Ga0157379_12175361
2187 Ga0157376_10183873
2188 Ga0157376_10330872
2189 Ga0157376_10513130
2190 Ga0157376_10709027
2191 Ga0157376_12077369
2192 Ga0157376_12209839
2193 Ga0157376_12931498
2194 Ga0182007_10325147
2195 Ga0163161_10137351
2196 Ga0163161_10352321
2197 Ga0163161_11299496
2198 Ga0206356_10486896
2199 Ga0206349_1412442
2200 Ga0206351_10094307
2201 Ga0206353_11896996
2202 Ga0206353_12028210
2203 Ga0214542_1022513
2204 Ga0214545_1013953
2205 Ga0213873_10014380
2206 Ga0213874_10007250
2207 Ga0213874_10237960
2208 Ga0213874_10291617
2209 Ga0213876_10001341
2210 Ga0213876_10622122
2211 Ga0213871_10006629
2212 Ga0213871_10027378
2213 Ga0213871_10043318
2214 Ga0224712_10002831
2215 Ga0224712_10191098
2216 Ga0224712_10556904
2217 Ga0224575_103157
2218 Ga0228598_1067208
2219 Ga0209563_109801
2220 Ga0209677_101244
2221 Ga0209677_120171
2222 Ga0209148_1000253
2223 Ga0209233_1001970
2224 Ga0209233_1009212
2225 Ga0209233_1015628
2226 Ga0209233_1020333
2227 Ga0209233_1032320
2228 Ga0209233_1033133
2229 Ga0209455_1005205
2230 Ga0209455_1016606
2231 Ga0209673_1073918
2232 Ga0209564_1011001
2233 Ga0209564_1035938
2234 Ga0209564_1072669
2235 Ga0209758_1000026
2236 Ga0209758_1000318
2237 Ga0209758_1001679
2238 Ga0209758_1002424
2239 Ga0209758_1003005
2240 Ga0209758_1012954
2241 Ga0209758_1040472
2242 Ga0209758_1055859
2243 Ga0209758_1085245
2244 Ga0209758_1097908
2245 Ga0209256_1013879
2246 Ga0209256_1048828
2247 Ga0207426_1000425
2248 Ga0207426_1001506
2249 Ga0207426_1019633
2250 Ga0207426_1023817
2251 Ga0207426_1047970
2252 Ga0207426_1066358
2253 Ga0207426_1130684
2254 Ga0209257_1002846
2255 Ga0207697_10067874
2256 Ga0207697_10269782
2257 Ga0207656_10049075
2258 Ga0207656_10267790
2259 Ga0207656_10699567
2260 Ga0207696_1173139
2261 Ga0207692_10000488
2262 Ga0207692_10004266
2263 Ga0207692_10620122
2264 Ga0207642_10058752
2265 Ga0207642_11101738
2266 Ga0207710_10113669
2267 Ga0207710_10126255
2268 Ga0207710_10261894
2269 Ga0207688_10104624
2270 Ga0207688_10114482
2271 Ga0207688_10154387
2272 Ga0207688_10269127
2273 Ga0207688_10484299
2274 Ga0207688_10656004
2275 Ga0207680_10343403
2276 Ga0207680_10979788
2277 Ga0207647_10163198
2278 Ga0207647_10169812
2279 Ga0207647_10330416
2280 Ga0207647_10592334
2281 Ga0207685_10004113
2282 Ga0207685_10016129
2283 Ga0207685_10199438
2284 Ga0207685_10652935
2285 Ga0207699_10001075
2286 Ga0207699_10003139
2287 Ga0207699_10030662
2288 Ga0207699_10302086
2289 Ga0207645_10335603
2290 Ga0207645_10877704
2291 Ga0207643_10076892
2292 Ga0207705_10207299
2293 Ga0207705_10410217
2294 Ga0207684_10131596
2295 Ga0207684_10201683
2296 Ga0207654_10000069
2297 Ga0207654_10049050
2298 Ga0207654_10125513
2299 Ga0207654_10387742
2300 Ga0207654_10553072
2301 Ga0207707_10001008
2302 Ga0207707_10076991
2303 Ga0207707_10171584
2304 Ga0207707_10451508
2305 Ga0207707_10482075
2306 Ga0207695_10000634
2307 Ga0207695_10000713
2308 Ga0207695_10134863
2309 Ga0207695_10250227
2310 Ga0207671_10026824
2311 Ga0207671_10077083
2312 Ga0207671_10172829
2313 Ga0207671_10187483
2314 Ga0207671_10255812
2315 Ga0207671_10443630
2316 Ga0207671_10736072
2317 Ga0207671_10865203
2318 Ga0207671_11241561
2319 Ga0207693_10011789
2320 Ga0207693_10061410
2321 Ga0207693_10243103
2322 Ga0207693_10402422
2323 Ga0207693_11063703
2324 Ga0207663_10000176
2325 Ga0207663_10006929
2326 Ga0207663_10029467
2327 Ga0207662_10128088
2328 Ga0207662_10520782
2329 Ga0207657_10196812
2330 Ga0207657_10769229
2331 Ga0207657_11031825
2332 Ga0207649_10316811
2333 Ga0207649_11197226
2334 Ga0207649_11210314
2335 Ga0207649_11574737
2336 Ga0207652_10140370
2337 Ga0207652_10223057
2338 Ga0207652_10364529
2339 Ga0207652_10892897
2340 Ga0207646_11354399
2341 Ga0207681_10806142
2342 Ga0207681_10891447
2343 Ga0207681_10990638
2344 Ga0207694_10000155
2345 Ga0207694_10231438
2346 Ga0207694_10260097
2347 Ga0207694_10474368
2348 Ga0207694_10980962
2349 Ga0207694_11835372
2350 Ga0207650_10223213
2351 Ga0207659_11442012
2352 Ga0207687_10167142
2353 Ga0207687_10180178
2354 Ga0207687_11454019
2355 Ga0207700_10012901
2356 Ga0207700_10022426
2357 Ga0207700_10045905
2358 Ga0207700_10183378
2359 Ga0207664_10070672
2360 Ga0207664_10140833
2361 Ga0207664_10226807
2362 Ga0207664_11867614
2363 Ga0207644_11213206
2364 Ga0207690_10230733
2365 Ga0207690_10398681
2366 Ga0207690_10561633
2367 Ga0207690_10848689
2368 Ga0207706_10207834
2369 Ga0207706_10220011
2370 Ga0207706_10464841
2371 Ga0207706_10467450
2372 Ga0207686_10125545
2373 Ga0207686_11003370
2374 Ga0207686_11106996
2375 Ga0207709_10033563
2376 Ga0207709_10114819
2377 Ga0207709_10838008
2378 Ga0207670_10226453
2379 Ga0207670_10245647
2380 Ga0207669_10017298
2381 Ga0207669_11146030
2382 Ga0207669_11264936
2383 Ga0207669_11556613
2384 Ga0207704_10623632
2385 Ga0207704_11383112
2386 Ga0207665_10018204
2387 Ga0207665_10022725
2388 Ga0207665_11188231
2389 Ga0207665_11300700
2390 Ga0207691_10753754
2391 Ga0207691_11601429
2392 Ga0207711_10678197
2393 Ga0207711_11520831
2394 Ga0207689_10142627
2395 Ga0207689_10199718
2396 Ga0207689_10264167
2397 Ga0207689_10431518
2398 Ga0207661_10114303
2399 Ga0207661_10774099
2400 Ga0207661_10839094
2401 Ga0207679_10146728
2402 Ga0207679_10457724
2403 Ga0207679_11439960
2404 Ga0207667_10045630
2405 Ga0207667_10142283
2406 Ga0207667_10260251
2407 Ga0207667_10280445
2408 Ga0207667_10558203
2409 Ga0207667_10842939
2410 Ga0207667_10968386
2411 Ga0207667_11094169
2412 Ga0207667_11108821
2413 Ga0207667_11284919
2414 Ga0207667_11466417
2415 Ga0207651_10322380
2416 Ga0207651_11257891
2417 Ga0207712_10126263
2418 Ga0207712_10223617
2419 Ga0207712_10634862
2420 Ga0207712_11057998
2421 Ga0207712_11246021
2422 Ga0207712_12058734
2423 Ga0207668_10024406
2424 Ga0207668_10095320
2425 Ga0207668_10180217
2426 Ga0207668_10295614
2427 Ga0207668_10548987
2428 Ga0207668_10961898
2429 Ga0207668_11183750
2430 Ga0207668_11244159
2431 Ga0207668_11354534
2432 Ga0207668_12055681
2433 Ga0207640_10082513
2434 Ga0207640_10118979
2435 Ga0207640_10206084
2436 Ga0207640_10281722
2437 Ga0207640_10613305
2438 Ga0207640_10685081
2439 Ga0207640_11835322
2440 Ga0207658_10337465
2441 Ga0207658_10454621
2442 Ga0207677_10104387
2443 Ga0207677_12267214
2444 Ga0207703_10150217
2445 Ga0207703_11091263
2446 Ga0207703_11416451
2447 Ga0207703_11493505
2448 Ga0207703_11956922
2449 Ga0207639_10004418
2450 Ga0207639_10141940
2451 Ga0207639_10500380
2452 Ga0207639_10646018
2453 Ga0207639_10656720
2454 Ga0207639_11045700
2455 Ga0207639_11083596
2456 Ga0207639_11316267
2457 Ga0207639_11367158
2458 Ga0207678_10012307
2459 Ga0207678_10023967
2460 Ga0207678_10089381
2461 Ga0207678_10136672
2462 Ga0207678_10198754
2463 Ga0207678_10232478
2464 Ga0207678_11121585
2465 Ga0207708_10175374
2466 Ga0207708_10833671
2467 Ga0207702_10000022
2468 Ga0207702_10000041
2469 Ga0207702_10007733
2470 Ga0207702_10231775
2471 Ga0207702_10429437
2472 Ga0207702_10683805
2473 Ga0207702_10776245
2474 Ga0207702_11607249
2475 Ga0207641_11935164
2476 Ga0207648_10588750
2477 Ga0207648_11865645
2478 Ga0207676_10052651
2479 Ga0207676_10265205
2480 Ga0207676_11337168
2481 Ga0207674_10005530
2482 Ga0207674_10015337
2483 Ga0207674_10453889
2484 Ga0207674_10540765
2485 Ga0207674_11134082
2486 Ga0207675_100278865
2487 Ga0207675_100860964
2488 Ga0207675_101613031
2489 Ga0207675_102358049
2490 Ga0207675_102687273
2491 Ga0207683_10074762
2492 Ga0207683_10189497
2493 Ga0207683_10381817
2494 Ga0207683_10550499
2495 Ga0207683_10753534
2496 Ga0207683_11103154
2497 Ga0207683_11943502
2498 Ga0207683_12085848
2499 Ga0207698_10044442
2500 Ga0207698_10078408
2501 Ga0207698_10100030
2502 Ga0207698_10146286
2503 Ga0207698_10186652
2504 Ga0207698_10358025
2505 Ga0207698_10722581
2506 Ga0207698_10851081
2507 Ga0207698_11308398
2508 Ga0207698_12302692
2509 Ga0207698_12526919
2510 Ga0209389_1000090
2511 Ga0209389_1000119
2512 Ga0209589_1000010
2513 Ga0209489_100011
2514 Ga0209489_100385
2515 Ga0209700_100013
2516 Ga0268266_10359041
2517 Ga0268266_10537219
2518 Ga0268266_10614064
2519 Ga0268266_10653711
2520 Ga0268266_10720069
2521 Ga0268266_10803928
2522 Ga0268266_11157136
2523 Ga0268266_12202753
2524 Ga0268265_10241475
2525 Ga0268265_10557126
2526 Ga0268265_10654088
2527 Ga0268265_10702484
2528 Ga0268265_11026983
2529 Ga0268265_11562283
2530 Ga0268264_10368029
2531 Ga0268264_10466858
2532 Ga0268264_10764227
2533 Ga0268264_12202815
2534 Ga0265319_1052575
2535 Ga0265334_10003794
2536 Ga0265318_10040278
2537 Ga0265323_10000529
2538 Ga0265322_10065558
2539 Ga0265336_10000169
2540 Ga0307517_10291326
2541 Ga0307517_10445842
2542 Ga0307517_10610590
2543 Ga0307515_10467366
2544 Ga0307515_10659510
2545 Ga0265338_10000624
2546 Ga0265338_11229494
2547 Ga0265324_10015145
2548 Ga0265762_1052602
2549 Ga0265770_1131010
2550 Ga0265330_10109331
2551 Ga0265339_10000560
2552 Ga0307513_10290462
2553 Ga0307513_10925441
2554 Ga0307509_10227270
2555 Ga0307509_10281389
2556 Ga0307408_101255530
2557 Ga0307508_10000501
2558 Ga0265314_10202597
2559 Ga0265342_10051874
2560 Ga0316576_10306653
2561 Ga0316578_10079450
2562 Ga0307516_10001650
2563 Ga0307516_10510548
2564 Ga0307516_10661080
2565 Ga0307405_10683454
2566 Ga0307412_10585445
2567 Ga0307409_102146997
2568 Ga0307416_100572688
2569 Ga0307416_101770426
2570 Ga0307416_102033650
2571 Ga0307416_102483445
2572 Ga0307414_11344956
2573 Ga0307411_10097452
2574 Ga0307415_101195387
2575 Ga0307415_101990863
2576 Ga0307415_102057431
2577 Ga0307507_10327900
2578 Ga0307510_10024022
2579 Ga0307510_10108332
2580 Ga0307510_10605599
2581 Ga0316213_1009054
2582 Ga0373930_0166493
2583 Ga0373959_0069579
2584 Ga0373940_0148226
2585 Ga0373936_0035462
2586 Ga0373936_0214927
2587 Ga0373953_0197960
2588 Ga0373954_0094970
2589 Ga0373943_0056308
2590 Ga0373946_0178003
2591 Ga0373946_0418679
2592 Ga0373955_0921895
2593 Ga0373942_0224127
2594 Ga0316574_0000583
2595 Ga0373931_0906821
2596 Ga0373935_0026604
2597 Ga0373935_1273631
2598 Ga0373927_0044931
2599 Ga0373927_0125525
2600 Ga0373947_0331303
2601 Ga0373937_0116233
2602 Ga0373937_0277661
2603 Ga0316582_0032095
2604 Ga0316584_0061834
2605 Ga0373925_0141633
2606 Ga0373925_1345794
2607 Ga0395900_0048961
2608 Ga0395900_1241213
2609 Ga0395900_1356633
2610 Ga0395900_1490874
2611 Ga0395898_0017014
2612 Ga0395898_0120258
2613 Ga0395898_0138115
2614 Ga0395905_0003720
2615 Ga0395905_0620276
2616 Ga0395905_0771829
2617 Ga0395905_0903283
2618 Ga0395905_1287791
2619 Ga0436364_0061231
2620 Ga0436364_0154333
2621 Ga0436364_0888765
2622 Ga0395901_0058832
2623 Ga0395901_0163797
2624 Ga0395901_0302538
2625 Ga0395901_0582478
2626 Ga0395901_0922077
2627 Ga0436365_0112862
2628 Ga0436365_0147464
2629 Ga0436365_0717568
2630 Ga0436365_0773004
2631 Ga0436365_1050534
2632 Ga0436365_1278112
2633 Ga0436365_1850099
2634 Ga0436360_0328780
2635 Ga0436360_0366484
2636 Ga0436360_0582586
2637 Ga0436360_1055724
2638 Ga0436361_0213272
2639 Ga0436361_0226150
2640 Ga0436361_0293025
2641 Ga0436361_0510320
2642 Ga0436363_0170815
2643 Ga0436363_0275971
2644 Ga0436363_0348712
2645 Ga0436363_0398948
2646 Ga0436363_0611524
2647 Ga0436362_0492403
2648 Ga0439465_0042388
2649 Ga0439465_0086175
2650 Ga0451793_1661917
2651 Ga0451798_0847575
2652 Ga0451800_0175728
2653 Ga0451802_1442244
2654 Ga0451804_0447390
2655 Ga0451833_1093963
2656 Ga0451835_0365809
2657 Ga0451835_1082516
2658 Ga0451839_0906687
2659 Ga0451845_0500577
2660 Ga0451853_0815963
2661 Ga0451853_2237783
2662 Ga0451853_4007085
2663 Ga0439431_0123146
2664 Ga0439455_0106809
2665 Ga0439455_0236112
2666 Ga0439459_0093668
2667 Ga0466969_0029006
2668 Ga0466972_0168300
2669 Ga0466972_0343020
2670 Ga0466965_0293779
2671 Ga0466965_0470058
2672 Ga0466966_0008640
2673 Ga0466966_0688573
2674 Ga0466961_0000081
2675 Ga0466964_0151362
2676 Ga0466964_0236700
2677 Ga0466968_0005304
2678 Ga0466968_0095078
2679 Ga0466957_0176292
2680 Ga0466957_1310508
2681 Ga0466957_1343418
2682 Ga0466960_0285292
2683 Ga0466959_0004686
2684 Ga0466959_0387416
2685 Ga0466967_0182204
2686 Ga0466967_0365028
2687 Ga0466967_0444509
2688 Ga0466967_0601462
2689 Ga0466967_0849029
2690 Ga0466967_1209013
2691 Ga0466967_1853724
2692 Ga0495617_056784
2693 Ga0495617_159856
2694 Ga0495592_0250305
2695 Ga0495592_0426018
2696 Ga0495603_0091684
2697 Ga0495603_0149919
2698 Ga0495603_0385311
2699 Ga0495590_0059434
2700 Ga0495629_0024603
2701 Ga0495629_0919495
2702 Ga0495638_0009527
2703 Ga0495638_0014000
2704 Ga0495638_0342996
2705 Ga0495638_0384130
2706 Ga0495641_0139396
2707 Ga0495651_0168634
2708 Ga0495651_0187642
2709 Ga0495651_0190989
2710 Ga0495651_0247248
2711 Ga0495651_0387732
2712 Ga0495653_0320701
2713 Ga0495653_0443919
2714 Ga0495650_0034490
2715 Ga0495650_0289854
2716 Ga0495582_0086029
2717 Ga0495582_0139963
2718 Ga0495605_0213752
2719 Ga0495605_0234764
2720 Ga0495639_0701919
2721 Ga0495584_0279548
2722 Ga0495584_0290941
2723 Ga0495584_0417858
2724 Ga0495585_0024609
2725 Ga0495585_0243734
2726 Ga0495596_0079868
2727 Ga0495596_0235061
2728 Ga0495596_0446972
2729 Ga0495607_0489531
2730 Ga0495583_0205045
2731 Ga0495606_0069216
2732 Ga0495606_0405212
2733 Ga0495608_0029753
2734 Ga0495608_0158095
2735 Ga0495610_0099015
2736 Ga0495610_0218571
2737 Ga0495616_0120781
2738 Ga0495618_0361310
2739 Ga0495620_0163260
2740 Ga0495620_0183300
2741 Ga0495628_0115335
2742 Ga0495628_0753942
2743 Ga0495631_0252460
2744 Ga0495632_0092363
2745 Ga0495632_0109574
2746 Ga0495632_0330965
2747 Ga0495632_0354550
2748 Ga0495643_0035822
2749 Ga0495643_0133030
2750 Ga0495643_0259844
2751 Ga0495644_0123374
2752 Ga0495644_0445567
2753 Ga0495648_0023829
2754 Ga0495648_0266880
2755 Ga0495648_0361423
2756 Ga0495648_0427506
2757 Ga0495648_0513921
2758 Ga0495666_0178585
2759 Ga0495642_0206450
2760 Ga0495652_0102786
2761 Ga0495652_0204173
2762 Ga0495652_0816958
2763 Ga0495652_0838814
2764 Ga0495654_0285913
2765 Ga0495654_0449482
2766 Ga0495665_0656276
2767 Ga0495640_0014514
2768 Ga0495640_0125542
2769 Ga0495640_0258285
2770 Ga0495587_0025877
2771 Ga0495598_0313365
2772 Ga0495609_0147350
2773 Ga0495597_0284289
2774 Ga0495645_0036139
2775 Ga0495622_0022232
2776 Ga0495622_0089044
2777 Ga0495622_0128995
2778 Ga0495622_0230055
2779 Ga0495633_0150729
2780 Ga0495633_0299987
2781 Ga0495667_0077362
2782 Ga0495667_0748095
2783 Ga0495656_0495681
2784 Ga0495656_0514720
2785 Ga0495668_0028861
2786 Ga0495668_0225902
2787 Ga0495668_0295785
2788 Ga0495634_0140276
2789 Ga0495634_0408543
2790 Ga0495611_0288134
2791 Ga0495611_0439586
2792 Ga0495625_0105077
2793 Ga0495625_0235848
2794 Ga0495635_0007905
2795 Ga0495659_0341152
2796 Ga0495661_0395626
2797 Ga0495588_0097033
2798 Ga0495588_0187238
2799 Ga0495657_0027075
2800 Ga0495657_0062847
2801 Ga0495599_0046271
2802 Ga0495599_0369443
2803 Ga0495599_0730760
2804 Ga0495623_0127320
2805 Ga0495646_0085468
2806 Ga0495646_0108703
2807 Ga0495647_0171488
2808 Ga0495658_0270039
2809 Ga0495669_0184968
2810 Ga0495669_0466936
2811 Ga0495669_0515531
2812 Ga0495613_0116232
2813 Ga0495624_0031167
2814 Ga0495624_0236070
2815 Ga0495670_0051666
2816 Ga0495670_0762993
2817 Ga0495671_0367108
2818 Ga0495671_0482081
2819 Ga0495671_0538198
2820 Ga0495649_0354352
2821 Ga0495649_0451530
2822 Ga0495649_0649106
2823 Ga0495589_0374266
2824 Ga0495589_0493735
2825 Ga0495589_0581547
2826 Ga0495600_0004475
2827 Ga0495600_0287033
2828 Ga0495581_0128377
2829 Ga0495581_0365218
2830 Ga0495581_0564230
2831 Ga0495604_0043292
2832 Ga0495604_0091524
2833 Ga0495636_0133871
2834 Ga0495636_0482937
2835 Ga0495674_0561591
2836 Ga0495676_0084775
2837 Ga0495676_0098435
2838 Ga0495676_0262010
2839 Ga0495680_0009018
2840 Ga0495680_1035939
2841 Ga0495683_0242924
2842 Ga0495683_0380932
2843 Ga0495687_091181
2844 Ga0495673_0135152
2845 Ga0495684_0958812
2846 Ga0495686_0133491
2847 Ga0495686_0258063
2848 Ga0495686_0475817
2849 Ga0495686_0563747
2850 Ga0495686_0627315
2851 Ga0495686_0628047
2852 Ga0495602_0032368
2853 Ga0495602_0299515
2854 Ga0495602_0552744
2855 Ga0495602_0614275
2856 Ga0495602_0773225
2857 Ga0495602_1029560
2858 Ga0495614_0062589
2859 Ga0495615_0077593
2860 Ga0495626_0252059
2861 Ga0495626_0311727
2862 Ga0496100_0042551
2863 Ga0496100_0516987
2864 Ga0496100_0540473
2865 Ga0496100_0596700
2866 Ga0496100_1332029
2867 Ga0496101_0107602
2868 Ga0496101_0212233
2869 Ga0496102_0028006
2870 Ga0496102_0106868
2871 Ga0496102_0255989
2872 Ga0496102_0278718
2873 Ga0496102_0357178
2874 Ga0496102_0738886
2875 Ga0496102_0976772
2876 Ga0496102_1682421
2877 Ga0496103_0049599
2878 Ga0496103_0143036
2879 Ga0496103_0510430
2880 Ga0496104_0018741
2881 Ga0496104_0041918
2882 Ga0496104_0043661
2883 Ga0496104_0094155
2884 Ga0496104_0140780
2885 Ga0496104_0416169
2886 Ga0496104_0530966
2887 Ga0496104_1019352
2888 Ga0496105_0039541
2889 Ga0496105_0060956
2890 Ga0496105_0252007
2891 Ga0496105_0460032
2892 Ga0496105_0487220
2893 Ga0496105_1335248
2894 Ga0496106_0006170
2895 Ga0496106_0039043
2896 Ga0496106_0075362
2897 Ga0496106_1572846
2898 Ga0496107_0060730
2899 Ga0496107_0062828
2900 Ga0496107_0134560
2901 Ga0496107_0864194
2902 Ga0496107_1131605
2903 Ga0496108_0071617
2904 Ga0496108_0162249
2905 Ga0496108_1363439
2906 Ga0496109_0042787
2907 Ga0496109_0145680
2908 Ga0496109_0176731
2909 Ga0496109_0813365
2910 Ga0496109_1206051
2911 Ga0496110_0034286
2912 Ga0496110_0502943
2913 Ga0496110_0549991
2914 Ga0496110_0706620
2915 Ga0496110_0773640
2916 Ga0496110_0992476
2917 Ga0496111_0278837
2918 Ga0496111_0958958
2919 Ga0496112_0001776
2920 Ga0496112_0094695
2921 Ga0496112_0111276
2922 Ga0496112_0288919
2923 Ga0496112_1041874
2924 Ga0496112_1612360
2925 Ga0496113_0058041
2926 Ga0496113_0237395
2927 Ga0496113_0519934
2928 Ga0496113_1080644
2929 Ga0496113_1453351
2930 Ga0496114_0080842
2931 Ga0496114_0299327
2932 Ga0496114_0680231
2933 Ga0496114_0991073
2934 Ga0496115_0040830
2935 Ga0496115_0052762
2936 Ga0496115_0230629
2937 Ga0496115_0383282
2938 Ga0496115_0893024
2939 Ga0496116_0054625
2940 Ga0496116_0119043
2941 Ga0496117_0013120
2942 Ga0496117_0112655
2943 Ga0496117_0183873
2944 Ga0496117_0334740
2945 Ga0496118_0019171
2946 Ga0496118_0060764
2947 Ga0496118_0121550
2948 Ga0496118_0140440
2949 Ga0496118_0305456
2950 Ga0496118_0494318
2951 Ga0496119_0026612
2952 Ga0496119_0245977
2953 Ga0496119_0276265
2954 Ga0496120_0153397
2955 Ga0496120_0231290
2956 Ga0496121_0000476
2957 Ga0496121_0026025
2958 Ga0496121_0038564
2959 Ga0496121_0056344
2960 Ga0496121_0089908
2961 Ga0496121_0163045
2962 Ga0496121_0183568
2963 Ga0496121_0278514
2964 Ga0496121_0279455
2965 Ga0496121_0331969
2966 Ga0496121_0453710
2967 Ga0496121_0490523
2968 Ga0496121_0685172
2969 Ga0496121_0715258
2970 Ga0496121_0847828
2971 Ga0496122_0132189
2972 Ga0496122_0255293
2973 Ga0496124_0001454
2974 Ga0496124_0139065
2975 Ga0496124_0175900
2976 Ga0496124_0203172
2977 Ga0496124_0307464
2978 Ga0496124_0351155
2979 Ga0496124_0717062
2980 Ga0496124_0741521
2981 Ga0496124_0981477
2982 Ga0496125_0061879
2983 Ga0496125_0073279
2984 Ga0496125_0146627
2985 Ga0496125_0163067
2986 Ga0496125_0163867
2987 Ga0496125_0275893
2988 Ga0496125_0321889
2989 Ga0496125_0489620
2990 Ga0496125_0516319
2991 Ga0496126_0019467
2992 Ga0496126_0027761
2993 Ga0496126_0117726
2994 Ga0496126_0175410
2995 Ga0496126_0215446
2996 Ga0496126_0251395
2997 Ga0496126_0285143
2998 Ga0496126_0317976
2999 Ga0496126_0330694
3000 Ga0496126_0334443
3001 Ga0496126_0352018
3002 Ga0496126_0364062
3003 Ga0496126_0384273
3004 Ga0496126_0424449
3005 Ga0496126_0735264
3006 Ga0496126_0980258
3007 Ga0496126_1200739
3008 Ga0495682_0151797
3009 Ga0495682_0199800
3010 Ga0501031_0026577
3011 Ga0501031_0049902
3012 Ga0501031_0196759
3013 Ga0501031_0202304
3014 Ga0501032_0000144
3015 Ga0501032_0014510
3016 Ga0501032_0057465
3017 Ga0501032_0192045
3018 Ga0501032_0346849
3019 Ga0501032_0394081
3020 Ga0501032_0417895
3021 Ga0501032_0765370
3022 Ga0501032_1027299
3023 Ga0501033_0000206
3024 Ga0501033_0004699
3025 Ga0501033_0026495
3026 Ga0501033_0068200
3027 Ga0501033_0113310
3028 Ga0501033_0377655
3029 Ga0501033_0476628
3030 Ga0501033_0550910
3031 Ga0501033_0984062
3032 Ga0501034_0000159
3033 Ga0501034_0124339
3034 Ga0501034_0164022
3035 Ga0501034_0252462
3036 Ga0501034_0315731
3037 Ga0501034_0491898
3038 Ga0501034_0874979
3039 Ga0501034_1044069
3040 Ga0501036_0000179
3041 Ga0501036_0082429
3042 Ga0501036_0374440
3043 Ga0501036_0407138
3044 Ga0501036_0606771
3045 Ga0501036_1478930
3046 Ga0501037_0000112
3047 Ga0501037_0000396
3048 Ga0501037_0021148
3049 Ga0501037_0032014
3050 Ga0501037_0060449
3051 Ga0501037_0117435
3052 Ga0501037_0280347
3053 Ga0501038_0000160
3054 Ga0501038_0002046
3055 Ga0501038_0004875
3056 Ga0501038_0017078
3057 Ga0501038_0327405
3058 Ga0501038_0571820
3059 Ga0501038_0813963
3060 Ga0501039_0006453
3061 Ga0501039_0041142
3062 Ga0501039_0076205
3063 Ga0501039_0094817
3064 Ga0501039_0125694
3065 Ga0501039_0622724
3066 Ga0501039_0832860
3067 Ga0501039_1200758
3068 Ga0501039_1366954
3069 Ga0501040_0050414
3070 Ga0501041_0349615
3071 Ga0501042_0010829
3072 Ga0501042_0473621
3073 Ga0501042_0964217
3074 Ga0501043_0000613
3075 Ga0501043_0009493
3076 Ga0501043_0084716
3077 Ga0501043_0256683
3078 Ga0501043_0386644
3079 Ga0501043_0400925
3080 Ga0501043_0538755
3081 Ga0501043_0597453
3082 Ga0501043_0620172
3083 Ga0501043_0982873
3084 Ga0501043_0988557
3085 Ga0501046_0000397
3086 Ga0501046_0011234
3087 Ga0501046_0110470
3088 Ga0501046_0283931
3089 Ga0501046_0545095
3090 Ga0501046_0765875
3091 Ga0501046_1111881
3092 Ga0501047_0000288
3093 Ga0501047_0084506
3094 Ga0501047_0109325
3095 Ga0501047_0118857
3096 Ga0501047_0290235
3097 Ga0501047_0464868
3098 Ga0501047_0806945
3099 Ga0501048_0009783
3100 Ga0501048_0049560
3101 Ga0501048_0182214
3102 Ga0501048_0183876
3103 Ga0501067_0000783
3104 Ga0501067_0008905
3105 Ga0501067_0063692
3106 Ga0501067_0255613
3107 Ga0501067_0265092
3108 Ga0501067_0278534
3109 Ga0501067_0428474
3110 Ga0501068_0001676
3111 Ga0501068_0060477
3112 Ga0501068_0308656
3113 Ga0501069_0012782
3114 Ga0501069_0201730
3115 Ga0501069_0428445
3116 Ga0501070_0002241
3117 Ga0501070_0025427
3118 Ga0501070_0123705
3119 Ga0501070_0146370
3120 Ga0501070_0184967
3121 Ga0501070_0608136
3122 Ga0501071_0022783
3123 Ga0501071_0646088
3124 Ga0501072_0001612
3125 Ga0501072_0125554
3126 Ga0501072_0167759
3127 Ga0501072_0971011
3128 Ga0501073_0000034
3129 Ga0501073_0036008
3130 Ga0501073_0040397
3131 Ga0501073_0081502
3132 Ga0501073_0101096
3133 Ga0501073_0439018
3134 Ga0501074_0000532
3135 Ga0501074_0069854
3136 Ga0501074_0174380
3137 Ga0501074_0979950
3138 Ga0501076_0607235
3139 Ga0501076_1312298
3140 Ga0501076_1326636
3141 Ga0501077_0238763
3142 Ga0501079_0036257
3143 Ga0501079_0204286
3144 Ga0501079_0355961
3145 Ga0501079_0433135
3146 Ga0501080_0000765
3147 Ga0501080_0079464
3148 Ga0501080_0265054
3149 Ga0501080_0421248
3150 Ga0501080_0730366
3151 Ga0501080_1282939
3152 Ga0501080_1511182
3153 Ga0501083_0004806
3154 Ga0501083_0019398
3155 Ga0501083_0078015
3156 Ga0501035_0000137
3157 Ga0501035_0005535
3158 Ga0501035_0031309
3159 Ga0501035_0095678
3160 Ga0501035_0109894
3161 Ga0501035_0209261
3162 Ga0501035_0324283
3163 Ga0501035_0499943
3164 Ga0501035_0525655
3165 Ga0501035_0902991
3166 Ga0501044_0000418
3167 Ga0501044_0075279
3168 Ga0501044_0087043
3169 Ga0501044_0158153
3170 Ga0501044_0185241
3171 Ga0501044_0207440
3172 Ga0501044_0211357
3173 Ga0501044_0221756
3174 Ga0501044_0297239
3175 Ga0501044_0492465
3176 Ga0501044_0911981
3177 Ga0501044_0959638
3178 Ga0501045_0025556
3179 Ga0501045_0061052
3180 Ga0501045_0376518
3181 Ga0501045_0467245
3182 Ga0501045_0716547
3183 nmdc:mga03683_551904_c1
3184 nmdc:mga03683_567034_c1
3185 nmdc:mga03n38_880704_c1
3186 nmdc:mga00v17_309679_c1
3187 nmdc:mga00v17_617866_c1
3188 nmdc:mga0yw44_435741_c1
3189 nmdc:mga0yw44_437546_c1
3190 nmdc:mga0yw44_492493_c1
3191 nmdc:mga0yw44_569093_c1
3192 nmdc:mga0yw44_7902_c1
3193 nmdc:mga0k408_337867_c1
3194 nmdc:mga0k408_46554_c1
3195 nmdc:mga06z11_242908_c1
3196 nmdc:mga06z11_424919_c1
3197 nmdc:mga07m45_334107_c1
3198 nmdc:mga07m45_52800_c1
3199 nmdc:mga07m45_90754_c1
3200 nmdc:mga05p37_737745_c1
3201 nmdc:mga08y16_430231_c1
3202 nmdc:mga0n895_352105_c1
3203 nmdc:mga08x19_1289035_c1
3204 nmdc:mga0sz30_119866_c1
3205 nmdc:mga0sz30_330701_c1
3206 nmdc:mga0sz30_54271_c1
3207 Ga0495601_0362503
3208 Ga0500610_0189783
3209 Ga0500635_0007763
3210 Ga0500635_0227243
3211 Ga0495655_0098408
3212 Ga0495595_0585374
3213 Ga0495619_0125960
3214 Ga0495619_0498997
3215 Ga0500578_0650027
3216 Ga0500643_000057
3217 Ga0500644_0043348
3218 Ga0500644_0211529
3219 Ga0500581_352340
3220 Ga0500646_0110080
3221 Ga0500646_0167253
3222 Ga0500647_0049399
3223 Ga0500647_0195614
3224 Ga0500583_0168593
3225 Ga0500583_0341165
3226 Ga0500651_0212251
3227 Ga0500651_0762061
3228 Ga0500566_0071724
3229 Ga0500648_315450
3230 Ga0500555_004324
3231 Ga0500555_032811
3232 Ga0500556_0004646
3233 Ga0500557_000225
3234 Ga0500562_106131
3235 Ga0500569_004900
3236 Ga0500572_001353
3237 Ga0500572_163094
3238 Ga0500592_055921
3239 Ga0500595_023912
3240 Ga0500595_176244
3241 Ga0500597_215728
3242 Ga0500608_367083
3243 Ga0500614_048160
3244 Ga0500618_144197
3245 Ga0500626_343788
3246 Ga0500642_0075818
3247 Ga0500655_088752
3248 Ga0500658_0141802
3249 Ga0500658_0213151
3250 Ga0500658_0434165
3251 Ga0500559_0003520
3252 Ga0500559_0009353
3253 Ga0500559_0014510
3254 Ga0500559_0206447
3255 Ga0500568_0064654
3256 Ga0500573_0014263
3257 Ga0500577_0197479
3258 Ga0500577_0366846
3259 Ga0500588_0364375
3260 Ga0500589_124616
3261 Ga0500590_121068
3262 Ga0500590_200681
3263 Ga0500590_297504
3264 Ga0500603_007768
3265 Ga0500604_0344311
3266 Ga0500616_0050905
3267 Ga0500622_0143836
3268 Ga0500624_029966
3269 Ga0500627_0185650
3270 Ga0500633_0244469
3271 Ga0500634_0194570
3272 Ga0500638_198954
3273 Ga0500638_357321
3274 Ga0500638_391643
3275 Ga0500639_059100
3276 Ga0500639_077714
3277 Ga0500636_0032501
3278 Ga0500636_0120323
3279 Ga0500636_0166410
3280 Ga0500636_0217347
3281 Ga0500636_0415581
3282 Ga0500637_0324824
3283 Ga0500637_0568362
3284 Ga0500625_015449
3285 Ga0500625_189416
3286 Ga0500552_005353
3287 Ga0500552_028666
3288 Ga0500596_003631
3289 Ga0500596_006493
3290 Ga0500599_021068
3291 Ga0501084_0005309
3292 Ga0500661_017797
3293 Ga0500661_048414
3294 Ga0587082_147885
3295 Ga0501082_0002188
3296 Ga0501082_0179469
3297 Ga0501082_0205711
3298 Ga0501082_1191903
3299 Ga0530510_0923909
3300 Ga0530510_1317479
3301 2507511075
3302 2508544892
3303 2508696882
3304 2509151821
3305 2511400413
3306 2513623537
3307 2513637415
3308 2513649738
3309 2513655091
3310 2513679601
3311 2513696512
3312 2513701150
3313 2513716971
3314 2513874704
3315 2513915886
3316 2514010578
3317 2515625353
3318 2517100645
3319 2517894809
3320 2524438132
3321 2524471408
3322 2524534576
3323 2528857588
3324 2617353285
3325 2617373200
3326 2644289479
3327 2671119225
3328 2723843019
3329 2728747532
3330 2745076987
3331 2793066021
3332 2793071283
3333 2793084041
3334 2805916703
3335 2818238210
3336 2824607536
3337 2824617052
3338 2824625916
3339 2824634672
3340 2824642730
3341 2824650646
3342 2824658767
3343 2824667965
3344 2824678542
3345 2824694990
3346 2824702857
3347 2824712090
3348 2824721431
3349 2824730741
3350 2824738719
3351 2824761472
3352 2824771365
3353 2824780495
3354 2838127950
3355 2841943244
3356 2841954024
3357 2841961934
3358 2841968116
3359 2841976675
3360 2841988047
3361 2844316857
3362 2847938618
3363 2847944183
3364 2849081591
3365 2857512245
3366 2874597808
3367 2874612648
3368 2874616865
3369 2874623379
3370 2874634207
3371 2874651337
3372 2876764059
3373 2876776408
3374 2876820976
3375 2879081729
3376 2879088406
3377 2879108861
3378 2879130443
3379 2879146329
3380 2881370735
3381 2881671282
3382 2885366881
3383 2885376964
3384 2885389349
3385 2885411865
3386 2888381468
3387 2888389177
3388 2888421871
3389 2889033688
3390 2903733908
3391 2903754744
3392 2903773208
3393 2904672690
3394 2904697799
3395 2904719293
3396 2906604524
3397 2906611537
3398 2906635231
3399 2908745117
3400 2908756437
3401 2908781656
3402 2922367046
3403 2922371122
3404 2922390176
3405 2922427818
3406 2929619519
3407 2929628011
3408 2932785843
3409 2932801087
3410 2932804165
3411 2932813591
3412 2932830888
3413 2933581440
3414 2935612693
3415 2935620930
3416 2935632248
3417 2935640014
3418 2935655190
3419 2935664071
3420 2935667132
3421 2935677809
3422 2935690262
3423 2935697403
3424 2935704888
3425 2935718042
3426 2935726808
3427 2935735578
3428 2935745151
3429 2935755272
3430 2935762206
3431 2935773586
3432 2935780146
3433 2935788509
3434 2935796665
3435 2935803710
3436 2935811623
3437 2935824182
3438 2935829497
3439 2935842526
3440 2935852671
3441 2935858738
3442 2935866840
3443 2935876971
3444 2935884026
3445 2935912178
3446 2935922391
3447 2935929207
3448 2935935838
3449 2935947404
3450 2935953501
3451 2935961985
3452 2935968527
3453 2935976711
3454 2935990666
3455 2935993390
3456 2936004285
3457 2936015431
3458 2936024065
3459 2936033080
3460 2936038205
3461 2936051173
3462 2936058551
3463 2940561447
3464 2941508196
3465 2941515298
3466 2941524126
3467 2941533638
3468 2941544627
3469 3005477531
3470 3005489778
3471 3005507072
3472 3005593033
3473 3005596486
3474 3005712555
3475 3005719615
3476 8006966581
3477 8006989427
3478 8006997896
3479 8016516500
3480 8016523911
3481 8016537440
3482 8016541712
3483 8016551561
3484 8016559942
3485 8016567097
3486 8016579815
3487 8016589066
3488 8016597874
3489 8016604012
3490 8016620595
3491 8016629399
3492 8016633911
3493 8017060039
3494 8019537125
3495 8019542423
3496 8019548337
3497 8019559635
3498 8019569742
3499 8019579543
3500 8019587254
3501 8019604085
3502 8019614445
3503 8019625074
3504 8019637107
3505 8019642494
3506 8019650085
3507 8019664974
3508 8019674510
3509 8019681594
3510 8019694180
3511 8055749223
3512 8056674927
3513 8056695227
3514 8056969657

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

7

69

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zud-assembly1.cif.gz_4 structure of this-thif protein complex 0.9161 1 65
1zud-assembly1.cif.gz_4 structure of this-thif protein complex 0.9032 1 65
2lek-assembly1.cif.gz_A solution nmr structure of a thiamine biosynthesis (this) protein rpa3574 from rhodopseudomonas palustris refined with nh rdcs. northeast structural genomics consortium target rpr325 0.893 1 65
3cwi-assembly1.cif.gz_A crystal structure of thiamine biosynthesis protein (this) from geobacter metallireducens. northeast structural genomics consortium target gmr137 0.8833 1 65
2lek-assembly1.cif.gz_A solution nmr structure of a thiamine biosynthesis (this) protein rpa3574 from rhodopseudomonas palustris refined with nh rdcs. northeast structural genomics consortium target rpr325 0.8806 1 65
ID Description Score Start End Superfamily
1zud200 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9162 3 65 3.10.20.30
2lekA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.893 1 65 3.10.20.30
3cwiA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.883 3 64 3.10.20.30
2lekA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8806 1 65 3.10.20.30
3cwiA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8328 3 64 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A537R1X2-F1-model_v4 Sulfur carrier protein ThiS 1.001 1 55
AF-F6DB21-F1-model_v4 Thiamine biosynthesis protein ThiS 0.9821 1 65
AF-A0A8B3C665-F1-model_v4 Sulfur carrier protein ThiS 0.982 1 65
AF-A0A1I7B0K5-F1-model_v4 Sulfur carrier protein ThiS 0.9777 1 65
AF-A0A1H6Y9Y6-F1-model_v4 Sulfur carrier protein 0.977 1 65

Map