F495464
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1719 | 1118 | 1049 | 191 |
Family's Representative Sequence
| Representative Sequence | 3300006051|Ga0075364_10177937|Ga0075364_101779372 |
| Length | 218 |
| Sequence | MYSNAKTAGLPGHEPARLAAADTTATPQGAAHPTASVQDIVQSFEEADEVVQHVDLSGYRFEDWVCLALFWTMAGLVFLQFFSRYVMNDSYAWTEELAVYCLIGVVFLGASMCVRACRHIQVDFLYRYLPKPVGRVLSTLIDVIRTAFFAYAIWLVYRYISLVGDEPMTTLFWNKAYVYWLAFAGFVMMFVRSVQVSVQNWRQGYSILENPSAYDAVD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 5 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 6 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 7 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 8 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 9 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 10 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 11 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 12 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 13 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 14 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 15 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 16 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 17 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 18 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 19 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 20 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 21 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 22 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 23 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 24 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 25 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 26 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 27 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 28 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 29 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 30 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 31 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 32 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 33 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 34 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 35 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 36 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 37 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 38 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 39 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 40 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 41 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 42 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 43 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 44 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 45 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 46 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 47 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 48 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 49 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 50 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 51 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 52 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 53 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 54 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 55 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 56 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 57 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 58 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 59 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 60 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 61 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 62 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 63 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 64 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 65 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 66 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 67 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 68 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 69 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 70 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 71 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 72 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 73 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 74 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 75 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 76 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 77 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 78 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 79 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 80 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 81 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 82 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 83 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 84 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 85 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 86 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 87 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 88 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 89 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 90 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 91 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 92 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 93 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 94 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 95 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 96 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 97 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 98 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 99 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 100 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 101 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 102 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 103 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 104 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 105 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 106 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 107 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 108 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 109 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 110 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 111 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 112 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 113 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 114 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 115 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 116 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 117 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 118 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 119 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 120 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 121 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 122 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 123 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 124 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 125 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 126 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 127 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 128 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 129 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 130 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 131 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 132 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 133 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 134 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 135 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 136 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 137 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 138 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 139 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 140 | 2791355199 | |||
| 141 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 142 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 143 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 144 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 145 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 146 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 147 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 148 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 149 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 150 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 151 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 152 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 153 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 154 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 155 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 156 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 157 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 158 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 159 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 160 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 161 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 162 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 163 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 164 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 165 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 166 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 167 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 168 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 169 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 170 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 171 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 172 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 173 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 174 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 175 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 176 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 177 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 178 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 179 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 180 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 181 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 182 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 183 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 184 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 185 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 186 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 187 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 188 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 189 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 190 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 191 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 192 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 193 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 194 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 195 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 196 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 197 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 198 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 199 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 200 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 201 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 202 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 203 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 204 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 205 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 206 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 207 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 208 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 209 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 210 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 211 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 212 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 213 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 214 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 215 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 216 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 217 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 218 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 219 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 220 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 221 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 222 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 223 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 224 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 225 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 226 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 227 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 228 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 229 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 230 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 231 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 232 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 233 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 234 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 235 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 236 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 237 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 238 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 239 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 240 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 241 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 242 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 243 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 244 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 245 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 246 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 247 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 248 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 249 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 250 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 251 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 252 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 253 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 254 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 255 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 256 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 257 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 258 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 259 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 260 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 261 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 262 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 263 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 264 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 265 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 266 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 267 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 268 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 269 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 270 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 271 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 272 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 273 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 274 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 275 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 276 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 277 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 278 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 279 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 280 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 281 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 282 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 283 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 284 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 285 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 286 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 287 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 288 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 289 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 290 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 291 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 292 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 293 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 294 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 295 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 296 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 297 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 298 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 299 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 300 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 301 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 302 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 303 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 304 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 305 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 306 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 307 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 308 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 309 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 310 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 311 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 312 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 313 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 314 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 315 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 316 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 317 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 318 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 319 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 320 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 321 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 322 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 323 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 324 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 325 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 326 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 327 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 328 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 329 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 330 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 331 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 332 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 333 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 334 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 335 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 336 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 337 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 338 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 339 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 340 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 341 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 342 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 343 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 344 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 345 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 346 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 347 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 348 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 349 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 350 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 351 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 352 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 353 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 354 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 355 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 356 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 357 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 358 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 359 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 360 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 361 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 362 | 2922368715 | |||
| 363 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 364 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 365 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 366 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 367 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 368 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 369 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 370 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 371 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 372 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 373 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 374 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 375 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 376 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 377 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 378 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 379 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 380 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 381 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 382 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 383 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 384 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 385 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 386 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 387 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 388 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 389 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 390 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 391 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 392 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 393 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 394 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 395 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 396 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 397 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 398 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 399 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 400 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 401 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 402 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 403 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 404 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 405 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 406 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 407 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 408 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 409 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 410 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 411 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 412 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 413 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 414 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 415 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 416 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 417 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 418 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 419 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 420 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 421 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 422 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 423 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 424 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 425 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 426 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 427 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 428 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 429 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 430 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 431 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 432 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 433 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 434 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 435 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 436 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 437 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 438 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 439 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 440 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 441 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 442 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 443 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 444 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 445 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 446 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 447 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 448 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 449 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 450 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 451 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 452 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 453 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 454 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 455 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 456 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 457 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 458 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 459 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 460 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 461 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 462 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 463 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 464 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 465 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 466 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 467 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 468 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 469 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 470 | 2941479691 | |||
| 471 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 472 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 473 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 474 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 475 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 476 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 477 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 478 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 479 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 480 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 481 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 482 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 483 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 484 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 485 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 486 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 487 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 488 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 489 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 490 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 491 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 492 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 493 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 494 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 495 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 496 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 497 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 498 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 499 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 500 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 501 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 502 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 503 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 504 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 505 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 506 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 507 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 508 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 509 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 510 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 511 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 512 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 513 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 514 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 515 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 516 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 517 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 518 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 519 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 520 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 521 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 522 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 523 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 524 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 525 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 526 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 527 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 528 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 529 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 530 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 531 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 532 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 533 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 534 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 535 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 536 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 537 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 538 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 539 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 540 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 541 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 542 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 543 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 544 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 545 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 546 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 547 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 548 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 549 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 550 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 551 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 552 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 553 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 554 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 555 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 556 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 557 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 558 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 559 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 560 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 561 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 562 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 563 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 564 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 565 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 566 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 567 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 568 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 569 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 570 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 571 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 572 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 573 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 574 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 575 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 576 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 577 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 578 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 579 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 580 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 581 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 582 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 583 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 584 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 585 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 586 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 587 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 588 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 589 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 590 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 591 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 592 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 593 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 594 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 595 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 596 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 597 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 598 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 599 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 600 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 601 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 602 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 603 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 604 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 605 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 606 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 607 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 608 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 609 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 610 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 611 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 612 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 613 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 614 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 615 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 616 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 617 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 618 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 619 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 620 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 621 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 622 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 623 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 624 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 625 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 626 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 627 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 628 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 629 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 630 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 631 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 632 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 633 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 634 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 635 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 636 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 637 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 638 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 639 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 640 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 641 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 642 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 643 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 644 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 645 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 646 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 647 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 648 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 649 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 650 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 651 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 652 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 653 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 654 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 655 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 656 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 657 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 658 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 659 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 660 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 661 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 662 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 663 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 664 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 665 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 666 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 667 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 668 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 669 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 670 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 671 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 672 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 673 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 674 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 675 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 676 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 677 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 678 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 679 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 680 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 681 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 682 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 683 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 684 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 685 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 686 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 687 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 688 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 689 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 690 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 691 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 692 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 693 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 694 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 695 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 696 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 697 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 698 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 699 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 700 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 701 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 702 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 703 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 704 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 705 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 706 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 707 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 708 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 709 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 710 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 711 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 712 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 713 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 714 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 715 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 716 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 717 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 718 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 719 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 720 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 721 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 722 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 723 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 724 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 725 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 726 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 727 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 728 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 729 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 730 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 731 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 732 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 733 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 734 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 735 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 736 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 737 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 738 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 739 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 740 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 741 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 742 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 743 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 744 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 745 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 746 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 747 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 748 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 749 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 750 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 751 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 752 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 753 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 754 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 755 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 756 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 757 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 758 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 759 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 760 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 761 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 762 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 763 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 764 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 765 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 766 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 767 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 768 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 769 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 770 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 771 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 772 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 773 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 774 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 775 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 776 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 777 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 778 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 779 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 780 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 781 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 782 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 783 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 784 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 785 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 786 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 787 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 788 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 789 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 790 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 791 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 792 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 793 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 794 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 795 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 796 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 797 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 798 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 799 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 800 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 801 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 802 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 803 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 804 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 805 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 806 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 807 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 808 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 809 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 810 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 811 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 812 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 813 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 814 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 815 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 816 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 817 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 818 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 819 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 820 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 821 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 822 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 823 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 824 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 825 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 826 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 827 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 828 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 829 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 830 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 831 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 832 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 833 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 834 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 835 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 836 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 837 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 838 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 839 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 840 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 841 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 842 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 843 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 844 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 845 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 846 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 847 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 848 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 849 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 850 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 851 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 852 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 853 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 854 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 855 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 856 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 857 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 858 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 859 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 860 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 861 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 862 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 863 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 864 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 865 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 866 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 867 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 868 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 869 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 870 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 871 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 872 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 873 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 874 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 875 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 876 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 877 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 878 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 879 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 880 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 881 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 882 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 883 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 884 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 885 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 886 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 887 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 888 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 889 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 890 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 891 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 892 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 893 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 894 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 895 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 896 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 897 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 898 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 899 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 900 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 901 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 902 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 903 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 904 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 905 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 906 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 907 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 908 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 909 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 910 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 911 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 912 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 913 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 914 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 915 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 916 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 917 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 918 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 919 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 920 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 921 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 922 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 923 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 924 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 925 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 926 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 927 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 928 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 929 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 930 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 931 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 932 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 933 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 934 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 935 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 936 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 937 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 938 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 939 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 940 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 941 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 942 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 943 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 944 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 945 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 946 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 947 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 948 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 949 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 950 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 951 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 952 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 953 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 954 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 955 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 956 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 957 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 958 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 959 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 960 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 961 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 962 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 963 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 964 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 965 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 966 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 967 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 968 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 969 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 970 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 971 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 972 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 973 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 974 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 975 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 976 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 977 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 978 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 979 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 980 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 981 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 982 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 983 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 984 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 985 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 986 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 987 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 988 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 989 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 990 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 991 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 992 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 993 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 994 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 995 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 996 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 997 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 998 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 999 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 1000 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 1001 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 1002 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 1003 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 1004 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 1005 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 1006 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 1007 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 1008 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 1009 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 1010 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 1011 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 1012 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 1013 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 1014 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 1015 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 1016 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 1017 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 1018 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 1019 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1020 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 1021 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 1022 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 1023 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 1024 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 1025 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 1026 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 1027 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 1028 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 1029 | 3300053152 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere | Metagenome | Endosphere |
| 1030 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1031 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 1032 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 1033 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1034 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 1035 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 1036 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 1037 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 1038 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 1039 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 1040 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 1041 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 1042 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 1043 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 1044 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1045 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1046 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1047 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1048 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1049 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1050 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1051 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1052 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1053 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1054 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1055 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1056 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1057 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1058 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1059 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1060 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1061 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1062 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1063 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1064 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1065 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1066 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1067 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1068 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1069 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1070 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1071 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 1072 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 1073 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 1074 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 1075 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 1076 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 1077 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 1078 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 1079 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 1080 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 1081 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 1082 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 1083 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 1084 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 1085 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 1086 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 1087 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 1088 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 1089 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1090 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1091 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1092 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1093 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 1094 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 1095 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 1096 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 1097 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 1098 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 1099 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 1100 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 1101 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 1102 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 1103 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 1104 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 1105 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 1106 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 1107 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 1108 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1109 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1110 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1111 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1112 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 1113 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 1114 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1115 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1116 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 1117 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
| 1118 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 61.04 |
| Metatranscriptomes | 0.12 |
| Isolates | 38.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.29 |
| Bulb | 0 |
| Endosphere | 20.3 |
| Nodule | 32.98 |
| Rhizoplane | 3.03 |
| Rhizosphere | 30.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25158J39367_1000856 | 3300002739 | Bacteria | 5804 |
| 2 | JGI25159J45721_1002192 | 3300002987 | Bacteria | 7596 |
| 3 | JGI25159J45721_1013501 | 3300002987 | Bacteria | 1886 |
| 4 | JGI25151J46595_10000463 | 3300003187 | Bacteria | 38967 |
| 5 | JGI25151J46595_10005027 | 3300003187 | Bacteria | 6886 |
| 6 | JGI25151J46595_10017428 | 3300003187 | Bacteria | 3113 |
| 7 | JGI25151J46595_10022275 | 3300003187 | Bacteria | 2633 |
| 8 | JGI25151J46595_10053605 | 3300003187 | Bacteria | 1345 |
| 9 | JGI25151J46595_10059344 | 3300003187 | Bacteria | 1232 |
| 10 | JGI25165J46597_1002684 | 3300003214 | Bacteria | 5318 |
| 11 | JGI25153J46596_10000681 | 3300003215 | Bacteria | 20727 |
| 12 | JGI25153J46596_10006921 | 3300003215 | Bacteria | 5655 |
| 13 | JGI25153J46596_10019799 | 3300003215 | Bacteria | 2564 |
| 14 | JGI25153J46596_10023467 | 3300003215 | Bacteria | 2247 |
| 15 | JGI25153J46596_10024497 | 3300003215 | Bacteria | 2176 |
| 16 | rootH1_10031368 | 3300003316 | Bacteria | 1339 |
| 17 | rootH1_10247466 | 3300003323 | Bacteria | 1458 |
| 18 | rootH1_10290538 | 3300003323 | Bacteria | 1625 |
| 19 | JGI25160J50197_1000797 | 3300003354 | Bacteria | 16984 |
| 20 | JGI25160J50197_1004179 | 3300003354 | Bacteria | 6277 |
| 21 | JGI25161J50226_1000233 | 3300003374 | Bacteria | 33741 |
| 22 | JGI25161J50226_1009245 | 3300003374 | Bacteria | 1425 |
| 23 | Ga0006562J51391_1010713 | 3300003578 | Bacteria | 4233 |
| 24 | JGI25404J52841_10005354 | 3300003659 | Bacteria | 2650 |
| 25 | Ga0055526_1001056 | 3300003771 | Bacteria | 20118 |
| 26 | Ga0055526_1004150 | 3300003771 | Bacteria | 8819 |
| 27 | Ga0055526_1005610 | 3300003771 | Bacteria | 7145 |
| 28 | Ga0055526_1009661 | 3300003771 | Bacteria | 4603 |
| 29 | Ga0055526_1010437 | 3300003771 | Bacteria | 4320 |
| 30 | Ga0055526_1011504 | 3300003771 | Bacteria | 3975 |
| 31 | Ga0055526_1016600 | 3300003771 | Bacteria | 2867 |
| 32 | Ga0055526_1036630 | 3300003771 | Bacteria | 1298 |
| 33 | Ga0055526_1036771 | 3300003771 | Bacteria | 1292 |
| 34 | Ga0055526_1044756 | 3300003771 | Bacteria | 1065 |
| 35 | Ga0055526_1046453 | 3300003771 | Bacteria | 1028 |
| 36 | Ga0055537_1004444 | 3300003773 | Bacteria | 4012 |
| 37 | Ga0055524_1000751 | 3300003775 | Bacteria | 22061 |
| 38 | Ga0055524_1001893 | 3300003775 | Bacteria | 11352 |
| 39 | Ga0055524_1004819 | 3300003775 | Bacteria | 6149 |
| 40 | Ga0055524_1006307 | 3300003775 | Bacteria | 5157 |
| 41 | Ga0055524_1012728 | 3300003775 | Bacteria | 3213 |
| 42 | Ga0055524_1014427 | 3300003775 | Bacteria | 2927 |
| 43 | Ga0055524_1052904 | 3300003775 | Bacteria | 903 |
| 44 | Ga0055536_1000380 | 3300003781 | Bacteria | 32625 |
| 45 | Ga0055534_1009966 | 3300003784 | Bacteria | 2021 |
| 46 | Ga0055528_1000054 | 3300003790 | Bacteria | 90334 |
| 47 | Ga0055528_1000343 | 3300003790 | Bacteria | 38462 |
| 48 | Ga0055528_1000764 | 3300003790 | Bacteria | 22452 |
| 49 | Ga0055528_1003831 | 3300003790 | Bacteria | 7401 |
| 50 | Ga0055528_1010860 | 3300003790 | Bacteria | 3663 |
| 51 | Ga0055528_1024968 | 3300003790 | Bacteria | 1773 |
| 52 | Ga0055530_10016080 | 3300003791 | Bacteria | 2408 |
| 53 | Ga0055540_1000077 | 3300003792 | Bacteria | 114283 |
| 54 | Ga0055540_1002166 | 3300003792 | Bacteria | 10702 |
| 55 | Ga0055540_1007797 | 3300003792 | Bacteria | 3972 |
| 56 | Ga0055540_1030799 | 3300003792 | Bacteria | 1240 |
| 57 | Ga0055531_10001197 | 3300003794 | Bacteria | 19909 |
| 58 | Ga0055531_10009606 | 3300003794 | Bacteria | 4926 |
| 59 | Ga0055531_10049381 | 3300003794 | Bacteria | 1124 |
| 60 | Ga0058692_1002629 | 3300003856 | Bacteria | 5920 |
| 61 | Ga0055543_1000770 | 3300004625 | Bacteria | 15967 |
| 62 | Ga0055543_1001585 | 3300004625 | Bacteria | 8771 |
| 63 | Ga0055543_1004072 | 3300004625 | Bacteria | 4093 |
| 64 | Ga0065165_1000062 | 3300005262 | Bacteria | 178885 |
| 65 | Ga0065165_1000254 | 3300005262 | Bacteria | 92762 |
| 66 | Ga0065165_1001892 | 3300005262 | Bacteria | 20185 |
| 67 | Ga0065165_1018148 | 3300005262 | Bacteria | 2560 |
| 68 | Ga0065165_1036576 | 3300005262 | Bacteria | 1496 |
| 69 | Ga0065707_10020470 | 3300005295 | Bacteria | 2196 |
| 70 | Ga0070658_10096070 | 3300005327 | Bacteria | 2446 |
| 71 | Ga0070676_10131218 | 3300005328 | Bacteria | 1585 |
| 72 | Ga0070690_100288724 | 3300005330 | Bacteria | 1172 |
| 73 | Ga0070670_100222172 | 3300005331 | Bacteria | 1643 |
| 74 | Ga0068869_100096373 | 3300005334 | Bacteria | 2233 |
| 75 | Ga0068869_100275493 | 3300005334 | Bacteria | 1351 |
| 76 | Ga0068869_100951250 | 3300005334 | Bacteria | 746 |
| 77 | Ga0070680_100878964 | 3300005336 | Bacteria | 773 |
| 78 | Ga0070682_100105754 | 3300005337 | Bacteria | 1866 |
| 79 | Ga0068868_100370495 | 3300005338 | Bacteria | 1230 |
| 80 | Ga0070660_100596084 | 3300005339 | Bacteria | 924 |
| 81 | Ga0070661_100166232 | 3300005344 | Bacteria | 1673 |
| 82 | Ga0070661_100387547 | 3300005344 | Bacteria | 1103 |
| 83 | Ga0070668_100027793 | 3300005347 | Bacteria | 4294 |
| 84 | Ga0070668_100134154 | 3300005347 | Bacteria | 1989 |
| 85 | Ga0070668_100451299 | 3300005347 | Bacteria | 1105 |
| 86 | Ga0070668_100673554 | 3300005347 | Bacteria | 910 |
| 87 | Ga0070669_100510440 | 3300005353 | Bacteria | 998 |
| 88 | Ga0070671_100425483 | 3300005355 | Bacteria | 1137 |
| 89 | Ga0070671_100555232 | 3300005355 | Bacteria | 990 |
| 90 | Ga0070671_100634209 | 3300005355 | Bacteria | 925 |
| 91 | Ga0070674_100239932 | 3300005356 | Bacteria | 1419 |
| 92 | Ga0070673_100443570 | 3300005364 | Bacteria | 1167 |
| 93 | Ga0070673_100524575 | 3300005364 | Bacteria | 1074 |
| 94 | Ga0070659_100276800 | 3300005366 | Bacteria | 1395 |
| 95 | Ga0070659_100421550 | 3300005366 | Bacteria | 1129 |
| 96 | Ga0070667_100105184 | 3300005367 | Bacteria | 2442 |
| 97 | Ga0070705_100406545 | 3300005440 | Unclassified | 1009 |
| 98 | Ga0070700_100465060 | 3300005441 | Bacteria | 965 |
| 99 | Ga0070694_100524386 | 3300005444 | Bacteria | 945 |
| 100 | Ga0070708_100577764 | 3300005445 | Bacteria | 1060 |
| 101 | Ga0070663_100051087 | 3300005455 | Bacteria | 2943 |
| 102 | Ga0070663_100057161 | 3300005455 | Bacteria | 2798 |
| 103 | Ga0070663_100199903 | 3300005455 | Bacteria | 1559 |
| 104 | Ga0070678_100599044 | 3300005456 | Bacteria | 984 |
| 105 | Ga0070678_101243152 | 3300005456 | Bacteria | 692 |
| 106 | Ga0070662_100289137 | 3300005457 | Bacteria | 1328 |
| 107 | Ga0070662_100657402 | 3300005457 | Bacteria | 884 |
| 108 | Ga0068867_100167283 | 3300005459 | Bacteria | 1738 |
| 109 | Ga0070685_10384864 | 3300005466 | Bacteria | 967 |
| 110 | Ga0070698_100101177 | 3300005471 | Bacteria | 2853 |
| 111 | Ga0070699_100116843 | 3300005518 | Bacteria | 2345 |
| 112 | Ga0070679_100022779 | 3300005530 | Bacteria | 6126 |
| 113 | Ga0070684_100508830 | 3300005535 | Bacteria | 1116 |
| 114 | Ga0068853_100160170 | 3300005539 | Bacteria | 2030 |
| 115 | Ga0068853_100915293 | 3300005539 | Bacteria | 843 |
| 116 | Ga0070686_100623035 | 3300005544 | Bacteria | 852 |
| 117 | Ga0070695_100049566 | 3300005545 | Bacteria | 2689 |
| 118 | Ga0070695_100056057 | 3300005545 | Bacteria | 2542 |
| 119 | Ga0070696_100014883 | 3300005546 | Bacteria | 5223 |
| 120 | Ga0070696_100194535 | 3300005546 | Bacteria | 1511 |
| 121 | Ga0070693_100089430 | 3300005547 | Bacteria | 1854 |
| 122 | Ga0070665_100010206 | 3300005548 | Bacteria | 9500 |
| 123 | Ga0070665_100151094 | 3300005548 | Bacteria | 2325 |
| 124 | Ga0070665_100309953 | 3300005548 | Bacteria | 1582 |
| 125 | Ga0070665_100379044 | 3300005548 | Bacteria | 1422 |
| 126 | Ga0070665_100470355 | 3300005548 | Bacteria | 1267 |
| 127 | Ga0070704_100029644 | 3300005549 | Bacteria | 3657 |
| 128 | Ga0070704_100521192 | 3300005549 | Bacteria | 1034 |
| 129 | Ga0068855_100030747 | 3300005563 | Bacteria | 6420 |
| 130 | Ga0068857_100623354 | 3300005577 | Bacteria | 1021 |
| 131 | Ga0068854_100344494 | 3300005578 | Bacteria | 1218 |
| 132 | Ga0068854_100367034 | 3300005578 | Bacteria | 1182 |
| 133 | Ga0068856_100207790 | 3300005614 | Bacteria | 1972 |
| 134 | Ga0068856_101036051 | 3300005614 | Bacteria | 839 |
| 135 | Ga0070702_100038055 | 3300005615 | Bacteria | 2675 |
| 136 | Ga0068852_100025826 | 3300005616 | Bacteria | 4765 |
| 137 | Ga0068852_100261872 | 3300005616 | Bacteria | 1661 |
| 138 | Ga0068859_100149727 | 3300005617 | Bacteria | 2409 |
| 139 | Ga0068859_100752044 | 3300005617 | Bacteria | 1064 |
| 140 | Ga0068864_100057625 | 3300005618 | Bacteria | 3356 |
| 141 | Ga0068861_100091696 | 3300005719 | Bacteria | 2399 |
| 142 | Ga0068861_100136783 | 3300005719 | Bacteria | 1995 |
| 143 | Ga0068870_10257109 | 3300005840 | Bacteria | 1085 |
| 144 | Ga0068863_100128828 | 3300005841 | Bacteria | 2415 |
| 145 | Ga0068863_100337581 | 3300005841 | Bacteria | 1465 |
| 146 | Ga0068863_100917553 | 3300005841 | Bacteria | 876 |
| 147 | Ga0068858_100254176 | 3300005842 | Bacteria | 1669 |
| 148 | Ga0068858_101389051 | 3300005842 | Bacteria | 692 |
| 149 | Ga0068860_100000312 | 3300005843 | Bacteria | 66724 |
| 150 | Ga0068860_100131015 | 3300005843 | Bacteria | 2406 |
| 151 | Ga0068860_100137173 | 3300005843 | Bacteria | 2350 |
| 152 | Ga0068860_100483380 | 3300005843 | Bacteria | 1234 |
| 153 | Ga0068860_100849333 | 3300005843 | Bacteria | 928 |
| 154 | Ga0068862_100441046 | 3300005844 | Bacteria | 1225 |
| 155 | Ga0081455_10018391 | 3300005937 | Bacteria | 6660 |
| 156 | Ga0081455_10072627 | 3300005937 | Bacteria | 2848 |
| 157 | Ga0081540_1003077 | 3300005983 | Bacteria | 13369 |
| 158 | Ga0081540_1003847 | 3300005983 | Bacteria | 11731 |
| 159 | Ga0081540_1015210 | 3300005983 | Bacteria | 4881 |
| 160 | Ga0081539_10024214 | 3300005985 | Bacteria | 3947 |
| 161 | Ga0075365_10011642 | 3300006038 | Bacteria | 5183 |
| 162 | Ga0075365_10016024 | 3300006038 | Bacteria | 4547 |
| 163 | Ga0075365_10019199 | 3300006038 | Bacteria | 4216 |
| 164 | Ga0075365_10019469 | 3300006038 | Bacteria | 4190 |
| 165 | Ga0075365_10077252 | 3300006038 | Bacteria | 2249 |
| 166 | Ga0075365_10170772 | 3300006038 | Bacteria | 1518 |
| 167 | Ga0075365_10192833 | 3300006038 | Bacteria | 1426 |
| 168 | Ga0075365_10217976 | 3300006038 | Bacteria | 1338 |
| 169 | Ga0075365_10396613 | 3300006038 | Bacteria | 974 |
| 170 | Ga0075368_10057000 | 3300006042 | Bacteria | 1559 |
| 171 | Ga0075368_10150941 | 3300006042 | Bacteria | 971 |
| 172 | Ga0075368_10268398 | 3300006042 | Bacteria | 731 |
| 173 | Ga0075363_100036248 | 3300006048 | Bacteria | 2586 |
| 174 | Ga0075363_100106500 | 3300006048 | Bacteria | 1555 |
| 175 | Ga0075363_100115464 | 3300006048 | Bacteria | 1495 |
| 176 | Ga0075363_100147378 | 3300006048 | Bacteria | 1327 |
| 177 | Ga0075363_100152898 | 3300006048 | Bacteria | 1303 |
| 178 | Ga0075363_100189770 | 3300006048 | Bacteria | 1172 |
| 179 | Ga0075363_100205378 | 3300006048 | Bacteria | 1126 |
| 180 | Ga0075363_100301451 | 3300006048 | Bacteria | 930 |
| 181 | Ga0075363_100332875 | 3300006048 | Bacteria | 885 |
| 182 | Ga0075364_10131203 | 3300006051 | Bacteria | 1681 |
| 183 | Ga0075364_10161287 | 3300006051 | Bacteria | 1513 |
| 184 | Ga0075364_10177937 | 3300006051 | Bacteria | 1439 |
| 185 | Ga0075364_10188523 | 3300006051 | Bacteria | 1396 |
| 186 | Ga0075364_10523433 | 3300006051 | Bacteria | 811 |
| 187 | Ga0075432_10174647 | 3300006058 | Bacteria | 837 |
| 188 | Ga0075362_10031083 | 3300006177 | Bacteria | 2309 |
| 189 | Ga0075362_10056513 | 3300006177 | Bacteria | 1766 |
| 190 | Ga0075362_10141902 | 3300006177 | Bacteria | 1148 |
| 191 | Ga0075362_10219497 | 3300006177 | Bacteria | 929 |
| 192 | Ga0075367_10002993 | 3300006178 | Bacteria | 7906 |
| 193 | Ga0075367_10015631 | 3300006178 | Bacteria | 4131 |
| 194 | Ga0075367_10039713 | 3300006178 | Bacteria | 2745 |
| 195 | Ga0075367_10077326 | 3300006178 | Bacteria | 2009 |
| 196 | Ga0075367_10116915 | 3300006178 | Bacteria | 1641 |
| 197 | Ga0075367_10118573 | 3300006178 | Bacteria | 1629 |
| 198 | Ga0075367_10140357 | 3300006178 | Bacteria | 1496 |
| 199 | Ga0075367_10148001 | 3300006178 | Bacteria | 1456 |
| 200 | Ga0075367_10307874 | 3300006178 | Bacteria | 998 |
| 201 | Ga0075369_10001157 | 3300006186 | Bacteria | 8907 |
| 202 | Ga0075369_10008423 | 3300006186 | Bacteria | 3966 |
| 203 | Ga0075369_10020074 | 3300006186 | Bacteria | 2734 |
| 204 | Ga0075369_10058365 | 3300006186 | Bacteria | 1680 |
| 205 | Ga0075369_10062446 | 3300006186 | Bacteria | 1627 |
| 206 | Ga0075369_10070913 | 3300006186 | Bacteria | 1533 |
| 207 | Ga0075369_10128222 | 3300006186 | Bacteria | 1151 |
| 208 | Ga0075369_10175197 | 3300006186 | Bacteria | 986 |
| 209 | Ga0075366_10005356 | 3300006195 | Bacteria | 6953 |
| 210 | Ga0075366_10179281 | 3300006195 | Bacteria | 1287 |
| 211 | Ga0075366_10418172 | 3300006195 | Bacteria | 826 |
| 212 | Ga0097621_100059180 | 3300006237 | Bacteria | 3135 |
| 213 | Ga0097621_100217989 | 3300006237 | Bacteria | 1662 |
| 214 | Ga0097621_100424722 | 3300006237 | Bacteria | 1193 |
| 215 | Ga0097621_101089209 | 3300006237 | Bacteria | 750 |
| 216 | Ga0075370_10004301 | 3300006353 | Bacteria | 6897 |
| 217 | Ga0075370_10006606 | 3300006353 | Bacteria | 5845 |
| 218 | Ga0075370_10060852 | 3300006353 | Bacteria | 2151 |
| 219 | Ga0075370_10083155 | 3300006353 | Bacteria | 1841 |
| 220 | Ga0075370_10151398 | 3300006353 | Bacteria | 1359 |
| 221 | Ga0075370_10193974 | 3300006353 | Bacteria | 1197 |
| 222 | Ga0075370_10238967 | 3300006353 | Bacteria | 1075 |
| 223 | Ga0075370_10654863 | 3300006353 | Bacteria | 638 |
| 224 | Ga0068871_100036259 | 3300006358 | Bacteria | 3925 |
| 225 | Ga0075428_100341164 | 3300006844 | Bacteria | 1609 |
| 226 | Ga0075428_100372345 | 3300006844 | Bacteria | 1531 |
| 227 | Ga0075430_100138044 | 3300006846 | Bacteria | 2031 |
| 228 | Ga0075429_100532299 | 3300006880 | Bacteria | 1030 |
| 229 | Ga0068865_100188398 | 3300006881 | Bacteria | 1593 |
| 230 | Ga0097620_100149730 | 3300006931 | Bacteria | 2409 |
| 231 | Ga0097620_100752115 | 3300006931 | Bacteria | 1064 |
| 232 | Ga0099825_1027405 | 3300006941 | Bacteria | 2901 |
| 233 | Ga0099823_1018479 | 3300006944 | Bacteria | 6721 |
| 234 | Ga0079104_1000044 | 3300006946 | Bacteria | 185367 |
| 235 | Ga0079104_1010264 | 3300006946 | Bacteria | 3098 |
| 236 | Ga0079104_1013037 | 3300006946 | Bacteria | 2582 |
| 237 | Ga0099826_10000071 | 3300006948 | Bacteria | 53307 |
| 238 | Ga0099826_10063147 | 3300006948 | Bacteria | 2396 |
| 239 | Ga0099826_10263439 | 3300006948 | Bacteria | 901 |
| 240 | Ga0105244_10100660 | 3300009036 | Bacteria | 1414 |
| 241 | Ga0105250_10067231 | 3300009092 | Bacteria | 1446 |
| 242 | Ga0105250_10110873 | 3300009092 | Bacteria | 1123 |
| 243 | Ga0105240_10006408 | 3300009093 | Bacteria | 17305 |
| 244 | Ga0105240_10238268 | 3300009093 | Bacteria | 2111 |
| 245 | Ga0105240_11142676 | 3300009093 | Bacteria | 827 |
| 246 | Ga0111539_10126014 | 3300009094 | Bacteria | 3000 |
| 247 | Ga0111539_10616218 | 3300009094 | Bacteria | 1264 |
| 248 | Ga0105245_10280154 | 3300009098 | Bacteria | 1629 |
| 249 | Ga0105245_10557569 | 3300009098 | Bacteria | 1168 |
| 250 | Ga0105245_10828231 | 3300009098 | Bacteria | 964 |
| 251 | Ga0105247_10324831 | 3300009101 | Bacteria | 1075 |
| 252 | Ga0114129_10039885 | 3300009147 | Bacteria | 6624 |
| 253 | Ga0114129_10134378 | 3300009147 | Bacteria | 3395 |
| 254 | Ga0105243_10006759 | 3300009148 | Bacteria | 8849 |
| 255 | Ga0105243_10081705 | 3300009148 | Bacteria | 2639 |
| 256 | Ga0105243_10479925 | 3300009148 | Bacteria | 1173 |
| 257 | Ga0105243_11085061 | 3300009148 | Bacteria | 808 |
| 258 | Ga0105241_10197760 | 3300009174 | Bacteria | 1677 |
| 259 | Ga0105241_10906272 | 3300009174 | Bacteria | 819 |
| 260 | Ga0105242_10152004 | 3300009176 | Bacteria | 2019 |
| 261 | Ga0105242_10891563 | 3300009176 | Bacteria | 888 |
| 262 | Ga0105248_10077894 | 3300009177 | Bacteria | 3727 |
| 263 | Ga0105248_10769494 | 3300009177 | Bacteria | 1086 |
| 264 | Ga0105248_10832293 | 3300009177 | Bacteria | 1042 |
| 265 | Ga0105248_11853285 | 3300009177 | Bacteria | 684 |
| 266 | Ga0105237_10030303 | 3300009545 | Bacteria | 5497 |
| 267 | Ga0105237_10061732 | 3300009545 | Bacteria | 3746 |
| 268 | Ga0105237_10260453 | 3300009545 | Bacteria | 1737 |
| 269 | Ga0105237_10340975 | 3300009545 | Bacteria | 1503 |
| 270 | Ga0105237_10860403 | 3300009545 | Bacteria | 913 |
| 271 | Ga0105237_11071292 | 3300009545 | Bacteria | 813 |
| 272 | Ga0105238_10118785 | 3300009551 | Bacteria | 2624 |
| 273 | Ga0105238_10261162 | 3300009551 | Bacteria | 1711 |
| 274 | Ga0105238_10922997 | 3300009551 | Bacteria | 892 |
| 275 | Ga0105249_10001039 | 3300009553 | Bacteria | 24545 |
| 276 | Ga0105249_10059087 | 3300009553 | Bacteria | 3516 |
| 277 | Ga0105249_10105017 | 3300009553 | Bacteria | 2663 |
| 278 | Ga0105249_10517587 | 3300009553 | Bacteria | 1240 |
| 279 | Ga0105249_10557109 | 3300009553 | Bacteria | 1197 |
| 280 | Ga0123341_1000044 | 3300009765 | Bacteria | 52707 |
| 281 | Ga0105239_10023525 | 3300010375 | Bacteria | 6786 |
| 282 | Ga0105239_10147958 | 3300010375 | Bacteria | 2620 |
| 283 | Ga0105239_10492903 | 3300010375 | Bacteria | 1393 |
| 284 | Ga0105239_10704658 | 3300010375 | Bacteria | 1154 |
| 285 | Ga0105239_10910710 | 3300010375 | Bacteria | 1009 |
| 286 | Ga0105246_10069899 | 3300011119 | Bacteria | 2467 |
| 287 | Ga0157339_1007446 | 3300012505 | Bacteria | 919 |
| 288 | Ga0157342_1012805 | 3300012507 | Bacteria | 889 |
| 289 | Ga0157338_1025190 | 3300012515 | Bacteria | 723 |
| 290 | Ga0157373_10040827 | 3300013100 | Bacteria | 3320 |
| 291 | Ga0157373_10145800 | 3300013100 | Bacteria | 1665 |
| 292 | Ga0157371_10000002 | 3300013102 | Bacteria | 665040 |
| 293 | Ga0157371_10051710 | 3300013102 | Bacteria | 2919 |
| 294 | Ga0157370_10000211 | 3300013104 | Bacteria | 74012 |
| 295 | Ga0157370_10421021 | 3300013104 | Bacteria | 1229 |
| 296 | Ga0157369_10238175 | 3300013105 | Bacteria | 1901 |
| 297 | Ga0157369_10270702 | 3300013105 | Bacteria | 1770 |
| 298 | Ga0171462_1009 | 3300013250 | Bacteria | 344993 |
| 299 | Ga0157378_10434649 | 3300013297 | Bacteria | 1300 |
| 300 | Ga0163162_11377263 | 3300013306 | Bacteria | 802 |
| 301 | Ga0157372_10582116 | 3300013307 | Bacteria | 1305 |
| 302 | Ga0157375_10060268 | 3300013308 | Bacteria | 3763 |
| 303 | Ga0157375_10735844 | 3300013308 | Bacteria | 1138 |
| 304 | Ga0163163_10330721 | 3300014325 | Bacteria | 1578 |
| 305 | Ga0163163_10410330 | 3300014325 | Bacteria | 1413 |
| 306 | Ga0163163_10686487 | 3300014325 | Bacteria | 1087 |
| 307 | Ga0157380_10026681 | 3300014326 | Bacteria | 4388 |
| 308 | Ga0157380_11420697 | 3300014326 | Bacteria | 745 |
| 309 | Ga0157377_10059883 | 3300014745 | Bacteria | 2172 |
| 310 | Ga0157379_10010498 | 3300014968 | Bacteria | 8073 |
| 311 | Ga0157376_10377837 | 3300014969 | Bacteria | 1364 |
| 312 | Ga0157376_10992808 | 3300014969 | Bacteria | 862 |
| 313 | Ga0163161_10056284 | 3300017792 | Bacteria | 2856 |
| 314 | Ga0163161_10402324 | 3300017792 | Bacteria | 1098 |
| 315 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 316 | Ga0214544_1000018 | 3300021320 | Bacteria | 187095 |
| 317 | Ga0214542_1000005 | 3300021321 | Bacteria | 389646 |
| 318 | Ga0214542_1000307 | 3300021321 | Bacteria | 83288 |
| 319 | Ga0214542_1015078 | 3300021321 | Bacteria | 8269 |
| 320 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 321 | Ga0214545_1035348 | 3300021324 | Bacteria | 1661 |
| 322 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 323 | Ga0214543_1000012 | 3300021327 | Bacteria | 338982 |
| 324 | Ga0214543_1000195 | 3300021327 | Bacteria | 89886 |
| 325 | Ga0228711_1002598 | 3300022739 | Bacteria | 27893 |
| 326 | Ga0228710_1002752 | 3300022740 | Bacteria | 27893 |
| 327 | Ga0209436_100007 | 3300025208 | Bacteria | 149841 |
| 328 | Ga0209563_102920 | 3300025230 | Bacteria | 3692 |
| 329 | Ga0207425_1005546 | 3300025245 | Bacteria | 3583 |
| 330 | Ga0207425_1005811 | 3300025245 | Bacteria | 3465 |
| 331 | Ga0207425_1007795 | 3300025245 | Bacteria | 2792 |
| 332 | Ga0207425_1021884 | 3300025245 | Bacteria | 1352 |
| 333 | Ga0207425_1037312 | 3300025245 | Bacteria | 938 |
| 334 | Ga0209677_103599 | 3300025253 | Bacteria | 4914 |
| 335 | Ga0209129_1001290 | 3300025258 | Bacteria | 14284 |
| 336 | Ga0209129_1001482 | 3300025258 | Bacteria | 13045 |
| 337 | Ga0209233_1000820 | 3300025261 | Bacteria | 13833 |
| 338 | Ga0209233_1020687 | 3300025261 | Bacteria | 1719 |
| 339 | Ga0209233_1052103 | 3300025261 | Bacteria | 827 |
| 340 | Ga0209565_1000021 | 3300025263 | Bacteria | 406281 |
| 341 | Ga0209673_1000005 | 3300025273 | Bacteria | 692788 |
| 342 | Ga0209673_1000067 | 3300025273 | Bacteria | 249077 |
| 343 | Ga0209673_1000294 | 3300025273 | Bacteria | 93050 |
| 344 | Ga0209673_1000968 | 3300025273 | Bacteria | 35620 |
| 345 | Ga0209673_1006587 | 3300025273 | Bacteria | 5563 |
| 346 | Ga0209673_1008320 | 3300025273 | Bacteria | 4628 |
| 347 | Ga0209673_1039849 | 3300025273 | Bacteria | 1351 |
| 348 | Ga0209130_1000001 | 3300025284 | Bacteria | 831557 |
| 349 | Ga0209130_1000235 | 3300025284 | Bacteria | 71379 |
| 350 | Ga0209675_1000149 | 3300025291 | Bacteria | 93109 |
| 351 | Ga0209676_1000014 | 3300025292 | Bacteria | 793514 |
| 352 | Ga0209676_1004568 | 3300025292 | Bacteria | 7660 |
| 353 | Ga0209676_1014385 | 3300025292 | Bacteria | 2978 |
| 354 | Ga0209676_1022321 | 3300025292 | Bacteria | 2101 |
| 355 | Ga0209025_1000260 | 3300025294 | Bacteria | 124240 |
| 356 | Ga0209025_1000522 | 3300025294 | Bacteria | 73140 |
| 357 | Ga0209025_1001148 | 3300025294 | Bacteria | 37707 |
| 358 | Ga0209025_1001542 | 3300025294 | Bacteria | 29365 |
| 359 | Ga0209025_1002894 | 3300025294 | Bacteria | 17153 |
| 360 | Ga0209025_1011728 | 3300025294 | Bacteria | 5723 |
| 361 | Ga0209025_1015802 | 3300025294 | Bacteria | 4515 |
| 362 | Ga0209025_1047398 | 3300025294 | Bacteria | 1755 |
| 363 | Ga0209025_1062800 | 3300025294 | Bacteria | 1375 |
| 364 | Ga0209025_1062878 | 3300025294 | Bacteria | 1374 |
| 365 | Ga0209025_1085713 | 3300025294 | Bacteria | 1050 |
| 366 | Ga0209564_1000019 | 3300025295 | Bacteria | 573686 |
| 367 | Ga0209564_1000092 | 3300025295 | Bacteria | 249018 |
| 368 | Ga0209564_1000336 | 3300025295 | Bacteria | 90930 |
| 369 | Ga0209564_1000455 | 3300025295 | Bacteria | 69085 |
| 370 | Ga0209564_1001045 | 3300025295 | Bacteria | 33865 |
| 371 | Ga0209564_1002205 | 3300025295 | Bacteria | 16256 |
| 372 | Ga0209564_1019591 | 3300025295 | Bacteria | 2520 |
| 373 | Ga0209564_1023165 | 3300025295 | Bacteria | 2166 |
| 374 | Ga0209564_1024220 | 3300025295 | Bacteria | 2079 |
| 375 | Ga0209564_1025025 | 3300025295 | Bacteria | 2022 |
| 376 | Ga0209564_1082394 | 3300025295 | Bacteria | 623 |
| 377 | Ga0209758_1000026 | 3300025297 | Bacteria | 582706 |
| 378 | Ga0209758_1000113 | 3300025297 | Bacteria | 202528 |
| 379 | Ga0209758_1000203 | 3300025297 | Bacteria | 132184 |
| 380 | Ga0209758_1001957 | 3300025297 | Bacteria | 22263 |
| 381 | Ga0209758_1005269 | 3300025297 | Bacteria | 10114 |
| 382 | Ga0209758_1016444 | 3300025297 | Bacteria | 3757 |
| 383 | Ga0209758_1021268 | 3300025297 | Bacteria | 3030 |
| 384 | Ga0209758_1024965 | 3300025297 | Bacteria | 2642 |
| 385 | Ga0209758_1025005 | 3300025297 | Bacteria | 2637 |
| 386 | Ga0209758_1027504 | 3300025297 | Bacteria | 2428 |
| 387 | Ga0209758_1032051 | 3300025297 | Bacteria | 2143 |
| 388 | Ga0209758_1050289 | 3300025297 | Bacteria | 1463 |
| 389 | Ga0209758_1090053 | 3300025297 | Bacteria | 901 |
| 390 | Ga0209050_1006608 | 3300025298 | Bacteria | 6808 |
| 391 | Ga0209050_1006975 | 3300025298 | Bacteria | 6507 |
| 392 | Ga0209050_1007063 | 3300025298 | Bacteria | 6438 |
| 393 | Ga0209256_1000170 | 3300025299 | Bacteria | 130504 |
| 394 | Ga0209256_1000182 | 3300025299 | Bacteria | 122471 |
| 395 | Ga0209256_1000475 | 3300025299 | Bacteria | 60194 |
| 396 | Ga0209256_1000625 | 3300025299 | Bacteria | 48667 |
| 397 | Ga0209256_1001533 | 3300025299 | Bacteria | 23225 |
| 398 | Ga0209256_1002121 | 3300025299 | Bacteria | 17205 |
| 399 | Ga0209256_1011067 | 3300025299 | Bacteria | 3666 |
| 400 | Ga0209256_1028898 | 3300025299 | Bacteria | 1555 |
| 401 | Ga0209256_1037619 | 3300025299 | Bacteria | 1259 |
| 402 | Ga0207426_1000045 | 3300025302 | Bacteria | 422847 |
| 403 | Ga0207426_1000213 | 3300025302 | Bacteria | 137311 |
| 404 | Ga0207426_1000282 | 3300025302 | Bacteria | 104108 |
| 405 | Ga0207426_1007399 | 3300025302 | Bacteria | 4603 |
| 406 | Ga0207426_1014504 | 3300025302 | Bacteria | 2885 |
| 407 | Ga0207426_1014578 | 3300025302 | Bacteria | 2875 |
| 408 | Ga0209051_1000027 | 3300025303 | Bacteria | 412172 |
| 409 | Ga0209051_1002417 | 3300025303 | Bacteria | 13419 |
| 410 | Ga0209051_1004473 | 3300025303 | Bacteria | 8601 |
| 411 | Ga0209051_1046772 | 3300025303 | Bacteria | 1485 |
| 412 | Ga0209051_1048392 | 3300025303 | Bacteria | 1442 |
| 413 | Ga0209051_1090810 | 3300025303 | Bacteria | 850 |
| 414 | Ga0209257_1000691 | 3300025304 | Bacteria | 52348 |
| 415 | Ga0209257_1001012 | 3300025304 | Bacteria | 38006 |
| 416 | Ga0209257_1004723 | 3300025304 | Bacteria | 10200 |
| 417 | Ga0209257_1013830 | 3300025304 | Bacteria | 3537 |
| 418 | Ga0209257_1097072 | 3300025304 | Bacteria | 725 |
| 419 | Ga0207697_10142880 | 3300025315 | Bacteria | 1039 |
| 420 | Ga0207656_10108821 | 3300025321 | Bacteria | 1278 |
| 421 | Ga0207710_10055505 | 3300025900 | Bacteria | 1786 |
| 422 | Ga0207710_10072061 | 3300025900 | Bacteria | 1586 |
| 423 | Ga0207688_10029829 | 3300025901 | Bacteria | 3006 |
| 424 | Ga0207688_10109504 | 3300025901 | Bacteria | 1602 |
| 425 | Ga0207688_10177792 | 3300025901 | Bacteria | 1268 |
| 426 | Ga0207688_10309236 | 3300025901 | Bacteria | 967 |
| 427 | Ga0207680_10277081 | 3300025903 | Bacteria | 1164 |
| 428 | Ga0207647_10013465 | 3300025904 | Bacteria | 5667 |
| 429 | Ga0207645_10126071 | 3300025907 | Bacteria | 1664 |
| 430 | Ga0207705_10057184 | 3300025909 | Bacteria | 2813 |
| 431 | Ga0207654_10062106 | 3300025911 | Bacteria | 2188 |
| 432 | Ga0207654_10065549 | 3300025911 | Bacteria | 2139 |
| 433 | Ga0207654_10069120 | 3300025911 | Bacteria | 2092 |
| 434 | Ga0207654_10292045 | 3300025911 | Bacteria | 1106 |
| 435 | Ga0207707_10046761 | 3300025912 | Bacteria | 3770 |
| 436 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 437 | Ga0207671_10014700 | 3300025914 | Bacteria | 6173 |
| 438 | Ga0207671_10327052 | 3300025914 | Bacteria | 1214 |
| 439 | Ga0207663_10593912 | 3300025916 | Bacteria | 869 |
| 440 | Ga0207660_10036633 | 3300025917 | Bacteria | 3411 |
| 441 | Ga0207657_10098320 | 3300025919 | Bacteria | 2432 |
| 442 | Ga0207657_10113701 | 3300025919 | Bacteria | 2233 |
| 443 | Ga0207657_10379728 | 3300025919 | Bacteria | 1113 |
| 444 | Ga0207657_10430543 | 3300025919 | Bacteria | 1036 |
| 445 | Ga0207649_10141205 | 3300025920 | Bacteria | 1648 |
| 446 | Ga0207649_10249054 | 3300025920 | Bacteria | 1279 |
| 447 | Ga0207649_10842690 | 3300025920 | Bacteria | 717 |
| 448 | Ga0207652_10023360 | 3300025921 | Bacteria | 5122 |
| 449 | Ga0207681_10068436 | 3300025923 | Bacteria | 2466 |
| 450 | Ga0207681_10498612 | 3300025923 | Bacteria | 996 |
| 451 | Ga0207681_10554154 | 3300025923 | Bacteria | 946 |
| 452 | Ga0207694_10164256 | 3300025924 | Bacteria | 1795 |
| 453 | Ga0207694_10165446 | 3300025924 | Bacteria | 1788 |
| 454 | Ga0207650_10463716 | 3300025925 | Bacteria | 1055 |
| 455 | Ga0207644_10192733 | 3300025931 | Bacteria | 1603 |
| 456 | Ga0207644_10628225 | 3300025931 | Bacteria | 893 |
| 457 | Ga0207706_10024422 | 3300025933 | Bacteria | 5419 |
| 458 | Ga0207706_10057307 | 3300025933 | Bacteria | 3432 |
| 459 | Ga0207686_10082920 | 3300025934 | Bacteria | 2097 |
| 460 | Ga0207709_10068948 | 3300025935 | Bacteria | 2237 |
| 461 | Ga0207670_10347911 | 3300025936 | Bacteria | 1173 |
| 462 | Ga0207669_10033791 | 3300025937 | Bacteria | 2890 |
| 463 | Ga0207669_10485848 | 3300025937 | Bacteria | 985 |
| 464 | Ga0207704_10027972 | 3300025938 | Bacteria | 3121 |
| 465 | Ga0207704_10514269 | 3300025938 | Bacteria | 967 |
| 466 | Ga0207665_10256041 | 3300025939 | Bacteria | 1295 |
| 467 | Ga0207711_10393349 | 3300025941 | Bacteria | 1287 |
| 468 | Ga0207711_10423180 | 3300025941 | Bacteria | 1239 |
| 469 | Ga0207679_10572631 | 3300025945 | Bacteria | 1015 |
| 470 | Ga0207667_10164362 | 3300025949 | Bacteria | 2282 |
| 471 | Ga0207651_10046470 | 3300025960 | Bacteria | 2920 |
| 472 | Ga0207651_10528808 | 3300025960 | Bacteria | 1023 |
| 473 | Ga0207712_10002059 | 3300025961 | Bacteria | 13199 |
| 474 | Ga0207712_10119224 | 3300025961 | Bacteria | 1993 |
| 475 | Ga0207668_10158531 | 3300025972 | Bacteria | 1760 |
| 476 | Ga0207668_10246103 | 3300025972 | Bacteria | 1449 |
| 477 | Ga0207668_10576598 | 3300025972 | Bacteria | 978 |
| 478 | Ga0207668_10862784 | 3300025972 | Bacteria | 804 |
| 479 | Ga0207640_10413084 | 3300025981 | Bacteria | 1102 |
| 480 | Ga0207658_10398316 | 3300025986 | Bacteria | 1209 |
| 481 | Ga0207658_10828175 | 3300025986 | Bacteria | 841 |
| 482 | Ga0207677_10077226 | 3300026023 | Bacteria | 2374 |
| 483 | Ga0207677_10263275 | 3300026023 | Bacteria | 1406 |
| 484 | Ga0207703_10142070 | 3300026035 | Bacteria | 2084 |
| 485 | Ga0207703_10557029 | 3300026035 | Bacteria | 1081 |
| 486 | Ga0207703_10902943 | 3300026035 | Bacteria | 846 |
| 487 | Ga0207678_10035692 | 3300026067 | Bacteria | 4329 |
| 488 | Ga0207678_10079006 | 3300026067 | Bacteria | 2818 |
| 489 | Ga0207678_10131896 | 3300026067 | Bacteria | 2132 |
| 490 | Ga0207678_10200935 | 3300026067 | Bacteria | 1704 |
| 491 | Ga0207678_10604252 | 3300026067 | Bacteria | 962 |
| 492 | Ga0207708_10042979 | 3300026075 | Bacteria | 3444 |
| 493 | Ga0207702_10022544 | 3300026078 | Bacteria | 5221 |
| 494 | Ga0207702_10694754 | 3300026078 | Bacteria | 1002 |
| 495 | Ga0207641_10274170 | 3300026088 | Bacteria | 1584 |
| 496 | Ga0207641_10874901 | 3300026088 | Bacteria | 891 |
| 497 | Ga0207648_10089924 | 3300026089 | Bacteria | 2683 |
| 498 | Ga0207676_10082940 | 3300026095 | Bacteria | 2609 |
| 499 | Ga0207676_10876357 | 3300026095 | Bacteria | 879 |
| 500 | Ga0207674_10031489 | 3300026116 | Bacteria | 5572 |
| 501 | Ga0207674_10046886 | 3300026116 | Bacteria | 4434 |
| 502 | Ga0207675_100196543 | 3300026118 | Bacteria | 1936 |
| 503 | Ga0207675_100222835 | 3300026118 | Bacteria | 1817 |
| 504 | Ga0207675_100336881 | 3300026118 | Bacteria | 1476 |
| 505 | Ga0207683_10032928 | 3300026121 | Bacteria | 4503 |
| 506 | Ga0207683_10106287 | 3300026121 | Bacteria | 2510 |
| 507 | Ga0209281_1000129 | 3300027111 | Bacteria | 194490 |
| 508 | Ga0209281_1000655 | 3300027111 | Bacteria | 37203 |
| 509 | Ga0209281_1000805 | 3300027111 | Bacteria | 28809 |
| 510 | Ga0209389_1000140 | 3300027296 | Bacteria | 63110 |
| 511 | Ga0209371_1000012 | 3300027312 | Bacteria | 748304 |
| 512 | Ga0209371_1000472 | 3300027312 | Bacteria | 39594 |
| 513 | Ga0209371_1001239 | 3300027312 | Bacteria | 18271 |
| 514 | Ga0209489_100775 | 3300027361 | Bacteria | 63110 |
| 515 | Ga0209700_100798 | 3300027363 | Bacteria | 63028 |
| 516 | Ga0209282_1000038 | 3300027666 | Bacteria | 128955 |
| 517 | Ga0209282_1000323 | 3300027666 | Bacteria | 23657 |
| 518 | Ga0209282_1051722 | 3300027666 | Bacteria | 2351 |
| 519 | Ga0209813_10022390 | 3300027866 | Bacteria | 1787 |
| 520 | Ga0209813_10035770 | 3300027866 | Bacteria | 1488 |
| 521 | Ga0209813_10124828 | 3300027866 | Bacteria | 899 |
| 522 | Ga0268266_10001288 | 3300028379 | Bacteria | 30547 |
| 523 | Ga0268266_10029665 | 3300028379 | Bacteria | 4648 |
| 524 | Ga0268266_10089824 | 3300028379 | Bacteria | 2691 |
| 525 | Ga0268266_10171474 | 3300028379 | Bacteria | 1969 |
| 526 | Ga0268266_10217032 | 3300028379 | Bacteria | 1756 |
| 527 | Ga0268266_10330020 | 3300028379 | Bacteria | 1429 |
| 528 | Ga0268266_10598029 | 3300028379 | Bacteria | 1059 |
| 529 | Ga0268266_10858996 | 3300028379 | Bacteria | 877 |
| 530 | Ga0268265_10805015 | 3300028380 | Bacteria | 916 |
| 531 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 532 | Ga0268264_10088538 | 3300028381 | Bacteria | 2665 |
| 533 | Ga0307517_10000392 | 3300028786 | Bacteria | 74887 |
| 534 | Ga0307517_10053505 | 3300028786 | Bacteria | 4018 |
| 535 | Ga0307517_10352816 | 3300028786 | Bacteria | 798 |
| 536 | Ga0307515_10010751 | 3300028794 | Bacteria | 17470 |
| 537 | Ga0307515_10099536 | 3300028794 | Bacteria | 3529 |
| 538 | Ga0307515_10397974 | 3300028794 | Bacteria | 1004 |
| 539 | Ga0268256_1000013 | 3300030500 | Bacteria | 752103 |
| 540 | Ga0268256_1004420 | 3300030500 | Bacteria | 5836 |
| 541 | Ga0307511_10077584 | 3300030521 | Bacteria | 2364 |
| 542 | Ga0307513_10001322 | 3300031456 | Bacteria | 35853 |
| 543 | Ga0307513_10137393 | 3300031456 | Bacteria | 2377 |
| 544 | Ga0307513_10256567 | 3300031456 | Bacteria | 1541 |
| 545 | Ga0307513_10407625 | 3300031456 | Bacteria | 1092 |
| 546 | Ga0307509_10005540 | 3300031507 | Bacteria | 17516 |
| 547 | Ga0307509_10012410 | 3300031507 | Bacteria | 10191 |
| 548 | Ga0307509_10119947 | 3300031507 | Bacteria | 2610 |
| 549 | Ga0307509_10399802 | 3300031507 | Bacteria | 1081 |
| 550 | Ga0307509_10476074 | 3300031507 | Bacteria | 938 |
| 551 | Ga0307408_100237788 | 3300031548 | Bacteria | 1495 |
| 552 | Ga0307408_100450104 | 3300031548 | Bacteria | 1117 |
| 553 | Ga0307508_10000051 | 3300031616 | Bacteria | 134500 |
| 554 | Ga0307508_10052399 | 3300031616 | Bacteria | 3624 |
| 555 | Ga0307508_10060988 | 3300031616 | Bacteria | 3333 |
| 556 | Ga0307508_10067924 | 3300031616 | Bacteria | 3134 |
| 557 | Ga0307508_10097443 | 3300031616 | Bacteria | 2533 |
| 558 | Ga0307516_10001211 | 3300031730 | Bacteria | 35950 |
| 559 | Ga0307516_10003513 | 3300031730 | Bacteria | 20060 |
| 560 | Ga0307516_10037984 | 3300031730 | Bacteria | 4809 |
| 561 | Ga0307516_10275574 | 3300031730 | Bacteria | 1366 |
| 562 | Ga0307516_10306367 | 3300031730 | Bacteria | 1263 |
| 563 | Ga0307413_10183716 | 3300031824 | Bacteria | 1494 |
| 564 | Ga0307410_10161173 | 3300031852 | Bacteria | 1681 |
| 565 | Ga0307406_10378326 | 3300031901 | Bacteria | 1115 |
| 566 | Ga0307406_10418996 | 3300031901 | Bacteria | 1066 |
| 567 | Ga0307407_10166996 | 3300031903 | Bacteria | 1446 |
| 568 | Ga0307412_10000922 | 3300031911 | Bacteria | 16792 |
| 569 | Ga0315914_1002543 | 3300031967 | Bacteria | 27893 |
| 570 | Ga0307409_100052103 | 3300031995 | Bacteria | 3136 |
| 571 | Ga0307409_100199817 | 3300031995 | Bacteria | 1787 |
| 572 | Ga0307409_100632366 | 3300031995 | Bacteria | 1062 |
| 573 | Ga0307414_10994044 | 3300032004 | Bacteria | 772 |
| 574 | Ga0307411_10402263 | 3300032005 | Bacteria | 1132 |
| 575 | Ga0307411_10408919 | 3300032005 | Bacteria | 1124 |
| 576 | Ga0307411_10738894 | 3300032005 | Bacteria | 861 |
| 577 | Ga0307415_100240560 | 3300032126 | Bacteria | 1464 |
| 578 | Ga0307415_100720003 | 3300032126 | Bacteria | 903 |
| 579 | Ga0307510_10008010 | 3300033180 | Bacteria | 12572 |
| 580 | Ga0307510_10009232 | 3300033180 | Bacteria | 11752 |
| 581 | Ga0307510_10091891 | 3300033180 | Bacteria | 2874 |
| 582 | Ga0315913_1001156 | 3300033430 | Bacteria | 27893 |
| 583 | Ga0315915_1000018 | 3300033464 | Bacteria | 129799 |
| 584 | Ga0373926_0031892 | 3300035083 | Bacteria | 1859 |
| 585 | Ga0373923_0038193 | 3300035111 | Bacteria | 1967 |
| 586 | Ga0373939_0038944 | 3300035114 | Bacteria | 1421 |
| 587 | Ga0373931_0012955 | 3300035691 | Bacteria | 4050 |
| 588 | Ga0373935_0015285 | 3300035692 | Bacteria | 4637 |
| 589 | Ga0373933_0316103 | 3300035724 | Bacteria | 1012 |
| 590 | Ga0373925_0334138 | 3300037068 | Bacteria | 1228 |
| 591 | Ga0237819_07783 | 3300038705 | Bacteria | 1516 |
| 592 | Ga0439439_0082230 | 3300041406 | Bacteria | 872 |
| 593 | Ga0439465_0012279 | 3300041413 | Bacteria | 2680 |
| 594 | Ga0439465_0014651 | 3300041413 | Bacteria | 2444 |
| 595 | Ga0439465_0017784 | 3300041413 | Bacteria | 2221 |
| 596 | Ga0451789_1320373 | 3300041443 | Bacteria | 979 |
| 597 | Ga0451793_0833877 | 3300041452 | Bacteria | 1235 |
| 598 | Ga0451835_0294912 | 3300041492 | Bacteria | 2336 |
| 599 | Ga0451835_0715463 | 3300041492 | Bacteria | 692 |
| 600 | Ga0451837_0008034 | 3300041494 | Bacteria | 658 |
| 601 | Ga0451839_0155811 | 3300041496 | Bacteria | 972 |
| 602 | Ga0451839_0966459 | 3300041496 | Bacteria | 885 |
| 603 | Ga0451841_1205379 | 3300041498 | Bacteria | 1973 |
| 604 | Ga0451847_0701608 | 3300041503 | Bacteria | 928 |
| 605 | Ga0451849_0541387 | 3300041505 | Bacteria | 1429 |
| 606 | Ga0451849_0570312 | 3300041505 | Bacteria | 838 |
| 607 | Ga0451849_0658622 | 3300041505 | Bacteria | 860 |
| 608 | Ga0451849_0739266 | 3300041505 | Bacteria | 699 |
| 609 | Ga0451851_0833168 | 3300041507 | Bacteria | 1916 |
| 610 | Ga0451853_0671269 | 3300041512 | Bacteria | 900 |
| 611 | Ga0451853_2803001 | 3300041512 | Bacteria | 644 |
| 612 | Ga0439445_0167846 | 3300042004 | Bacteria | 642 |
| 613 | Ga0439432_014871 | 3300042006 | Bacteria | 2631 |
| 614 | Ga0439432_027227 | 3300042006 | Bacteria | 1868 |
| 615 | Ga0439449_0007729 | 3300042007 | Bacteria | 4084 |
| 616 | Ga0439449_0026273 | 3300042007 | Bacteria | 2173 |
| 617 | Ga0439462_0022361 | 3300042015 | Bacteria | 1654 |
| 618 | Ga0439462_0064861 | 3300042015 | Bacteria | 989 |
| 619 | Ga0450920_053273 | 3300042122 | Bacteria | 813 |
| 620 | Ga0439434_0020910 | 3300042435 | Bacteria | 1966 |
| 621 | Ga0439459_0009683 | 3300042438 | Bacteria | 1669 |
| 622 | Ga0450918_002564 | 3300042531 | Bacteria | 3433 |
| 623 | Ga0466969_0086893 | 3300044656 | Bacteria | 1485 |
| 624 | Ga0466972_0033010 | 3300044658 | Bacteria | 2539 |
| 625 | Ga0466972_0087033 | 3300044658 | Bacteria | 1484 |
| 626 | Ga0466965_0137957 | 3300044683 | Bacteria | 1268 |
| 627 | Ga0466966_0000610 | 3300044684 | Bacteria | 22674 |
| 628 | Ga0466961_0000124 | 3300044693 | Bacteria | 51384 |
| 629 | Ga0466964_0267288 | 3300044706 | Bacteria | 850 |
| 630 | Ga0466968_0051502 | 3300044735 | Bacteria | 1759 |
| 631 | Ga0466959_0061235 | 3300045049 | Bacteria | 2737 |
| 632 | Ga0495617_009312 | 3300046452 | Bacteria | 3371 |
| 633 | Ga0495617_092591 | 3300046452 | Bacteria | 985 |
| 634 | Ga0495592_0414968 | 3300046454 | Bacteria | 850 |
| 635 | Ga0495603_0007138 | 3300046455 | Bacteria | 6706 |
| 636 | Ga0495603_0024002 | 3300046455 | Bacteria | 3689 |
| 637 | Ga0495590_0130245 | 3300046457 | Bacteria | 904 |
| 638 | Ga0495629_0026056 | 3300046459 | Bacteria | 4155 |
| 639 | Ga0495638_0000475 | 3300046460 | Bacteria | 48300 |
| 640 | Ga0495638_0005749 | 3300046460 | Bacteria | 9130 |
| 641 | Ga0495638_0052465 | 3300046460 | Bacteria | 2540 |
| 642 | Ga0495638_0160086 | 3300046460 | Bacteria | 1299 |
| 643 | Ga0495651_0032791 | 3300046462 | Bacteria | 4051 |
| 644 | Ga0495651_0124663 | 3300046462 | Bacteria | 1887 |
| 645 | Ga0495653_0205731 | 3300046463 | Bacteria | 1333 |
| 646 | Ga0495650_0095026 | 3300046471 | Bacteria | 1127 |
| 647 | Ga0495650_0164761 | 3300046471 | Bacteria | 788 |
| 648 | Ga0495605_0003451 | 3300046474 | Bacteria | 9403 |
| 649 | Ga0495605_0099694 | 3300046474 | Bacteria | 1337 |
| 650 | Ga0495664_0080043 | 3300046477 | Bacteria | 1958 |
| 651 | Ga0495585_0043282 | 3300046492 | Bacteria | 2519 |
| 652 | Ga0495585_0047449 | 3300046492 | Bacteria | 2392 |
| 653 | Ga0495594_0113865 | 3300046499 | Bacteria | 1526 |
| 654 | Ga0495607_0000697 | 3300046501 | Bacteria | 32441 |
| 655 | Ga0495607_0014846 | 3300046501 | Bacteria | 5062 |
| 656 | Ga0495583_0030954 | 3300046506 | Bacteria | 2600 |
| 657 | Ga0495583_0070141 | 3300046506 | Bacteria | 1542 |
| 658 | Ga0495606_0093908 | 3300046507 | Bacteria | 1839 |
| 659 | Ga0495606_0193121 | 3300046507 | Bacteria | 1166 |
| 660 | Ga0495606_0308698 | 3300046507 | Bacteria | 854 |
| 661 | Ga0495608_0246503 | 3300046511 | Bacteria | 1115 |
| 662 | Ga0495610_0035010 | 3300046512 | Bacteria | 2582 |
| 663 | Ga0495610_0036676 | 3300046512 | Bacteria | 2503 |
| 664 | Ga0495616_0009361 | 3300046513 | Bacteria | 5741 |
| 665 | Ga0495616_0113891 | 3300046513 | Bacteria | 1254 |
| 666 | Ga0495620_0011838 | 3300046515 | Bacteria | 4535 |
| 667 | Ga0495620_0102183 | 3300046515 | Bacteria | 1142 |
| 668 | Ga0495628_0458413 | 3300046516 | Bacteria | 925 |
| 669 | Ga0495628_0750170 | 3300046516 | Bacteria | 686 |
| 670 | Ga0495630_0081544 | 3300046517 | Bacteria | 2441 |
| 671 | Ga0495631_0012439 | 3300046518 | Bacteria | 4154 |
| 672 | Ga0495631_0082092 | 3300046518 | Bacteria | 1390 |
| 673 | Ga0495631_0143918 | 3300046518 | Bacteria | 1023 |
| 674 | Ga0495632_0021912 | 3300046519 | Bacteria | 3434 |
| 675 | Ga0495632_0042216 | 3300046519 | Bacteria | 2287 |
| 676 | Ga0495632_0068598 | 3300046519 | Bacteria | 1708 |
| 677 | Ga0495632_0219567 | 3300046519 | Bacteria | 860 |
| 678 | Ga0495632_0321702 | 3300046519 | Bacteria | 683 |
| 679 | Ga0495643_0026331 | 3300046522 | Bacteria | 3283 |
| 680 | Ga0495643_0071034 | 3300046522 | Bacteria | 1828 |
| 681 | Ga0495643_0104346 | 3300046522 | Bacteria | 1449 |
| 682 | Ga0495643_0112480 | 3300046522 | Bacteria | 1383 |
| 683 | Ga0495643_0193244 | 3300046522 | Bacteria | 981 |
| 684 | Ga0495644_0068026 | 3300046523 | Bacteria | 1338 |
| 685 | Ga0495648_0028240 | 3300046524 | Bacteria | 3741 |
| 686 | Ga0495648_0041644 | 3300046524 | Bacteria | 2898 |
| 687 | Ga0495648_0043160 | 3300046524 | Bacteria | 2830 |
| 688 | Ga0495648_0093652 | 3300046524 | Bacteria | 1675 |
| 689 | Ga0495663_0040163 | 3300046525 | Bacteria | 1420 |
| 690 | Ga0495666_0039895 | 3300046526 | Bacteria | 2279 |
| 691 | Ga0495666_0216057 | 3300046526 | Bacteria | 879 |
| 692 | Ga0495654_0000122 | 3300046530 | Bacteria | 86717 |
| 693 | Ga0495654_0089343 | 3300046530 | Bacteria | 1432 |
| 694 | Ga0495640_0007377 | 3300046533 | Bacteria | 8655 |
| 695 | Ga0495598_0022520 | 3300046537 | Bacteria | 1687 |
| 696 | Ga0495609_0029333 | 3300046538 | Bacteria | 2505 |
| 697 | Ga0495609_0138545 | 3300046538 | Bacteria | 1039 |
| 698 | Ga0495609_0180022 | 3300046538 | Bacteria | 890 |
| 699 | Ga0495597_0005508 | 3300046542 | Bacteria | 6697 |
| 700 | Ga0495597_0061568 | 3300046542 | Bacteria | 1634 |
| 701 | Ga0495597_0081875 | 3300046542 | Bacteria | 1380 |
| 702 | Ga0495597_0176732 | 3300046542 | Bacteria | 864 |
| 703 | Ga0495633_0016222 | 3300046558 | Bacteria | 3848 |
| 704 | Ga0495633_0134140 | 3300046558 | Bacteria | 1145 |
| 705 | Ga0495633_0142925 | 3300046558 | Bacteria | 1106 |
| 706 | Ga0495633_0177625 | 3300046558 | Bacteria | 980 |
| 707 | Ga0495656_0116356 | 3300046615 | Bacteria | 1257 |
| 708 | Ga0495668_0006686 | 3300046616 | Bacteria | 7508 |
| 709 | Ga0495668_0019058 | 3300046616 | Bacteria | 3960 |
| 710 | Ga0495668_0238381 | 3300046616 | Bacteria | 996 |
| 711 | Ga0495611_0089472 | 3300046648 | Bacteria | 1422 |
| 712 | Ga0495611_0130673 | 3300046648 | Bacteria | 1171 |
| 713 | Ga0495611_0211511 | 3300046648 | Bacteria | 903 |
| 714 | Ga0495625_0011467 | 3300046660 | Bacteria | 7226 |
| 715 | Ga0495625_0085040 | 3300046660 | Bacteria | 2196 |
| 716 | Ga0495625_0134998 | 3300046660 | Bacteria | 1668 |
| 717 | Ga0495625_0157846 | 3300046660 | Bacteria | 1521 |
| 718 | Ga0495625_0567067 | 3300046660 | Bacteria | 686 |
| 719 | Ga0495635_0004183 | 3300046663 | Bacteria | 10013 |
| 720 | Ga0495659_0102406 | 3300046664 | Bacteria | 1110 |
| 721 | Ga0495661_0062750 | 3300046665 | Bacteria | 2200 |
| 722 | Ga0495661_0118040 | 3300046665 | Bacteria | 1469 |
| 723 | Ga0495588_0009969 | 3300046674 | Bacteria | 4404 |
| 724 | Ga0495588_0135215 | 3300046674 | Bacteria | 1301 |
| 725 | Ga0495623_0229800 | 3300046679 | Bacteria | 1053 |
| 726 | Ga0495658_0320330 | 3300046683 | Bacteria | 983 |
| 727 | Ga0495669_0082174 | 3300046684 | Bacteria | 1480 |
| 728 | Ga0495613_0139892 | 3300046689 | Bacteria | 1730 |
| 729 | Ga0495624_0016398 | 3300046690 | Bacteria | 4986 |
| 730 | Ga0495624_0220545 | 3300046690 | Bacteria | 1150 |
| 731 | Ga0495624_0273426 | 3300046690 | Bacteria | 1020 |
| 732 | Ga0495670_0070486 | 3300046691 | Bacteria | 1769 |
| 733 | Ga0495671_0053020 | 3300046692 | Bacteria | 2014 |
| 734 | Ga0495671_0069331 | 3300046692 | Bacteria | 1733 |
| 735 | Ga0495649_0201636 | 3300046694 | Bacteria | 1033 |
| 736 | Ga0495600_0005392 | 3300046809 | Bacteria | 7711 |
| 737 | Ga0495600_0621838 | 3300046809 | Bacteria | 655 |
| 738 | Ga0495660_0022531 | 3300046810 | Bacteria | 3595 |
| 739 | Ga0495581_0282479 | 3300047315 | Bacteria | 970 |
| 740 | Ga0495604_0017983 | 3300047317 | Bacteria | 5656 |
| 741 | Ga0495604_0633633 | 3300047317 | Bacteria | 683 |
| 742 | Ga0495636_0050396 | 3300047318 | Bacteria | 1743 |
| 743 | Ga0495636_0112417 | 3300047318 | Bacteria | 1199 |
| 744 | Ga0495636_0135577 | 3300047318 | Bacteria | 1097 |
| 745 | Ga0495674_0607347 | 3300047319 | Bacteria | 866 |
| 746 | Ga0495676_0056474 | 3300047321 | Bacteria | 3104 |
| 747 | Ga0495676_0067566 | 3300047321 | Bacteria | 2765 |
| 748 | Ga0495683_0083541 | 3300047323 | Bacteria | 1555 |
| 749 | Ga0495683_0210562 | 3300047323 | Bacteria | 872 |
| 750 | Ga0495687_000722 | 3300047443 | Bacteria | 36591 |
| 751 | Ga0495687_008590 | 3300047443 | Bacteria | 5827 |
| 752 | Ga0495677_0173425 | 3300047445 | Bacteria | 835 |
| 753 | Ga0495673_0058242 | 3300047469 | Bacteria | 1666 |
| 754 | Ga0495681_0053412 | 3300047470 | Bacteria | 1892 |
| 755 | Ga0495681_0147187 | 3300047470 | Bacteria | 991 |
| 756 | Ga0495681_0238557 | 3300047470 | Bacteria | 723 |
| 757 | Ga0495684_0392864 | 3300047471 | Bacteria | 976 |
| 758 | Ga0495686_0148562 | 3300047472 | Bacteria | 1377 |
| 759 | Ga0495593_0080512 | 3300047673 | Bacteria | 1685 |
| 760 | Ga0495593_0127556 | 3300047673 | Bacteria | 1293 |
| 761 | Ga0495615_0024434 | 3300048090 | Bacteria | 1394 |
| 762 | Ga0495615_0054486 | 3300048090 | Bacteria | 1038 |
| 763 | Ga0495626_0070685 | 3300048091 | Bacteria | 1570 |
| 764 | Ga0495626_0107361 | 3300048091 | Bacteria | 1212 |
| 765 | Ga0495626_0124031 | 3300048091 | Bacteria | 1108 |
| 766 | Ga0496100_0250714 | 3300048903 | Bacteria | 1309 |
| 767 | Ga0496101_0453909 | 3300048904 | Bacteria | 1011 |
| 768 | Ga0496102_0179347 | 3300048905 | Bacteria | 1995 |
| 769 | Ga0496102_0210896 | 3300048905 | Bacteria | 1831 |
| 770 | Ga0496102_0261022 | 3300048905 | Bacteria | 1633 |
| 771 | Ga0496103_0033739 | 3300048906 | Bacteria | 3127 |
| 772 | Ga0496104_0065692 | 3300048907 | Bacteria | 3443 |
| 773 | Ga0496104_0089310 | 3300048907 | Bacteria | 2944 |
| 774 | Ga0496104_0366715 | 3300048907 | Bacteria | 1353 |
| 775 | Ga0496104_0371974 | 3300048907 | Bacteria | 1342 |
| 776 | Ga0496104_0415966 | 3300048907 | Bacteria | 1257 |
| 777 | Ga0496104_0542953 | 3300048907 | Bacteria | 1073 |
| 778 | Ga0496105_0228114 | 3300048908 | Bacteria | 1514 |
| 779 | Ga0496105_0252150 | 3300048908 | Bacteria | 1429 |
| 780 | Ga0496106_0000355 | 3300048909 | Bacteria | 32404 |
| 781 | Ga0496106_0000765 | 3300048909 | Bacteria | 23253 |
| 782 | Ga0496106_0361939 | 3300048909 | Bacteria | 1165 |
| 783 | Ga0496106_1054562 | 3300048909 | Bacteria | 638 |
| 784 | Ga0496107_0193401 | 3300048910 | Bacteria | 1512 |
| 785 | Ga0496107_0205141 | 3300048910 | Bacteria | 1465 |
| 786 | Ga0496107_0467417 | 3300048910 | Bacteria | 936 |
| 787 | Ga0496107_0703893 | 3300048910 | Bacteria | 743 |
| 788 | Ga0496108_0168853 | 3300048911 | Bacteria | 1892 |
| 789 | Ga0496109_0304420 | 3300048912 | Bacteria | 1503 |
| 790 | Ga0496110_0294672 | 3300048913 | Bacteria | 1478 |
| 791 | Ga0496110_0543292 | 3300048913 | Bacteria | 1056 |
| 792 | Ga0496110_1134035 | 3300048913 | Bacteria | 690 |
| 793 | Ga0496111_0000161 | 3300048914 | Bacteria | 30179 |
| 794 | Ga0496111_0301663 | 3300048914 | Bacteria | 1187 |
| 795 | Ga0496112_0038171 | 3300048915 | Bacteria | 4690 |
| 796 | Ga0496112_0081591 | 3300048915 | Bacteria | 3198 |
| 797 | Ga0496112_0242117 | 3300048915 | Bacteria | 1756 |
| 798 | Ga0496113_0079333 | 3300048916 | Bacteria | 2513 |
| 799 | Ga0496114_0074011 | 3300048917 | Bacteria | 2868 |
| 800 | Ga0496114_0347666 | 3300048917 | Bacteria | 1311 |
| 801 | Ga0496114_0352134 | 3300048917 | Bacteria | 1302 |
| 802 | Ga0496114_0438122 | 3300048917 | Bacteria | 1157 |
| 803 | Ga0496114_1011355 | 3300048917 | Bacteria | 715 |
| 804 | Ga0496115_0140404 | 3300048918 | Bacteria | 1993 |
| 805 | Ga0496115_0181795 | 3300048918 | Bacteria | 1738 |
| 806 | Ga0496115_0347057 | 3300048918 | Bacteria | 1211 |
| 807 | Ga0496115_0557753 | 3300048918 | Bacteria | 915 |
| 808 | Ga0496116_0000243 | 3300048919 | Bacteria | 99201 |
| 809 | Ga0496116_0035198 | 3300048919 | Bacteria | 3520 |
| 810 | Ga0496116_0050570 | 3300048919 | Bacteria | 2768 |
| 811 | Ga0496116_0068841 | 3300048919 | Bacteria | 2253 |
| 812 | Ga0496116_0098206 | 3300048919 | Bacteria | 1758 |
| 813 | Ga0496116_0146092 | 3300048919 | Bacteria | 1322 |
| 814 | Ga0496116_0180012 | 3300048919 | Bacteria | 1133 |
| 815 | Ga0496117_0000016 | 3300048920 | Bacteria | 523642 |
| 816 | Ga0496117_0250894 | 3300048920 | Bacteria | 965 |
| 817 | Ga0496117_0312662 | 3300048920 | Bacteria | 827 |
| 818 | Ga0496118_0000618 | 3300048921 | Bacteria | 58468 |
| 819 | Ga0496118_0000758 | 3300048921 | Bacteria | 52123 |
| 820 | Ga0496118_0018278 | 3300048921 | Bacteria | 6330 |
| 821 | Ga0496118_0062355 | 3300048921 | Bacteria | 2753 |
| 822 | Ga0496118_0086264 | 3300048921 | Bacteria | 2182 |
| 823 | Ga0496118_0290398 | 3300048921 | Bacteria | 904 |
| 824 | Ga0496119_0020692 | 3300048922 | Bacteria | 4785 |
| 825 | Ga0496119_0037805 | 3300048922 | Bacteria | 3129 |
| 826 | Ga0496119_0039638 | 3300048922 | Bacteria | 3025 |
| 827 | Ga0496119_0047807 | 3300048922 | Bacteria | 2658 |
| 828 | Ga0496119_0330102 | 3300048922 | Bacteria | 744 |
| 829 | Ga0496120_0000056 | 3300048923 | Bacteria | 180367 |
| 830 | Ga0496120_0168459 | 3300048923 | Bacteria | 1085 |
| 831 | Ga0496121_0000212 | 3300048924 | Bacteria | 127508 |
| 832 | Ga0496121_0000490 | 3300048924 | Bacteria | 75983 |
| 833 | Ga0496121_0005284 | 3300048924 | Bacteria | 16633 |
| 834 | Ga0496121_0010821 | 3300048924 | Bacteria | 10209 |
| 835 | Ga0496121_0012780 | 3300048924 | Bacteria | 9094 |
| 836 | Ga0496121_0025866 | 3300048924 | Bacteria | 5553 |
| 837 | Ga0496121_0035931 | 3300048924 | Bacteria | 4427 |
| 838 | Ga0496121_0043504 | 3300048924 | Bacteria | 3888 |
| 839 | Ga0496121_0070165 | 3300048924 | Bacteria | 2824 |
| 840 | Ga0496121_0101889 | 3300048924 | Bacteria | 2213 |
| 841 | Ga0496121_0156854 | 3300048924 | Bacteria | 1669 |
| 842 | Ga0496121_0216720 | 3300048924 | Bacteria | 1351 |
| 843 | Ga0496121_0297240 | 3300048924 | Bacteria | 1097 |
| 844 | Ga0496121_0383331 | 3300048924 | Bacteria | 926 |
| 845 | Ga0496121_0388202 | 3300048924 | Bacteria | 918 |
| 846 | Ga0496121_0485862 | 3300048924 | Bacteria | 787 |
| 847 | Ga0496122_0000002 | 3300048925 | Bacteria | 905834 |
| 848 | Ga0496122_0000106 | 3300048925 | Bacteria | 193672 |
| 849 | Ga0496122_0000821 | 3300048925 | Bacteria | 59417 |
| 850 | Ga0496122_0014427 | 3300048925 | Bacteria | 7643 |
| 851 | Ga0496122_0017699 | 3300048925 | Bacteria | 6637 |
| 852 | Ga0496122_0076238 | 3300048925 | Bacteria | 2360 |
| 853 | Ga0496122_0082285 | 3300048925 | Bacteria | 2237 |
| 854 | Ga0496122_0220255 | 3300048925 | Bacteria | 1090 |
| 855 | Ga0496122_0232361 | 3300048925 | Bacteria | 1047 |
| 856 | Ga0496123_0000002 | 3300048926 | Bacteria | 1811682 |
| 857 | Ga0496123_0000022 | 3300048926 | Bacteria | 361832 |
| 858 | Ga0496123_0000872 | 3300048926 | Bacteria | 47911 |
| 859 | Ga0496123_0023293 | 3300048926 | Bacteria | 4742 |
| 860 | Ga0496124_0000080 | 3300048927 | Bacteria | 210439 |
| 861 | Ga0496124_0000861 | 3300048927 | Bacteria | 49579 |
| 862 | Ga0496124_0004878 | 3300048927 | Bacteria | 15431 |
| 863 | Ga0496124_0010860 | 3300048927 | Bacteria | 9165 |
| 864 | Ga0496124_0070834 | 3300048927 | Bacteria | 2891 |
| 865 | Ga0496124_0071440 | 3300048927 | Bacteria | 2877 |
| 866 | Ga0496124_0078437 | 3300048927 | Bacteria | 2722 |
| 867 | Ga0496124_0083348 | 3300048927 | Bacteria | 2623 |
| 868 | Ga0496124_0217545 | 3300048927 | Bacteria | 1439 |
| 869 | Ga0496124_0454531 | 3300048927 | Bacteria | 872 |
| 870 | Ga0496125_0000884 | 3300048928 | Bacteria | 47543 |
| 871 | Ga0496125_0012755 | 3300048928 | Bacteria | 8310 |
| 872 | Ga0496125_0017939 | 3300048928 | Bacteria | 6728 |
| 873 | Ga0496125_0093394 | 3300048928 | Bacteria | 2245 |
| 874 | Ga0496125_0152717 | 3300048928 | Bacteria | 1583 |
| 875 | Ga0496125_0186194 | 3300048928 | Bacteria | 1377 |
| 876 | Ga0496125_0247645 | 3300048928 | Bacteria | 1126 |
| 877 | Ga0496126_0000554 | 3300048929 | Bacteria | 71982 |
| 878 | Ga0496126_0031476 | 3300048929 | Bacteria | 5011 |
| 879 | Ga0496126_0035266 | 3300048929 | Bacteria | 4690 |
| 880 | Ga0496126_0040035 | 3300048929 | Bacteria | 4346 |
| 881 | Ga0496126_0047672 | 3300048929 | Bacteria | 3922 |
| 882 | Ga0496126_0338791 | 3300048929 | Bacteria | 1232 |
| 883 | Ga0496126_0661002 | 3300048929 | Bacteria | 816 |
| 884 | Ga0496126_0954233 | 3300048929 | Bacteria | 646 |
| 885 | Ga0495678_093929 | 3300049459 | Bacteria | 1051 |
| 886 | Ga0495678_119790 | 3300049459 | Bacteria | 885 |
| 887 | Ga0495682_0022972 | 3300049460 | Bacteria | 2330 |
| 888 | Ga0495682_0142163 | 3300049460 | Bacteria | 857 |
| 889 | Ga0501032_0175641 | 3300049569 | Bacteria | 1403 |
| 890 | Ga0501033_0234037 | 3300049570 | Bacteria | 1304 |
| 891 | Ga0501040_0149053 | 3300049576 | Bacteria | 1650 |
| 892 | Ga0501043_0493959 | 3300049579 | Bacteria | 915 |
| 893 | Ga0501046_0298107 | 3300049580 | Bacteria | 1178 |
| 894 | Ga0501046_0426917 | 3300049580 | Bacteria | 955 |
| 895 | Ga0501047_0013443 | 3300049581 | Bacteria | 7760 |
| 896 | Ga0501047_0062731 | 3300049581 | Bacteria | 3585 |
| 897 | Ga0501048_0113852 | 3300049582 | Bacteria | 1911 |
| 898 | Ga0501068_0094612 | 3300049584 | Bacteria | 1847 |
| 899 | Ga0501069_0152351 | 3300049585 | Bacteria | 1329 |
| 900 | Ga0501074_0248955 | 3300049590 | Bacteria | 1264 |
| 901 | Ga0501083_0183352 | 3300049744 | Bacteria | 1366 |
| 902 | Ga0501044_0005038 | 3300049823 | Bacteria | 14756 |
| 903 | Ga0501045_0077606 | 3300049824 | Bacteria | 2448 |
| 904 | nmdc:mga03683_133364_c1 | 3300050489 | Bacteria | 1113 |
| 905 | nmdc:mga03n38_116525_c1 | 3300050490 | Bacteria | 1308 |
| 906 | nmdc:mga03n38_191024_c1 | 3300050490 | Bacteria | 1055 |
| 907 | nmdc:mga03n38_262522_c1 | 3300050490 | Bacteria | 916 |
| 908 | nmdc:mga03n38_57184_c1 | 3300050490 | Bacteria | 1763 |
| 909 | nmdc:mga00v17_120638_c1 | 3300050491 | Bacteria | 1669 |
| 910 | nmdc:mga00v17_208578_c1 | 3300050491 | Bacteria | 1264 |
| 911 | nmdc:mga00v17_241926_c1 | 3300050491 | Bacteria | 1170 |
| 912 | nmdc:mga00v17_361451_c1 | 3300050491 | Bacteria | 944 |
| 913 | nmdc:mga00v17_3_c1 | 3300050491 | Bacteria | 242367 |
| 914 | nmdc:mga00v17_610338_c1 | 3300050491 | Bacteria | 703 |
| 915 | nmdc:mga00v17_643630_c1 | 3300050491 | Bacteria | 682 |
| 916 | nmdc:mga00v17_73752_c1 | 3300050491 | Bacteria | 2120 |
| 917 | nmdc:mga0yw44_105055_c1 | 3300050492 | Bacteria | 1804 |
| 918 | nmdc:mga0yw44_128_c2 | 3300050492 | Bacteria | 13634 |
| 919 | nmdc:mga0yw44_14433_c1 | 3300050492 | Bacteria | 4196 |
| 920 | nmdc:mga0yw44_16961_c1 | 3300050492 | Bacteria | 3949 |
| 921 | nmdc:mga0yw44_173880_c1 | 3300050492 | Bacteria | 1415 |
| 922 | nmdc:mga0yw44_174167_c1 | 3300050492 | Bacteria | 1414 |
| 923 | nmdc:mga0yw44_22166_c1 | 3300050492 | Bacteria | 3557 |
| 924 | nmdc:mga0yw44_226943_c1 | 3300050492 | Bacteria | 1239 |
| 925 | nmdc:mga0yw44_279131_c1 | 3300050492 | Bacteria | 1116 |
| 926 | nmdc:mga0yw44_372467_c1 | 3300050492 | Bacteria | 963 |
| 927 | nmdc:mga0yw44_4892_c2 | 3300050492 | Bacteria | 4759 |
| 928 | nmdc:mga0yw44_526297_c1 | 3300050492 | Bacteria | 802 |
| 929 | nmdc:mga0k408_1383_c1 | 3300050493 | Bacteria | 13098 |
| 930 | nmdc:mga0k408_168347_c1 | 3300050493 | Bacteria | 1306 |
| 931 | nmdc:mga0k408_180506_c1 | 3300050493 | Bacteria | 1259 |
| 932 | nmdc:mga0k408_186098_c1 | 3300050493 | Bacteria | 1239 |
| 933 | nmdc:mga0k408_71765_c1 | 3300050493 | Bacteria | 2021 |
| 934 | nmdc:mga0k408_86721_c1 | 3300050493 | Bacteria | 1838 |
| 935 | nmdc:mga06z11_11929_c1 | 3300050494 | Bacteria | 3764 |
| 936 | nmdc:mga06z11_121100_c1 | 3300050494 | Bacteria | 1460 |
| 937 | nmdc:mga06z11_134937_c1 | 3300050494 | Bacteria | 1390 |
| 938 | nmdc:mga06z11_193209_c1 | 3300050494 | Bacteria | 1179 |
| 939 | nmdc:mga06z11_240677_c1 | 3300050494 | Bacteria | 1063 |
| 940 | nmdc:mga06z11_287022_c1 | 3300050494 | Bacteria | 976 |
| 941 | nmdc:mga06z11_293678_c1 | 3300050494 | Bacteria | 965 |
| 942 | nmdc:mga06z11_297023_c1 | 3300050494 | Bacteria | 960 |
| 943 | nmdc:mga06z11_5003_c1 | 3300050494 | Bacteria | 5269 |
| 944 | nmdc:mga06z11_507743_c1 | 3300050494 | Bacteria | 731 |
| 945 | nmdc:mga06z11_7911_c1 | 3300050494 | Bacteria | 4402 |
| 946 | nmdc:mga06z11_80852_c1 | 3300050494 | Bacteria | 1743 |
| 947 | nmdc:mga04h51_24731_c1 | 3300050495 | Bacteria | 1842 |
| 948 | nmdc:mga04h51_32606_c1 | 3300050495 | Bacteria | 1653 |
| 949 | nmdc:mga04h51_70588_c1 | 3300050495 | Bacteria | 1219 |
| 950 | nmdc:mga07m45_139712_c1 | 3300050496 | Bacteria | 1403 |
| 951 | nmdc:mga07m45_3676_c1 | 3300050496 | Bacteria | 7416 |
| 952 | nmdc:mga07m45_51883_c2 | 3300050496 | Bacteria | 1963 |
| 953 | nmdc:mga07m45_52506_c1 | 3300050496 | Bacteria | 2301 |
| 954 | nmdc:mga07m45_5718_c1 | 3300050496 | Bacteria | 6219 |
| 955 | nmdc:mga07m45_73781_c1 | 3300050496 | Bacteria | 1943 |
| 956 | nmdc:mga07m45_8545_c1 | 3300050496 | Bacteria | 5269 |
| 957 | nmdc:mga05p37_190489_c1 | 3300050507 | Bacteria | 2490 |
| 958 | nmdc:mga05p37_521040_c1 | 3300050507 | Bacteria | 1360 |
| 959 | nmdc:mga09592_446558_c1 | 3300050508 | Bacteria | 1116 |
| 960 | nmdc:mga0qj67_464114_c1 | 3300050509 | Bacteria | 1019 |
| 961 | nmdc:mga0qj67_76368_c1 | 3300050509 | Bacteria | 2679 |
| 962 | nmdc:mga08y16_415999_c1 | 3300050511 | Bacteria | 1374 |
| 963 | nmdc:mga08y16_65581_c1 | 3300050511 | Bacteria | 3790 |
| 964 | nmdc:mga0rr50_293273_c1 | 3300050513 | Bacteria | 1359 |
| 965 | nmdc:mga0sz30_12371_c1 | 3300050516 | Bacteria | 3320 |
| 966 | nmdc:mga0sz30_294193_c1 | 3300050516 | Bacteria | 724 |
| 967 | nmdc:mga0sz30_34918_c1 | 3300050516 | Bacteria | 2096 |
| 968 | nmdc:mga0sz30_37069_c1 | 3300050516 | Bacteria | 2040 |
| 969 | nmdc:mga0sz30_4699_c1 | 3300050516 | Bacteria | 4957 |
| 970 | nmdc:mga0sz30_49798_c2 | 3300050516 | Bacteria | 1346 |
| 971 | nmdc:mga0sz30_51562_c1 | 3300050516 | Bacteria | 1746 |
| 972 | nmdc:mga0sz30_65067_c1 | 3300050516 | Bacteria | 1563 |
| 973 | nmdc:mga0sz30_982_c1 | 3300050516 | Bacteria | 10245 |
| 974 | Ga0500610_0072093 | 3300053079 | Bacteria | 1801 |
| 975 | Ga0500610_0156237 | 3300053079 | Bacteria | 1139 |
| 976 | Ga0495655_0062339 | 3300053083 | Bacteria | 1021 |
| 977 | Ga0495619_0104837 | 3300053085 | Bacteria | 1928 |
| 978 | Ga0500578_0150466 | 3300053086 | Bacteria | 1450 |
| 979 | Ga0500643_000055 | 3300053087 | Bacteria | 134904 |
| 980 | Ga0500647_0134699 | 3300053091 | Bacteria | 1163 |
| 981 | Ga0500651_0066988 | 3300053093 | Bacteria | 2236 |
| 982 | Ga0500651_0312622 | 3300053093 | Bacteria | 899 |
| 983 | Ga0500566_0000041 | 3300053094 | Bacteria | 65580 |
| 984 | Ga0500640_197320 | 3300053095 | Bacteria | 707 |
| 985 | Ga0500641_0026061 | 3300053096 | Bacteria | 2267 |
| 986 | Ga0500648_117904 | 3300053097 | Bacteria | 1457 |
| 987 | Ga0500650_0225016 | 3300053098 | Bacteria | 848 |
| 988 | Ga0500654_121663 | 3300053099 | Bacteria | 1024 |
| 989 | Ga0500557_000017 | 3300053105 | Bacteria | 96699 |
| 990 | Ga0500557_037856 | 3300053105 | Bacteria | 1498 |
| 991 | Ga0500560_000033 | 3300053107 | Bacteria | 15664 |
| 992 | Ga0500569_008436 | 3300053109 | Bacteria | 2356 |
| 993 | Ga0500569_014543 | 3300053109 | Bacteria | 1950 |
| 994 | Ga0500572_009460 | 3300053111 | Bacteria | 2304 |
| 995 | Ga0500592_018694 | 3300053116 | Bacteria | 1113 |
| 996 | Ga0500594_0001940 | 3300053118 | Bacteria | 4473 |
| 997 | Ga0500594_0070772 | 3300053118 | Bacteria | 1025 |
| 998 | Ga0500594_0185452 | 3300053118 | Bacteria | 680 |
| 999 | Ga0500595_000891 | 3300053119 | Bacteria | 17010 |
| 1000 | Ga0500595_001184 | 3300053119 | Bacteria | 14382 |
| 1001 | Ga0500595_062568 | 3300053119 | Bacteria | 1120 |
| 1002 | Ga0500608_165189 | 3300053122 | Bacteria | 955 |
| 1003 | Ga0500618_000285 | 3300053125 | Bacteria | 38522 |
| 1004 | Ga0500618_042067 | 3300053125 | Bacteria | 1047 |
| 1005 | Ga0500621_083986 | 3300053126 | Bacteria | 1274 |
| 1006 | Ga0500642_0000171 | 3300053130 | Bacteria | 26884 |
| 1007 | Ga0500642_0085072 | 3300053130 | Bacteria | 1457 |
| 1008 | Ga0500642_0088117 | 3300053130 | Bacteria | 1432 |
| 1009 | Ga0500652_209416 | 3300053131 | Bacteria | 788 |
| 1010 | Ga0500655_036861 | 3300053133 | Bacteria | 953 |
| 1011 | Ga0500658_0020608 | 3300053134 | Bacteria | 2490 |
| 1012 | Ga0500559_0022060 | 3300053136 | Bacteria | 2700 |
| 1013 | Ga0500559_0030989 | 3300053136 | Bacteria | 2294 |
| 1014 | Ga0500559_0319043 | 3300053136 | Bacteria | 728 |
| 1015 | Ga0500561_0000034 | 3300053137 | Bacteria | 28171 |
| 1016 | Ga0500564_166616 | 3300053138 | Bacteria | 929 |
| 1017 | Ga0500568_0000109 | 3300053139 | Bacteria | 76714 |
| 1018 | Ga0500568_0000202 | 3300053139 | Bacteria | 52432 |
| 1019 | Ga0500568_0003149 | 3300053139 | Bacteria | 9399 |
| 1020 | Ga0500568_0083646 | 3300053139 | Bacteria | 1209 |
| 1021 | Ga0500573_0041459 | 3300053140 | Bacteria | 2657 |
| 1022 | Ga0500577_0122383 | 3300053142 | Bacteria | 1084 |
| 1023 | Ga0500577_0321596 | 3300053142 | Bacteria | 676 |
| 1024 | Ga0500588_0071588 | 3300053146 | Bacteria | 1138 |
| 1025 | Ga0500603_013184 | 3300053150 | Bacteria | 1913 |
| 1026 | Ga0500604_0013214 | 3300053151 | Bacteria | 2234 |
| 1027 | Ga0500606_122139 | 3300053152 | Bacteria | 867 |
| 1028 | Ga0500616_0000472 | 3300053153 | Bacteria | 52191 |
| 1029 | Ga0500616_0098621 | 3300053153 | Bacteria | 1432 |
| 1030 | Ga0500619_211016 | 3300053154 | Bacteria | 649 |
| 1031 | Ga0500620_130632 | 3300053155 | Bacteria | 879 |
| 1032 | Ga0500622_0000134 | 3300053156 | Bacteria | 78418 |
| 1033 | Ga0500622_0018187 | 3300053156 | Bacteria | 3737 |
| 1034 | Ga0500622_0029086 | 3300053156 | Bacteria | 2907 |
| 1035 | Ga0500622_0085531 | 3300053156 | Bacteria | 1573 |
| 1036 | Ga0500624_000323 | 3300053157 | Bacteria | 16314 |
| 1037 | Ga0500634_0192563 | 3300053161 | Bacteria | 904 |
| 1038 | Ga0500638_121376 | 3300053162 | Bacteria | 1195 |
| 1039 | Ga0500636_0000107 | 3300053177 | Bacteria | 42896 |
| 1040 | Ga0500636_0141890 | 3300053177 | Bacteria | 1328 |
| 1041 | Ga0500636_0252480 | 3300053177 | Bacteria | 898 |
| 1042 | Ga0500637_0000240 | 3300053178 | Bacteria | 20394 |
| 1043 | Ga0500645_036326 | 3300053730 | Bacteria | 1466 |
| 1044 | Ga0500552_000443 | 3300053733 | Bacteria | 3833 |
| 1045 | Ga0500596_006036 | 3300053735 | Bacteria | 2082 |
| 1046 | Ga0500599_001227 | 3300053736 | Bacteria | 2930 |
| 1047 | Ga0500601_012419 | 3300053737 | Bacteria | 961 |
| 1048 | Ga0587072_023949 | 3300059643 | Bacteria | 1100 |
| 1049 | Ga0501082_0039710 | 3300060353 | Bacteria | 4060 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048927 | Ga0496124_0454531 | Ga0496124_0454531_284_826 | 179 |
| 2 | 3300048922 | Ga0496119_0037805 | Ga0496119_0037805_2085_2729 | 182 |
| 3 | 3300048924 | Ga0496121_0000490 | Ga0496121_0000490_5259_5903 | 182 |
| 4 | 3300048925 | Ga0496122_0082285 | Ga0496122_0082285_649_1293 | 182 |
| 5 | 3300048928 | Ga0496125_0000884 | Ga0496125_0000884_34021_34665 | 182 |
| 6 | 3300048929 | Ga0496126_0035266 | Ga0496126_0035266_92_736 | 182 |
| 7 | 3300025245 | Ga0207425_1007795 | Ga0207425_10077952 | 184 |
| 8 | 3300026023 | Ga0207677_10077226 | Ga0207677_100772263 | 184 |
| 9 | 3300026035 | Ga0207703_10557029 | Ga0207703_105570292 | 184 |
| 10 | iso_pu_bacteria | 2513237087 | 2513591697 | 184 |
| 11 | iso_pu_bacteria | 2828305725 | 2828307559 | 184 |
| 12 | iso_pu_bacteria | 2775506901 | 2776265753 | 185 |
| 13 | iso_pu_bacteria | 2894232714 | 2894232959 | 185 |
| 14 | iso_pu_bacteria | 8006984368 | 8006984706 | 185 |
| 15 | 3300009036 | Ga0105244_10100660 | Ga0105244_101006602 | 186 |
| 16 | 3300009147 | Ga0114129_10039885 | Ga0114129_100398851 | 186 |
| 17 | 3300031507 | Ga0307509_10399802 | Ga0307509_103998021 | 186 |
| 18 | 3300031507 | Ga0307509_10476074 | Ga0307509_104760742 | 186 |
| 19 | 3300046501 | Ga0495607_0000697 | Ga0495607_0000697_29282_29881 | 186 |
| 20 | 3300048091 | Ga0495626_0107361 | Ga0495626_0107361_557_1156 | 186 |
| 21 | 3300048919 | Ga0496116_0050570 | Ga0496116_0050570_56_721 | 186 |
| 22 | 3300048924 | Ga0496121_0070165 | Ga0496121_0070165_1629_2273 | 186 |
| 23 | 3300048925 | Ga0496122_0000821 | Ga0496122_0000821_21528_22172 | 186 |
| 24 | 3300048926 | Ga0496123_0000872 | Ga0496123_0000872_39134_39778 | 186 |
| 25 | 3300048928 | Ga0496125_0017939 | Ga0496125_0017939_4593_5237 | 186 |
| 26 | 3300048929 | Ga0496126_0338791 | Ga0496126_0338791_466_1110 | 186 |
| 27 | 3300050507 | nmdc:mga05p37_521040_c1 | nmdc:mga05p37_521040_c1_729_1322 | 186 |
| 28 | 3300050516 | nmdc:mga0sz30_294193_c1 | nmdc:mga0sz30_294193_c1_12_575 | 186 |
| 29 | iso_pu_bacteria | 2509276019 | 2509377457 | 186 |
| 30 | iso_pu_bacteria | 2509276021 | 2509391255 | 186 |
| 31 | iso_pu_bacteria | 2509276033 | 2509445434 | 186 |
| 32 | iso_pu_bacteria | 2510065019 | 2510135991 | 186 |
| 33 | iso_pu_bacteria | 2510065057 | 2510302947 | 186 |
| 34 | iso_pu_bacteria | 2510461069 | 2510840866 | 186 |
| 35 | iso_pu_bacteria | 2510461076 | 2510892531 | 186 |
| 36 | iso_pu_bacteria | 2510917030 | 2511200350 | 186 |
| 37 | iso_pu_bacteria | 2511231027 | 2511389048 | 186 |
| 38 | iso_pu_bacteria | 2511231052 | 2511496939 | 186 |
| 39 | iso_pu_bacteria | 2512047086 | 2512528845 | 186 |
| 40 | iso_pu_bacteria | 2512875026 | 2512969043 | 186 |
| 41 | iso_pu_bacteria | 2513237084 | 2513568289 | 186 |
| 42 | iso_pu_bacteria | 2513237085 | 2513578170 | 186 |
| 43 | iso_pu_bacteria | 2513237086 | 2513583380 | 186 |
| 44 | iso_pu_bacteria | 2513237089 | 2513605565 | 186 |
| 45 | iso_pu_bacteria | 2513237091 | 2513614946 | 186 |
| 46 | iso_pu_bacteria | 2513237093 | 2513634805 | 186 |
| 47 | iso_pu_bacteria | 2513237103 | 2513713831 | 186 |
| 48 | iso_pu_bacteria | 2513237140 | 2513883934 | 186 |
| 49 | iso_pu_bacteria | 2513237143 | 2513901600 | 186 |
| 50 | iso_pu_bacteria | 2513237144 | 2513910530 | 186 |
| 51 | iso_pu_bacteria | 2513237146 | 2513927961 | 186 |
| 52 | iso_pu_bacteria | 2513237156 | 2513986235 | 186 |
| 53 | iso_pu_bacteria | 2513237159 | 2514002288 | 186 |
| 54 | iso_pu_bacteria | 2513237160 | 2514007707 | 186 |
| 55 | iso_pu_bacteria | 2513237162 | 2514021928 | 186 |
| 56 | iso_pu_bacteria | 2515075009 | 2515109071 | 186 |
| 57 | iso_pu_bacteria | 2515154107 | 2515612198 | 186 |
| 58 | iso_pu_bacteria | 2515154113 | 2515632425 | 186 |
| 59 | iso_pu_bacteria | 2515154114 | 2515640688 | 186 |
| 60 | iso_pu_bacteria | 2515154116 | 2515661645 | 186 |
| 61 | iso_pu_bacteria | 2515154134 | 2515737888 | 186 |
| 62 | iso_pu_bacteria | 2516143018 | 2516206697 | 186 |
| 63 | iso_pu_bacteria | 2516653046 | 2516895831 | 186 |
| 64 | iso_pu_bacteria | 2516653077 | 2517041414 | 186 |
| 65 | iso_pu_bacteria | 2516653085 | 2517079951 | 186 |
| 66 | iso_pu_bacteria | 2517093000 | 2517097970 | 186 |
| 67 | iso_pu_bacteria | 2517287029 | 2517410251 | 186 |
| 68 | iso_pu_bacteria | 2517487022 | 2517566204 | 186 |
| 69 | iso_pu_bacteria | 2524023207 | 2524449167 | 186 |
| 70 | iso_pu_bacteria | 2529292951 | 2530649223 | 186 |
| 71 | iso_pu_bacteria | 2537561587 | 2537873171 | 186 |
| 72 | iso_pu_bacteria | 2551306084 | 2551678699 | 186 |
| 73 | iso_pu_bacteria | 2551306084 | 2551681937 | 186 |
| 74 | iso_pu_bacteria | 2551306085 | 2551683258 | 186 |
| 75 | iso_pu_bacteria | 2551306086 | 2551696700 | 186 |
| 76 | iso_pu_bacteria | 2551306087 | 2551699863 | 186 |
| 77 | iso_pu_bacteria | 2551306089 | 2551709114 | 186 |
| 78 | iso_pu_bacteria | 2551306089 | 2551714117 | 186 |
| 79 | iso_pu_bacteria | 2551306090 | 2551716762 | 186 |
| 80 | iso_pu_bacteria | 2551306091 | 2551731410 | 186 |
| 81 | iso_pu_bacteria | 2551306092 | 2551739065 | 186 |
| 82 | iso_pu_bacteria | 2551306093 | 2551744240 | 186 |
| 83 | iso_pu_bacteria | 2554235003 | 2554245651 | 186 |
| 84 | iso_pu_bacteria | 2558860100 | 2558864992 | 186 |
| 85 | iso_pu_bacteria | 2558860242 | 2559296520 | 186 |
| 86 | iso_pu_bacteria | 2582581298 | 2585222486 | 186 |
| 87 | iso_pu_bacteria | 2582581866 | 2585395795 | 186 |
| 88 | iso_pu_bacteria | 2585427526 | 2585525809 | 186 |
| 89 | iso_pu_bacteria | 2585427528 | 2585541661 | 186 |
| 90 | iso_pu_bacteria | 2585427529 | 2585544562 | 186 |
| 91 | iso_pu_bacteria | 2585427593 | 2585840120 | 186 |
| 92 | iso_pu_bacteria | 2599185170 | 2599420971 | 186 |
| 93 | iso_pu_bacteria | 2599185210 | 2599602985 | 186 |
| 94 | iso_pu_bacteria | 2600255279 | 2601610606 | 186 |
| 95 | iso_pu_bacteria | 2600255308 | 2601747064 | 186 |
| 96 | iso_pu_bacteria | 2615840624 | 2616294764 | 186 |
| 97 | iso_pu_bacteria | 2643221568 | 2643853748 | 186 |
| 98 | iso_pu_bacteria | 2643221693 | 2644520647 | 186 |
| 99 | iso_pu_bacteria | 2657244999 | 2657685760 | 186 |
| 100 | iso_pu_bacteria | 2690316117 | 2692319201 | 186 |
| 101 | iso_pu_bacteria | 2718217882 | 2719184467 | 186 |
| 102 | iso_pu_bacteria | 2718217927 | 2719389663 | 186 |
| 103 | iso_pu_bacteria | 2718217997 | 2719668323 | 186 |
| 104 | iso_pu_bacteria | 2718218009 | 2719728487 | 186 |
| 105 | iso_pu_bacteria | 2718218199 | 2720489016 | 186 |
| 106 | iso_pu_bacteria | 2718218232 | 2720609708 | 186 |
| 107 | iso_pu_bacteria | 2718218233 | 2720617139 | 186 |
| 108 | iso_pu_bacteria | 2718218235 | 2720628271 | 186 |
| 109 | iso_pu_bacteria | 2718218269 | 2720772235 | 186 |
| 110 | iso_pu_bacteria | 2718218363 | 2721144175 | 186 |
| 111 | iso_pu_bacteria | 2718218365 | 2721156273 | 186 |
| 112 | iso_pu_bacteria | 2718218366 | 2721161550 | 186 |
| 113 | iso_pu_bacteria | 2718218423 | 2721402431 | 186 |
| 114 | iso_pu_bacteria | 2721755514 | 2722842695 | 186 |
| 115 | iso_pu_bacteria | 2721755556 | 2723029655 | 186 |
| 116 | iso_pu_bacteria | 2721755684 | 2723564024 | 186 |
| 117 | iso_pu_bacteria | 2721755685 | 2723569559 | 186 |
| 118 | iso_pu_bacteria | 2721755809 | 2724036265 | 186 |
| 119 | iso_pu_bacteria | 2721755810 | 2724041512 | 186 |
| 120 | iso_pu_bacteria | 2721755819 | 2724092264 | 186 |
| 121 | iso_pu_bacteria | 2721755822 | 2724101106 | 186 |
| 122 | iso_pu_bacteria | 2721755823 | 2724112632 | 186 |
| 123 | iso_pu_bacteria | 2724679232 | 2725947040 | 186 |
| 124 | iso_pu_bacteria | 2728369352 | 2730110188 | 186 |
| 125 | iso_pu_bacteria | 2728369365 | 2730160583 | 186 |
| 126 | iso_pu_bacteria | 2728369397 | 2730295806 | 186 |
| 127 | iso_pu_bacteria | 2738541333 | 2739036275 | 186 |
| 128 | iso_pu_bacteria | 2751185821 | 2753463805 | 186 |
| 129 | iso_pu_bacteria | 2765235802 | 2765463889 | 186 |
| 130 | iso_pu_bacteria | 2765235942 | 2766069236 | 186 |
| 131 | iso_pu_bacteria | 2767802442 | 2770197920 | 186 |
| 132 | iso_pu_bacteria | 2775506902 | 2776269003 | 186 |
| 133 | iso_pu_bacteria | 2775506904 | 2776283860 | 186 |
| 134 | iso_pu_bacteria | 2791355082 | 2792583712 | 186 |
| 135 | iso_pu_bacteria | 2791355091 | 2792621525 | 186 |
| 136 | iso_pu_bacteria | 2791355092 | 2792627787 | 186 |
| 137 | iso_pu_bacteria | 2791355094 | 2792640254 | 186 |
| 138 | iso_pu_bacteria | 2791355256 | 2793297466 | 186 |
| 139 | iso_pu_bacteria | 2791355259 | 2793317384 | 186 |
| 140 | iso_pu_bacteria | 2791355260 | 2793325315 | 186 |
| 141 | iso_pu_bacteria | 2791355261 | 2793330458 | 186 |
| 142 | iso_pu_bacteria | 2791355262 | 2793336623 | 186 |
| 143 | iso_pu_bacteria | 2791355263 | 2793342541 | 186 |
| 144 | iso_pu_bacteria | 2791355264 | 2793345351 | 186 |
| 145 | iso_pu_bacteria | 2791355265 | 2793354905 | 186 |
| 146 | iso_pu_bacteria | 2791355266 | 2793362315 | 186 |
| 147 | iso_pu_bacteria | 2791355267 | 2793365139 | 186 |
| 148 | iso_pu_bacteria | 2802428858 | 2802720677 | 186 |
| 149 | iso_pu_bacteria | 2802428859 | 2802727866 | 186 |
| 150 | iso_pu_bacteria | 2802428860 | 2802733019 | 186 |
| 151 | iso_pu_bacteria | 2802428861 | 2802740246 | 186 |
| 152 | iso_pu_bacteria | 2802428862 | 2802746188 | 186 |
| 153 | iso_pu_bacteria | 2802428863 | 2802753524 | 186 |
| 154 | iso_pu_bacteria | 2802429268 | 2804754976 | 186 |
| 155 | iso_pu_bacteria | 2802429605 | 2805927116 | 186 |
| 156 | iso_pu_bacteria | 2802429606 | 2805934460 | 186 |
| 157 | iso_pu_bacteria | 2802429633 | 2806046378 | 186 |
| 158 | iso_pu_bacteria | 2802429634 | 2806053086 | 186 |
| 159 | iso_pu_bacteria | 2802429635 | 2806059706 | 186 |
| 160 | iso_pu_bacteria | 2802429636 | 2806068556 | 186 |
| 161 | iso_pu_bacteria | 2802429637 | 2806074978 | 186 |
| 162 | iso_pu_bacteria | 2808606387 | 2808986971 | 186 |
| 163 | iso_pu_bacteria | 2818991439 | 2819560726 | 186 |
| 164 | iso_pu_bacteria | 2838016132 | 2838016460 | 186 |
| 165 | iso_pu_bacteria | 2838022645 | 2838028359 | 186 |
| 166 | iso_pu_bacteria | 2838035591 | 2838041331 | 186 |
| 167 | iso_pu_bacteria | 2838042994 | 2838048098 | 186 |
| 168 | iso_pu_bacteria | 2838048938 | 2838050094 | 186 |
| 169 | iso_pu_bacteria | 2838061910 | 2838068251 | 186 |
| 170 | iso_pu_bacteria | 2838068647 | 2838068997 | 186 |
| 171 | iso_pu_bacteria | 2838074704 | 2838078610 | 186 |
| 172 | iso_pu_bacteria | 2838661181 | 2838665724 | 186 |
| 173 | iso_pu_bacteria | 2838668709 | 2838669582 | 186 |
| 174 | iso_pu_bacteria | 2838675328 | 2838677783 | 186 |
| 175 | iso_pu_bacteria | 2838680041 | 2838685329 | 186 |
| 176 | iso_pu_bacteria | 2838686498 | 2838687694 | 186 |
| 177 | iso_pu_bacteria | 2838694306 | 2838700066 | 186 |
| 178 | iso_pu_bacteria | 2838701080 | 2838701954 | 186 |
| 179 | iso_pu_bacteria | 2838707686 | 2838713170 | 186 |
| 180 | iso_pu_bacteria | 2838714209 | 2838717312 | 186 |
| 181 | iso_pu_bacteria | 2838719591 | 2838722079 | 186 |
| 182 | iso_pu_bacteria | 2838724970 | 2838728061 | 186 |
| 183 | iso_pu_bacteria | 2838729681 | 2838735581 | 186 |
| 184 | iso_pu_bacteria | 2838742623 | 2838748483 | 186 |
| 185 | iso_pu_bacteria | 2839993093 | 2839993841 | 186 |
| 186 | iso_pu_bacteria | 2840764183 | 2840766845 | 186 |
| 187 | iso_pu_bacteria | 2841846520 | 2841849722 | 186 |
| 188 | iso_pu_bacteria | 2841851746 | 2841854241 | 186 |
| 189 | iso_pu_bacteria | 2841859092 | 2841861243 | 186 |
| 190 | iso_pu_bacteria | 2841864319 | 2841868619 | 186 |
| 191 | iso_pu_bacteria | 2842110456 | 2842111377 | 186 |
| 192 | iso_pu_bacteria | 2842118031 | 2842123534 | 186 |
| 193 | iso_pu_bacteria | 2842124991 | 2842127530 | 186 |
| 194 | iso_pu_bacteria | 2842130223 | 2842132676 | 186 |
| 195 | iso_pu_bacteria | 2842152218 | 2842154670 | 186 |
| 196 | iso_pu_bacteria | 2842156927 | 2842159391 | 186 |
| 197 | iso_pu_bacteria | 2842163707 | 2842163830 | 186 |
| 198 | iso_pu_bacteria | 2842170452 | 2842173168 | 186 |
| 199 | iso_pu_bacteria | 2842175837 | 2842178290 | 186 |
| 200 | iso_pu_bacteria | 2842180545 | 2842183040 | 186 |
| 201 | iso_pu_bacteria | 2842187318 | 2842190419 | 186 |
| 202 | iso_pu_bacteria | 2842192696 | 2842198512 | 186 |
| 203 | iso_pu_bacteria | 2842198810 | 2842204335 | 186 |
| 204 | iso_pu_bacteria | 2842205361 | 2842209348 | 186 |
| 205 | iso_pu_bacteria | 2842211629 | 2842214733 | 186 |
| 206 | iso_pu_bacteria | 2842217011 | 2842223822 | 186 |
| 207 | iso_pu_bacteria | 2842224351 | 2842227453 | 186 |
| 208 | iso_pu_bacteria | 2842229732 | 2842232751 | 186 |
| 209 | iso_pu_bacteria | 2842237096 | 2842242583 | 186 |
| 210 | iso_pu_bacteria | 2842243621 | 2842247006 | 186 |
| 211 | iso_pu_bacteria | 2842250916 | 2842251623 | 186 |
| 212 | iso_pu_bacteria | 2842257432 | 2842259308 | 186 |
| 213 | iso_pu_bacteria | 2842264693 | 2842265334 | 186 |
| 214 | iso_pu_bacteria | 2842271015 | 2842272274 | 186 |
| 215 | iso_pu_bacteria | 2842278818 | 2842282608 | 186 |
| 216 | iso_pu_bacteria | 2842291075 | 2842296650 | 186 |
| 217 | iso_pu_bacteria | 2842304105 | 2842309246 | 186 |
| 218 | iso_pu_bacteria | 2842311132 | 2842313492 | 186 |
| 219 | iso_pu_bacteria | 2842317721 | 2842323390 | 186 |
| 220 | iso_pu_bacteria | 2842341865 | 2842342568 | 186 |
| 221 | iso_pu_bacteria | 2842363717 | 2842365657 | 186 |
| 222 | iso_pu_bacteria | 2842370503 | 2842374672 | 186 |
| 223 | iso_pu_bacteria | 2842377471 | 2842383051 | 186 |
| 224 | iso_pu_bacteria | 2842384541 | 2842390183 | 186 |
| 225 | iso_pu_bacteria | 2842395702 | 2842400368 | 186 |
| 226 | iso_pu_bacteria | 2842402390 | 2842405706 | 186 |
| 227 | iso_pu_bacteria | 2842409023 | 2842412290 | 186 |
| 228 | iso_pu_bacteria | 2842415677 | 2842418936 | 186 |
| 229 | iso_pu_bacteria | 2842422224 | 2842423143 | 186 |
| 230 | iso_pu_bacteria | 2842428310 | 2842428613 | 186 |
| 231 | iso_pu_bacteria | 2842434925 | 2842435227 | 186 |
| 232 | iso_pu_bacteria | 2842441272 | 2842441910 | 186 |
| 233 | iso_pu_bacteria | 2842447887 | 2842448041 | 186 |
| 234 | iso_pu_bacteria | 2842462802 | 2842463039 | 186 |
| 235 | iso_pu_bacteria | 2842469257 | 2842469559 | 186 |
| 236 | iso_pu_bacteria | 2842489311 | 2842489601 | 186 |
| 237 | iso_pu_bacteria | 2842495871 | 2842500433 | 186 |
| 238 | iso_pu_bacteria | 2842515876 | 2842518490 | 186 |
| 239 | iso_pu_bacteria | 2842521101 | 2842525843 | 186 |
| 240 | iso_pu_bacteria | 2842871566 | 2842873433 | 186 |
| 241 | iso_pu_bacteria | 2844454524 | 2844460689 | 186 |
| 242 | iso_pu_bacteria | 2847417321 | 2847422293 | 186 |
| 243 | iso_pu_bacteria | 2848992105 | 2848998256 | 186 |
| 244 | iso_pu_bacteria | 2850079185 | 2850084709 | 186 |
| 245 | iso_pu_bacteria | 2854896431 | 2854899811 | 186 |
| 246 | iso_pu_bacteria | 2854916844 | 2854920969 | 186 |
| 247 | iso_pu_bacteria | 2855825444 | 2855829352 | 186 |
| 248 | iso_pu_bacteria | 2855839649 | 2855844451 | 186 |
| 249 | iso_pu_bacteria | 2855872281 | 2855875676 | 186 |
| 250 | iso_pu_bacteria | 2857516855 | 2857518249 | 186 |
| 251 | iso_pu_bacteria | 2858800743 | 2858806088 | 186 |
| 252 | iso_pu_bacteria | 2894652903 | 2894653227 | 186 |
| 253 | iso_pu_bacteria | 2896384573 | 2896389292 | 186 |
| 254 | iso_pu_bacteria | 2899792073 | 2899793524 | 186 |
| 255 | iso_pu_bacteria | 2899845264 | 2899847719 | 186 |
| 256 | iso_pu_bacteria | 2904578770 | 2904579468 | 186 |
| 257 | iso_pu_bacteria | 2913295892 | 2913297002 | 186 |
| 258 | iso_pu_bacteria | 2915980308 | 2915982753 | 186 |
| 259 | iso_pu_bacteria | 2915986958 | 2915988129 | 186 |
| 260 | iso_pu_bacteria | 2915993759 | 2915993827 | 186 |
| 261 | iso_pu_bacteria | 2916000859 | 2916005470 | 186 |
| 262 | iso_pu_bacteria | 2916007675 | 2916008816 | 186 |
| 263 | iso_pu_bacteria | 2916014648 | 2916021498 | 186 |
| 264 | iso_pu_bacteria | 2916021584 | 2916021659 | 186 |
| 265 | iso_pu_bacteria | 2916028427 | 2916028530 | 186 |
| 266 | iso_pu_bacteria | 2916035215 | 2916037525 | 186 |
| 267 | iso_pu_bacteria | 2916041962 | 2916042011 | 186 |
| 268 | iso_pu_bacteria | 2916048683 | 2916048783 | 186 |
| 269 | iso_pu_bacteria | 2916055098 | 2916059867 | 186 |
| 270 | iso_pu_bacteria | 2916061851 | 2916067091 | 186 |
| 271 | iso_pu_bacteria | 2916068649 | 2916074781 | 186 |
| 272 | iso_pu_bacteria | 2916076590 | 2916077496 | 186 |
| 273 | iso_pu_bacteria | 2919100787 | 2919103071 | 186 |
| 274 | iso_pu_bacteria | 2919114240 | 2919117577 | 186 |
| 275 | iso_pu_bacteria | 2919119836 | 2919120865 | 186 |
| 276 | iso_pu_bacteria | 2919166419 | 2919168220 | 186 |
| 277 | iso_pu_bacteria | 2920760137 | 2920764922 | 186 |
| 278 | iso_pu_bacteria | 2921201388 | 2921205317 | 186 |
| 279 | iso_pu_bacteria | 2921208531 | 2921212107 | 186 |
| 280 | iso_pu_bacteria | 2921237296 | 2921237334 | 186 |
| 281 | iso_pu_bacteria | 2921244191 | 2921249223 | 186 |
| 282 | iso_pu_bacteria | 2921250672 | 2921253115 | 186 |
| 283 | iso_pu_bacteria | 2921257292 | 2921259462 | 186 |
| 284 | iso_pu_bacteria | 2921263974 | 2921268090 | 186 |
| 285 | iso_pu_bacteria | 2921282425 | 2921288642 | 186 |
| 286 | iso_pu_bacteria | 2921289301 | 2921295094 | 186 |
| 287 | iso_pu_bacteria | 2921296804 | 2921298801 | 186 |
| 288 | iso_pu_bacteria | 2924144063 | 2924150423 | 186 |
| 289 | iso_pu_bacteria | 2924150972 | 2924157188 | 186 |
| 290 | iso_pu_bacteria | 2924158325 | 2924161701 | 186 |
| 291 | iso_pu_bacteria | 2924165586 | 2924171202 | 186 |
| 292 | iso_pu_bacteria | 2924172951 | 2924175043 | 186 |
| 293 | iso_pu_bacteria | 2924179722 | 2924182714 | 186 |
| 294 | iso_pu_bacteria | 2924186466 | 2924189117 | 186 |
| 295 | iso_pu_bacteria | 2924193448 | 2924196813 | 186 |
| 296 | iso_pu_bacteria | 2924200457 | 2924200537 | 186 |
| 297 | iso_pu_bacteria | 2924207177 | 2924212086 | 186 |
| 298 | iso_pu_bacteria | 2924214083 | 2924217765 | 186 |
| 299 | iso_pu_bacteria | 2924221636 | 2924223655 | 186 |
| 300 | iso_pu_bacteria | 2924228884 | 2924233404 | 186 |
| 301 | iso_pu_bacteria | 2926754445 | 2926759015 | 186 |
| 302 | iso_pu_bacteria | 2926760298 | 2926763468 | 186 |
| 303 | iso_pu_bacteria | 2928521798 | 2928522272 | 186 |
| 304 | iso_pu_bacteria | 2933006813 | 2933009947 | 186 |
| 305 | iso_pu_bacteria | 2933011516 | 2933014116 | 186 |
| 306 | iso_pu_bacteria | 2933016740 | 2933020663 | 186 |
| 307 | iso_pu_bacteria | 2933570622 | 2933575653 | 186 |
| 308 | iso_pu_bacteria | 2933586486 | 2933587931 | 186 |
| 309 | iso_pu_bacteria | 2933594066 | 2933595916 | 186 |
| 310 | iso_pu_bacteria | 2933599457 | 2933599664 | 186 |
| 311 | iso_pu_bacteria | 2935894831 | 2935899543 | 186 |
| 312 | iso_pu_bacteria | 2935901341 | 2935902930 | 186 |
| 313 | iso_pu_bacteria | 2936367885 | 2936374150 | 186 |
| 314 | iso_pu_bacteria | 2936375103 | 2936375331 | 186 |
| 315 | iso_pu_bacteria | 2936381700 | 2936383143 | 186 |
| 316 | iso_pu_bacteria | 2936996657 | 2936998401 | 186 |
| 317 | iso_pu_bacteria | 2937002841 | 2937002993 | 186 |
| 318 | iso_pu_bacteria | 2937009748 | 2937009842 | 186 |
| 319 | iso_pu_bacteria | 2937016420 | 2937020004 | 186 |
| 320 | iso_pu_bacteria | 2937023124 | 2937025160 | 186 |
| 321 | iso_pu_bacteria | 2937029754 | 2937032865 | 186 |
| 322 | iso_pu_bacteria | 2937036028 | 2937041944 | 186 |
| 323 | iso_pu_bacteria | 2937042894 | 2937049090 | 186 |
| 324 | iso_pu_bacteria | 2937049772 | 2937054580 | 186 |
| 325 | iso_pu_bacteria | 2937056579 | 2937058646 | 186 |
| 326 | iso_pu_bacteria | 2937063883 | 2937063922 | 186 |
| 327 | iso_pu_bacteria | 2937071275 | 2937077741 | 186 |
| 328 | iso_pu_bacteria | 2937078374 | 2937081125 | 186 |
| 329 | iso_pu_bacteria | 2937084907 | 2937090076 | 186 |
| 330 | iso_pu_bacteria | 2937091812 | 2937094422 | 186 |
| 331 | iso_pu_bacteria | 2937098957 | 2937101438 | 186 |
| 332 | iso_pu_bacteria | 2937106411 | 2937108024 | 186 |
| 333 | iso_pu_bacteria | 2937113482 | 2937115422 | 186 |
| 334 | iso_pu_bacteria | 2937119839 | 2937120089 | 186 |
| 335 | iso_pu_bacteria | 2937126314 | 2937128216 | 186 |
| 336 | iso_pu_bacteria | 2954011201 | 2954014303 | 186 |
| 337 | iso_pu_bacteria | 2957375807 | 2957377369 | 186 |
| 338 | iso_pu_bacteria | 2957382221 | 2957382269 | 186 |
| 339 | iso_pu_bacteria | 2957388812 | 2957395522 | 186 |
| 340 | iso_pu_bacteria | 2957395598 | 2957397980 | 186 |
| 341 | iso_pu_bacteria | 2957402308 | 2957404285 | 186 |
| 342 | iso_pu_bacteria | 2957408893 | 2957414782 | 186 |
| 343 | iso_pu_bacteria | 2957415311 | 2957421116 | 186 |
| 344 | iso_pu_bacteria | 2957422303 | 2957424619 | 186 |
| 345 | iso_pu_bacteria | 2957430029 | 2957431348 | 186 |
| 346 | iso_pu_bacteria | 2957437181 | 2957441401 | 186 |
| 347 | iso_pu_bacteria | 2957443900 | 2957446013 | 186 |
| 348 | iso_pu_bacteria | 2957450854 | 2957451114 | 186 |
| 349 | iso_pu_bacteria | 2957457609 | 2957461747 | 186 |
| 350 | iso_pu_bacteria | 2957464669 | 2957465972 | 186 |
| 351 | iso_pu_bacteria | 2957471148 | 2957474521 | 186 |
| 352 | iso_pu_bacteria | 2957478035 | 2957483292 | 186 |
| 353 | iso_pu_bacteria | 2957484790 | 2957491264 | 186 |
| 354 | iso_pu_bacteria | 2957491536 | 2957496577 | 186 |
| 355 | iso_pu_bacteria | 2957498199 | 2957502015 | 186 |
| 356 | iso_pu_bacteria | 2957505466 | 2957505533 | 186 |
| 357 | iso_pu_bacteria | 2960584000 | 2960584081 | 186 |
| 358 | iso_pu_bacteria | 2960591022 | 2960593909 | 186 |
| 359 | iso_pu_bacteria | 2960597568 | 2960603098 | 186 |
| 360 | iso_pu_bacteria | 2960603979 | 2960604158 | 186 |
| 361 | iso_pu_bacteria | 2960610863 | 2960610942 | 186 |
| 362 | iso_pu_bacteria | 2960617483 | 2960622307 | 186 |
| 363 | iso_pu_bacteria | 2960624210 | 2960624367 | 186 |
| 364 | iso_pu_bacteria | 2960631154 | 2960637884 | 186 |
| 365 | iso_pu_bacteria | 2960637947 | 2960637983 | 186 |
| 366 | iso_pu_bacteria | 2960645483 | 2960649240 | 186 |
| 367 | iso_pu_bacteria | 2960652885 | 2960653278 | 186 |
| 368 | iso_pu_bacteria | 2960660292 | 2960663687 | 186 |
| 369 | iso_pu_bacteria | 2960667422 | 2960667508 | 186 |
| 370 | iso_pu_bacteria | 2960674078 | 2960676581 | 186 |
| 371 | iso_pu_bacteria | 2960680706 | 2960683244 | 186 |
| 372 | iso_pu_bacteria | 2960693952 | 2960700386 | 186 |
| 373 | iso_pu_bacteria | 2964607997 | 2964611034 | 186 |
| 374 | iso_pu_bacteria | 2964615318 | 2964615463 | 186 |
| 375 | iso_pu_bacteria | 2964621998 | 2964628164 | 186 |
| 376 | iso_pu_bacteria | 2964628898 | 2964628964 | 186 |
| 377 | iso_pu_bacteria | 2964636051 | 2964640183 | 186 |
| 378 | iso_pu_bacteria | 2964643177 | 2964643434 | 186 |
| 379 | iso_pu_bacteria | 2964649959 | 2964653973 | 186 |
| 380 | iso_pu_bacteria | 2964656573 | 2964656666 | 186 |
| 381 | iso_pu_bacteria | 2964663802 | 2964664054 | 186 |
| 382 | iso_pu_bacteria | 2964670856 | 2964676917 | 186 |
| 383 | iso_pu_bacteria | 2964678106 | 2964682321 | 186 |
| 384 | iso_pu_bacteria | 2964685014 | 2964690732 | 186 |
| 385 | iso_pu_bacteria | 2964691889 | 2964695938 | 186 |
| 386 | iso_pu_bacteria | 2964698721 | 2964698852 | 186 |
| 387 | iso_pu_bacteria | 2964705432 | 2964707586 | 186 |
| 388 | iso_pu_bacteria | 2964712639 | 2964717768 | 186 |
| 389 | iso_pu_bacteria | 2964719344 | 2964721809 | 186 |
| 390 | iso_pu_bacteria | 2967664464 | 2967664506 | 186 |
| 391 | iso_pu_bacteria | 2967671571 | 2967672461 | 186 |
| 392 | iso_pu_bacteria | 2967678726 | 2967683263 | 186 |
| 393 | iso_pu_bacteria | 2967686174 | 2967690160 | 186 |
| 394 | iso_pu_bacteria | 2967693043 | 2967698573 | 186 |
| 395 | iso_pu_bacteria | 2967699805 | 2967706179 | 186 |
| 396 | iso_pu_bacteria | 2967706974 | 2967711839 | 186 |
| 397 | iso_pu_bacteria | 2967714385 | 2967718646 | 186 |
| 398 | iso_pu_bacteria | 2967721400 | 2967723159 | 186 |
| 399 | iso_pu_bacteria | 2967728569 | 2967730016 | 186 |
| 400 | iso_pu_bacteria | 2967735183 | 2967737466 | 186 |
| 401 | iso_pu_bacteria | 2967742019 | 2967748071 | 186 |
| 402 | iso_pu_bacteria | 2967748971 | 2967749230 | 186 |
| 403 | iso_pu_bacteria | 2967755722 | 2967755982 | 186 |
| 404 | iso_pu_bacteria | 2967762386 | 2967762535 | 186 |
| 405 | iso_pu_bacteria | 2967769361 | 2967769401 | 186 |
| 406 | iso_pu_bacteria | 2967775926 | 2967777265 | 186 |
| 407 | iso_pu_bacteria | 2970019648 | 2970019696 | 186 |
| 408 | iso_pu_bacteria | 2970026789 | 2970027030 | 186 |
| 409 | iso_pu_bacteria | 2970033650 | 2970033909 | 186 |
| 410 | iso_pu_bacteria | 2970040964 | 2970044090 | 186 |
| 411 | iso_pu_bacteria | 2970047711 | 2970051034 | 186 |
| 412 | iso_pu_bacteria | 2970054988 | 2970058363 | 186 |
| 413 | iso_pu_bacteria | 2970061556 | 2970065197 | 186 |
| 414 | iso_pu_bacteria | 2970068827 | 2970075852 | 186 |
| 415 | iso_pu_bacteria | 2970076120 | 2970077957 | 186 |
| 416 | iso_pu_bacteria | 2970082768 | 2970084517 | 186 |
| 417 | iso_pu_bacteria | 2970088815 | 2970091854 | 186 |
| 418 | iso_pu_bacteria | 2970095765 | 2970097702 | 186 |
| 419 | iso_pu_bacteria | 2970102677 | 2970102937 | 186 |
| 420 | iso_pu_bacteria | 2970109326 | 2970111390 | 186 |
| 421 | iso_pu_bacteria | 2970116247 | 2970119002 | 186 |
| 422 | iso_pu_bacteria | 2970122695 | 2970124091 | 186 |
| 423 | iso_pu_bacteria | 2970129317 | 2970135384 | 186 |
| 424 | iso_pu_bacteria | 2970136068 | 2970141699 | 186 |
| 425 | iso_pu_bacteria | 2970143518 | 2970146300 | 186 |
| 426 | iso_pu_bacteria | 2970149975 | 2970152183 | 186 |
| 427 | iso_pu_bacteria | 2970156795 | 2970160094 | 186 |
| 428 | iso_pu_bacteria | 2970164137 | 2970164822 | 186 |
| 429 | iso_pu_bacteria | 2970170962 | 2970171238 | 186 |
| 430 | iso_pu_bacteria | 2970177841 | 2970179965 | 186 |
| 431 | iso_pu_bacteria | 2970184632 | 2970191449 | 186 |
| 432 | iso_pu_bacteria | 2970191845 | 2970195056 | 186 |
| 433 | iso_pu_bacteria | 2977516862 | 2977521727 | 186 |
| 434 | iso_pu_bacteria | 2977523885 | 2977525815 | 186 |
| 435 | iso_pu_bacteria | 2977530762 | 2977535509 | 186 |
| 436 | iso_pu_bacteria | 2977537788 | 2977539891 | 186 |
| 437 | iso_pu_bacteria | 2977544691 | 2977545656 | 186 |
| 438 | iso_pu_bacteria | 2977551784 | 2977556209 | 186 |
| 439 | iso_pu_bacteria | 2977558990 | 2977559116 | 186 |
| 440 | iso_pu_bacteria | 2977565890 | 2977566026 | 186 |
| 441 | iso_pu_bacteria | 2977572785 | 2977574537 | 186 |
| 442 | iso_pu_bacteria | 2977579622 | 2977584975 | 186 |
| 443 | iso_pu_bacteria | 2978969890 | 2978970847 | 186 |
| 444 | iso_pu_bacteria | 2979089926 | 2979091497 | 186 |
| 445 | iso_pu_bacteria | 2979095461 | 2979097017 | 186 |
| 446 | iso_pu_bacteria | 2979100975 | 2979101309 | 186 |
| 447 | iso_pu_bacteria | 2984509177 | 2984510734 | 186 |
| 448 | iso_pu_bacteria | 2984518228 | 2984518565 | 186 |
| 449 | iso_pu_bacteria | 2984537506 | 2984539084 | 186 |
| 450 | iso_pu_bacteria | 2984587000 | 2984587956 | 186 |
| 451 | iso_pu_bacteria | 2984601300 | 2984605782 | 186 |
| 452 | iso_pu_bacteria | 2996893221 | 2996894462 | 186 |
| 453 | iso_pu_bacteria | 3002141150 | 3002142273 | 186 |
| 454 | iso_pu_bacteria | 639633055 | 639645162 | 186 |
| 455 | iso_pu_bacteria | 648276728 | 648735463 | 186 |
| 456 | iso_pu_bacteria | 650716007 | 650842938 | 186 |
| 457 | iso_pu_bacteria | 8003570095 | 8003574350 | 186 |
| 458 | iso_pu_bacteria | 8003992118 | 8003996975 | 186 |
| 459 | iso_pu_bacteria | 8003999396 | 8004004673 | 186 |
| 460 | iso_pu_bacteria | 8005275841 | 8005278008 | 186 |
| 461 | iso_pu_bacteria | 8005282627 | 8005286223 | 186 |
| 462 | iso_pu_bacteria | 8005289223 | 8005295500 | 186 |
| 463 | iso_pu_bacteria | 8005301065 | 8005306331 | 186 |
| 464 | iso_pu_bacteria | 8005307578 | 8005307702 | 186 |
| 465 | iso_pu_bacteria | 8005376324 | 8005380036 | 186 |
| 466 | iso_pu_bacteria | 8005382845 | 8005383439 | 186 |
| 467 | iso_pu_bacteria | 8005395548 | 8005399033 | 186 |
| 468 | iso_pu_bacteria | 8005430974 | 8005434716 | 186 |
| 469 | iso_pu_bacteria | 8005460587 | 8005467440 | 186 |
| 470 | iso_pu_bacteria | 8005497431 | 8005502529 | 186 |
| 471 | iso_pu_bacteria | 8005556819 | 8005563542 | 186 |
| 472 | iso_pu_bacteria | 8005563573 | 8005565315 | 186 |
| 473 | iso_pu_bacteria | 8005570704 | 8005572383 | 186 |
| 474 | iso_pu_bacteria | 8005619151 | 8005623737 | 186 |
| 475 | iso_pu_bacteria | 8005668836 | 8005673957 | 186 |
| 476 | iso_pu_bacteria | 8005688590 | 8005693973 | 186 |
| 477 | iso_pu_bacteria | 8005695170 | 8005701191 | 186 |
| 478 | iso_pu_bacteria | 8018127388 | 8018131883 | 186 |
| 479 | iso_pu_bacteria | 8018150411 | 8018153733 | 186 |
| 480 | iso_pu_bacteria | 8018163183 | 8018165724 | 186 |
| 481 | iso_pu_bacteria | 8018176218 | 8018176557 | 186 |
| 482 | iso_pu_bacteria | 8023680758 | 8023687887 | 186 |
| 483 | iso_pu_bacteria | 8024479707 | 8024484826 | 186 |
| 484 | iso_pu_bacteria | 8024501048 | 8024507141 | 186 |
| 485 | iso_pu_bacteria | 8049293176 | 8049298090 | 186 |
| 486 | iso_pu_bacteria | 8054460903 | 8054464557 | 186 |
| 487 | iso_pu_bacteria | 8056375014 | 8056377692 | 186 |
| 488 | iso_pu_bacteria | 8056382006 | 8056382471 | 186 |
| 489 | iso_pu_bacteria | 8057874678 | 8057877802 | 186 |
| 490 | 3300005843 | Ga0068860_100137173 | Ga0068860_1001371732 | 187 |
| 491 | 3300014968 | Ga0157379_10010498 | Ga0157379_100104982 | 187 |
| 492 | 3300025292 | Ga0209676_1004568 | Ga0209676_10045685 | 187 |
| 493 | 3300025298 | Ga0209050_1006975 | Ga0209050_10069755 | 187 |
| 494 | 3300025941 | Ga0207711_10423180 | Ga0207711_104231802 | 187 |
| 495 | 3300028381 | Ga0268264_10088538 | Ga0268264_100885383 | 187 |
| 496 | 3300031616 | Ga0307508_10067924 | Ga0307508_100679242 | 187 |
| 497 | 3300031911 | Ga0307412_10000922 | Ga0307412_1000092218 | 187 |
| 498 | 3300046542 | Ga0495597_0005508 | Ga0495597_0005508_284_886 | 187 |
| 499 | 3300047443 | Ga0495687_000722 | Ga0495687_000722_7691_8293 | 187 |
| 500 | 3300048919 | Ga0496116_0068841 | Ga0496116_0068841_43_687 | 187 |
| 501 | 3300048927 | Ga0496124_0217545 | Ga0496124_0217545_59_703 | 187 |
| 502 | iso_pu_bacteria | 2507262055 | 2507511238 | 187 |
| 503 | iso_pu_bacteria | 2508501009 | 2508545040 | 187 |
| 504 | iso_pu_bacteria | 2508501042 | 2508693786 | 187 |
| 505 | iso_pu_bacteria | 2513237092 | 2513623677 | 187 |
| 506 | iso_pu_bacteria | 2513237094 | 2513640865 | 187 |
| 507 | iso_pu_bacteria | 2513237095 | 2513650794 | 187 |
| 508 | iso_pu_bacteria | 2513237101 | 2513693802 | 187 |
| 509 | iso_pu_bacteria | 2513237104 | 2513719730 | 187 |
| 510 | iso_pu_bacteria | 2513237139 | 2513874849 | 187 |
| 511 | iso_pu_bacteria | 2513237161 | 2514010431 | 187 |
| 512 | iso_pu_bacteria | 2515154112 | 2515625187 | 187 |
| 513 | iso_pu_bacteria | 2517093001 | 2517100857 | 187 |
| 514 | iso_pu_bacteria | 2524023205 | 2524437952 | 187 |
| 515 | iso_pu_bacteria | 2528768022 | 2528849252 | 187 |
| 516 | iso_pu_bacteria | 2599185292 | 2599907674 | 187 |
| 517 | iso_pu_bacteria | 2617270735 | 2617350527 | 187 |
| 518 | iso_pu_bacteria | 2617270741 | 2617373359 | 187 |
| 519 | iso_pu_bacteria | 2643221569 | 2643858732 | 187 |
| 520 | iso_pu_bacteria | 2643221594 | 2643982108 | 187 |
| 521 | iso_pu_bacteria | 2643221621 | 2644120498 | 187 |
| 522 | iso_pu_bacteria | 2643221733 | 2644728096 | 187 |
| 523 | iso_pu_bacteria | 2643221736 | 2644742395 | 187 |
| 524 | iso_pu_bacteria | 2721755755 | 2723843409 | 187 |
| 525 | iso_pu_bacteria | 2744054633 | 2745082317 | 187 |
| 526 | iso_pu_bacteria | 2791355196 | 2793061791 | 187 |
| 527 | iso_pu_bacteria | 2791355199 | 2793077866 | 187 |
| 528 | iso_pu_bacteria | 2802429603 | 2805916852 | 187 |
| 529 | iso_pu_bacteria | 2808606395 | 2809034212 | 187 |
| 530 | iso_pu_bacteria | 2816332527 | 2818238390 | 187 |
| 531 | iso_pu_bacteria | 2821123053 | 2821127246 | 187 |
| 532 | iso_pu_bacteria | 2824600985 | 2824607948 | 187 |
| 533 | iso_pu_bacteria | 2824609381 | 2824611491 | 187 |
| 534 | iso_pu_bacteria | 2824653114 | 2824657229 | 187 |
| 535 | iso_pu_bacteria | 2824661429 | 2824663387 | 187 |
| 536 | iso_pu_bacteria | 2824671348 | 2824675252 | 187 |
| 537 | iso_pu_bacteria | 2824679649 | 2824684024 | 187 |
| 538 | iso_pu_bacteria | 2824687955 | 2824690119 | 187 |
| 539 | iso_pu_bacteria | 2824696289 | 2824698670 | 187 |
| 540 | iso_pu_bacteria | 2824704595 | 2824708265 | 187 |
| 541 | iso_pu_bacteria | 2824732956 | 2824740251 | 187 |
| 542 | iso_pu_bacteria | 2824746037 | 2824746066 | 187 |
| 543 | iso_pu_bacteria | 2824753945 | 2824754480 | 187 |
| 544 | iso_pu_bacteria | 2824763712 | 2824765474 | 187 |
| 545 | iso_pu_bacteria | 2824773399 | 2824773523 | 187 |
| 546 | iso_pu_bacteria | 2838122688 | 2838129087 | 187 |
| 547 | iso_pu_bacteria | 2838736955 | 2838740610 | 187 |
| 548 | iso_pu_bacteria | 2841760612 | 2841763820 | 187 |
| 549 | iso_pu_bacteria | 2841840854 | 2841844451 | 187 |
| 550 | iso_pu_bacteria | 2841941048 | 2841943395 | 187 |
| 551 | iso_pu_bacteria | 2841949485 | 2841953876 | 187 |
| 552 | iso_pu_bacteria | 2841957949 | 2841962132 | 187 |
| 553 | iso_pu_bacteria | 2841966195 | 2841971408 | 187 |
| 554 | iso_pu_bacteria | 2841974524 | 2841981223 | 187 |
| 555 | iso_pu_bacteria | 2841983080 | 2841990370 | 187 |
| 556 | iso_pu_bacteria | 2842038055 | 2842042467 | 187 |
| 557 | iso_pu_bacteria | 2842045827 | 2842050510 | 187 |
| 558 | iso_pu_bacteria | 2842140634 | 2842144481 | 187 |
| 559 | iso_pu_bacteria | 2844104063 | 2844109276 | 187 |
| 560 | iso_pu_bacteria | 2847939898 | 2847944032 | 187 |
| 561 | iso_pu_bacteria | 2851182111 | 2851183073 | 187 |
| 562 | iso_pu_bacteria | 2851246043 | 2851251383 | 187 |
| 563 | iso_pu_bacteria | 2857509624 | 2857512410 | 187 |
| 564 | iso_pu_bacteria | 2857531043 | 2857534773 | 187 |
| 565 | iso_pu_bacteria | 2857537821 | 2857540166 | 187 |
| 566 | iso_pu_bacteria | 2857576091 | 2857578390 | 187 |
| 567 | iso_pu_bacteria | 2858950400 | 2858954127 | 187 |
| 568 | iso_pu_bacteria | 2874590934 | 2874597979 | 187 |
| 569 | iso_pu_bacteria | 2874604998 | 2874611680 | 187 |
| 570 | iso_pu_bacteria | 2874628541 | 2874633900 | 187 |
| 571 | iso_pu_bacteria | 2874645413 | 2874651507 | 187 |
| 572 | iso_pu_bacteria | 2876761206 | 2876768757 | 187 |
| 573 | iso_pu_bacteria | 2876771140 | 2876776580 | 187 |
| 574 | iso_pu_bacteria | 2876808645 | 2876814241 | 187 |
| 575 | iso_pu_bacteria | 2876818435 | 2876824830 | 187 |
| 576 | iso_pu_bacteria | 2879074833 | 2879081557 | 187 |
| 577 | iso_pu_bacteria | 2879099564 | 2879109080 | 187 |
| 578 | iso_pu_bacteria | 2879110137 | 2879114918 | 187 |
| 579 | iso_pu_bacteria | 2879127579 | 2879134267 | 187 |
| 580 | iso_pu_bacteria | 2879142872 | 2879145906 | 187 |
| 581 | iso_pu_bacteria | 2885366525 | 2885366699 | 187 |
| 582 | iso_pu_bacteria | 2885409591 | 2885410597 | 187 |
| 583 | iso_pu_bacteria | 2888378607 | 2888381282 | 187 |
| 584 | iso_pu_bacteria | 2888388044 | 2888389393 | 187 |
| 585 | iso_pu_bacteria | 2888419890 | 2888421719 | 187 |
| 586 | iso_pu_bacteria | 2889033259 | 2889037730 | 187 |
| 587 | iso_pu_bacteria | 2904711408 | 2904712614 | 187 |
| 588 | iso_pu_bacteria | 2906626472 | 2906630775 | 187 |
| 589 | iso_pu_bacteria | 2908775508 | 2908781819 | 187 |
| 590 | iso_pu_bacteria | 2922361189 | 2922361673 | 187 |
| 591 | iso_pu_bacteria | 2922368715 | 2922370906 | 187 |
| 592 | iso_pu_bacteria | 2922386360 | 2922387069 | 187 |
| 593 | iso_pu_bacteria | 2922393267 | 2922401221 | 187 |
| 594 | iso_pu_bacteria | 2929615660 | 2929619310 | 187 |
| 595 | iso_pu_bacteria | 2929624759 | 2929628220 | 187 |
| 596 | iso_pu_bacteria | 2932784394 | 2932785609 | 187 |
| 597 | iso_pu_bacteria | 2932794094 | 2932796974 | 187 |
| 598 | iso_pu_bacteria | 2932801729 | 2932807271 | 187 |
| 599 | iso_pu_bacteria | 2932809354 | 2932813806 | 187 |
| 600 | iso_pu_bacteria | 2932818245 | 2932822225 | 187 |
| 601 | iso_pu_bacteria | 2932828146 | 2932830673 | 187 |
| 602 | iso_pu_bacteria | 2933577622 | 2933581231 | 187 |
| 603 | iso_pu_bacteria | 2935608549 | 2935612532 | 187 |
| 604 | iso_pu_bacteria | 2935616580 | 2935620714 | 187 |
| 605 | iso_pu_bacteria | 2935638405 | 2935639792 | 187 |
| 606 | iso_pu_bacteria | 2935648319 | 2935650432 | 187 |
| 607 | iso_pu_bacteria | 2935656913 | 2935658579 | 187 |
| 608 | iso_pu_bacteria | 2935665750 | 2935667370 | 187 |
| 609 | iso_pu_bacteria | 2935675223 | 2935677572 | 187 |
| 610 | iso_pu_bacteria | 2935684952 | 2935690487 | 187 |
| 611 | iso_pu_bacteria | 2935694250 | 2935697182 | 187 |
| 612 | iso_pu_bacteria | 2935703347 | 2935705110 | 187 |
| 613 | iso_pu_bacteria | 2935713505 | 2935717817 | 187 |
| 614 | iso_pu_bacteria | 2935722832 | 2935727033 | 187 |
| 615 | iso_pu_bacteria | 2935732158 | 2935735803 | 187 |
| 616 | iso_pu_bacteria | 2935741537 | 2935744926 | 187 |
| 617 | iso_pu_bacteria | 2935750917 | 2935755496 | 187 |
| 618 | iso_pu_bacteria | 2935760218 | 2935761990 | 187 |
| 619 | iso_pu_bacteria | 2935769743 | 2935774642 | 187 |
| 620 | iso_pu_bacteria | 2935777560 | 2935781928 | 187 |
| 621 | iso_pu_bacteria | 2935785616 | 2935789343 | 187 |
| 622 | iso_pu_bacteria | 2935793552 | 2935797614 | 187 |
| 623 | iso_pu_bacteria | 2935801545 | 2935803489 | 187 |
| 624 | iso_pu_bacteria | 2935810662 | 2935811415 | 187 |
| 625 | iso_pu_bacteria | 2935819856 | 2935824021 | 187 |
| 626 | iso_pu_bacteria | 2935827899 | 2935829275 | 187 |
| 627 | iso_pu_bacteria | 2935837841 | 2935842746 | 187 |
| 628 | iso_pu_bacteria | 2935847175 | 2935852832 | 187 |
| 629 | iso_pu_bacteria | 2935855204 | 2935858522 | 187 |
| 630 | iso_pu_bacteria | 2935864058 | 2935867057 | 187 |
| 631 | iso_pu_bacteria | 2935873716 | 2935877187 | 187 |
| 632 | iso_pu_bacteria | 2935883170 | 2935884604 | 187 |
| 633 | iso_pu_bacteria | 2935908558 | 2935912016 | 187 |
| 634 | iso_pu_bacteria | 2935916978 | 2935922227 | 187 |
| 635 | iso_pu_bacteria | 2935926038 | 2935929045 | 187 |
| 636 | iso_pu_bacteria | 2935934488 | 2935935676 | 187 |
| 637 | iso_pu_bacteria | 2935942939 | 2935947242 | 187 |
| 638 | iso_pu_bacteria | 2935951376 | 2935953664 | 187 |
| 639 | iso_pu_bacteria | 2935967501 | 2935968690 | 187 |
| 640 | iso_pu_bacteria | 2935975950 | 2935976902 | 187 |
| 641 | iso_pu_bacteria | 2935984226 | 2935986141 | 187 |
| 642 | iso_pu_bacteria | 2935992306 | 2935995177 | 187 |
| 643 | iso_pu_bacteria | 2936002035 | 2936004064 | 187 |
| 644 | iso_pu_bacteria | 2936011229 | 2936013009 | 187 |
| 645 | iso_pu_bacteria | 2936019824 | 2936021904 | 187 |
| 646 | iso_pu_bacteria | 2936028420 | 2936030302 | 187 |
| 647 | iso_pu_bacteria | 2936037263 | 2936037997 | 187 |
| 648 | iso_pu_bacteria | 2936046547 | 2936048098 | 187 |
| 649 | iso_pu_bacteria | 2936055302 | 2936059731 | 187 |
| 650 | iso_pu_bacteria | 2940556831 | 2940561223 | 187 |
| 651 | iso_pu_bacteria | 2941479691 | 2941480005 | 187 |
| 652 | iso_pu_bacteria | 2941538514 | 2941544405 | 187 |
| 653 | iso_pu_bacteria | 3005445848 | 3005451061 | 187 |
| 654 | iso_pu_bacteria | 3005483717 | 3005487568 | 187 |
| 655 | iso_pu_bacteria | 3005506211 | 3005511307 | 187 |
| 656 | iso_pu_bacteria | 3005587118 | 3005592856 | 187 |
| 657 | iso_pu_bacteria | 3005594810 | 3005596298 | 187 |
| 658 | iso_pu_bacteria | 8006926726 | 8006927408 | 187 |
| 659 | iso_pu_bacteria | 8006964411 | 8006966785 | 187 |
| 660 | iso_pu_bacteria | 8006994254 | 8006994697 | 187 |
| 661 | iso_pu_bacteria | 8016511872 | 8016516739 | 187 |
| 662 | iso_pu_bacteria | 8016522445 | 8016524081 | 187 |
| 663 | iso_pu_bacteria | 8016530956 | 8016537625 | 187 |
| 664 | iso_pu_bacteria | 8016539877 | 8016541898 | 187 |
| 665 | iso_pu_bacteria | 8016557553 | 8016559768 | 187 |
| 666 | iso_pu_bacteria | 8016566248 | 8016567281 | 187 |
| 667 | iso_pu_bacteria | 8016575299 | 8016579993 | 187 |
| 668 | iso_pu_bacteria | 8016583857 | 8016588849 | 187 |
| 669 | iso_pu_bacteria | 8016595262 | 8016597710 | 187 |
| 670 | iso_pu_bacteria | 8016603502 | 8016604609 | 187 |
| 671 | iso_pu_bacteria | 8016613128 | 8016620404 | 187 |
| 672 | iso_pu_bacteria | 8016622563 | 8016629569 | 187 |
| 673 | iso_pu_bacteria | 8016630954 | 8016637824 | 187 |
| 674 | iso_pu_bacteria | 8017057580 | 8017059823 | 187 |
| 675 | iso_pu_bacteria | 8019530166 | 8019537304 | 187 |
| 676 | iso_pu_bacteria | 8019538911 | 8019539018 | 187 |
| 677 | iso_pu_bacteria | 8019547302 | 8019548506 | 187 |
| 678 | iso_pu_bacteria | 8019576017 | 8019579303 | 187 |
| 679 | iso_pu_bacteria | 8019586578 | 8019597358 | 187 |
| 680 | iso_pu_bacteria | 8019597564 | 8019604328 | 187 |
| 681 | iso_pu_bacteria | 8019608314 | 8019614208 | 187 |
| 682 | iso_pu_bacteria | 8019619141 | 8019624885 | 187 |
| 683 | iso_pu_bacteria | 8019629233 | 8019637302 | 187 |
| 684 | iso_pu_bacteria | 8019638758 | 8019642287 | 187 |
| 685 | iso_pu_bacteria | 8019648815 | 8019650274 | 187 |
| 686 | iso_pu_bacteria | 8019659431 | 8019665156 | 187 |
| 687 | iso_pu_bacteria | 8019668869 | 8019674689 | 187 |
| 688 | iso_pu_bacteria | 8019678201 | 8019681410 | 187 |
| 689 | iso_pu_bacteria | 8019687851 | 8019694364 | 187 |
| 690 | iso_pu_bacteria | 8055742211 | 8055749432 | 187 |
| 691 | iso_pu_bacteria | 8056673599 | 8056680828 | 187 |
| 692 | iso_pu_bacteria | 8057529695 | 8057534253 | 187 |
| 693 | 3300005546 | Ga0070696_100194535 | Ga0070696_1001945352 | 188 |
| 694 | 3300005548 | Ga0070665_100151094 | Ga0070665_1001510943 | 188 |
| 695 | 3300005614 | Ga0068856_100207790 | Ga0068856_1002077902 | 188 |
| 696 | 3300005618 | Ga0068864_100057625 | Ga0068864_1000576252 | 188 |
| 697 | 3300005840 | Ga0068870_10257109 | Ga0068870_102571092 | 188 |
| 698 | 3300005842 | Ga0068858_100254176 | Ga0068858_1002541762 | 188 |
| 699 | 3300006038 | Ga0075365_10170772 | Ga0075365_101707722 | 188 |
| 700 | 3300006042 | Ga0075368_10150941 | Ga0075368_101509412 | 188 |
| 701 | 3300006048 | Ga0075363_100106500 | Ga0075363_1001065002 | 188 |
| 702 | 3300006048 | Ga0075363_100147378 | Ga0075363_1001473782 | 188 |
| 703 | 3300006048 | Ga0075363_100152898 | Ga0075363_1001528982 | 188 |
| 704 | 3300006051 | Ga0075364_10161287 | Ga0075364_101612872 | 188 |
| 705 | 3300006177 | Ga0075362_10141902 | Ga0075362_101419022 | 188 |
| 706 | 3300006178 | Ga0075367_10015631 | Ga0075367_100156313 | 188 |
| 707 | 3300006178 | Ga0075367_10077326 | Ga0075367_100773262 | 188 |
| 708 | 3300006195 | Ga0075366_10418172 | Ga0075366_104181722 | 188 |
| 709 | 3300006237 | Ga0097621_100059180 | Ga0097621_1000591803 | 188 |
| 710 | 3300006353 | Ga0075370_10193974 | Ga0075370_101939742 | 188 |
| 711 | 3300006358 | Ga0068871_100036259 | Ga0068871_1000362594 | 188 |
| 712 | 3300006880 | Ga0075429_100532299 | Ga0075429_1005322992 | 188 |
| 713 | 3300009094 | Ga0111539_10126014 | Ga0111539_101260142 | 188 |
| 714 | 3300009094 | Ga0111539_10616218 | Ga0111539_106162182 | 188 |
| 715 | 3300009176 | Ga0105242_10891563 | Ga0105242_108915631 | 188 |
| 716 | 3300009553 | Ga0105249_10059087 | Ga0105249_100590873 | 188 |
| 717 | 3300011119 | Ga0105246_10069899 | Ga0105246_100698992 | 188 |
| 718 | 3300014326 | Ga0157380_10026681 | Ga0157380_100266814 | 188 |
| 719 | 3300025900 | Ga0207710_10072061 | Ga0207710_100720612 | 188 |
| 720 | 3300025901 | Ga0207688_10177792 | Ga0207688_101777922 | 188 |
| 721 | 3300025907 | Ga0207645_10126071 | Ga0207645_101260712 | 188 |
| 722 | 3300025914 | Ga0207671_10327052 | Ga0207671_103270521 | 188 |
| 723 | 3300025919 | Ga0207657_10098320 | Ga0207657_100983202 | 188 |
| 724 | 3300025925 | Ga0207650_10463716 | Ga0207650_104637161 | 188 |
| 725 | 3300025931 | Ga0207644_10628225 | Ga0207644_106282252 | 188 |
| 726 | 3300025937 | Ga0207669_10485848 | Ga0207669_104858482 | 188 |
| 727 | 3300025941 | Ga0207711_10393349 | Ga0207711_103933492 | 188 |
| 728 | 3300025945 | Ga0207679_10572631 | Ga0207679_105726312 | 188 |
| 729 | 3300025961 | Ga0207712_10119224 | Ga0207712_101192242 | 188 |
| 730 | 3300025972 | Ga0207668_10246103 | Ga0207668_102461032 | 188 |
| 731 | 3300025981 | Ga0207640_10413084 | Ga0207640_104130842 | 188 |
| 732 | 3300026023 | Ga0207677_10263275 | Ga0207677_102632752 | 188 |
| 733 | 3300026035 | Ga0207703_10142070 | Ga0207703_101420702 | 188 |
| 734 | 3300026067 | Ga0207678_10604252 | Ga0207678_106042522 | 188 |
| 735 | 3300026078 | Ga0207702_10022544 | Ga0207702_100225444 | 188 |
| 736 | 3300026095 | Ga0207676_10082940 | Ga0207676_100829402 | 188 |
| 737 | 3300026121 | Ga0207683_10032928 | Ga0207683_100329284 | 188 |
| 738 | 3300026121 | Ga0207683_10106287 | Ga0207683_101062872 | 188 |
| 739 | 3300027866 | Ga0209813_10022390 | Ga0209813_100223902 | 188 |
| 740 | 3300027866 | Ga0209813_10035770 | Ga0209813_100357702 | 188 |
| 741 | 3300028379 | Ga0268266_10217032 | Ga0268266_102170322 | 188 |
| 742 | 3300028786 | Ga0307517_10053505 | Ga0307517_100535052 | 188 |
| 743 | 3300031456 | Ga0307513_10137393 | Ga0307513_101373932 | 188 |
| 744 | 3300031456 | Ga0307513_10256567 | Ga0307513_102565672 | 188 |
| 745 | 3300031456 | Ga0307513_10407625 | Ga0307513_104076251 | 188 |
| 746 | 3300031507 | Ga0307509_10012410 | Ga0307509_100124107 | 188 |
| 747 | 3300031616 | Ga0307508_10052399 | Ga0307508_100523992 | 188 |
| 748 | 3300031730 | Ga0307516_10001211 | Ga0307516_100012115 | 188 |
| 749 | 3300031852 | Ga0307410_10161173 | Ga0307410_101611732 | 188 |
| 750 | 3300033180 | Ga0307510_10091891 | Ga0307510_100918912 | 188 |
| 751 | 3300035114 | Ga0373939_0038944 | Ga0373939_0038944_507_1103 | 188 |
| 752 | 3300035691 | Ga0373931_0012955 | Ga0373931_0012955_2387_2983 | 188 |
| 753 | 3300037068 | Ga0373925_0334138 | Ga0373925_0334138_115_711 | 188 |
| 754 | 3300046517 | Ga0495630_0081544 | Ga0495630_0081544_1601_2200 | 188 |
| 755 | 3300046522 | Ga0495643_0071034 | Ga0495643_0071034_215_820 | 188 |
| 756 | 3300046526 | Ga0495666_0216057 | Ga0495666_0216057_82_681 | 188 |
| 757 | 3300046690 | Ga0495624_0016398 | Ga0495624_0016398_2949_3548 | 188 |
| 758 | 3300047321 | Ga0495676_0067566 | Ga0495676_0067566_1538_2137 | 188 |
| 759 | 3300047673 | Ga0495593_0080512 | Ga0495593_0080512_139_738 | 188 |
| 760 | 3300050490 | nmdc:mga03n38_57184_c1 | nmdc:mga03n38_57184_c1_134_733 | 188 |
| 761 | 3300050492 | nmdc:mga0yw44_173880_c1 | nmdc:mga0yw44_173880_c1_145_744 | 188 |
| 762 | 3300050493 | nmdc:mga0k408_1383_c1 | nmdc:mga0k408_1383_c1_7271_7870 | 188 |
| 763 | 3300050494 | nmdc:mga06z11_287022_c1 | nmdc:mga06z11_287022_c1_290_862 | 188 |
| 764 | 3300050494 | nmdc:mga06z11_297023_c1 | nmdc:mga06z11_297023_c1_105_704 | 188 |
| 765 | 3300050495 | nmdc:mga04h51_32606_c1 | nmdc:mga04h51_32606_c1_901_1500 | 188 |
| 766 | 3300050496 | nmdc:mga07m45_3676_c1 | nmdc:mga07m45_3676_c1_6663_7262 | 188 |
| 767 | 3300050511 | nmdc:mga08y16_415999_c1 | nmdc:mga08y16_415999_c1_526_1098 | 188 |
| 768 | 3300050516 | nmdc:mga0sz30_4699_c1 | nmdc:mga0sz30_4699_c1_839_1438 | 188 |
| 769 | iso_pu_bacteria | 2585427633 | 2585992848 | 188 |
| 770 | iso_pu_bacteria | 2585427634 | 2586003578 | 188 |
| 771 | iso_pu_bacteria | 2600254933 | 2600376885 | 188 |
| 772 | iso_pu_bacteria | 2643221558 | 2643814035 | 188 |
| 773 | iso_pu_bacteria | 2818991461 | 2819688529 | 188 |
| 774 | iso_pu_bacteria | 2899803654 | 2899807110 | 188 |
| 775 | iso_pu_bacteria | 2917699015 | 2917701652 | 188 |
| 776 | iso_pu_bacteria | 2919171160 | 2919176410 | 188 |
| 777 | 3300003187 | JGI25151J46595_10005027 | JGI25151J46595_100050274 | 189 |
| 778 | 3300003771 | Ga0055526_1005610 | Ga0055526_10056106 | 189 |
| 779 | 3300003771 | Ga0055526_1011504 | Ga0055526_10115042 | 189 |
| 780 | 3300003771 | Ga0055526_1016600 | Ga0055526_10166002 | 189 |
| 781 | 3300003771 | Ga0055526_1036630 | Ga0055526_10366302 | 189 |
| 782 | 3300003771 | Ga0055526_1044756 | Ga0055526_10447562 | 189 |
| 783 | 3300003773 | Ga0055537_1004444 | Ga0055537_10044442 | 189 |
| 784 | 3300003775 | Ga0055524_1001893 | Ga0055524_10018937 | 189 |
| 785 | 3300003781 | Ga0055536_1000380 | Ga0055536_100038020 | 189 |
| 786 | 3300003784 | Ga0055534_1009966 | Ga0055534_10099662 | 189 |
| 787 | 3300005719 | Ga0068861_100136783 | Ga0068861_1001367832 | 189 |
| 788 | 3300006038 | Ga0075365_10217976 | Ga0075365_102179762 | 189 |
| 789 | 3300006038 | Ga0075365_10396613 | Ga0075365_103966132 | 189 |
| 790 | 3300006042 | Ga0075368_10057000 | Ga0075368_100570002 | 189 |
| 791 | 3300006051 | Ga0075364_10177937 | Ga0075364_101779372 | 189 |
| 792 | 3300006058 | Ga0075432_10174647 | Ga0075432_101746471 | 189 |
| 793 | 3300006178 | Ga0075367_10039713 | Ga0075367_100397133 | 189 |
| 794 | 3300006846 | Ga0075430_100138044 | Ga0075430_1001380441 | 189 |
| 795 | 3300006946 | Ga0079104_1000044 | Ga0079104_100004481 | 189 |
| 796 | 3300009551 | Ga0105238_10118785 | Ga0105238_101187852 | 189 |
| 797 | 3300014325 | Ga0163163_10686487 | Ga0163163_106864871 | 189 |
| 798 | 3300017792 | Ga0163161_10402324 | Ga0163161_104023243 | 189 |
| 799 | 3300025263 | Ga0209565_1000021 | Ga0209565_1000021270 | 189 |
| 800 | 3300025291 | Ga0209675_1000149 | Ga0209675_100014962 | 189 |
| 801 | 3300025292 | Ga0209676_1000014 | Ga0209676_1000014715 | 189 |
| 802 | 3300025294 | Ga0209025_1000522 | Ga0209025_100052236 | 189 |
| 803 | 3300025294 | Ga0209025_1001542 | Ga0209025_10015422 | 189 |
| 804 | 3300025294 | Ga0209025_1062800 | Ga0209025_10628001 | 189 |
| 805 | 3300025295 | Ga0209564_1000455 | Ga0209564_100045536 | 189 |
| 806 | 3300025295 | Ga0209564_1001045 | Ga0209564_100104510 | 189 |
| 807 | 3300025295 | Ga0209564_1002205 | Ga0209564_100220510 | 189 |
| 808 | 3300025299 | Ga0209256_1000625 | Ga0209256_10006257 | 189 |
| 809 | 3300025303 | Ga0209051_1048392 | Ga0209051_10483922 | 189 |
| 810 | 3300025901 | Ga0207688_10029829 | Ga0207688_100298292 | 189 |
| 811 | 3300025924 | Ga0207694_10165446 | Ga0207694_101654462 | 189 |
| 812 | 3300025972 | Ga0207668_10576598 | Ga0207668_105765981 | 189 |
| 813 | 3300025972 | Ga0207668_10862784 | Ga0207668_108627841 | 189 |
| 814 | 3300027111 | Ga0209281_1000129 | Ga0209281_100012991 | 189 |
| 815 | 3300031548 | Ga0307408_100450104 | Ga0307408_1004501042 | 189 |
| 816 | 3300031730 | Ga0307516_10306367 | Ga0307516_103063672 | 189 |
| 817 | 3300031903 | Ga0307407_10166996 | Ga0307407_101669961 | 189 |
| 818 | 3300031995 | Ga0307409_100052103 | Ga0307409_1000521032 | 189 |
| 819 | 3300046512 | Ga0495610_0036676 | Ga0495610_0036676_961_1536 | 189 |
| 820 | 3300048913 | Ga0496110_0294672 | Ga0496110_0294672_90_665 | 189 |
| 821 | 3300048914 | Ga0496111_0000161 | Ga0496111_0000161_8361_8936 | 189 |
| 822 | 3300048924 | Ga0496121_0005284 | Ga0496121_0005284_8599_9174 | 189 |
| 823 | 3300048924 | Ga0496121_0012780 | Ga0496121_0012780_7797_8372 | 189 |
| 824 | 3300048924 | Ga0496121_0101889 | Ga0496121_0101889_1391_2008 | 189 |
| 825 | 3300048925 | Ga0496122_0076238 | Ga0496122_0076238_1019_1594 | 189 |
| 826 | 3300048926 | Ga0496123_0023293 | Ga0496123_0023293_482_1057 | 189 |
| 827 | 3300048927 | Ga0496124_0010860 | Ga0496124_0010860_3154_3729 | 189 |
| 828 | 3300048927 | Ga0496124_0078437 | Ga0496124_0078437_1425_2000 | 189 |
| 829 | 3300049570 | Ga0501033_0234037 | Ga0501033_0234037_325_936 | 189 |
| 830 | 3300049576 | Ga0501040_0149053 | Ga0501040_0149053_526_1101 | 189 |
| 831 | 3300049579 | Ga0501043_0493959 | Ga0501043_0493959_34_645 | 189 |
| 832 | 3300049580 | Ga0501046_0426917 | Ga0501046_0426917_114_725 | 189 |
| 833 | 3300049581 | Ga0501047_0013443 | Ga0501047_0013443_6822_7433 | 189 |
| 834 | 3300049582 | Ga0501048_0113852 | Ga0501048_0113852_200_775 | 189 |
| 835 | 3300049590 | Ga0501074_0248955 | Ga0501074_0248955_128_703 | 189 |
| 836 | 3300049823 | Ga0501044_0005038 | Ga0501044_0005038_6213_6824 | 189 |
| 837 | 3300049824 | Ga0501045_0077606 | Ga0501045_0077606_858_1433 | 189 |
| 838 | 3300050490 | nmdc:mga03n38_262522_c1 | nmdc:mga03n38_262522_c1_238_813 | 189 |
| 839 | 3300050491 | nmdc:mga00v17_208578_c1 | nmdc:mga00v17_208578_c1_314_970 | 189 |
| 840 | 3300050491 | nmdc:mga00v17_610338_c1 | nmdc:mga00v17_610338_c1_89_661 | 189 |
| 841 | 3300050491 | nmdc:mga00v17_643630_c1 | nmdc:mga00v17_643630_c1_91_666 | 189 |
| 842 | 3300050492 | nmdc:mga0yw44_279131_c1 | nmdc:mga0yw44_279131_c1_59_631 | 189 |
| 843 | 3300050492 | nmdc:mga0yw44_526297_c1 | nmdc:mga0yw44_526297_c1_170_757 | 189 |
| 844 | 3300050494 | nmdc:mga06z11_5003_c1 | nmdc:mga06z11_5003_c1_1227_1814 | 189 |
| 845 | 3300050509 | nmdc:mga0qj67_76368_c1 | nmdc:mga0qj67_76368_c1_348_923 | 189 |
| 846 | 3300053125 | Ga0500618_000285 | Ga0500618_000285_29583_30158 | 189 |
| 847 | 3300053155 | Ga0500620_130632 | Ga0500620_130632_88_663 | 189 |
| 848 | iso_pu_bacteria | 2599185236 | 2599720742 | 189 |
| 849 | iso_pu_bacteria | 2841911363 | 2841916896 | 189 |
| 850 | iso_pu_bacteria | 2841917233 | 2841917600 | 189 |
| 851 | 3300002739 | JGI25158J39367_1000856 | JGI25158J39367_10008565 | 190 |
| 852 | 3300002987 | JGI25159J45721_1002192 | JGI25159J45721_10021924 | 190 |
| 853 | 3300002987 | JGI25159J45721_1013501 | JGI25159J45721_10135012 | 190 |
| 854 | 3300003187 | JGI25151J46595_10000463 | JGI25151J46595_1000046314 | 190 |
| 855 | 3300003187 | JGI25151J46595_10017428 | JGI25151J46595_100174283 | 190 |
| 856 | 3300003187 | JGI25151J46595_10022275 | JGI25151J46595_100222752 | 190 |
| 857 | 3300003187 | JGI25151J46595_10053605 | JGI25151J46595_100536052 | 190 |
| 858 | 3300003187 | JGI25151J46595_10059344 | JGI25151J46595_100593442 | 190 |
| 859 | 3300003214 | JGI25165J46597_1002684 | JGI25165J46597_10026844 | 190 |
| 860 | 3300003215 | JGI25153J46596_10000681 | JGI25153J46596_100006812 | 190 |
| 861 | 3300003215 | JGI25153J46596_10006921 | JGI25153J46596_100069213 | 190 |
| 862 | 3300003215 | JGI25153J46596_10019799 | JGI25153J46596_100197991 | 190 |
| 863 | 3300003215 | JGI25153J46596_10023467 | JGI25153J46596_100234671 | 190 |
| 864 | 3300003215 | JGI25153J46596_10024497 | JGI25153J46596_100244972 | 190 |
| 865 | 3300003316 | rootH1_10031368 | rootH1_100313682 | 190 |
| 866 | 3300003323 | rootH1_10247466 | rootH1_102474662 | 190 |
| 867 | 3300003323 | rootH1_10290538 | rootH1_102905382 | 190 |
| 868 | 3300003354 | JGI25160J50197_1000797 | JGI25160J50197_100079715 | 190 |
| 869 | 3300003354 | JGI25160J50197_1004179 | JGI25160J50197_10041797 | 190 |
| 870 | 3300003374 | JGI25161J50226_1000233 | JGI25161J50226_100023315 | 190 |
| 871 | 3300003374 | JGI25161J50226_1009245 | JGI25161J50226_10092451 | 190 |
| 872 | 3300003578 | Ga0006562J51391_1010713 | Ga0006562J51391_10107133 | 190 |
| 873 | 3300003659 | JGI25404J52841_10005354 | JGI25404J52841_100053542 | 190 |
| 874 | 3300003771 | Ga0055526_1001056 | Ga0055526_100105613 | 190 |
| 875 | 3300003771 | Ga0055526_1004150 | Ga0055526_10041507 | 190 |
| 876 | 3300003771 | Ga0055526_1009661 | Ga0055526_10096612 | 190 |
| 877 | 3300003771 | Ga0055526_1010437 | Ga0055526_10104373 | 190 |
| 878 | 3300003771 | Ga0055526_1036771 | Ga0055526_10367712 | 190 |
| 879 | 3300003771 | Ga0055526_1046453 | Ga0055526_10464531 | 190 |
| 880 | 3300003775 | Ga0055524_1000751 | Ga0055524_100075122 | 190 |
| 881 | 3300003775 | Ga0055524_1004819 | Ga0055524_10048192 | 190 |
| 882 | 3300003775 | Ga0055524_1006307 | Ga0055524_10063072 | 190 |
| 883 | 3300003775 | Ga0055524_1012728 | Ga0055524_10127284 | 190 |
| 884 | 3300003775 | Ga0055524_1014427 | Ga0055524_10144272 | 190 |
| 885 | 3300003775 | Ga0055524_1052904 | Ga0055524_10529041 | 190 |
| 886 | 3300003790 | Ga0055528_1000054 | Ga0055528_100005488 | 190 |
| 887 | 3300003790 | Ga0055528_1000343 | Ga0055528_100034336 | 190 |
| 888 | 3300003790 | Ga0055528_1000764 | Ga0055528_100076414 | 190 |
| 889 | 3300003790 | Ga0055528_1003831 | Ga0055528_10038312 | 190 |
| 890 | 3300003790 | Ga0055528_1010860 | Ga0055528_10108603 | 190 |
| 891 | 3300003790 | Ga0055528_1024968 | Ga0055528_10249682 | 190 |
| 892 | 3300003791 | Ga0055530_10016080 | Ga0055530_100160802 | 190 |
| 893 | 3300003792 | Ga0055540_1000077 | Ga0055540_100007771 | 190 |
| 894 | 3300003792 | Ga0055540_1002166 | Ga0055540_10021665 | 190 |
| 895 | 3300003792 | Ga0055540_1007797 | Ga0055540_10077974 | 190 |
| 896 | 3300003792 | Ga0055540_1030799 | Ga0055540_10307992 | 190 |
| 897 | 3300003794 | Ga0055531_10001197 | Ga0055531_100011971 | 190 |
| 898 | 3300003794 | Ga0055531_10009606 | Ga0055531_100096064 | 190 |
| 899 | 3300003794 | Ga0055531_10049381 | Ga0055531_100493812 | 190 |
| 900 | 3300003856 | Ga0058692_1002629 | Ga0058692_10026295 | 190 |
| 901 | 3300004625 | Ga0055543_1000770 | Ga0055543_100077015 | 190 |
| 902 | 3300004625 | Ga0055543_1001585 | Ga0055543_10015856 | 190 |
| 903 | 3300004625 | Ga0055543_1004072 | Ga0055543_10040723 | 190 |
| 904 | 3300005262 | Ga0065165_1000062 | Ga0065165_100006229 | 190 |
| 905 | 3300005262 | Ga0065165_1000254 | Ga0065165_100025477 | 190 |
| 906 | 3300005262 | Ga0065165_1001892 | Ga0065165_100189212 | 190 |
| 907 | 3300005262 | Ga0065165_1018148 | Ga0065165_10181483 | 190 |
| 908 | 3300005262 | Ga0065165_1036576 | Ga0065165_10365762 | 190 |
| 909 | 3300005295 | Ga0065707_10020470 | Ga0065707_100204701 | 190 |
| 910 | 3300005327 | Ga0070658_10096070 | Ga0070658_100960702 | 190 |
| 911 | 3300005328 | Ga0070676_10131218 | Ga0070676_101312181 | 190 |
| 912 | 3300005330 | Ga0070690_100288724 | Ga0070690_1002887242 | 190 |
| 913 | 3300005331 | Ga0070670_100222172 | Ga0070670_1002221722 | 190 |
| 914 | 3300005334 | Ga0068869_100096373 | Ga0068869_1000963733 | 190 |
| 915 | 3300005334 | Ga0068869_100275493 | Ga0068869_1002754932 | 190 |
| 916 | 3300005334 | Ga0068869_100951250 | Ga0068869_1009512501 | 190 |
| 917 | 3300005336 | Ga0070680_100878964 | Ga0070680_1008789641 | 190 |
| 918 | 3300005337 | Ga0070682_100105754 | Ga0070682_1001057542 | 190 |
| 919 | 3300005338 | Ga0068868_100370495 | Ga0068868_1003704952 | 190 |
| 920 | 3300005339 | Ga0070660_100596084 | Ga0070660_1005960841 | 190 |
| 921 | 3300005344 | Ga0070661_100166232 | Ga0070661_1001662321 | 190 |
| 922 | 3300005344 | Ga0070661_100387547 | Ga0070661_1003875472 | 190 |
| 923 | 3300005347 | Ga0070668_100027793 | Ga0070668_1000277934 | 190 |
| 924 | 3300005347 | Ga0070668_100134154 | Ga0070668_1001341542 | 190 |
| 925 | 3300005347 | Ga0070668_100451299 | Ga0070668_1004512991 | 190 |
| 926 | 3300005347 | Ga0070668_100673554 | Ga0070668_1006735542 | 190 |
| 927 | 3300005353 | Ga0070669_100510440 | Ga0070669_1005104402 | 190 |
| 928 | 3300005355 | Ga0070671_100425483 | Ga0070671_1004254832 | 190 |
| 929 | 3300005355 | Ga0070671_100555232 | Ga0070671_1005552321 | 190 |
| 930 | 3300005355 | Ga0070671_100634209 | Ga0070671_1006342092 | 190 |
| 931 | 3300005356 | Ga0070674_100239932 | Ga0070674_1002399322 | 190 |
| 932 | 3300005364 | Ga0070673_100443570 | Ga0070673_1004435701 | 190 |
| 933 | 3300005364 | Ga0070673_100524575 | Ga0070673_1005245752 | 190 |
| 934 | 3300005366 | Ga0070659_100276800 | Ga0070659_1002768002 | 190 |
| 935 | 3300005366 | Ga0070659_100421550 | Ga0070659_1004215502 | 190 |
| 936 | 3300005367 | Ga0070667_100105184 | Ga0070667_1001051842 | 190 |
| 937 | 3300005440 | Ga0070705_100406545 | Ga0070705_1004065452 | 190 |
| 938 | 3300005441 | Ga0070700_100465060 | Ga0070700_1004650602 | 190 |
| 939 | 3300005444 | Ga0070694_100524386 | Ga0070694_1005243861 | 190 |
| 940 | 3300005445 | Ga0070708_100577764 | Ga0070708_1005777642 | 190 |
| 941 | 3300005455 | Ga0070663_100051087 | Ga0070663_1000510872 | 190 |
| 942 | 3300005455 | Ga0070663_100057161 | Ga0070663_1000571613 | 190 |
| 943 | 3300005455 | Ga0070663_100199903 | Ga0070663_1001999032 | 190 |
| 944 | 3300005456 | Ga0070678_100599044 | Ga0070678_1005990442 | 190 |
| 945 | 3300005456 | Ga0070678_101243152 | Ga0070678_1012431521 | 190 |
| 946 | 3300005457 | Ga0070662_100289137 | Ga0070662_1002891372 | 190 |
| 947 | 3300005457 | Ga0070662_100657402 | Ga0070662_1006574022 | 190 |
| 948 | 3300005459 | Ga0068867_100167283 | Ga0068867_1001672832 | 190 |
| 949 | 3300005466 | Ga0070685_10384864 | Ga0070685_103848642 | 190 |
| 950 | 3300005471 | Ga0070698_100101177 | Ga0070698_1001011773 | 190 |
| 951 | 3300005518 | Ga0070699_100116843 | Ga0070699_1001168433 | 190 |
| 952 | 3300005530 | Ga0070679_100022779 | Ga0070679_1000227796 | 190 |
| 953 | 3300005535 | Ga0070684_100508830 | Ga0070684_1005088302 | 190 |
| 954 | 3300005539 | Ga0068853_100160170 | Ga0068853_1001601702 | 190 |
| 955 | 3300005539 | Ga0068853_100915293 | Ga0068853_1009152932 | 190 |
| 956 | 3300005544 | Ga0070686_100623035 | Ga0070686_1006230351 | 190 |
| 957 | 3300005545 | Ga0070695_100049566 | Ga0070695_1000495663 | 190 |
| 958 | 3300005545 | Ga0070695_100056057 | Ga0070695_1000560572 | 190 |
| 959 | 3300005546 | Ga0070696_100014883 | Ga0070696_1000148832 | 190 |
| 960 | 3300005547 | Ga0070693_100089430 | Ga0070693_1000894302 | 190 |
| 961 | 3300005548 | Ga0070665_100010206 | Ga0070665_1000102062 | 190 |
| 962 | 3300005548 | Ga0070665_100309953 | Ga0070665_1003099532 | 190 |
| 963 | 3300005548 | Ga0070665_100379044 | Ga0070665_1003790442 | 190 |
| 964 | 3300005548 | Ga0070665_100470355 | Ga0070665_1004703552 | 190 |
| 965 | 3300005549 | Ga0070704_100029644 | Ga0070704_1000296443 | 190 |
| 966 | 3300005549 | Ga0070704_100521192 | Ga0070704_1005211921 | 190 |
| 967 | 3300005563 | Ga0068855_100030747 | Ga0068855_1000307473 | 190 |
| 968 | 3300005577 | Ga0068857_100623354 | Ga0068857_1006233542 | 190 |
| 969 | 3300005578 | Ga0068854_100344494 | Ga0068854_1003444942 | 190 |
| 970 | 3300005578 | Ga0068854_100367034 | Ga0068854_1003670341 | 190 |
| 971 | 3300005614 | Ga0068856_101036051 | Ga0068856_1010360512 | 190 |
| 972 | 3300005615 | Ga0070702_100038055 | Ga0070702_1000380553 | 190 |
| 973 | 3300005616 | Ga0068852_100025826 | Ga0068852_1000258262 | 190 |
| 974 | 3300005616 | Ga0068852_100261872 | Ga0068852_1002618722 | 190 |
| 975 | 3300005617 | Ga0068859_100149727 | Ga0068859_1001497272 | 190 |
| 976 | 3300005617 | Ga0068859_100752044 | Ga0068859_1007520442 | 190 |
| 977 | 3300005719 | Ga0068861_100091696 | Ga0068861_1000916962 | 190 |
| 978 | 3300005841 | Ga0068863_100128828 | Ga0068863_1001288282 | 190 |
| 979 | 3300005841 | Ga0068863_100337581 | Ga0068863_1003375812 | 190 |
| 980 | 3300005841 | Ga0068863_100917553 | Ga0068863_1009175531 | 190 |
| 981 | 3300005842 | Ga0068858_101389051 | Ga0068858_1013890511 | 190 |
| 982 | 3300005843 | Ga0068860_100000312 | Ga0068860_10000031232 | 190 |
| 983 | 3300005843 | Ga0068860_100131015 | Ga0068860_1001310152 | 190 |
| 984 | 3300005843 | Ga0068860_100483380 | Ga0068860_1004833802 | 190 |
| 985 | 3300005843 | Ga0068860_100849333 | Ga0068860_1008493332 | 190 |
| 986 | 3300005844 | Ga0068862_100441046 | Ga0068862_1004410462 | 190 |
| 987 | 3300005937 | Ga0081455_10018391 | Ga0081455_100183916 | 190 |
| 988 | 3300005937 | Ga0081455_10072627 | Ga0081455_100726273 | 190 |
| 989 | 3300005983 | Ga0081540_1003077 | Ga0081540_10030776 | 190 |
| 990 | 3300005983 | Ga0081540_1003847 | Ga0081540_100384710 | 190 |
| 991 | 3300005983 | Ga0081540_1015210 | Ga0081540_10152104 | 190 |
| 992 | 3300005985 | Ga0081539_10024214 | Ga0081539_100242143 | 190 |
| 993 | 3300006038 | Ga0075365_10011642 | Ga0075365_100116422 | 190 |
| 994 | 3300006038 | Ga0075365_10016024 | Ga0075365_100160242 | 190 |
| 995 | 3300006038 | Ga0075365_10019199 | Ga0075365_100191993 | 190 |
| 996 | 3300006038 | Ga0075365_10019469 | Ga0075365_100194694 | 190 |
| 997 | 3300006038 | Ga0075365_10077252 | Ga0075365_100772522 | 190 |
| 998 | 3300006038 | Ga0075365_10192833 | Ga0075365_101928332 | 190 |
| 999 | 3300006042 | Ga0075368_10268398 | Ga0075368_102683981 | 190 |
| 1000 | 3300006048 | Ga0075363_100036248 | Ga0075363_1000362482 | 190 |
| 1001 | 3300006048 | Ga0075363_100115464 | Ga0075363_1001154642 | 190 |
| 1002 | 3300006048 | Ga0075363_100189770 | Ga0075363_1001897701 | 190 |
| 1003 | 3300006048 | Ga0075363_100205378 | Ga0075363_1002053782 | 190 |
| 1004 | 3300006048 | Ga0075363_100301451 | Ga0075363_1003014512 | 190 |
| 1005 | 3300006048 | Ga0075363_100332875 | Ga0075363_1003328751 | 190 |
| 1006 | 3300006051 | Ga0075364_10131203 | Ga0075364_101312032 | 190 |
| 1007 | 3300006051 | Ga0075364_10188523 | Ga0075364_101885232 | 190 |
| 1008 | 3300006051 | Ga0075364_10523433 | Ga0075364_105234331 | 190 |
| 1009 | 3300006177 | Ga0075362_10031083 | Ga0075362_100310833 | 190 |
| 1010 | 3300006177 | Ga0075362_10056513 | Ga0075362_100565132 | 190 |
| 1011 | 3300006177 | Ga0075362_10219497 | Ga0075362_102194972 | 190 |
| 1012 | 3300006178 | Ga0075367_10002993 | Ga0075367_100029932 | 190 |
| 1013 | 3300006178 | Ga0075367_10116915 | Ga0075367_101169152 | 190 |
| 1014 | 3300006178 | Ga0075367_10118573 | Ga0075367_101185732 | 190 |
| 1015 | 3300006178 | Ga0075367_10140357 | Ga0075367_101403572 | 190 |
| 1016 | 3300006178 | Ga0075367_10148001 | Ga0075367_101480011 | 190 |
| 1017 | 3300006178 | Ga0075367_10307874 | Ga0075367_103078741 | 190 |
| 1018 | 3300006186 | Ga0075369_10001157 | Ga0075369_100011578 | 190 |
| 1019 | 3300006186 | Ga0075369_10008423 | Ga0075369_100084232 | 190 |
| 1020 | 3300006186 | Ga0075369_10020074 | Ga0075369_100200742 | 190 |
| 1021 | 3300006186 | Ga0075369_10058365 | Ga0075369_100583652 | 190 |
| 1022 | 3300006186 | Ga0075369_10062446 | Ga0075369_100624462 | 190 |
| 1023 | 3300006186 | Ga0075369_10070913 | Ga0075369_100709131 | 190 |
| 1024 | 3300006186 | Ga0075369_10128222 | Ga0075369_101282222 | 190 |
| 1025 | 3300006186 | Ga0075369_10175197 | Ga0075369_101751971 | 190 |
| 1026 | 3300006195 | Ga0075366_10005356 | Ga0075366_100053567 | 190 |
| 1027 | 3300006195 | Ga0075366_10179281 | Ga0075366_101792812 | 190 |
| 1028 | 3300006237 | Ga0097621_100217989 | Ga0097621_1002179892 | 190 |
| 1029 | 3300006237 | Ga0097621_100424722 | Ga0097621_1004247222 | 190 |
| 1030 | 3300006237 | Ga0097621_101089209 | Ga0097621_1010892091 | 190 |
| 1031 | 3300006353 | Ga0075370_10004301 | Ga0075370_100043015 | 190 |
| 1032 | 3300006353 | Ga0075370_10006606 | Ga0075370_100066062 | 190 |
| 1033 | 3300006353 | Ga0075370_10060852 | Ga0075370_100608522 | 190 |
| 1034 | 3300006353 | Ga0075370_10083155 | Ga0075370_100831552 | 190 |
| 1035 | 3300006353 | Ga0075370_10151398 | Ga0075370_101513982 | 190 |
| 1036 | 3300006353 | Ga0075370_10238967 | Ga0075370_102389672 | 190 |
| 1037 | 3300006353 | Ga0075370_10654863 | Ga0075370_106548631 | 190 |
| 1038 | 3300006844 | Ga0075428_100341164 | Ga0075428_1003411642 | 190 |
| 1039 | 3300006844 | Ga0075428_100372345 | Ga0075428_1003723451 | 190 |
| 1040 | 3300006881 | Ga0068865_100188398 | Ga0068865_1001883982 | 190 |
| 1041 | 3300006931 | Ga0097620_100149730 | Ga0097620_1001497302 | 190 |
| 1042 | 3300006931 | Ga0097620_100752115 | Ga0097620_1007521152 | 190 |
| 1043 | 3300006941 | Ga0099825_1027405 | Ga0099825_10274052 | 190 |
| 1044 | 3300006944 | Ga0099823_1018479 | Ga0099823_10184792 | 190 |
| 1045 | 3300006946 | Ga0079104_1010264 | Ga0079104_10102643 | 190 |
| 1046 | 3300006946 | Ga0079104_1013037 | Ga0079104_10130373 | 190 |
| 1047 | 3300006948 | Ga0099826_10000071 | Ga0099826_1000007128 | 190 |
| 1048 | 3300006948 | Ga0099826_10063147 | Ga0099826_100631472 | 190 |
| 1049 | 3300006948 | Ga0099826_10263439 | Ga0099826_102634392 | 190 |
| 1050 | 3300009092 | Ga0105250_10067231 | Ga0105250_100672312 | 190 |
| 1051 | 3300009092 | Ga0105250_10110873 | Ga0105250_101108731 | 190 |
| 1052 | 3300009093 | Ga0105240_10006408 | Ga0105240_1000640811 | 190 |
| 1053 | 3300009093 | Ga0105240_10238268 | Ga0105240_102382682 | 190 |
| 1054 | 3300009093 | Ga0105240_11142676 | Ga0105240_111426762 | 190 |
| 1055 | 3300009098 | Ga0105245_10280154 | Ga0105245_102801542 | 190 |
| 1056 | 3300009098 | Ga0105245_10557569 | Ga0105245_105575692 | 190 |
| 1057 | 3300009098 | Ga0105245_10828231 | Ga0105245_108282311 | 190 |
| 1058 | 3300009101 | Ga0105247_10324831 | Ga0105247_103248312 | 190 |
| 1059 | 3300009147 | Ga0114129_10134378 | Ga0114129_101343782 | 190 |
| 1060 | 3300009148 | Ga0105243_10006759 | Ga0105243_1000675910 | 190 |
| 1061 | 3300009148 | Ga0105243_10081705 | Ga0105243_100817052 | 190 |
| 1062 | 3300009148 | Ga0105243_10479925 | Ga0105243_104799252 | 190 |
| 1063 | 3300009148 | Ga0105243_11085061 | Ga0105243_110850611 | 190 |
| 1064 | 3300009174 | Ga0105241_10197760 | Ga0105241_101977602 | 190 |
| 1065 | 3300009174 | Ga0105241_10906272 | Ga0105241_109062721 | 190 |
| 1066 | 3300009176 | Ga0105242_10152004 | Ga0105242_101520042 | 190 |
| 1067 | 3300009177 | Ga0105248_10077894 | Ga0105248_100778942 | 190 |
| 1068 | 3300009177 | Ga0105248_10769494 | Ga0105248_107694941 | 190 |
| 1069 | 3300009177 | Ga0105248_10832293 | Ga0105248_108322932 | 190 |
| 1070 | 3300009177 | Ga0105248_11853285 | Ga0105248_118532851 | 190 |
| 1071 | 3300009545 | Ga0105237_10030303 | Ga0105237_100303035 | 190 |
| 1072 | 3300009545 | Ga0105237_10061732 | Ga0105237_100617322 | 190 |
| 1073 | 3300009545 | Ga0105237_10260453 | Ga0105237_102604532 | 190 |
| 1074 | 3300009545 | Ga0105237_10340975 | Ga0105237_103409752 | 190 |
| 1075 | 3300009545 | Ga0105237_10860403 | Ga0105237_108604032 | 190 |
| 1076 | 3300009545 | Ga0105237_11071292 | Ga0105237_110712921 | 190 |
| 1077 | 3300009551 | Ga0105238_10261162 | Ga0105238_102611622 | 190 |
| 1078 | 3300009551 | Ga0105238_10922997 | Ga0105238_109229972 | 190 |
| 1079 | 3300009553 | Ga0105249_10001039 | Ga0105249_1000103922 | 190 |
| 1080 | 3300009553 | Ga0105249_10105017 | Ga0105249_101050171 | 190 |
| 1081 | 3300009553 | Ga0105249_10517587 | Ga0105249_105175872 | 190 |
| 1082 | 3300009553 | Ga0105249_10557109 | Ga0105249_105571092 | 190 |
| 1083 | 3300009765 | Ga0123341_1000044 | Ga0123341_100004426 | 190 |
| 1084 | 3300010375 | Ga0105239_10023525 | Ga0105239_100235254 | 190 |
| 1085 | 3300010375 | Ga0105239_10147958 | Ga0105239_101479582 | 190 |
| 1086 | 3300010375 | Ga0105239_10492903 | Ga0105239_104929032 | 190 |
| 1087 | 3300010375 | Ga0105239_10704658 | Ga0105239_107046582 | 190 |
| 1088 | 3300010375 | Ga0105239_10910710 | Ga0105239_109107102 | 190 |
| 1089 | 3300012505 | Ga0157339_1007446 | Ga0157339_10074461 | 190 |
| 1090 | 3300012507 | Ga0157342_1012805 | Ga0157342_10128051 | 190 |
| 1091 | 3300012515 | Ga0157338_1025190 | Ga0157338_10251901 | 190 |
| 1092 | 3300013100 | Ga0157373_10040827 | Ga0157373_100408272 | 190 |
| 1093 | 3300013100 | Ga0157373_10145800 | Ga0157373_101458002 | 190 |
| 1094 | 3300013102 | Ga0157371_10000002 | Ga0157371_10000002533 | 190 |
| 1095 | 3300013102 | Ga0157371_10051710 | Ga0157371_100517103 | 190 |
| 1096 | 3300013104 | Ga0157370_10000211 | Ga0157370_1000021150 | 190 |
| 1097 | 3300013104 | Ga0157370_10421021 | Ga0157370_104210212 | 190 |
| 1098 | 3300013105 | Ga0157369_10238175 | Ga0157369_102381752 | 190 |
| 1099 | 3300013105 | Ga0157369_10270702 | Ga0157369_102707022 | 190 |
| 1100 | 3300013250 | Ga0171462_1009 | Ga0171462_100911 | 190 |
| 1101 | 3300013297 | Ga0157378_10434649 | Ga0157378_104346492 | 190 |
| 1102 | 3300013306 | Ga0163162_11377263 | Ga0163162_113772632 | 190 |
| 1103 | 3300013307 | Ga0157372_10582116 | Ga0157372_105821162 | 190 |
| 1104 | 3300013308 | Ga0157375_10060268 | Ga0157375_100602684 | 190 |
| 1105 | 3300013308 | Ga0157375_10735844 | Ga0157375_107358442 | 190 |
| 1106 | 3300014325 | Ga0163163_10330721 | Ga0163163_103307212 | 190 |
| 1107 | 3300014325 | Ga0163163_10410330 | Ga0163163_104103302 | 190 |
| 1108 | 3300014326 | Ga0157380_11420697 | Ga0157380_114206972 | 190 |
| 1109 | 3300014745 | Ga0157377_10059883 | Ga0157377_100598832 | 190 |
| 1110 | 3300014969 | Ga0157376_10377837 | Ga0157376_103778372 | 190 |
| 1111 | 3300014969 | Ga0157376_10992808 | Ga0157376_109928082 | 190 |
| 1112 | 3300017792 | Ga0163161_10056284 | Ga0163161_100562842 | 190 |
| 1113 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001118 | 190 |
| 1114 | 3300021320 | Ga0214544_1000018 | Ga0214544_1000018178 | 190 |
| 1115 | 3300021321 | Ga0214542_1000005 | Ga0214542_1000005118 | 190 |
| 1116 | 3300021321 | Ga0214542_1000307 | Ga0214542_100030765 | 190 |
| 1117 | 3300021321 | Ga0214542_1015078 | Ga0214542_10150783 | 190 |
| 1118 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003646 | 190 |
| 1119 | 3300021324 | Ga0214545_1035348 | Ga0214545_10353482 | 190 |
| 1120 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002118 | 190 |
| 1121 | 3300021327 | Ga0214543_1000012 | Ga0214543_100001239 | 190 |
| 1122 | 3300021327 | Ga0214543_1000195 | Ga0214543_100019522 | 190 |
| 1123 | 3300022739 | Ga0228711_1002598 | Ga0228711_10025985 | 190 |
| 1124 | 3300022740 | Ga0228710_1002752 | Ga0228710_100275223 | 190 |
| 1125 | 3300025208 | Ga0209436_100007 | Ga0209436_100007107 | 190 |
| 1126 | 3300025230 | Ga0209563_102920 | Ga0209563_1029203 | 190 |
| 1127 | 3300025245 | Ga0207425_1005546 | Ga0207425_10055462 | 190 |
| 1128 | 3300025245 | Ga0207425_1005811 | Ga0207425_10058113 | 190 |
| 1129 | 3300025245 | Ga0207425_1021884 | Ga0207425_10218841 | 190 |
| 1130 | 3300025245 | Ga0207425_1037312 | Ga0207425_10373121 | 190 |
| 1131 | 3300025253 | Ga0209677_103599 | Ga0209677_1035992 | 190 |
| 1132 | 3300025258 | Ga0209129_1001290 | Ga0209129_100129015 | 190 |
| 1133 | 3300025258 | Ga0209129_1001482 | Ga0209129_10014826 | 190 |
| 1134 | 3300025261 | Ga0209233_1000820 | Ga0209233_10008208 | 190 |
| 1135 | 3300025261 | Ga0209233_1020687 | Ga0209233_10206872 | 190 |
| 1136 | 3300025261 | Ga0209233_1052103 | Ga0209233_10521032 | 190 |
| 1137 | 3300025273 | Ga0209673_1000005 | Ga0209673_1000005178 | 190 |
| 1138 | 3300025273 | Ga0209673_1000067 | Ga0209673_1000067144 | 190 |
| 1139 | 3300025273 | Ga0209673_1000294 | Ga0209673_100029472 | 190 |
| 1140 | 3300025273 | Ga0209673_1000968 | Ga0209673_100096825 | 190 |
| 1141 | 3300025273 | Ga0209673_1006587 | Ga0209673_10065874 | 190 |
| 1142 | 3300025273 | Ga0209673_1008320 | Ga0209673_10083204 | 190 |
| 1143 | 3300025273 | Ga0209673_1039849 | Ga0209673_10398492 | 190 |
| 1144 | 3300025284 | Ga0209130_1000001 | Ga0209130_1000001663 | 190 |
| 1145 | 3300025284 | Ga0209130_1000235 | Ga0209130_100023562 | 190 |
| 1146 | 3300025292 | Ga0209676_1014385 | Ga0209676_10143852 | 190 |
| 1147 | 3300025292 | Ga0209676_1022321 | Ga0209676_10223212 | 190 |
| 1148 | 3300025294 | Ga0209025_1000260 | Ga0209025_100026051 | 190 |
| 1149 | 3300025294 | Ga0209025_1001148 | Ga0209025_100114813 | 190 |
| 1150 | 3300025294 | Ga0209025_1002894 | Ga0209025_10028945 | 190 |
| 1151 | 3300025294 | Ga0209025_1011728 | Ga0209025_10117282 | 190 |
| 1152 | 3300025294 | Ga0209025_1015802 | Ga0209025_10158022 | 190 |
| 1153 | 3300025294 | Ga0209025_1047398 | Ga0209025_10473982 | 190 |
| 1154 | 3300025294 | Ga0209025_1062878 | Ga0209025_10628781 | 190 |
| 1155 | 3300025294 | Ga0209025_1085713 | Ga0209025_10857132 | 190 |
| 1156 | 3300025295 | Ga0209564_1000019 | Ga0209564_1000019298 | 190 |
| 1157 | 3300025295 | Ga0209564_1000092 | Ga0209564_1000092144 | 190 |
| 1158 | 3300025295 | Ga0209564_1000336 | Ga0209564_100033638 | 190 |
| 1159 | 3300025295 | Ga0209564_1019591 | Ga0209564_10195913 | 190 |
| 1160 | 3300025295 | Ga0209564_1023165 | Ga0209564_10231652 | 190 |
| 1161 | 3300025295 | Ga0209564_1024220 | Ga0209564_10242202 | 190 |
| 1162 | 3300025295 | Ga0209564_1025025 | Ga0209564_10250252 | 190 |
| 1163 | 3300025295 | Ga0209564_1082394 | Ga0209564_10823941 | 190 |
| 1164 | 3300025297 | Ga0209758_1000026 | Ga0209758_1000026222 | 190 |
| 1165 | 3300025297 | Ga0209758_1000113 | Ga0209758_100011351 | 190 |
| 1166 | 3300025297 | Ga0209758_1000203 | Ga0209758_10002037 | 190 |
| 1167 | 3300025297 | Ga0209758_1001957 | Ga0209758_100195720 | 190 |
| 1168 | 3300025297 | Ga0209758_1005269 | Ga0209758_10052696 | 190 |
| 1169 | 3300025297 | Ga0209758_1016444 | Ga0209758_10164444 | 190 |
| 1170 | 3300025297 | Ga0209758_1021268 | Ga0209758_10212682 | 190 |
| 1171 | 3300025297 | Ga0209758_1024965 | Ga0209758_10249653 | 190 |
| 1172 | 3300025297 | Ga0209758_1025005 | Ga0209758_10250052 | 190 |
| 1173 | 3300025297 | Ga0209758_1027504 | Ga0209758_10275041 | 190 |
| 1174 | 3300025297 | Ga0209758_1032051 | Ga0209758_10320512 | 190 |
| 1175 | 3300025297 | Ga0209758_1050289 | Ga0209758_10502892 | 190 |
| 1176 | 3300025297 | Ga0209758_1090053 | Ga0209758_10900532 | 190 |
| 1177 | 3300025298 | Ga0209050_1006608 | Ga0209050_10066084 | 190 |
| 1178 | 3300025298 | Ga0209050_1007063 | Ga0209050_10070632 | 190 |
| 1179 | 3300025299 | Ga0209256_1000170 | Ga0209256_100017084 | 190 |
| 1180 | 3300025299 | Ga0209256_1000182 | Ga0209256_100018269 | 190 |
| 1181 | 3300025299 | Ga0209256_1000475 | Ga0209256_10004758 | 190 |
| 1182 | 3300025299 | Ga0209256_1001533 | Ga0209256_100153320 | 190 |
| 1183 | 3300025299 | Ga0209256_1002121 | Ga0209256_10021214 | 190 |
| 1184 | 3300025299 | Ga0209256_1011067 | Ga0209256_10110672 | 190 |
| 1185 | 3300025299 | Ga0209256_1028898 | Ga0209256_10288982 | 190 |
| 1186 | 3300025299 | Ga0209256_1037619 | Ga0209256_10376191 | 190 |
| 1187 | 3300025302 | Ga0207426_1000045 | Ga0207426_1000045272 | 190 |
| 1188 | 3300025302 | Ga0207426_1000213 | Ga0207426_100021318 | 190 |
| 1189 | 3300025302 | Ga0207426_1000282 | Ga0207426_100028246 | 190 |
| 1190 | 3300025302 | Ga0207426_1007399 | Ga0207426_10073992 | 190 |
| 1191 | 3300025302 | Ga0207426_1014504 | Ga0207426_10145044 | 190 |
| 1192 | 3300025302 | Ga0207426_1014578 | Ga0207426_10145783 | 190 |
| 1193 | 3300025303 | Ga0209051_1000027 | Ga0209051_1000027266 | 190 |
| 1194 | 3300025303 | Ga0209051_1002417 | Ga0209051_10024176 | 190 |
| 1195 | 3300025303 | Ga0209051_1004473 | Ga0209051_10044736 | 190 |
| 1196 | 3300025303 | Ga0209051_1046772 | Ga0209051_10467722 | 190 |
| 1197 | 3300025303 | Ga0209051_1090810 | Ga0209051_10908101 | 190 |
| 1198 | 3300025304 | Ga0209257_1000691 | Ga0209257_100069130 | 190 |
| 1199 | 3300025304 | Ga0209257_1001012 | Ga0209257_10010128 | 190 |
| 1200 | 3300025304 | Ga0209257_1004723 | Ga0209257_10047233 | 190 |
| 1201 | 3300025304 | Ga0209257_1013830 | Ga0209257_10138304 | 190 |
| 1202 | 3300025304 | Ga0209257_1097072 | Ga0209257_10970721 | 190 |
| 1203 | 3300025315 | Ga0207697_10142880 | Ga0207697_101428801 | 190 |
| 1204 | 3300025321 | Ga0207656_10108821 | Ga0207656_101088212 | 190 |
| 1205 | 3300025900 | Ga0207710_10055505 | Ga0207710_100555052 | 190 |
| 1206 | 3300025901 | Ga0207688_10109504 | Ga0207688_101095042 | 190 |
| 1207 | 3300025901 | Ga0207688_10309236 | Ga0207688_103092361 | 190 |
| 1208 | 3300025903 | Ga0207680_10277081 | Ga0207680_102770812 | 190 |
| 1209 | 3300025904 | Ga0207647_10013465 | Ga0207647_100134653 | 190 |
| 1210 | 3300025909 | Ga0207705_10057184 | Ga0207705_100571842 | 190 |
| 1211 | 3300025911 | Ga0207654_10062106 | Ga0207654_100621062 | 190 |
| 1212 | 3300025911 | Ga0207654_10065549 | Ga0207654_100655492 | 190 |
| 1213 | 3300025911 | Ga0207654_10069120 | Ga0207654_100691202 | 190 |
| 1214 | 3300025911 | Ga0207654_10292045 | Ga0207654_102920451 | 190 |
| 1215 | 3300025912 | Ga0207707_10046761 | Ga0207707_100467614 | 190 |
| 1216 | 3300025913 | Ga0207695_10000006 | Ga0207695_10000006969 | 190 |
| 1217 | 3300025914 | Ga0207671_10014700 | Ga0207671_100147002 | 190 |
| 1218 | 3300025916 | Ga0207663_10593912 | Ga0207663_105939121 | 190 |
| 1219 | 3300025917 | Ga0207660_10036633 | Ga0207660_100366334 | 190 |
| 1220 | 3300025919 | Ga0207657_10113701 | Ga0207657_101137012 | 190 |
| 1221 | 3300025919 | Ga0207657_10379728 | Ga0207657_103797281 | 190 |
| 1222 | 3300025919 | Ga0207657_10430543 | Ga0207657_104305432 | 190 |
| 1223 | 3300025920 | Ga0207649_10141205 | Ga0207649_101412052 | 190 |
| 1224 | 3300025920 | Ga0207649_10249054 | Ga0207649_102490541 | 190 |
| 1225 | 3300025920 | Ga0207649_10842690 | Ga0207649_108426901 | 190 |
| 1226 | 3300025921 | Ga0207652_10023360 | Ga0207652_100233602 | 190 |
| 1227 | 3300025923 | Ga0207681_10068436 | Ga0207681_100684362 | 190 |
| 1228 | 3300025923 | Ga0207681_10498612 | Ga0207681_104986122 | 190 |
| 1229 | 3300025923 | Ga0207681_10554154 | Ga0207681_105541542 | 190 |
| 1230 | 3300025924 | Ga0207694_10164256 | Ga0207694_101642562 | 190 |
| 1231 | 3300025931 | Ga0207644_10192733 | Ga0207644_101927332 | 190 |
| 1232 | 3300025933 | Ga0207706_10024422 | Ga0207706_100244224 | 190 |
| 1233 | 3300025933 | Ga0207706_10057307 | Ga0207706_100573072 | 190 |
| 1234 | 3300025934 | Ga0207686_10082920 | Ga0207686_100829202 | 190 |
| 1235 | 3300025935 | Ga0207709_10068948 | Ga0207709_100689483 | 190 |
| 1236 | 3300025936 | Ga0207670_10347911 | Ga0207670_103479112 | 190 |
| 1237 | 3300025937 | Ga0207669_10033791 | Ga0207669_100337912 | 190 |
| 1238 | 3300025938 | Ga0207704_10027972 | Ga0207704_100279722 | 190 |
| 1239 | 3300025938 | Ga0207704_10514269 | Ga0207704_105142692 | 190 |
| 1240 | 3300025939 | Ga0207665_10256041 | Ga0207665_102560412 | 190 |
| 1241 | 3300025949 | Ga0207667_10164362 | Ga0207667_101643622 | 190 |
| 1242 | 3300025960 | Ga0207651_10046470 | Ga0207651_100464702 | 190 |
| 1243 | 3300025960 | Ga0207651_10528808 | Ga0207651_105288082 | 190 |
| 1244 | 3300025961 | Ga0207712_10002059 | Ga0207712_1000205914 | 190 |
| 1245 | 3300025972 | Ga0207668_10158531 | Ga0207668_101585312 | 190 |
| 1246 | 3300025986 | Ga0207658_10398316 | Ga0207658_103983162 | 190 |
| 1247 | 3300025986 | Ga0207658_10828175 | Ga0207658_108281751 | 190 |
| 1248 | 3300026035 | Ga0207703_10902943 | Ga0207703_109029431 | 190 |
| 1249 | 3300026067 | Ga0207678_10035692 | Ga0207678_100356922 | 190 |
| 1250 | 3300026067 | Ga0207678_10079006 | Ga0207678_100790063 | 190 |
| 1251 | 3300026067 | Ga0207678_10131896 | Ga0207678_101318962 | 190 |
| 1252 | 3300026067 | Ga0207678_10200935 | Ga0207678_102009352 | 190 |
| 1253 | 3300026075 | Ga0207708_10042979 | Ga0207708_100429793 | 190 |
| 1254 | 3300026078 | Ga0207702_10694754 | Ga0207702_106947542 | 190 |
| 1255 | 3300026088 | Ga0207641_10274170 | Ga0207641_102741702 | 190 |
| 1256 | 3300026088 | Ga0207641_10874901 | Ga0207641_108749012 | 190 |
| 1257 | 3300026089 | Ga0207648_10089924 | Ga0207648_100899243 | 190 |
| 1258 | 3300026095 | Ga0207676_10876357 | Ga0207676_108763571 | 190 |
| 1259 | 3300026116 | Ga0207674_10031489 | Ga0207674_100314892 | 190 |
| 1260 | 3300026116 | Ga0207674_10046886 | Ga0207674_100468862 | 190 |
| 1261 | 3300026118 | Ga0207675_100196543 | Ga0207675_1001965432 | 190 |
| 1262 | 3300026118 | Ga0207675_100222835 | Ga0207675_1002228352 | 190 |
| 1263 | 3300026118 | Ga0207675_100336881 | Ga0207675_1003368812 | 190 |
| 1264 | 3300027111 | Ga0209281_1000655 | Ga0209281_10006553 | 190 |
| 1265 | 3300027111 | Ga0209281_1000805 | Ga0209281_100080525 | 190 |
| 1266 | 3300027296 | Ga0209389_1000140 | Ga0209389_100014019 | 190 |
| 1267 | 3300027312 | Ga0209371_1000012 | Ga0209371_1000012282 | 190 |
| 1268 | 3300027312 | Ga0209371_1000472 | Ga0209371_100047224 | 190 |
| 1269 | 3300027312 | Ga0209371_1001239 | Ga0209371_10012393 | 190 |
| 1270 | 3300027361 | Ga0209489_100775 | Ga0209489_10077519 | 190 |
| 1271 | 3300027363 | Ga0209700_100798 | Ga0209700_10079852 | 190 |
| 1272 | 3300027666 | Ga0209282_1000038 | Ga0209282_1000038115 | 190 |
| 1273 | 3300027666 | Ga0209282_1000323 | Ga0209282_100032318 | 190 |
| 1274 | 3300027666 | Ga0209282_1051722 | Ga0209282_10517222 | 190 |
| 1275 | 3300027866 | Ga0209813_10124828 | Ga0209813_101248282 | 190 |
| 1276 | 3300028379 | Ga0268266_10001288 | Ga0268266_100012882 | 190 |
| 1277 | 3300028379 | Ga0268266_10029665 | Ga0268266_100296654 | 190 |
| 1278 | 3300028379 | Ga0268266_10089824 | Ga0268266_100898243 | 190 |
| 1279 | 3300028379 | Ga0268266_10171474 | Ga0268266_101714742 | 190 |
| 1280 | 3300028379 | Ga0268266_10330020 | Ga0268266_103300202 | 190 |
| 1281 | 3300028379 | Ga0268266_10598029 | Ga0268266_105980291 | 190 |
| 1282 | 3300028379 | Ga0268266_10858996 | Ga0268266_108589962 | 190 |
| 1283 | 3300028380 | Ga0268265_10805015 | Ga0268265_108050152 | 190 |
| 1284 | 3300028381 | Ga0268264_10000030 | Ga0268264_1000003030 | 190 |
| 1285 | 3300028786 | Ga0307517_10000392 | Ga0307517_1000039240 | 190 |
| 1286 | 3300028786 | Ga0307517_10352816 | Ga0307517_103528161 | 190 |
| 1287 | 3300028794 | Ga0307515_10010751 | Ga0307515_100107512 | 190 |
| 1288 | 3300028794 | Ga0307515_10099536 | Ga0307515_100995362 | 190 |
| 1289 | 3300028794 | Ga0307515_10397974 | Ga0307515_103979742 | 190 |
| 1290 | 3300030500 | Ga0268256_1000013 | Ga0268256_1000013282 | 190 |
| 1291 | 3300030500 | Ga0268256_1004420 | Ga0268256_10044206 | 190 |
| 1292 | 3300030521 | Ga0307511_10077584 | Ga0307511_100775842 | 190 |
| 1293 | 3300031456 | Ga0307513_10001322 | Ga0307513_1000132217 | 190 |
| 1294 | 3300031507 | Ga0307509_10005540 | Ga0307509_100055402 | 190 |
| 1295 | 3300031507 | Ga0307509_10119947 | Ga0307509_101199472 | 190 |
| 1296 | 3300031548 | Ga0307408_100237788 | Ga0307408_1002377882 | 190 |
| 1297 | 3300031616 | Ga0307508_10000051 | Ga0307508_10000051115 | 190 |
| 1298 | 3300031616 | Ga0307508_10060988 | Ga0307508_100609884 | 190 |
| 1299 | 3300031616 | Ga0307508_10097443 | Ga0307508_100974433 | 190 |
| 1300 | 3300031730 | Ga0307516_10003513 | Ga0307516_100035133 | 190 |
| 1301 | 3300031730 | Ga0307516_10037984 | Ga0307516_100379842 | 190 |
| 1302 | 3300031730 | Ga0307516_10275574 | Ga0307516_102755742 | 190 |
| 1303 | 3300031824 | Ga0307413_10183716 | Ga0307413_101837162 | 190 |
| 1304 | 3300031901 | Ga0307406_10378326 | Ga0307406_103783261 | 190 |
| 1305 | 3300031901 | Ga0307406_10418996 | Ga0307406_104189961 | 190 |
| 1306 | 3300031967 | Ga0315914_1002543 | Ga0315914_10025435 | 190 |
| 1307 | 3300031995 | Ga0307409_100199817 | Ga0307409_1001998172 | 190 |
| 1308 | 3300031995 | Ga0307409_100632366 | Ga0307409_1006323662 | 190 |
| 1309 | 3300032004 | Ga0307414_10994044 | Ga0307414_109940441 | 190 |
| 1310 | 3300032005 | Ga0307411_10402263 | Ga0307411_104022632 | 190 |
| 1311 | 3300032005 | Ga0307411_10408919 | Ga0307411_104089192 | 190 |
| 1312 | 3300032005 | Ga0307411_10738894 | Ga0307411_107388941 | 190 |
| 1313 | 3300032126 | Ga0307415_100240560 | Ga0307415_1002405602 | 190 |
| 1314 | 3300032126 | Ga0307415_100720003 | Ga0307415_1007200032 | 190 |
| 1315 | 3300033180 | Ga0307510_10008010 | Ga0307510_100080108 | 190 |
| 1316 | 3300033180 | Ga0307510_10009232 | Ga0307510_100092329 | 190 |
| 1317 | 3300033430 | Ga0315913_1001156 | Ga0315913_10011565 | 190 |
| 1318 | 3300033464 | Ga0315915_1000018 | Ga0315915_1000018115 | 190 |
| 1319 | 3300035083 | Ga0373926_0031892 | Ga0373926_0031892_361_939 | 190 |
| 1320 | 3300035111 | Ga0373923_0038193 | Ga0373923_0038193_971_1549 | 190 |
| 1321 | 3300035692 | Ga0373935_0015285 | Ga0373935_0015285_542_1120 | 190 |
| 1322 | 3300035724 | Ga0373933_0316103 | Ga0373933_0316103_424_1002 | 190 |
| 1323 | 3300038705 | Ga0237819_07783 | Ga0237819_07783_506_1084 | 190 |
| 1324 | 3300041406 | Ga0439439_0082230 | Ga0439439_0082230_100_672 | 190 |
| 1325 | 3300041413 | Ga0439465_0012279 | Ga0439465_0012279_1884_2456 | 190 |
| 1326 | 3300041413 | Ga0439465_0014651 | Ga0439465_0014651_700_1272 | 190 |
| 1327 | 3300041413 | Ga0439465_0017784 | Ga0439465_0017784_851_1468 | 190 |
| 1328 | 3300041443 | Ga0451789_1320373 | Ga0451789_1320373_163_735 | 190 |
| 1329 | 3300041452 | Ga0451793_0833877 | Ga0451793_0833877_464_1042 | 190 |
| 1330 | 3300041492 | Ga0451835_0294912 | Ga0451835_0294912_1335_1907 | 190 |
| 1331 | 3300041492 | Ga0451835_0715463 | Ga0451835_0715463_18_590 | 190 |
| 1332 | 3300041494 | Ga0451837_0008034 | Ga0451837_0008034_20_592 | 190 |
| 1333 | 3300041496 | Ga0451839_0155811 | Ga0451839_0155811_101_679 | 190 |
| 1334 | 3300041496 | Ga0451839_0966459 | Ga0451839_0966459_94_666 | 190 |
| 1335 | 3300041498 | Ga0451841_1205379 | Ga0451841_1205379_50_622 | 190 |
| 1336 | 3300041503 | Ga0451847_0701608 | Ga0451847_0701608_254_826 | 190 |
| 1337 | 3300041505 | Ga0451849_0541387 | Ga0451849_0541387_681_1253 | 190 |
| 1338 | 3300041505 | Ga0451849_0570312 | Ga0451849_0570312_60_638 | 190 |
| 1339 | 3300041505 | Ga0451849_0658622 | Ga0451849_0658622_97_675 | 190 |
| 1340 | 3300041505 | Ga0451849_0739266 | Ga0451849_0739266_32_604 | 190 |
| 1341 | 3300041507 | Ga0451851_0833168 | Ga0451851_0833168_785_1357 | 190 |
| 1342 | 3300041512 | Ga0451853_0671269 | Ga0451853_0671269_190_762 | 190 |
| 1343 | 3300041512 | Ga0451853_2803001 | Ga0451853_2803001_18_590 | 190 |
| 1344 | 3300042004 | Ga0439445_0167846 | Ga0439445_0167846_36_608 | 190 |
| 1345 | 3300042006 | Ga0439432_014871 | Ga0439432_014871_1294_1866 | 190 |
| 1346 | 3300042006 | Ga0439432_027227 | Ga0439432_027227_174_746 | 190 |
| 1347 | 3300042007 | Ga0439449_0007729 | Ga0439449_0007729_1298_1870 | 190 |
| 1348 | 3300042007 | Ga0439449_0026273 | Ga0439449_0026273_1471_2043 | 190 |
| 1349 | 3300042015 | Ga0439462_0022361 | Ga0439462_0022361_82_711 | 190 |
| 1350 | 3300042015 | Ga0439462_0064861 | Ga0439462_0064861_235_807 | 190 |
| 1351 | 3300042122 | Ga0450920_053273 | Ga0450920_053273_61_633 | 190 |
| 1352 | 3300042435 | Ga0439434_0020910 | Ga0439434_0020910_569_1186 | 190 |
| 1353 | 3300042438 | Ga0439459_0009683 | Ga0439459_0009683_915_1493 | 190 |
| 1354 | 3300042531 | Ga0450918_002564 | Ga0450918_002564_1506_2123 | 190 |
| 1355 | 3300044656 | Ga0466969_0086893 | Ga0466969_0086893_225_803 | 190 |
| 1356 | 3300044658 | Ga0466972_0033010 | Ga0466972_0033010_1358_1936 | 190 |
| 1357 | 3300044658 | Ga0466972_0087033 | Ga0466972_0087033_471_1049 | 190 |
| 1358 | 3300044683 | Ga0466965_0137957 | Ga0466965_0137957_98_676 | 190 |
| 1359 | 3300044684 | Ga0466966_0000610 | Ga0466966_0000610_21447_22025 | 190 |
| 1360 | 3300044693 | Ga0466961_0000124 | Ga0466961_0000124_1391_1969 | 190 |
| 1361 | 3300044706 | Ga0466964_0267288 | Ga0466964_0267288_21_599 | 190 |
| 1362 | 3300044735 | Ga0466968_0051502 | Ga0466968_0051502_763_1341 | 190 |
| 1363 | 3300045049 | Ga0466959_0061235 | Ga0466959_0061235_1208_1786 | 190 |
| 1364 | 3300046452 | Ga0495617_009312 | Ga0495617_009312_1448_2026 | 190 |
| 1365 | 3300046452 | Ga0495617_092591 | Ga0495617_092591_369_941 | 190 |
| 1366 | 3300046454 | Ga0495592_0414968 | Ga0495592_0414968_157_735 | 190 |
| 1367 | 3300046455 | Ga0495603_0007138 | Ga0495603_0007138_864_1442 | 190 |
| 1368 | 3300046455 | Ga0495603_0024002 | Ga0495603_0024002_2896_3474 | 190 |
| 1369 | 3300046457 | Ga0495590_0130245 | Ga0495590_0130245_75_653 | 190 |
| 1370 | 3300046459 | Ga0495629_0026056 | Ga0495629_0026056_988_1566 | 190 |
| 1371 | 3300046460 | Ga0495638_0000475 | Ga0495638_0000475_19235_19807 | 190 |
| 1372 | 3300046460 | Ga0495638_0005749 | Ga0495638_0005749_996_1574 | 190 |
| 1373 | 3300046460 | Ga0495638_0052465 | Ga0495638_0052465_1184_1756 | 190 |
| 1374 | 3300046460 | Ga0495638_0160086 | Ga0495638_0160086_237_815 | 190 |
| 1375 | 3300046462 | Ga0495651_0032791 | Ga0495651_0032791_2717_3295 | 190 |
| 1376 | 3300046462 | Ga0495651_0124663 | Ga0495651_0124663_377_955 | 190 |
| 1377 | 3300046463 | Ga0495653_0205731 | Ga0495653_0205731_189_767 | 190 |
| 1378 | 3300046471 | Ga0495650_0095026 | Ga0495650_0095026_446_1018 | 190 |
| 1379 | 3300046471 | Ga0495650_0164761 | Ga0495650_0164761_26_604 | 190 |
| 1380 | 3300046474 | Ga0495605_0003451 | Ga0495605_0003451_486_1112 | 190 |
| 1381 | 3300046474 | Ga0495605_0099694 | Ga0495605_0099694_599_1177 | 190 |
| 1382 | 3300046477 | Ga0495664_0080043 | Ga0495664_0080043_1317_1895 | 190 |
| 1383 | 3300046492 | Ga0495585_0043282 | Ga0495585_0043282_1254_1826 | 190 |
| 1384 | 3300046492 | Ga0495585_0047449 | Ga0495585_0047449_1027_1653 | 190 |
| 1385 | 3300046499 | Ga0495594_0113865 | Ga0495594_0113865_336_914 | 190 |
| 1386 | 3300046501 | Ga0495607_0014846 | Ga0495607_0014846_2025_2597 | 190 |
| 1387 | 3300046506 | Ga0495583_0030954 | Ga0495583_0030954_1652_2287 | 190 |
| 1388 | 3300046506 | Ga0495583_0070141 | Ga0495583_0070141_697_1269 | 190 |
| 1389 | 3300046507 | Ga0495606_0093908 | Ga0495606_0093908_22_594 | 190 |
| 1390 | 3300046507 | Ga0495606_0193121 | Ga0495606_0193121_548_1120 | 190 |
| 1391 | 3300046507 | Ga0495606_0308698 | Ga0495606_0308698_219_797 | 190 |
| 1392 | 3300046511 | Ga0495608_0246503 | Ga0495608_0246503_231_809 | 190 |
| 1393 | 3300046512 | Ga0495610_0035010 | Ga0495610_0035010_1107_1679 | 190 |
| 1394 | 3300046513 | Ga0495616_0009361 | Ga0495616_0009361_1482_2108 | 190 |
| 1395 | 3300046513 | Ga0495616_0113891 | Ga0495616_0113891_13_591 | 190 |
| 1396 | 3300046515 | Ga0495620_0011838 | Ga0495620_0011838_1513_2085 | 190 |
| 1397 | 3300046515 | Ga0495620_0102183 | Ga0495620_0102183_400_978 | 190 |
| 1398 | 3300046516 | Ga0495628_0458413 | Ga0495628_0458413_272_850 | 190 |
| 1399 | 3300046516 | Ga0495628_0750170 | Ga0495628_0750170_28_606 | 190 |
| 1400 | 3300046518 | Ga0495631_0012439 | Ga0495631_0012439_1454_2080 | 190 |
| 1401 | 3300046518 | Ga0495631_0082092 | Ga0495631_0082092_391_963 | 190 |
| 1402 | 3300046518 | Ga0495631_0143918 | Ga0495631_0143918_423_1001 | 190 |
| 1403 | 3300046519 | Ga0495632_0021912 | Ga0495632_0021912_332_910 | 190 |
| 1404 | 3300046519 | Ga0495632_0042216 | Ga0495632_0042216_632_1204 | 190 |
| 1405 | 3300046519 | Ga0495632_0068598 | Ga0495632_0068598_493_1119 | 190 |
| 1406 | 3300046519 | Ga0495632_0219567 | Ga0495632_0219567_200_778 | 190 |
| 1407 | 3300046519 | Ga0495632_0321702 | Ga0495632_0321702_36_671 | 190 |
| 1408 | 3300046522 | Ga0495643_0026331 | Ga0495643_0026331_326_904 | 190 |
| 1409 | 3300046522 | Ga0495643_0104346 | Ga0495643_0104346_12_590 | 190 |
| 1410 | 3300046522 | Ga0495643_0112480 | Ga0495643_0112480_701_1327 | 190 |
| 1411 | 3300046522 | Ga0495643_0193244 | Ga0495643_0193244_48_620 | 190 |
| 1412 | 3300046523 | Ga0495644_0068026 | Ga0495644_0068026_131_709 | 190 |
| 1413 | 3300046524 | Ga0495648_0028240 | Ga0495648_0028240_2972_3550 | 190 |
| 1414 | 3300046524 | Ga0495648_0041644 | Ga0495648_0041644_397_975 | 190 |
| 1415 | 3300046524 | Ga0495648_0043160 | Ga0495648_0043160_746_1318 | 190 |
| 1416 | 3300046524 | Ga0495648_0093652 | Ga0495648_0093652_1020_1646 | 190 |
| 1417 | 3300046525 | Ga0495663_0040163 | Ga0495663_0040163_67_639 | 190 |
| 1418 | 3300046526 | Ga0495666_0039895 | Ga0495666_0039895_1389_1967 | 190 |
| 1419 | 3300046530 | Ga0495654_0000122 | Ga0495654_0000122_86051_86689 | 190 |
| 1420 | 3300046530 | Ga0495654_0089343 | Ga0495654_0089343_421_993 | 190 |
| 1421 | 3300046533 | Ga0495640_0007377 | Ga0495640_0007377_1739_2317 | 190 |
| 1422 | 3300046537 | Ga0495598_0022520 | Ga0495598_0022520_857_1435 | 190 |
| 1423 | 3300046538 | Ga0495609_0029333 | Ga0495609_0029333_1066_1644 | 190 |
| 1424 | 3300046538 | Ga0495609_0138545 | Ga0495609_0138545_340_966 | 190 |
| 1425 | 3300046538 | Ga0495609_0180022 | Ga0495609_0180022_233_805 | 190 |
| 1426 | 3300046542 | Ga0495597_0061568 | Ga0495597_0061568_602_1174 | 190 |
| 1427 | 3300046542 | Ga0495597_0081875 | Ga0495597_0081875_41_619 | 190 |
| 1428 | 3300046542 | Ga0495597_0176732 | Ga0495597_0176732_216_794 | 190 |
| 1429 | 3300046558 | Ga0495633_0016222 | Ga0495633_0016222_755_1327 | 190 |
| 1430 | 3300046558 | Ga0495633_0134140 | Ga0495633_0134140_528_1106 | 190 |
| 1431 | 3300046558 | Ga0495633_0142925 | Ga0495633_0142925_386_958 | 190 |
| 1432 | 3300046558 | Ga0495633_0177625 | Ga0495633_0177625_311_889 | 190 |
| 1433 | 3300046615 | Ga0495656_0116356 | Ga0495656_0116356_139_717 | 190 |
| 1434 | 3300046616 | Ga0495668_0006686 | Ga0495668_0006686_2492_3118 | 190 |
| 1435 | 3300046616 | Ga0495668_0019058 | Ga0495668_0019058_2720_3298 | 190 |
| 1436 | 3300046616 | Ga0495668_0238381 | Ga0495668_0238381_253_831 | 190 |
| 1437 | 3300046648 | Ga0495611_0089472 | Ga0495611_0089472_104_676 | 190 |
| 1438 | 3300046648 | Ga0495611_0130673 | Ga0495611_0130673_409_987 | 190 |
| 1439 | 3300046648 | Ga0495611_0211511 | Ga0495611_0211511_151_729 | 190 |
| 1440 | 3300046660 | Ga0495625_0011467 | Ga0495625_0011467_2696_3322 | 190 |
| 1441 | 3300046660 | Ga0495625_0085040 | Ga0495625_0085040_232_804 | 190 |
| 1442 | 3300046660 | Ga0495625_0134998 | Ga0495625_0134998_787_1359 | 190 |
| 1443 | 3300046660 | Ga0495625_0157846 | Ga0495625_0157846_839_1417 | 190 |
| 1444 | 3300046660 | Ga0495625_0567067 | Ga0495625_0567067_98_670 | 190 |
| 1445 | 3300046663 | Ga0495635_0004183 | Ga0495635_0004183_701_1279 | 190 |
| 1446 | 3300046664 | Ga0495659_0102406 | Ga0495659_0102406_84_662 | 190 |
| 1447 | 3300046665 | Ga0495661_0062750 | Ga0495661_0062750_46_624 | 190 |
| 1448 | 3300046665 | Ga0495661_0118040 | Ga0495661_0118040_740_1312 | 190 |
| 1449 | 3300046674 | Ga0495588_0009969 | Ga0495588_0009969_3639_4217 | 190 |
| 1450 | 3300046674 | Ga0495588_0135215 | Ga0495588_0135215_370_948 | 190 |
| 1451 | 3300046679 | Ga0495623_0229800 | Ga0495623_0229800_203_781 | 190 |
| 1452 | 3300046683 | Ga0495658_0320330 | Ga0495658_0320330_76_654 | 190 |
| 1453 | 3300046684 | Ga0495669_0082174 | Ga0495669_0082174_441_1031 | 190 |
| 1454 | 3300046689 | Ga0495613_0139892 | Ga0495613_0139892_827_1405 | 190 |
| 1455 | 3300046690 | Ga0495624_0220545 | Ga0495624_0220545_102_680 | 190 |
| 1456 | 3300046690 | Ga0495624_0273426 | Ga0495624_0273426_109_687 | 190 |
| 1457 | 3300046691 | Ga0495670_0070486 | Ga0495670_0070486_29_655 | 190 |
| 1458 | 3300046692 | Ga0495671_0053020 | Ga0495671_0053020_1363_1935 | 190 |
| 1459 | 3300046692 | Ga0495671_0069331 | Ga0495671_0069331_788_1366 | 190 |
| 1460 | 3300046694 | Ga0495649_0201636 | Ga0495649_0201636_211_783 | 190 |
| 1461 | 3300046809 | Ga0495600_0005392 | Ga0495600_0005392_4730_5308 | 190 |
| 1462 | 3300046809 | Ga0495600_0621838 | Ga0495600_0621838_61_639 | 190 |
| 1463 | 3300046810 | Ga0495660_0022531 | Ga0495660_0022531_1924_2496 | 190 |
| 1464 | 3300047315 | Ga0495581_0282479 | Ga0495581_0282479_302_880 | 190 |
| 1465 | 3300047317 | Ga0495604_0017983 | Ga0495604_0017983_3062_3640 | 190 |
| 1466 | 3300047317 | Ga0495604_0633633 | Ga0495604_0633633_85_663 | 190 |
| 1467 | 3300047318 | Ga0495636_0050396 | Ga0495636_0050396_1077_1703 | 190 |
| 1468 | 3300047318 | Ga0495636_0112417 | Ga0495636_0112417_167_739 | 190 |
| 1469 | 3300047318 | Ga0495636_0135577 | Ga0495636_0135577_105_704 | 190 |
| 1470 | 3300047319 | Ga0495674_0607347 | Ga0495674_0607347_70_648 | 190 |
| 1471 | 3300047321 | Ga0495676_0056474 | Ga0495676_0056474_73_651 | 190 |
| 1472 | 3300047323 | Ga0495683_0083541 | Ga0495683_0083541_917_1489 | 190 |
| 1473 | 3300047323 | Ga0495683_0210562 | Ga0495683_0210562_133_711 | 190 |
| 1474 | 3300047443 | Ga0495687_008590 | Ga0495687_008590_2287_2865 | 190 |
| 1475 | 3300047445 | Ga0495677_0173425 | Ga0495677_0173425_71_649 | 190 |
| 1476 | 3300047469 | Ga0495673_0058242 | Ga0495673_0058242_775_1353 | 190 |
| 1477 | 3300047470 | Ga0495681_0053412 | Ga0495681_0053412_929_1501 | 190 |
| 1478 | 3300047470 | Ga0495681_0147187 | Ga0495681_0147187_380_958 | 190 |
| 1479 | 3300047470 | Ga0495681_0238557 | Ga0495681_0238557_134_712 | 190 |
| 1480 | 3300047471 | Ga0495684_0392864 | Ga0495684_0392864_91_669 | 190 |
| 1481 | 3300047472 | Ga0495686_0148562 | Ga0495686_0148562_48_620 | 190 |
| 1482 | 3300047673 | Ga0495593_0127556 | Ga0495593_0127556_609_1187 | 190 |
| 1483 | 3300048090 | Ga0495615_0024434 | Ga0495615_0024434_476_1048 | 190 |
| 1484 | 3300048090 | Ga0495615_0054486 | Ga0495615_0054486_430_1008 | 190 |
| 1485 | 3300048091 | Ga0495626_0070685 | Ga0495626_0070685_566_1138 | 190 |
| 1486 | 3300048091 | Ga0495626_0124031 | Ga0495626_0124031_26_604 | 190 |
| 1487 | 3300048903 | Ga0496100_0250714 | Ga0496100_0250714_36_614 | 190 |
| 1488 | 3300048904 | Ga0496101_0453909 | Ga0496101_0453909_356_937 | 190 |
| 1489 | 3300048905 | Ga0496102_0179347 | Ga0496102_0179347_1360_1938 | 190 |
| 1490 | 3300048905 | Ga0496102_0210896 | Ga0496102_0210896_379_957 | 190 |
| 1491 | 3300048905 | Ga0496102_0261022 | Ga0496102_0261022_106_684 | 190 |
| 1492 | 3300048906 | Ga0496103_0033739 | Ga0496103_0033739_2538_3116 | 190 |
| 1493 | 3300048907 | Ga0496104_0065692 | Ga0496104_0065692_1999_2577 | 190 |
| 1494 | 3300048907 | Ga0496104_0089310 | Ga0496104_0089310_2306_2884 | 190 |
| 1495 | 3300048907 | Ga0496104_0366715 | Ga0496104_0366715_228_806 | 190 |
| 1496 | 3300048907 | Ga0496104_0371974 | Ga0496104_0371974_537_1115 | 190 |
| 1497 | 3300048907 | Ga0496104_0415966 | Ga0496104_0415966_244_822 | 190 |
| 1498 | 3300048907 | Ga0496104_0542953 | Ga0496104_0542953_403_981 | 190 |
| 1499 | 3300048908 | Ga0496105_0228114 | Ga0496105_0228114_753_1331 | 190 |
| 1500 | 3300048908 | Ga0496105_0252150 | Ga0496105_0252150_472_1050 | 190 |
| 1501 | 3300048909 | Ga0496106_0000355 | Ga0496106_0000355_25778_26350 | 190 |
| 1502 | 3300048909 | Ga0496106_0000765 | Ga0496106_0000765_456_1034 | 190 |
| 1503 | 3300048909 | Ga0496106_0361939 | Ga0496106_0361939_38_610 | 190 |
| 1504 | 3300048909 | Ga0496106_1054562 | Ga0496106_1054562_48_626 | 190 |
| 1505 | 3300048910 | Ga0496107_0193401 | Ga0496107_0193401_454_1026 | 190 |
| 1506 | 3300048910 | Ga0496107_0205141 | Ga0496107_0205141_853_1431 | 190 |
| 1507 | 3300048910 | Ga0496107_0467417 | Ga0496107_0467417_92_670 | 190 |
| 1508 | 3300048910 | Ga0496107_0703893 | Ga0496107_0703893_51_629 | 190 |
| 1509 | 3300048911 | Ga0496108_0168853 | Ga0496108_0168853_408_986 | 190 |
| 1510 | 3300048912 | Ga0496109_0304420 | Ga0496109_0304420_899_1477 | 190 |
| 1511 | 3300048913 | Ga0496110_0543292 | Ga0496110_0543292_199_777 | 190 |
| 1512 | 3300048913 | Ga0496110_1134035 | Ga0496110_1134035_35_613 | 190 |
| 1513 | 3300048914 | Ga0496111_0301663 | Ga0496111_0301663_522_1100 | 190 |
| 1514 | 3300048915 | Ga0496112_0038171 | Ga0496112_0038171_3904_4482 | 190 |
| 1515 | 3300048915 | Ga0496112_0081591 | Ga0496112_0081591_2019_2597 | 190 |
| 1516 | 3300048915 | Ga0496112_0242117 | Ga0496112_0242117_850_1428 | 190 |
| 1517 | 3300048916 | Ga0496113_0079333 | Ga0496113_0079333_1143_1715 | 190 |
| 1518 | 3300048917 | Ga0496114_0074011 | Ga0496114_0074011_836_1420 | 190 |
| 1519 | 3300048917 | Ga0496114_0347666 | Ga0496114_0347666_338_916 | 190 |
| 1520 | 3300048917 | Ga0496114_0352134 | Ga0496114_0352134_32_610 | 190 |
| 1521 | 3300048917 | Ga0496114_0438122 | Ga0496114_0438122_257_835 | 190 |
| 1522 | 3300048917 | Ga0496114_1011355 | Ga0496114_1011355_34_612 | 190 |
| 1523 | 3300048918 | Ga0496115_0140404 | Ga0496115_0140404_1267_1845 | 190 |
| 1524 | 3300048918 | Ga0496115_0181795 | Ga0496115_0181795_1126_1704 | 190 |
| 1525 | 3300048918 | Ga0496115_0347057 | Ga0496115_0347057_299_877 | 190 |
| 1526 | 3300048918 | Ga0496115_0557753 | Ga0496115_0557753_16_594 | 190 |
| 1527 | 3300048919 | Ga0496116_0000243 | Ga0496116_0000243_62339_62914 | 190 |
| 1528 | 3300048919 | Ga0496116_0035198 | Ga0496116_0035198_1092_1664 | 190 |
| 1529 | 3300048919 | Ga0496116_0098206 | Ga0496116_0098206_931_1503 | 190 |
| 1530 | 3300048919 | Ga0496116_0146092 | Ga0496116_0146092_329_901 | 190 |
| 1531 | 3300048919 | Ga0496116_0180012 | Ga0496116_0180012_192_770 | 190 |
| 1532 | 3300048920 | Ga0496117_0000016 | Ga0496117_0000016_429489_430061 | 190 |
| 1533 | 3300048920 | Ga0496117_0250894 | Ga0496117_0250894_246_818 | 190 |
| 1534 | 3300048920 | Ga0496117_0312662 | Ga0496117_0312662_19_597 | 190 |
| 1535 | 3300048921 | Ga0496118_0000618 | Ga0496118_0000618_41306_41884 | 190 |
| 1536 | 3300048921 | Ga0496118_0000758 | Ga0496118_0000758_12049_12621 | 190 |
| 1537 | 3300048921 | Ga0496118_0018278 | Ga0496118_0018278_4466_5038 | 190 |
| 1538 | 3300048921 | Ga0496118_0062355 | Ga0496118_0062355_130_702 | 190 |
| 1539 | 3300048921 | Ga0496118_0086264 | Ga0496118_0086264_504_1079 | 190 |
| 1540 | 3300048921 | Ga0496118_0290398 | Ga0496118_0290398_268_846 | 190 |
| 1541 | 3300048922 | Ga0496119_0020692 | Ga0496119_0020692_818_1396 | 190 |
| 1542 | 3300048922 | Ga0496119_0039638 | Ga0496119_0039638_1103_1675 | 190 |
| 1543 | 3300048922 | Ga0496119_0047807 | Ga0496119_0047807_870_1442 | 190 |
| 1544 | 3300048922 | Ga0496119_0330102 | Ga0496119_0330102_11_586 | 190 |
| 1545 | 3300048923 | Ga0496120_0000056 | Ga0496120_0000056_118466_119038 | 190 |
| 1546 | 3300048923 | Ga0496120_0168459 | Ga0496120_0168459_459_1031 | 190 |
| 1547 | 3300048924 | Ga0496121_0000212 | Ga0496121_0000212_59330_59908 | 190 |
| 1548 | 3300048924 | Ga0496121_0010821 | Ga0496121_0010821_3506_4078 | 190 |
| 1549 | 3300048924 | Ga0496121_0025866 | Ga0496121_0025866_3857_4435 | 190 |
| 1550 | 3300048924 | Ga0496121_0035931 | Ga0496121_0035931_1425_2003 | 190 |
| 1551 | 3300048924 | Ga0496121_0043504 | Ga0496121_0043504_3050_3622 | 190 |
| 1552 | 3300048924 | Ga0496121_0156854 | Ga0496121_0156854_92_670 | 190 |
| 1553 | 3300048924 | Ga0496121_0216720 | Ga0496121_0216720_81_659 | 190 |
| 1554 | 3300048924 | Ga0496121_0297240 | Ga0496121_0297240_218_796 | 190 |
| 1555 | 3300048924 | Ga0496121_0383331 | Ga0496121_0383331_96_668 | 190 |
| 1556 | 3300048924 | Ga0496121_0388202 | Ga0496121_0388202_267_839 | 190 |
| 1557 | 3300048924 | Ga0496121_0485862 | Ga0496121_0485862_44_616 | 190 |
| 1558 | 3300048925 | Ga0496122_0000002 | Ga0496122_0000002_430150_430722 | 190 |
| 1559 | 3300048925 | Ga0496122_0000106 | Ga0496122_0000106_65611_66201 | 190 |
| 1560 | 3300048925 | Ga0496122_0014427 | Ga0496122_0014427_2875_3447 | 190 |
| 1561 | 3300048925 | Ga0496122_0017699 | Ga0496122_0017699_1309_1884 | 190 |
| 1562 | 3300048925 | Ga0496122_0220255 | Ga0496122_0220255_159_737 | 190 |
| 1563 | 3300048925 | Ga0496122_0232361 | Ga0496122_0232361_198_773 | 190 |
| 1564 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_1380961_1381533 | 190 |
| 1565 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_430150_430722 | 190 |
| 1566 | 3300048926 | Ga0496123_0000022 | Ga0496123_0000022_295956_296546 | 190 |
| 1567 | 3300048927 | Ga0496124_0000080 | Ga0496124_0000080_209096_209668 | 190 |
| 1568 | 3300048927 | Ga0496124_0000861 | Ga0496124_0000861_12504_13082 | 190 |
| 1569 | 3300048927 | Ga0496124_0004878 | Ga0496124_0004878_529_1101 | 190 |
| 1570 | 3300048927 | Ga0496124_0070834 | Ga0496124_0070834_1262_1837 | 190 |
| 1571 | 3300048927 | Ga0496124_0071440 | Ga0496124_0071440_2178_2750 | 190 |
| 1572 | 3300048927 | Ga0496124_0083348 | Ga0496124_0083348_1673_2263 | 190 |
| 1573 | 3300048928 | Ga0496125_0012755 | Ga0496125_0012755_2283_2855 | 190 |
| 1574 | 3300048928 | Ga0496125_0093394 | Ga0496125_0093394_996_1574 | 190 |
| 1575 | 3300048928 | Ga0496125_0152717 | Ga0496125_0152717_171_743 | 190 |
| 1576 | 3300048928 | Ga0496125_0186194 | Ga0496125_0186194_380_958 | 190 |
| 1577 | 3300048928 | Ga0496125_0247645 | Ga0496125_0247645_182_754 | 190 |
| 1578 | 3300048929 | Ga0496126_0000554 | Ga0496126_0000554_62802_63377 | 190 |
| 1579 | 3300048929 | Ga0496126_0031476 | Ga0496126_0031476_3932_4510 | 190 |
| 1580 | 3300048929 | Ga0496126_0040035 | Ga0496126_0040035_1814_2392 | 190 |
| 1581 | 3300048929 | Ga0496126_0047672 | Ga0496126_0047672_2242_2820 | 190 |
| 1582 | 3300048929 | Ga0496126_0661002 | Ga0496126_0661002_20_598 | 190 |
| 1583 | 3300048929 | Ga0496126_0954233 | Ga0496126_0954233_17_595 | 190 |
| 1584 | 3300049459 | Ga0495678_093929 | Ga0495678_093929_209_787 | 190 |
| 1585 | 3300049459 | Ga0495678_119790 | Ga0495678_119790_251_823 | 190 |
| 1586 | 3300049460 | Ga0495682_0022972 | Ga0495682_0022972_1358_1984 | 190 |
| 1587 | 3300049460 | Ga0495682_0142163 | Ga0495682_0142163_261_839 | 190 |
| 1588 | 3300049569 | Ga0501032_0175641 | Ga0501032_0175641_698_1270 | 190 |
| 1589 | 3300049580 | Ga0501046_0298107 | Ga0501046_0298107_28_600 | 190 |
| 1590 | 3300049581 | Ga0501047_0062731 | Ga0501047_0062731_86_658 | 190 |
| 1591 | 3300049584 | Ga0501068_0094612 | Ga0501068_0094612_785_1357 | 190 |
| 1592 | 3300049585 | Ga0501069_0152351 | Ga0501069_0152351_693_1271 | 190 |
| 1593 | 3300049744 | Ga0501083_0183352 | Ga0501083_0183352_475_1047 | 190 |
| 1594 | 3300050489 | nmdc:mga03683_133364_c1 | nmdc:mga03683_133364_c1_373_945 | 190 |
| 1595 | 3300050490 | nmdc:mga03n38_116525_c1 | nmdc:mga03n38_116525_c1_363_941 | 190 |
| 1596 | 3300050490 | nmdc:mga03n38_191024_c1 | nmdc:mga03n38_191024_c1_275_847 | 190 |
| 1597 | 3300050491 | nmdc:mga00v17_120638_c1 | nmdc:mga00v17_120638_c1_292_870 | 190 |
| 1598 | 3300050491 | nmdc:mga00v17_241926_c1 | nmdc:mga00v17_241926_c1_70_732 | 190 |
| 1599 | 3300050491 | nmdc:mga00v17_361451_c1 | nmdc:mga00v17_361451_c1_142_720 | 190 |
| 1600 | 3300050491 | nmdc:mga00v17_3_c1 | nmdc:mga00v17_3_c1_210389_210961 | 190 |
| 1601 | 3300050491 | nmdc:mga00v17_73752_c1 | nmdc:mga00v17_73752_c1_1380_1958 | 190 |
| 1602 | 3300050492 | nmdc:mga0yw44_105055_c1 | nmdc:mga0yw44_105055_c1_799_1377 | 190 |
| 1603 | 3300050492 | nmdc:mga0yw44_128_c2 | nmdc:mga0yw44_128_c2_4634_5206 | 190 |
| 1604 | 3300050492 | nmdc:mga0yw44_14433_c1 | nmdc:mga0yw44_14433_c1_3143_3715 | 190 |
| 1605 | 3300050492 | nmdc:mga0yw44_16961_c1 | nmdc:mga0yw44_16961_c1_328_906 | 190 |
| 1606 | 3300050492 | nmdc:mga0yw44_174167_c1 | nmdc:mga0yw44_174167_c1_396_974 | 190 |
| 1607 | 3300050492 | nmdc:mga0yw44_22166_c1 | nmdc:mga0yw44_22166_c1_1910_2488 | 190 |
| 1608 | 3300050492 | nmdc:mga0yw44_226943_c1 | nmdc:mga0yw44_226943_c1_421_999 | 190 |
| 1609 | 3300050492 | nmdc:mga0yw44_372467_c1 | nmdc:mga0yw44_372467_c1_210_785 | 190 |
| 1610 | 3300050492 | nmdc:mga0yw44_4892_c2 | nmdc:mga0yw44_4892_c2_843_1421 | 190 |
| 1611 | 3300050493 | nmdc:mga0k408_168347_c1 | nmdc:mga0k408_168347_c1_565_1143 | 190 |
| 1612 | 3300050493 | nmdc:mga0k408_180506_c1 | nmdc:mga0k408_180506_c1_211_789 | 190 |
| 1613 | 3300050493 | nmdc:mga0k408_186098_c1 | nmdc:mga0k408_186098_c1_445_1023 | 190 |
| 1614 | 3300050493 | nmdc:mga0k408_71765_c1 | nmdc:mga0k408_71765_c1_232_804 | 190 |
| 1615 | 3300050493 | nmdc:mga0k408_86721_c1 | nmdc:mga0k408_86721_c1_456_1028 | 190 |
| 1616 | 3300050494 | nmdc:mga06z11_11929_c1 | nmdc:mga06z11_11929_c1_732_1316 | 190 |
| 1617 | 3300050494 | nmdc:mga06z11_121100_c1 | nmdc:mga06z11_121100_c1_473_1051 | 190 |
| 1618 | 3300050494 | nmdc:mga06z11_134937_c1 | nmdc:mga06z11_134937_c1_346_918 | 190 |
| 1619 | 3300050494 | nmdc:mga06z11_193209_c1 | nmdc:mga06z11_193209_c1_190_768 | 190 |
| 1620 | 3300050494 | nmdc:mga06z11_240677_c1 | nmdc:mga06z11_240677_c1_354_932 | 190 |
| 1621 | 3300050494 | nmdc:mga06z11_293678_c1 | nmdc:mga06z11_293678_c1_16_594 | 190 |
| 1622 | 3300050494 | nmdc:mga06z11_507743_c1 | nmdc:mga06z11_507743_c1_95_673 | 190 |
| 1623 | 3300050494 | nmdc:mga06z11_7911_c1 | nmdc:mga06z11_7911_c1_2228_2800 | 190 |
| 1624 | 3300050494 | nmdc:mga06z11_80852_c1 | nmdc:mga06z11_80852_c1_528_1100 | 190 |
| 1625 | 3300050495 | nmdc:mga04h51_24731_c1 | nmdc:mga04h51_24731_c1_646_1224 | 190 |
| 1626 | 3300050495 | nmdc:mga04h51_70588_c1 | nmdc:mga04h51_70588_c1_200_778 | 190 |
| 1627 | 3300050496 | nmdc:mga07m45_139712_c1 | nmdc:mga07m45_139712_c1_316_888 | 190 |
| 1628 | 3300050496 | nmdc:mga07m45_51883_c2 | nmdc:mga07m45_51883_c2_1074_1652 | 190 |
| 1629 | 3300050496 | nmdc:mga07m45_52506_c1 | nmdc:mga07m45_52506_c1_15_587 | 190 |
| 1630 | 3300050496 | nmdc:mga07m45_5718_c1 | nmdc:mga07m45_5718_c1_4884_5462 | 190 |
| 1631 | 3300050496 | nmdc:mga07m45_73781_c1 | nmdc:mga07m45_73781_c1_1055_1633 | 190 |
| 1632 | 3300050496 | nmdc:mga07m45_8545_c1 | nmdc:mga07m45_8545_c1_3622_4194 | 190 |
| 1633 | 3300050507 | nmdc:mga05p37_190489_c1 | nmdc:mga05p37_190489_c1_749_1327 | 190 |
| 1634 | 3300050508 | nmdc:mga09592_446558_c1 | nmdc:mga09592_446558_c1_194_772 | 190 |
| 1635 | 3300050509 | nmdc:mga0qj67_464114_c1 | nmdc:mga0qj67_464114_c1_74_652 | 190 |
| 1636 | 3300050511 | nmdc:mga08y16_65581_c1 | nmdc:mga08y16_65581_c1_2127_2705 | 190 |
| 1637 | 3300050513 | nmdc:mga0rr50_293273_c1 | nmdc:mga0rr50_293273_c1_43_621 | 190 |
| 1638 | 3300050516 | nmdc:mga0sz30_12371_c1 | nmdc:mga0sz30_12371_c1_2613_3191 | 190 |
| 1639 | 3300050516 | nmdc:mga0sz30_34918_c1 | nmdc:mga0sz30_34918_c1_292_864 | 190 |
| 1640 | 3300050516 | nmdc:mga0sz30_37069_c1 | nmdc:mga0sz30_37069_c1_627_1289 | 190 |
| 1641 | 3300050516 | nmdc:mga0sz30_49798_c2 | nmdc:mga0sz30_49798_c2_213_785 | 190 |
| 1642 | 3300050516 | nmdc:mga0sz30_51562_c1 | nmdc:mga0sz30_51562_c1_73_651 | 190 |
| 1643 | 3300050516 | nmdc:mga0sz30_65067_c1 | nmdc:mga0sz30_65067_c1_260_832 | 190 |
| 1644 | 3300050516 | nmdc:mga0sz30_982_c1 | nmdc:mga0sz30_982_c1_1550_2122 | 190 |
| 1645 | 3300053079 | Ga0500610_0072093 | Ga0500610_0072093_33_659 | 190 |
| 1646 | 3300053079 | Ga0500610_0156237 | Ga0500610_0156237_326_904 | 190 |
| 1647 | 3300053083 | Ga0495655_0062339 | Ga0495655_0062339_392_964 | 190 |
| 1648 | 3300053085 | Ga0495619_0104837 | Ga0495619_0104837_996_1574 | 190 |
| 1649 | 3300053086 | Ga0500578_0150466 | Ga0500578_0150466_505_1083 | 190 |
| 1650 | 3300053087 | Ga0500643_000055 | Ga0500643_000055_48953_49531 | 190 |
| 1651 | 3300053091 | Ga0500647_0134699 | Ga0500647_0134699_173_751 | 190 |
| 1652 | 3300053093 | Ga0500651_0066988 | Ga0500651_0066988_1224_1796 | 190 |
| 1653 | 3300053093 | Ga0500651_0312622 | Ga0500651_0312622_24_602 | 190 |
| 1654 | 3300053094 | Ga0500566_0000041 | Ga0500566_0000041_8528_9106 | 190 |
| 1655 | 3300053095 | Ga0500640_197320 | Ga0500640_197320_34_612 | 190 |
| 1656 | 3300053096 | Ga0500641_0026061 | Ga0500641_0026061_1107_1685 | 190 |
| 1657 | 3300053097 | Ga0500648_117904 | Ga0500648_117904_215_793 | 190 |
| 1658 | 3300053098 | Ga0500650_0225016 | Ga0500650_0225016_162_788 | 190 |
| 1659 | 3300053099 | Ga0500654_121663 | Ga0500654_121663_31_609 | 190 |
| 1660 | 3300053105 | Ga0500557_000017 | Ga0500557_000017_66795_67373 | 190 |
| 1661 | 3300053105 | Ga0500557_037856 | Ga0500557_037856_351_977 | 190 |
| 1662 | 3300053107 | Ga0500560_000033 | Ga0500560_000033_11062_11634 | 190 |
| 1663 | 3300053109 | Ga0500569_008436 | Ga0500569_008436_1592_2170 | 190 |
| 1664 | 3300053109 | Ga0500569_014543 | Ga0500569_014543_646_1272 | 190 |
| 1665 | 3300053111 | Ga0500572_009460 | Ga0500572_009460_1013_1591 | 190 |
| 1666 | 3300053116 | Ga0500592_018694 | Ga0500592_018694_90_668 | 190 |
| 1667 | 3300053118 | Ga0500594_0001940 | Ga0500594_0001940_3442_4068 | 190 |
| 1668 | 3300053118 | Ga0500594_0070772 | Ga0500594_0070772_358_936 | 190 |
| 1669 | 3300053118 | Ga0500594_0185452 | Ga0500594_0185452_46_624 | 190 |
| 1670 | 3300053119 | Ga0500595_000891 | Ga0500595_000891_15303_15965 | 190 |
| 1671 | 3300053119 | Ga0500595_001184 | Ga0500595_001184_1004_1582 | 190 |
| 1672 | 3300053119 | Ga0500595_062568 | Ga0500595_062568_149_727 | 190 |
| 1673 | 3300053122 | Ga0500608_165189 | Ga0500608_165189_221_799 | 190 |
| 1674 | 3300053125 | Ga0500618_042067 | Ga0500618_042067_23_601 | 190 |
| 1675 | 3300053126 | Ga0500621_083986 | Ga0500621_083986_218_796 | 190 |
| 1676 | 3300053130 | Ga0500642_0000171 | Ga0500642_0000171_893_1471 | 190 |
| 1677 | 3300053130 | Ga0500642_0085072 | Ga0500642_0085072_457_1035 | 190 |
| 1678 | 3300053130 | Ga0500642_0088117 | Ga0500642_0088117_461_1039 | 190 |
| 1679 | 3300053131 | Ga0500652_209416 | Ga0500652_209416_145_723 | 190 |
| 1680 | 3300053133 | Ga0500655_036861 | Ga0500655_036861_138_716 | 190 |
| 1681 | 3300053134 | Ga0500658_0020608 | Ga0500658_0020608_1069_1641 | 190 |
| 1682 | 3300053136 | Ga0500559_0022060 | Ga0500559_0022060_1602_2180 | 190 |
| 1683 | 3300053136 | Ga0500559_0030989 | Ga0500559_0030989_1524_2102 | 190 |
| 1684 | 3300053136 | Ga0500559_0319043 | Ga0500559_0319043_109_687 | 190 |
| 1685 | 3300053137 | Ga0500561_0000034 | Ga0500561_0000034_4139_4711 | 190 |
| 1686 | 3300053138 | Ga0500564_166616 | Ga0500564_166616_118_696 | 190 |
| 1687 | 3300053139 | Ga0500568_0000109 | Ga0500568_0000109_61742_62368 | 190 |
| 1688 | 3300053139 | Ga0500568_0000202 | Ga0500568_0000202_10402_10977 | 190 |
| 1689 | 3300053139 | Ga0500568_0003149 | Ga0500568_0003149_5486_6058 | 190 |
| 1690 | 3300053139 | Ga0500568_0083646 | Ga0500568_0083646_207_785 | 190 |
| 1691 | 3300053140 | Ga0500573_0041459 | Ga0500573_0041459_172_750 | 190 |
| 1692 | 3300053142 | Ga0500577_0122383 | Ga0500577_0122383_461_1033 | 190 |
| 1693 | 3300053142 | Ga0500577_0321596 | Ga0500577_0321596_92_664 | 190 |
| 1694 | 3300053146 | Ga0500588_0071588 | Ga0500588_0071588_298_924 | 190 |
| 1695 | 3300053150 | Ga0500603_013184 | Ga0500603_013184_954_1616 | 190 |
| 1696 | 3300053151 | Ga0500604_0013214 | Ga0500604_0013214_395_967 | 190 |
| 1697 | 3300053152 | Ga0500606_122139 | Ga0500606_122139_85_657 | 190 |
| 1698 | 3300053153 | Ga0500616_0000472 | Ga0500616_0000472_23076_23702 | 190 |
| 1699 | 3300053153 | Ga0500616_0098621 | Ga0500616_0098621_49_621 | 190 |
| 1700 | 3300053154 | Ga0500619_211016 | Ga0500619_211016_61_639 | 190 |
| 1701 | 3300053156 | Ga0500622_0000134 | Ga0500622_0000134_5619_6254 | 190 |
| 1702 | 3300053156 | Ga0500622_0018187 | Ga0500622_0018187_1600_2178 | 190 |
| 1703 | 3300053156 | Ga0500622_0029086 | Ga0500622_0029086_2070_2648 | 190 |
| 1704 | 3300053156 | Ga0500622_0085531 | Ga0500622_0085531_602_1180 | 190 |
| 1705 | 3300053157 | Ga0500624_000323 | Ga0500624_000323_15233_15805 | 190 |
| 1706 | 3300053161 | Ga0500634_0192563 | Ga0500634_0192563_46_618 | 190 |
| 1707 | 3300053162 | Ga0500638_121376 | Ga0500638_121376_318_980 | 190 |
| 1708 | 3300053177 | Ga0500636_0000107 | Ga0500636_0000107_1511_2089 | 190 |
| 1709 | 3300053177 | Ga0500636_0141890 | Ga0500636_0141890_578_1156 | 190 |
| 1710 | 3300053177 | Ga0500636_0252480 | Ga0500636_0252480_292_870 | 190 |
| 1711 | 3300053178 | Ga0500637_0000240 | Ga0500637_0000240_15305_15967 | 190 |
| 1712 | 3300053730 | Ga0500645_036326 | Ga0500645_036326_689_1267 | 190 |
| 1713 | 3300053733 | Ga0500552_000443 | Ga0500552_000443_2792_3370 | 190 |
| 1714 | 3300053735 | Ga0500596_006036 | Ga0500596_006036_1298_1876 | 190 |
| 1715 | 3300053736 | Ga0500599_001227 | Ga0500599_001227_345_923 | 190 |
| 1716 | 3300053737 | Ga0500601_012419 | Ga0500601_012419_58_636 | 190 |
| 1717 | 3300059643 | Ga0587072_023949 | Ga0587072_023949_23_595 | 190 |
| 1718 | 3300060353 | Ga0501082_0039710 | Ga0501082_0039710_1950_2522 | 190 |
| 1719 | iso_pu_bacteria | 8005626139 | 8005626296 | 190 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qha-assembly1.cif.gz_A | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.8076 | 32 | 172 |
| 8thj-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) | 0.7791 | 32 | 177 |
| 7qha-assembly1.cif.gz_A | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.7479 | 32 | 172 |
| 3nvo-assembly2.cif.gz_B-2 | the soluble domain structure of the zntb zn2+ efflux system | 0.6195 | 68 | 170 |
| 8thj-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) | 0.6183 | 32 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37674_16_146_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8298 | 45 | 174 | 1.20.120.550 |
| af_P37674_16_146_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8188 | 45 | 174 | 1.20.120.550 |
| 3mq1A01 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.7193 | 83 | 170 | 1.20.58.970 |
| af_Q553K8_226_392_1.20.58.340 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region | 0.6702 | 65 | 170 | 1.20.58.340 |
| 3mq1A01 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.6404 | 83 | 170 | 1.20.58.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A413G513-F1-model_v4 | TRAP transporter small permease | 0.9023 | 32 | 174 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A1I1BFZ3-F1-model_v4 | TRAP-type C4-dicarboxylate transport system, small permease component | 0.8997 | 32 | 172 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A2V1JWP9-F1-model_v4 | TRAP transporter small permease protein | 0.8988 | 33 | 175 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A1Y1S3F3-F1-model_v4 | C4-dicarboxylate ABC transporter permease | 0.8987 | 32 | 173 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A2T0KET4-F1-model_v4 | TRAP-type C4-dicarboxylate transport system permease small subunit | 0.8972 | 32 | 170 |
GO:0005886
GO:0015740 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar