F495464

General Info

Members Datasets Scaffolds Average Seq Length
1719 1118 1049 191

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10177937|Ga0075364_101779372
Length 218
Sequence MYSNAKTAGLPGHEPARLAAADTTATPQGAAHPTASVQDIVQSFEEADEVVQHVDLSGYRFEDWVCLALFWTMAGLVFLQFFSRYVMNDSYAWTEELAVYCLIGVVFLGASMCVRACRHIQVDFLYRYLPKPVGRVLSTLIDVIRTAFFAYAIWLVYRYISLVGDEPMTTLFWNKAYVYWLAFAGFVMMFVRSVQVSVQNWRQGYSILENPSAYDAVD

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
7 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
8 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
9 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
10 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
11 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
12 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
20 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
21 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
22 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
23 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
24 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
25 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
26 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
27 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
28 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
29 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
30 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
31 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
32 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
33 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
34 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
35 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
36 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
37 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
38 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
39 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
40 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
41 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
42 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
43 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
44 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
45 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
46 2516143018 Ensifer sp. BR816 Isolate Nodule
47 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
48 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
49 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
50 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
51 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
52 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
53 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
54 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
55 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
56 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
57 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
58 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
59 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
60 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
61 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
62 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
63 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
64 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
65 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
66 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
67 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
68 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
69 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
70 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
71 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
72 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
73 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
74 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
75 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
76 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
77 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
78 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
79 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
80 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
81 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
82 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
83 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
84 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
85 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
86 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
87 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
88 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
89 2643221558 Rhizobium sp. Root149 Isolate Unclassified
90 2643221568 Rhizobium sp. Root564 Isolate Unclassified
91 2643221569 Achromobacter sp. Root565 Isolate Unclassified
92 2643221594 Achromobacter sp. Root170 Isolate Unclassified
93 2643221621 Achromobacter sp. Root83 Isolate Unclassified
94 2643221693 Rhizobium sp. Root491 Isolate Unclassified
95 2643221733 Bosea sp. Root381 Isolate Unclassified
96 2643221736 Bosea sp. Root483D1 Isolate Unclassified
97 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
98 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
99 2718217882 Rhizobium sp. N741 Isolate Nodule
100 2718217927 Rhizobium sp. N324 Isolate Nodule
101 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
102 2718218009 Rhizobium sp. N561 Isolate Nodule
103 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
104 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
105 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
106 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
107 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
108 2718218363 Rhizobium sp. N113 Isolate Nodule
109 2718218365 Rhizobium sp. N731 Isolate Nodule
110 2718218366 Rhizobium sp. N621 Isolate Nodule
111 2718218423 Rhizobium sp. N941 Isolate Nodule
112 2721755514 Rhizobium sp. N6212 Isolate Nodule
113 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
114 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
115 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
116 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
117 2721755809 Rhizobium sp. N541 Isolate Nodule
118 2721755810 Rhizobium sp. N871 Isolate Nodule
119 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
120 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
121 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
122 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
123 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
124 2728369365 Rhizobium sp. N1341 Isolate Nodule
125 2728369397 Rhizobium sp. N1314 Isolate Nodule
126 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
127 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
128 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
129 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
130 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
131 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
132 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
133 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
134 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
135 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
136 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
137 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
138 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
139 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
140 2791355199
141 2791355256 Rhizobium sp. M10 Isolate Nodule
142 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
143 2791355260 Rhizobium sp. L9 Isolate Nodule
144 2791355261 Rhizobium sp. J15 Isolate Nodule
145 2791355262 Rhizobium sp. M1 Isolate Nodule
146 2791355263 Rhizobium chutanense C5 Isolate Nodule
147 2791355264 Rhizobium sp. S9 Isolate Nodule
148 2791355265 Rhizobium sp. H4 Isolate Nodule
149 2791355266 Rhizobium sp. L43 Isolate Nodule
150 2791355267 Rhizobium sp. L18 Isolate Nodule
151 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
152 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
153 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
154 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
155 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
156 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
157 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
158 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
159 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
160 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
161 2802429633 Rhizobium anhuiense J3 Isolate Nodule
162 2802429634 Rhizobium anhuiense S10 Isolate Nodule
163 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
164 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
165 2802429637 Rhizobium anhuiense C15 Isolate Nodule
166 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
167 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
168 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
169 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
170 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
171 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
172 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
173 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
174 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
175 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
176 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
177 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
178 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
179 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
180 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
181 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
182 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
183 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
184 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
185 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
186 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
187 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
188 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
189 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
190 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
191 2838048938 Rhizobium pisi 27/80 Isolate Nodule
192 2838061910 Rhizobium phaseoli L15 Isolate Nodule
193 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
194 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
195 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
196 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
197 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
198 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
199 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
200 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
201 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
202 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
203 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
204 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
205 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
206 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
207 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
208 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
209 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
210 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
211 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
212 2841760612 Bosea sp. Tri-49 Isolate Nodule
213 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
214 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
215 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
216 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
217 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
218 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
219 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
220 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
221 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
222 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
223 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
224 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
225 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
226 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
227 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
228 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
229 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
230 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
231 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
232 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
233 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
234 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
235 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
236 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
237 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
238 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
239 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
240 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
241 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
242 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
243 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
244 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
245 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
246 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
247 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
248 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
249 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
250 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
251 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
252 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
253 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
254 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
255 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
256 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
257 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
258 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
259 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
260 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
261 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
262 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
263 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
264 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
265 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
266 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
267 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
268 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
269 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
270 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
271 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
272 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
273 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
274 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
275 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
276 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
277 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
278 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
279 2844104063 Bosea sp. Tri-39 Isolate Nodule
280 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
281 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
282 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
283 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
284 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
285 2851182111 Bosea sp. Tri-44 Isolate Nodule
286 2851246043 Bosea sp. Tri-54 Isolate Nodule
287 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
288 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
289 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
290 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
291 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
292 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
293 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
294 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
295 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
296 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
297 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
298 2858950400 Achromobacter sp. K91 Isolate Unclassified
299 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
300 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
301 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
302 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
303 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
304 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
305 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
306 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
307 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
308 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
309 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
310 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
311 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
312 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
313 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
314 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
315 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
316 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
317 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
318 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
319 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
320 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
321 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
322 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
323 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
324 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
325 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
326 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
327 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
328 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
329 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
330 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
331 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
332 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
333 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
334 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
335 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
336 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
337 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
338 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
339 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
340 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
341 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
342 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
343 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
344 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
345 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
346 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
347 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
348 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
349 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
350 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
351 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
352 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
353 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
354 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
355 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
356 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
357 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
358 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
359 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
360 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
361 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
362 2922368715
363 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
364 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
365 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
366 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
367 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
368 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
369 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
370 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
371 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
372 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
373 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
374 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
375 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
376 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
377 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
378 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
379 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
380 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
381 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
382 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
383 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
384 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
385 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
386 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
387 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
388 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
389 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
390 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
391 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
392 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
393 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
394 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
395 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
396 2933599457 Rhizobium phaseoli M3 Isolate Nodule
397 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
398 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
399 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
400 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
401 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
402 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
403 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
404 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
405 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
406 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
407 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
408 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
409 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
410 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
411 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
412 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
413 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
414 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
415 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
416 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
417 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
418 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
419 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
420 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
421 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
422 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
423 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
424 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
425 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
426 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
427 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
428 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
429 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
430 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
431 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
432 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
433 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
434 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
435 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
436 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
437 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
438 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
439 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
440 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
441 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
442 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
443 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
444 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
445 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
446 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
447 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
448 2936381700 Rhizobium chutanense C16 Isolate Unclassified
449 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
450 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
451 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
452 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
453 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
454 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
455 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
456 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
457 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
458 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
459 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
460 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
461 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
462 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
463 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
464 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
465 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
466 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
467 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
468 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
469 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
470 2941479691
471 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
472 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
473 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
474 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
475 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
476 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
477 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
478 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
479 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
480 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
481 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
482 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
483 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
484 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
485 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
486 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
487 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
488 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
489 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
490 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
491 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
492 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
493 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
494 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
495 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
496 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
497 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
498 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
499 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
500 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
501 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
502 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
503 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
504 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
505 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
506 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
507 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
508 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
509 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
510 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
511 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
512 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
513 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
514 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
515 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
516 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
517 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
518 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
519 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
520 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
521 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
522 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
523 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
524 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
525 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
526 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
527 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
528 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
529 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
530 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
531 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
532 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
533 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
534 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
535 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
536 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
537 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
538 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
539 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
540 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
541 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
542 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
543 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
544 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
545 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
546 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
547 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
548 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
549 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
550 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
551 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
552 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
553 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
554 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
555 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
556 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
557 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
558 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
559 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
560 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
561 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
562 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
563 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
564 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
565 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
566 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
567 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
568 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
569 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
570 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
571 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
572 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
573 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
574 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
575 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
576 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
577 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
578 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
579 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
580 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
581 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
582 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
583 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
584 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
585 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
586 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
587 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
588 2996893221 Rhizobium sp. R635 Isolate Nodule
589 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
590 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
591 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
592 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
593 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
594 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
595 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
596 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
597 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
598 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
599 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
600 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
601 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
602 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
603 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
604 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
605 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
606 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
607 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
608 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
609 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
610 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
611 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
612 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
613 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
614 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
615 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
616 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
617 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
618 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
619 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
620 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
621 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
622 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
623 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
624 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
625 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
626 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
627 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
628 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
629 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
630 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
631 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
632 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
633 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
634 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
635 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
636 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
637 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
638 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
639 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
640 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
641 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
642 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
643 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
644 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
645 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
646 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
647 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
648 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
649 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
650 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
651 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
652 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
653 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
654 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
655 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
656 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
657 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
658 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
659 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
660 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
661 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
662 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
663 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
664 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
665 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
666 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
667 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
668 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
669 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
670 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
671 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
672 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
673 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
674 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
675 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
676 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
677 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
678 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
679 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
680 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
681 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
682 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
683 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
684 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
685 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
686 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
687 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
688 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
689 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
690 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
691 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
692 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
693 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
694 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
695 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
696 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
697 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
698 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
699 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
700 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
701 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
702 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
703 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
704 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
705 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
706 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
707 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
708 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
709 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
710 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
711 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
712 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
713 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
714 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
715 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
716 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
717 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
718 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
719 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
720 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
721 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
722 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
723 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
724 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
725 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
726 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
727 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
728 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
729 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
730 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
731 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
732 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
733 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
734 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
735 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
736 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
737 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
738 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
739 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
740 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
741 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
742 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
743 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
744 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
745 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
746 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
747 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
748 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
749 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
750 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
751 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
752 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
753 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
754 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
755 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
756 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
757 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
758 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
759 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
760 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
761 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
762 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
763 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
764 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
765 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
766 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
767 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
768 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
769 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
770 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
771 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
772 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
773 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
774 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
775 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
776 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
777 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
778 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
779 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
780 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
781 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
782 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
783 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
784 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
785 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
786 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
787 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
788 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
789 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
790 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
791 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
792 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
793 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
794 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
795 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
796 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
797 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
798 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
799 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
800 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
801 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
802 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
803 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
804 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
805 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
806 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
807 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
808 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
809 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
810 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
811 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
812 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
813 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
814 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
815 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
816 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
817 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
818 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
819 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
820 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
821 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
822 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
823 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
824 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
825 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
826 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
827 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
828 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
829 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
830 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
831 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
832 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
833 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
834 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
835 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
836 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
837 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
838 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
839 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
840 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
841 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
842 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
843 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
844 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
845 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
846 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
847 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
848 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
849 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
850 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
851 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
852 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
853 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
854 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
855 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
856 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
857 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
858 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
859 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
860 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
861 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
862 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
863 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
864 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
865 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
866 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
867 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
868 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
869 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
870 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
871 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
872 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
873 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
874 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
875 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
876 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
877 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
878 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
879 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
880 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
881 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
882 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
883 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
884 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
885 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
886 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
887 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
888 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
889 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
890 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
891 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
892 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
893 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
894 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
895 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
896 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
897 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
898 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
899 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
900 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
901 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
902 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
903 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
904 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
905 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
906 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
907 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
908 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
909 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
910 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
911 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
912 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
913 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
914 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
915 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
916 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
917 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
918 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
919 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
920 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
921 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
922 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
923 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
924 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
925 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
926 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
927 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
928 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
929 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
930 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
931 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
932 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
933 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
934 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
935 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
936 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
937 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
938 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
939 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
940 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
941 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
942 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
943 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
944 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
945 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
946 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
947 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
948 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
949 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
950 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
951 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
952 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
953 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
954 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
955 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
956 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
957 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
958 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
959 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
960 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
961 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
962 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
963 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
964 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
965 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
966 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
967 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
968 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
969 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
970 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
971 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
972 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
973 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
974 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
975 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
976 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
977 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
978 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
979 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
980 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
981 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
982 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
983 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
984 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
985 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
986 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
987 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
988 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
989 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
990 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
991 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
992 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
993 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
994 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
995 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
996 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
997 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
998 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
999 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1000 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
1001 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
1002 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
1003 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
1004 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
1005 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
1006 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
1007 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
1008 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
1009 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
1010 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
1011 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
1012 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1013 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
1014 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1015 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
1016 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1017 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
1018 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
1019 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1020 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1021 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1022 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
1023 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1024 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1025 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
1026 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
1027 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
1028 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1029 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
1030 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1031 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
1032 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
1033 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1034 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1035 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1036 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
1037 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1038 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
1039 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1040 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
1041 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
1042 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
1043 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
1044 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1045 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1046 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1047 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1048 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1049 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1050 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1051 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1052 8005275841 Rhizobium sp. N4311 Isolate Nodule
1053 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1054 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1055 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1056 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1057 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1058 8005382845 Rhizobium sp. R634 Isolate Nodule
1059 8005395548 Rhizobium sp. R339 Isolate Nodule
1060 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1061 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1062 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1063 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1064 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1065 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1066 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1067 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1068 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1069 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1070 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1071 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
1072 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
1073 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
1074 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
1075 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
1076 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
1077 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
1078 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
1079 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
1080 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
1081 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
1082 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
1083 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
1084 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
1085 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
1086 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
1087 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
1088 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1089 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1090 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1091 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1092 8018176218 Rhizobium sp. N122 Isolate Nodule
1093 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
1094 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
1095 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
1096 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
1097 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
1098 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
1099 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
1100 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
1101 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
1102 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
1103 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
1104 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
1105 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
1106 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
1107 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
1108 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1109 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1110 8024501048 Rhizobium sp. H4 Isolate Nodule
1111 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1112 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1113 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1114 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1115 8056382006 Rhizobium croatiense 13T Isolate Nodule
1116 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
1117 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
1118 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 61.04
Metatranscriptomes 0.12
Isolates 38.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 20.3
Nodule 32.98
Rhizoplane 3.03
Rhizosphere 30.37
Stem 0
Stem Tuber 0
Unclassified 13.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000856 3300002739 Bacteria 5804
2 JGI25159J45721_1002192 3300002987 Bacteria 7596
3 JGI25159J45721_1013501 3300002987 Bacteria 1886
4 JGI25151J46595_10000463 3300003187 Bacteria 38967
5 JGI25151J46595_10005027 3300003187 Bacteria 6886
6 JGI25151J46595_10017428 3300003187 Bacteria 3113
7 JGI25151J46595_10022275 3300003187 Bacteria 2633
8 JGI25151J46595_10053605 3300003187 Bacteria 1345
9 JGI25151J46595_10059344 3300003187 Bacteria 1232
10 JGI25165J46597_1002684 3300003214 Bacteria 5318
11 JGI25153J46596_10000681 3300003215 Bacteria 20727
12 JGI25153J46596_10006921 3300003215 Bacteria 5655
13 JGI25153J46596_10019799 3300003215 Bacteria 2564
14 JGI25153J46596_10023467 3300003215 Bacteria 2247
15 JGI25153J46596_10024497 3300003215 Bacteria 2176
16 rootH1_10031368 3300003316 Bacteria 1339
17 rootH1_10247466 3300003323 Bacteria 1458
18 rootH1_10290538 3300003323 Bacteria 1625
19 JGI25160J50197_1000797 3300003354 Bacteria 16984
20 JGI25160J50197_1004179 3300003354 Bacteria 6277
21 JGI25161J50226_1000233 3300003374 Bacteria 33741
22 JGI25161J50226_1009245 3300003374 Bacteria 1425
23 Ga0006562J51391_1010713 3300003578 Bacteria 4233
24 JGI25404J52841_10005354 3300003659 Bacteria 2650
25 Ga0055526_1001056 3300003771 Bacteria 20118
26 Ga0055526_1004150 3300003771 Bacteria 8819
27 Ga0055526_1005610 3300003771 Bacteria 7145
28 Ga0055526_1009661 3300003771 Bacteria 4603
29 Ga0055526_1010437 3300003771 Bacteria 4320
30 Ga0055526_1011504 3300003771 Bacteria 3975
31 Ga0055526_1016600 3300003771 Bacteria 2867
32 Ga0055526_1036630 3300003771 Bacteria 1298
33 Ga0055526_1036771 3300003771 Bacteria 1292
34 Ga0055526_1044756 3300003771 Bacteria 1065
35 Ga0055526_1046453 3300003771 Bacteria 1028
36 Ga0055537_1004444 3300003773 Bacteria 4012
37 Ga0055524_1000751 3300003775 Bacteria 22061
38 Ga0055524_1001893 3300003775 Bacteria 11352
39 Ga0055524_1004819 3300003775 Bacteria 6149
40 Ga0055524_1006307 3300003775 Bacteria 5157
41 Ga0055524_1012728 3300003775 Bacteria 3213
42 Ga0055524_1014427 3300003775 Bacteria 2927
43 Ga0055524_1052904 3300003775 Bacteria 903
44 Ga0055536_1000380 3300003781 Bacteria 32625
45 Ga0055534_1009966 3300003784 Bacteria 2021
46 Ga0055528_1000054 3300003790 Bacteria 90334
47 Ga0055528_1000343 3300003790 Bacteria 38462
48 Ga0055528_1000764 3300003790 Bacteria 22452
49 Ga0055528_1003831 3300003790 Bacteria 7401
50 Ga0055528_1010860 3300003790 Bacteria 3663
51 Ga0055528_1024968 3300003790 Bacteria 1773
52 Ga0055530_10016080 3300003791 Bacteria 2408
53 Ga0055540_1000077 3300003792 Bacteria 114283
54 Ga0055540_1002166 3300003792 Bacteria 10702
55 Ga0055540_1007797 3300003792 Bacteria 3972
56 Ga0055540_1030799 3300003792 Bacteria 1240
57 Ga0055531_10001197 3300003794 Bacteria 19909
58 Ga0055531_10009606 3300003794 Bacteria 4926
59 Ga0055531_10049381 3300003794 Bacteria 1124
60 Ga0058692_1002629 3300003856 Bacteria 5920
61 Ga0055543_1000770 3300004625 Bacteria 15967
62 Ga0055543_1001585 3300004625 Bacteria 8771
63 Ga0055543_1004072 3300004625 Bacteria 4093
64 Ga0065165_1000062 3300005262 Bacteria 178885
65 Ga0065165_1000254 3300005262 Bacteria 92762
66 Ga0065165_1001892 3300005262 Bacteria 20185
67 Ga0065165_1018148 3300005262 Bacteria 2560
68 Ga0065165_1036576 3300005262 Bacteria 1496
69 Ga0065707_10020470 3300005295 Bacteria 2196
70 Ga0070658_10096070 3300005327 Bacteria 2446
71 Ga0070676_10131218 3300005328 Bacteria 1585
72 Ga0070690_100288724 3300005330 Bacteria 1172
73 Ga0070670_100222172 3300005331 Bacteria 1643
74 Ga0068869_100096373 3300005334 Bacteria 2233
75 Ga0068869_100275493 3300005334 Bacteria 1351
76 Ga0068869_100951250 3300005334 Bacteria 746
77 Ga0070680_100878964 3300005336 Bacteria 773
78 Ga0070682_100105754 3300005337 Bacteria 1866
79 Ga0068868_100370495 3300005338 Bacteria 1230
80 Ga0070660_100596084 3300005339 Bacteria 924
81 Ga0070661_100166232 3300005344 Bacteria 1673
82 Ga0070661_100387547 3300005344 Bacteria 1103
83 Ga0070668_100027793 3300005347 Bacteria 4294
84 Ga0070668_100134154 3300005347 Bacteria 1989
85 Ga0070668_100451299 3300005347 Bacteria 1105
86 Ga0070668_100673554 3300005347 Bacteria 910
87 Ga0070669_100510440 3300005353 Bacteria 998
88 Ga0070671_100425483 3300005355 Bacteria 1137
89 Ga0070671_100555232 3300005355 Bacteria 990
90 Ga0070671_100634209 3300005355 Bacteria 925
91 Ga0070674_100239932 3300005356 Bacteria 1419
92 Ga0070673_100443570 3300005364 Bacteria 1167
93 Ga0070673_100524575 3300005364 Bacteria 1074
94 Ga0070659_100276800 3300005366 Bacteria 1395
95 Ga0070659_100421550 3300005366 Bacteria 1129
96 Ga0070667_100105184 3300005367 Bacteria 2442
97 Ga0070705_100406545 3300005440 Unclassified 1009
98 Ga0070700_100465060 3300005441 Bacteria 965
99 Ga0070694_100524386 3300005444 Bacteria 945
100 Ga0070708_100577764 3300005445 Bacteria 1060
101 Ga0070663_100051087 3300005455 Bacteria 2943
102 Ga0070663_100057161 3300005455 Bacteria 2798
103 Ga0070663_100199903 3300005455 Bacteria 1559
104 Ga0070678_100599044 3300005456 Bacteria 984
105 Ga0070678_101243152 3300005456 Bacteria 692
106 Ga0070662_100289137 3300005457 Bacteria 1328
107 Ga0070662_100657402 3300005457 Bacteria 884
108 Ga0068867_100167283 3300005459 Bacteria 1738
109 Ga0070685_10384864 3300005466 Bacteria 967
110 Ga0070698_100101177 3300005471 Bacteria 2853
111 Ga0070699_100116843 3300005518 Bacteria 2345
112 Ga0070679_100022779 3300005530 Bacteria 6126
113 Ga0070684_100508830 3300005535 Bacteria 1116
114 Ga0068853_100160170 3300005539 Bacteria 2030
115 Ga0068853_100915293 3300005539 Bacteria 843
116 Ga0070686_100623035 3300005544 Bacteria 852
117 Ga0070695_100049566 3300005545 Bacteria 2689
118 Ga0070695_100056057 3300005545 Bacteria 2542
119 Ga0070696_100014883 3300005546 Bacteria 5223
120 Ga0070696_100194535 3300005546 Bacteria 1511
121 Ga0070693_100089430 3300005547 Bacteria 1854
122 Ga0070665_100010206 3300005548 Bacteria 9500
123 Ga0070665_100151094 3300005548 Bacteria 2325
124 Ga0070665_100309953 3300005548 Bacteria 1582
125 Ga0070665_100379044 3300005548 Bacteria 1422
126 Ga0070665_100470355 3300005548 Bacteria 1267
127 Ga0070704_100029644 3300005549 Bacteria 3657
128 Ga0070704_100521192 3300005549 Bacteria 1034
129 Ga0068855_100030747 3300005563 Bacteria 6420
130 Ga0068857_100623354 3300005577 Bacteria 1021
131 Ga0068854_100344494 3300005578 Bacteria 1218
132 Ga0068854_100367034 3300005578 Bacteria 1182
133 Ga0068856_100207790 3300005614 Bacteria 1972
134 Ga0068856_101036051 3300005614 Bacteria 839
135 Ga0070702_100038055 3300005615 Bacteria 2675
136 Ga0068852_100025826 3300005616 Bacteria 4765
137 Ga0068852_100261872 3300005616 Bacteria 1661
138 Ga0068859_100149727 3300005617 Bacteria 2409
139 Ga0068859_100752044 3300005617 Bacteria 1064
140 Ga0068864_100057625 3300005618 Bacteria 3356
141 Ga0068861_100091696 3300005719 Bacteria 2399
142 Ga0068861_100136783 3300005719 Bacteria 1995
143 Ga0068870_10257109 3300005840 Bacteria 1085
144 Ga0068863_100128828 3300005841 Bacteria 2415
145 Ga0068863_100337581 3300005841 Bacteria 1465
146 Ga0068863_100917553 3300005841 Bacteria 876
147 Ga0068858_100254176 3300005842 Bacteria 1669
148 Ga0068858_101389051 3300005842 Bacteria 692
149 Ga0068860_100000312 3300005843 Bacteria 66724
150 Ga0068860_100131015 3300005843 Bacteria 2406
151 Ga0068860_100137173 3300005843 Bacteria 2350
152 Ga0068860_100483380 3300005843 Bacteria 1234
153 Ga0068860_100849333 3300005843 Bacteria 928
154 Ga0068862_100441046 3300005844 Bacteria 1225
155 Ga0081455_10018391 3300005937 Bacteria 6660
156 Ga0081455_10072627 3300005937 Bacteria 2848
157 Ga0081540_1003077 3300005983 Bacteria 13369
158 Ga0081540_1003847 3300005983 Bacteria 11731
159 Ga0081540_1015210 3300005983 Bacteria 4881
160 Ga0081539_10024214 3300005985 Bacteria 3947
161 Ga0075365_10011642 3300006038 Bacteria 5183
162 Ga0075365_10016024 3300006038 Bacteria 4547
163 Ga0075365_10019199 3300006038 Bacteria 4216
164 Ga0075365_10019469 3300006038 Bacteria 4190
165 Ga0075365_10077252 3300006038 Bacteria 2249
166 Ga0075365_10170772 3300006038 Bacteria 1518
167 Ga0075365_10192833 3300006038 Bacteria 1426
168 Ga0075365_10217976 3300006038 Bacteria 1338
169 Ga0075365_10396613 3300006038 Bacteria 974
170 Ga0075368_10057000 3300006042 Bacteria 1559
171 Ga0075368_10150941 3300006042 Bacteria 971
172 Ga0075368_10268398 3300006042 Bacteria 731
173 Ga0075363_100036248 3300006048 Bacteria 2586
174 Ga0075363_100106500 3300006048 Bacteria 1555
175 Ga0075363_100115464 3300006048 Bacteria 1495
176 Ga0075363_100147378 3300006048 Bacteria 1327
177 Ga0075363_100152898 3300006048 Bacteria 1303
178 Ga0075363_100189770 3300006048 Bacteria 1172
179 Ga0075363_100205378 3300006048 Bacteria 1126
180 Ga0075363_100301451 3300006048 Bacteria 930
181 Ga0075363_100332875 3300006048 Bacteria 885
182 Ga0075364_10131203 3300006051 Bacteria 1681
183 Ga0075364_10161287 3300006051 Bacteria 1513
184 Ga0075364_10177937 3300006051 Bacteria 1439
185 Ga0075364_10188523 3300006051 Bacteria 1396
186 Ga0075364_10523433 3300006051 Bacteria 811
187 Ga0075432_10174647 3300006058 Bacteria 837
188 Ga0075362_10031083 3300006177 Bacteria 2309
189 Ga0075362_10056513 3300006177 Bacteria 1766
190 Ga0075362_10141902 3300006177 Bacteria 1148
191 Ga0075362_10219497 3300006177 Bacteria 929
192 Ga0075367_10002993 3300006178 Bacteria 7906
193 Ga0075367_10015631 3300006178 Bacteria 4131
194 Ga0075367_10039713 3300006178 Bacteria 2745
195 Ga0075367_10077326 3300006178 Bacteria 2009
196 Ga0075367_10116915 3300006178 Bacteria 1641
197 Ga0075367_10118573 3300006178 Bacteria 1629
198 Ga0075367_10140357 3300006178 Bacteria 1496
199 Ga0075367_10148001 3300006178 Bacteria 1456
200 Ga0075367_10307874 3300006178 Bacteria 998
201 Ga0075369_10001157 3300006186 Bacteria 8907
202 Ga0075369_10008423 3300006186 Bacteria 3966
203 Ga0075369_10020074 3300006186 Bacteria 2734
204 Ga0075369_10058365 3300006186 Bacteria 1680
205 Ga0075369_10062446 3300006186 Bacteria 1627
206 Ga0075369_10070913 3300006186 Bacteria 1533
207 Ga0075369_10128222 3300006186 Bacteria 1151
208 Ga0075369_10175197 3300006186 Bacteria 986
209 Ga0075366_10005356 3300006195 Bacteria 6953
210 Ga0075366_10179281 3300006195 Bacteria 1287
211 Ga0075366_10418172 3300006195 Bacteria 826
212 Ga0097621_100059180 3300006237 Bacteria 3135
213 Ga0097621_100217989 3300006237 Bacteria 1662
214 Ga0097621_100424722 3300006237 Bacteria 1193
215 Ga0097621_101089209 3300006237 Bacteria 750
216 Ga0075370_10004301 3300006353 Bacteria 6897
217 Ga0075370_10006606 3300006353 Bacteria 5845
218 Ga0075370_10060852 3300006353 Bacteria 2151
219 Ga0075370_10083155 3300006353 Bacteria 1841
220 Ga0075370_10151398 3300006353 Bacteria 1359
221 Ga0075370_10193974 3300006353 Bacteria 1197
222 Ga0075370_10238967 3300006353 Bacteria 1075
223 Ga0075370_10654863 3300006353 Bacteria 638
224 Ga0068871_100036259 3300006358 Bacteria 3925
225 Ga0075428_100341164 3300006844 Bacteria 1609
226 Ga0075428_100372345 3300006844 Bacteria 1531
227 Ga0075430_100138044 3300006846 Bacteria 2031
228 Ga0075429_100532299 3300006880 Bacteria 1030
229 Ga0068865_100188398 3300006881 Bacteria 1593
230 Ga0097620_100149730 3300006931 Bacteria 2409
231 Ga0097620_100752115 3300006931 Bacteria 1064
232 Ga0099825_1027405 3300006941 Bacteria 2901
233 Ga0099823_1018479 3300006944 Bacteria 6721
234 Ga0079104_1000044 3300006946 Bacteria 185367
235 Ga0079104_1010264 3300006946 Bacteria 3098
236 Ga0079104_1013037 3300006946 Bacteria 2582
237 Ga0099826_10000071 3300006948 Bacteria 53307
238 Ga0099826_10063147 3300006948 Bacteria 2396
239 Ga0099826_10263439 3300006948 Bacteria 901
240 Ga0105244_10100660 3300009036 Bacteria 1414
241 Ga0105250_10067231 3300009092 Bacteria 1446
242 Ga0105250_10110873 3300009092 Bacteria 1123
243 Ga0105240_10006408 3300009093 Bacteria 17305
244 Ga0105240_10238268 3300009093 Bacteria 2111
245 Ga0105240_11142676 3300009093 Bacteria 827
246 Ga0111539_10126014 3300009094 Bacteria 3000
247 Ga0111539_10616218 3300009094 Bacteria 1264
248 Ga0105245_10280154 3300009098 Bacteria 1629
249 Ga0105245_10557569 3300009098 Bacteria 1168
250 Ga0105245_10828231 3300009098 Bacteria 964
251 Ga0105247_10324831 3300009101 Bacteria 1075
252 Ga0114129_10039885 3300009147 Bacteria 6624
253 Ga0114129_10134378 3300009147 Bacteria 3395
254 Ga0105243_10006759 3300009148 Bacteria 8849
255 Ga0105243_10081705 3300009148 Bacteria 2639
256 Ga0105243_10479925 3300009148 Bacteria 1173
257 Ga0105243_11085061 3300009148 Bacteria 808
258 Ga0105241_10197760 3300009174 Bacteria 1677
259 Ga0105241_10906272 3300009174 Bacteria 819
260 Ga0105242_10152004 3300009176 Bacteria 2019
261 Ga0105242_10891563 3300009176 Bacteria 888
262 Ga0105248_10077894 3300009177 Bacteria 3727
263 Ga0105248_10769494 3300009177 Bacteria 1086
264 Ga0105248_10832293 3300009177 Bacteria 1042
265 Ga0105248_11853285 3300009177 Bacteria 684
266 Ga0105237_10030303 3300009545 Bacteria 5497
267 Ga0105237_10061732 3300009545 Bacteria 3746
268 Ga0105237_10260453 3300009545 Bacteria 1737
269 Ga0105237_10340975 3300009545 Bacteria 1503
270 Ga0105237_10860403 3300009545 Bacteria 913
271 Ga0105237_11071292 3300009545 Bacteria 813
272 Ga0105238_10118785 3300009551 Bacteria 2624
273 Ga0105238_10261162 3300009551 Bacteria 1711
274 Ga0105238_10922997 3300009551 Bacteria 892
275 Ga0105249_10001039 3300009553 Bacteria 24545
276 Ga0105249_10059087 3300009553 Bacteria 3516
277 Ga0105249_10105017 3300009553 Bacteria 2663
278 Ga0105249_10517587 3300009553 Bacteria 1240
279 Ga0105249_10557109 3300009553 Bacteria 1197
280 Ga0123341_1000044 3300009765 Bacteria 52707
281 Ga0105239_10023525 3300010375 Bacteria 6786
282 Ga0105239_10147958 3300010375 Bacteria 2620
283 Ga0105239_10492903 3300010375 Bacteria 1393
284 Ga0105239_10704658 3300010375 Bacteria 1154
285 Ga0105239_10910710 3300010375 Bacteria 1009
286 Ga0105246_10069899 3300011119 Bacteria 2467
287 Ga0157339_1007446 3300012505 Bacteria 919
288 Ga0157342_1012805 3300012507 Bacteria 889
289 Ga0157338_1025190 3300012515 Bacteria 723
290 Ga0157373_10040827 3300013100 Bacteria 3320
291 Ga0157373_10145800 3300013100 Bacteria 1665
292 Ga0157371_10000002 3300013102 Bacteria 665040
293 Ga0157371_10051710 3300013102 Bacteria 2919
294 Ga0157370_10000211 3300013104 Bacteria 74012
295 Ga0157370_10421021 3300013104 Bacteria 1229
296 Ga0157369_10238175 3300013105 Bacteria 1901
297 Ga0157369_10270702 3300013105 Bacteria 1770
298 Ga0171462_1009 3300013250 Bacteria 344993
299 Ga0157378_10434649 3300013297 Bacteria 1300
300 Ga0163162_11377263 3300013306 Bacteria 802
301 Ga0157372_10582116 3300013307 Bacteria 1305
302 Ga0157375_10060268 3300013308 Bacteria 3763
303 Ga0157375_10735844 3300013308 Bacteria 1138
304 Ga0163163_10330721 3300014325 Bacteria 1578
305 Ga0163163_10410330 3300014325 Bacteria 1413
306 Ga0163163_10686487 3300014325 Bacteria 1087
307 Ga0157380_10026681 3300014326 Bacteria 4388
308 Ga0157380_11420697 3300014326 Bacteria 745
309 Ga0157377_10059883 3300014745 Bacteria 2172
310 Ga0157379_10010498 3300014968 Bacteria 8073
311 Ga0157376_10377837 3300014969 Bacteria 1364
312 Ga0157376_10992808 3300014969 Bacteria 862
313 Ga0163161_10056284 3300017792 Bacteria 2856
314 Ga0163161_10402324 3300017792 Bacteria 1098
315 Ga0214544_1000001 3300021320 Bacteria 783667
316 Ga0214544_1000018 3300021320 Bacteria 187095
317 Ga0214542_1000005 3300021321 Bacteria 389646
318 Ga0214542_1000307 3300021321 Bacteria 83288
319 Ga0214542_1015078 3300021321 Bacteria 8269
320 Ga0214545_1000003 3300021324 Bacteria 720274
321 Ga0214545_1035348 3300021324 Bacteria 1661
322 Ga0214543_1000002 3300021327 Bacteria 712733
323 Ga0214543_1000012 3300021327 Bacteria 338982
324 Ga0214543_1000195 3300021327 Bacteria 89886
325 Ga0228711_1002598 3300022739 Bacteria 27893
326 Ga0228710_1002752 3300022740 Bacteria 27893
327 Ga0209436_100007 3300025208 Bacteria 149841
328 Ga0209563_102920 3300025230 Bacteria 3692
329 Ga0207425_1005546 3300025245 Bacteria 3583
330 Ga0207425_1005811 3300025245 Bacteria 3465
331 Ga0207425_1007795 3300025245 Bacteria 2792
332 Ga0207425_1021884 3300025245 Bacteria 1352
333 Ga0207425_1037312 3300025245 Bacteria 938
334 Ga0209677_103599 3300025253 Bacteria 4914
335 Ga0209129_1001290 3300025258 Bacteria 14284
336 Ga0209129_1001482 3300025258 Bacteria 13045
337 Ga0209233_1000820 3300025261 Bacteria 13833
338 Ga0209233_1020687 3300025261 Bacteria 1719
339 Ga0209233_1052103 3300025261 Bacteria 827
340 Ga0209565_1000021 3300025263 Bacteria 406281
341 Ga0209673_1000005 3300025273 Bacteria 692788
342 Ga0209673_1000067 3300025273 Bacteria 249077
343 Ga0209673_1000294 3300025273 Bacteria 93050
344 Ga0209673_1000968 3300025273 Bacteria 35620
345 Ga0209673_1006587 3300025273 Bacteria 5563
346 Ga0209673_1008320 3300025273 Bacteria 4628
347 Ga0209673_1039849 3300025273 Bacteria 1351
348 Ga0209130_1000001 3300025284 Bacteria 831557
349 Ga0209130_1000235 3300025284 Bacteria 71379
350 Ga0209675_1000149 3300025291 Bacteria 93109
351 Ga0209676_1000014 3300025292 Bacteria 793514
352 Ga0209676_1004568 3300025292 Bacteria 7660
353 Ga0209676_1014385 3300025292 Bacteria 2978
354 Ga0209676_1022321 3300025292 Bacteria 2101
355 Ga0209025_1000260 3300025294 Bacteria 124240
356 Ga0209025_1000522 3300025294 Bacteria 73140
357 Ga0209025_1001148 3300025294 Bacteria 37707
358 Ga0209025_1001542 3300025294 Bacteria 29365
359 Ga0209025_1002894 3300025294 Bacteria 17153
360 Ga0209025_1011728 3300025294 Bacteria 5723
361 Ga0209025_1015802 3300025294 Bacteria 4515
362 Ga0209025_1047398 3300025294 Bacteria 1755
363 Ga0209025_1062800 3300025294 Bacteria 1375
364 Ga0209025_1062878 3300025294 Bacteria 1374
365 Ga0209025_1085713 3300025294 Bacteria 1050
366 Ga0209564_1000019 3300025295 Bacteria 573686
367 Ga0209564_1000092 3300025295 Bacteria 249018
368 Ga0209564_1000336 3300025295 Bacteria 90930
369 Ga0209564_1000455 3300025295 Bacteria 69085
370 Ga0209564_1001045 3300025295 Bacteria 33865
371 Ga0209564_1002205 3300025295 Bacteria 16256
372 Ga0209564_1019591 3300025295 Bacteria 2520
373 Ga0209564_1023165 3300025295 Bacteria 2166
374 Ga0209564_1024220 3300025295 Bacteria 2079
375 Ga0209564_1025025 3300025295 Bacteria 2022
376 Ga0209564_1082394 3300025295 Bacteria 623
377 Ga0209758_1000026 3300025297 Bacteria 582706
378 Ga0209758_1000113 3300025297 Bacteria 202528
379 Ga0209758_1000203 3300025297 Bacteria 132184
380 Ga0209758_1001957 3300025297 Bacteria 22263
381 Ga0209758_1005269 3300025297 Bacteria 10114
382 Ga0209758_1016444 3300025297 Bacteria 3757
383 Ga0209758_1021268 3300025297 Bacteria 3030
384 Ga0209758_1024965 3300025297 Bacteria 2642
385 Ga0209758_1025005 3300025297 Bacteria 2637
386 Ga0209758_1027504 3300025297 Bacteria 2428
387 Ga0209758_1032051 3300025297 Bacteria 2143
388 Ga0209758_1050289 3300025297 Bacteria 1463
389 Ga0209758_1090053 3300025297 Bacteria 901
390 Ga0209050_1006608 3300025298 Bacteria 6808
391 Ga0209050_1006975 3300025298 Bacteria 6507
392 Ga0209050_1007063 3300025298 Bacteria 6438
393 Ga0209256_1000170 3300025299 Bacteria 130504
394 Ga0209256_1000182 3300025299 Bacteria 122471
395 Ga0209256_1000475 3300025299 Bacteria 60194
396 Ga0209256_1000625 3300025299 Bacteria 48667
397 Ga0209256_1001533 3300025299 Bacteria 23225
398 Ga0209256_1002121 3300025299 Bacteria 17205
399 Ga0209256_1011067 3300025299 Bacteria 3666
400 Ga0209256_1028898 3300025299 Bacteria 1555
401 Ga0209256_1037619 3300025299 Bacteria 1259
402 Ga0207426_1000045 3300025302 Bacteria 422847
403 Ga0207426_1000213 3300025302 Bacteria 137311
404 Ga0207426_1000282 3300025302 Bacteria 104108
405 Ga0207426_1007399 3300025302 Bacteria 4603
406 Ga0207426_1014504 3300025302 Bacteria 2885
407 Ga0207426_1014578 3300025302 Bacteria 2875
408 Ga0209051_1000027 3300025303 Bacteria 412172
409 Ga0209051_1002417 3300025303 Bacteria 13419
410 Ga0209051_1004473 3300025303 Bacteria 8601
411 Ga0209051_1046772 3300025303 Bacteria 1485
412 Ga0209051_1048392 3300025303 Bacteria 1442
413 Ga0209051_1090810 3300025303 Bacteria 850
414 Ga0209257_1000691 3300025304 Bacteria 52348
415 Ga0209257_1001012 3300025304 Bacteria 38006
416 Ga0209257_1004723 3300025304 Bacteria 10200
417 Ga0209257_1013830 3300025304 Bacteria 3537
418 Ga0209257_1097072 3300025304 Bacteria 725
419 Ga0207697_10142880 3300025315 Bacteria 1039
420 Ga0207656_10108821 3300025321 Bacteria 1278
421 Ga0207710_10055505 3300025900 Bacteria 1786
422 Ga0207710_10072061 3300025900 Bacteria 1586
423 Ga0207688_10029829 3300025901 Bacteria 3006
424 Ga0207688_10109504 3300025901 Bacteria 1602
425 Ga0207688_10177792 3300025901 Bacteria 1268
426 Ga0207688_10309236 3300025901 Bacteria 967
427 Ga0207680_10277081 3300025903 Bacteria 1164
428 Ga0207647_10013465 3300025904 Bacteria 5667
429 Ga0207645_10126071 3300025907 Bacteria 1664
430 Ga0207705_10057184 3300025909 Bacteria 2813
431 Ga0207654_10062106 3300025911 Bacteria 2188
432 Ga0207654_10065549 3300025911 Bacteria 2139
433 Ga0207654_10069120 3300025911 Bacteria 2092
434 Ga0207654_10292045 3300025911 Bacteria 1106
435 Ga0207707_10046761 3300025912 Bacteria 3770
436 Ga0207695_10000006 3300025913 Bacteria 1135309
437 Ga0207671_10014700 3300025914 Bacteria 6173
438 Ga0207671_10327052 3300025914 Bacteria 1214
439 Ga0207663_10593912 3300025916 Bacteria 869
440 Ga0207660_10036633 3300025917 Bacteria 3411
441 Ga0207657_10098320 3300025919 Bacteria 2432
442 Ga0207657_10113701 3300025919 Bacteria 2233
443 Ga0207657_10379728 3300025919 Bacteria 1113
444 Ga0207657_10430543 3300025919 Bacteria 1036
445 Ga0207649_10141205 3300025920 Bacteria 1648
446 Ga0207649_10249054 3300025920 Bacteria 1279
447 Ga0207649_10842690 3300025920 Bacteria 717
448 Ga0207652_10023360 3300025921 Bacteria 5122
449 Ga0207681_10068436 3300025923 Bacteria 2466
450 Ga0207681_10498612 3300025923 Bacteria 996
451 Ga0207681_10554154 3300025923 Bacteria 946
452 Ga0207694_10164256 3300025924 Bacteria 1795
453 Ga0207694_10165446 3300025924 Bacteria 1788
454 Ga0207650_10463716 3300025925 Bacteria 1055
455 Ga0207644_10192733 3300025931 Bacteria 1603
456 Ga0207644_10628225 3300025931 Bacteria 893
457 Ga0207706_10024422 3300025933 Bacteria 5419
458 Ga0207706_10057307 3300025933 Bacteria 3432
459 Ga0207686_10082920 3300025934 Bacteria 2097
460 Ga0207709_10068948 3300025935 Bacteria 2237
461 Ga0207670_10347911 3300025936 Bacteria 1173
462 Ga0207669_10033791 3300025937 Bacteria 2890
463 Ga0207669_10485848 3300025937 Bacteria 985
464 Ga0207704_10027972 3300025938 Bacteria 3121
465 Ga0207704_10514269 3300025938 Bacteria 967
466 Ga0207665_10256041 3300025939 Bacteria 1295
467 Ga0207711_10393349 3300025941 Bacteria 1287
468 Ga0207711_10423180 3300025941 Bacteria 1239
469 Ga0207679_10572631 3300025945 Bacteria 1015
470 Ga0207667_10164362 3300025949 Bacteria 2282
471 Ga0207651_10046470 3300025960 Bacteria 2920
472 Ga0207651_10528808 3300025960 Bacteria 1023
473 Ga0207712_10002059 3300025961 Bacteria 13199
474 Ga0207712_10119224 3300025961 Bacteria 1993
475 Ga0207668_10158531 3300025972 Bacteria 1760
476 Ga0207668_10246103 3300025972 Bacteria 1449
477 Ga0207668_10576598 3300025972 Bacteria 978
478 Ga0207668_10862784 3300025972 Bacteria 804
479 Ga0207640_10413084 3300025981 Bacteria 1102
480 Ga0207658_10398316 3300025986 Bacteria 1209
481 Ga0207658_10828175 3300025986 Bacteria 841
482 Ga0207677_10077226 3300026023 Bacteria 2374
483 Ga0207677_10263275 3300026023 Bacteria 1406
484 Ga0207703_10142070 3300026035 Bacteria 2084
485 Ga0207703_10557029 3300026035 Bacteria 1081
486 Ga0207703_10902943 3300026035 Bacteria 846
487 Ga0207678_10035692 3300026067 Bacteria 4329
488 Ga0207678_10079006 3300026067 Bacteria 2818
489 Ga0207678_10131896 3300026067 Bacteria 2132
490 Ga0207678_10200935 3300026067 Bacteria 1704
491 Ga0207678_10604252 3300026067 Bacteria 962
492 Ga0207708_10042979 3300026075 Bacteria 3444
493 Ga0207702_10022544 3300026078 Bacteria 5221
494 Ga0207702_10694754 3300026078 Bacteria 1002
495 Ga0207641_10274170 3300026088 Bacteria 1584
496 Ga0207641_10874901 3300026088 Bacteria 891
497 Ga0207648_10089924 3300026089 Bacteria 2683
498 Ga0207676_10082940 3300026095 Bacteria 2609
499 Ga0207676_10876357 3300026095 Bacteria 879
500 Ga0207674_10031489 3300026116 Bacteria 5572
501 Ga0207674_10046886 3300026116 Bacteria 4434
502 Ga0207675_100196543 3300026118 Bacteria 1936
503 Ga0207675_100222835 3300026118 Bacteria 1817
504 Ga0207675_100336881 3300026118 Bacteria 1476
505 Ga0207683_10032928 3300026121 Bacteria 4503
506 Ga0207683_10106287 3300026121 Bacteria 2510
507 Ga0209281_1000129 3300027111 Bacteria 194490
508 Ga0209281_1000655 3300027111 Bacteria 37203
509 Ga0209281_1000805 3300027111 Bacteria 28809
510 Ga0209389_1000140 3300027296 Bacteria 63110
511 Ga0209371_1000012 3300027312 Bacteria 748304
512 Ga0209371_1000472 3300027312 Bacteria 39594
513 Ga0209371_1001239 3300027312 Bacteria 18271
514 Ga0209489_100775 3300027361 Bacteria 63110
515 Ga0209700_100798 3300027363 Bacteria 63028
516 Ga0209282_1000038 3300027666 Bacteria 128955
517 Ga0209282_1000323 3300027666 Bacteria 23657
518 Ga0209282_1051722 3300027666 Bacteria 2351
519 Ga0209813_10022390 3300027866 Bacteria 1787
520 Ga0209813_10035770 3300027866 Bacteria 1488
521 Ga0209813_10124828 3300027866 Bacteria 899
522 Ga0268266_10001288 3300028379 Bacteria 30547
523 Ga0268266_10029665 3300028379 Bacteria 4648
524 Ga0268266_10089824 3300028379 Bacteria 2691
525 Ga0268266_10171474 3300028379 Bacteria 1969
526 Ga0268266_10217032 3300028379 Bacteria 1756
527 Ga0268266_10330020 3300028379 Bacteria 1429
528 Ga0268266_10598029 3300028379 Bacteria 1059
529 Ga0268266_10858996 3300028379 Bacteria 877
530 Ga0268265_10805015 3300028380 Bacteria 916
531 Ga0268264_10000030 3300028381 Bacteria 418542
532 Ga0268264_10088538 3300028381 Bacteria 2665
533 Ga0307517_10000392 3300028786 Bacteria 74887
534 Ga0307517_10053505 3300028786 Bacteria 4018
535 Ga0307517_10352816 3300028786 Bacteria 798
536 Ga0307515_10010751 3300028794 Bacteria 17470
537 Ga0307515_10099536 3300028794 Bacteria 3529
538 Ga0307515_10397974 3300028794 Bacteria 1004
539 Ga0268256_1000013 3300030500 Bacteria 752103
540 Ga0268256_1004420 3300030500 Bacteria 5836
541 Ga0307511_10077584 3300030521 Bacteria 2364
542 Ga0307513_10001322 3300031456 Bacteria 35853
543 Ga0307513_10137393 3300031456 Bacteria 2377
544 Ga0307513_10256567 3300031456 Bacteria 1541
545 Ga0307513_10407625 3300031456 Bacteria 1092
546 Ga0307509_10005540 3300031507 Bacteria 17516
547 Ga0307509_10012410 3300031507 Bacteria 10191
548 Ga0307509_10119947 3300031507 Bacteria 2610
549 Ga0307509_10399802 3300031507 Bacteria 1081
550 Ga0307509_10476074 3300031507 Bacteria 938
551 Ga0307408_100237788 3300031548 Bacteria 1495
552 Ga0307408_100450104 3300031548 Bacteria 1117
553 Ga0307508_10000051 3300031616 Bacteria 134500
554 Ga0307508_10052399 3300031616 Bacteria 3624
555 Ga0307508_10060988 3300031616 Bacteria 3333
556 Ga0307508_10067924 3300031616 Bacteria 3134
557 Ga0307508_10097443 3300031616 Bacteria 2533
558 Ga0307516_10001211 3300031730 Bacteria 35950
559 Ga0307516_10003513 3300031730 Bacteria 20060
560 Ga0307516_10037984 3300031730 Bacteria 4809
561 Ga0307516_10275574 3300031730 Bacteria 1366
562 Ga0307516_10306367 3300031730 Bacteria 1263
563 Ga0307413_10183716 3300031824 Bacteria 1494
564 Ga0307410_10161173 3300031852 Bacteria 1681
565 Ga0307406_10378326 3300031901 Bacteria 1115
566 Ga0307406_10418996 3300031901 Bacteria 1066
567 Ga0307407_10166996 3300031903 Bacteria 1446
568 Ga0307412_10000922 3300031911 Bacteria 16792
569 Ga0315914_1002543 3300031967 Bacteria 27893
570 Ga0307409_100052103 3300031995 Bacteria 3136
571 Ga0307409_100199817 3300031995 Bacteria 1787
572 Ga0307409_100632366 3300031995 Bacteria 1062
573 Ga0307414_10994044 3300032004 Bacteria 772
574 Ga0307411_10402263 3300032005 Bacteria 1132
575 Ga0307411_10408919 3300032005 Bacteria 1124
576 Ga0307411_10738894 3300032005 Bacteria 861
577 Ga0307415_100240560 3300032126 Bacteria 1464
578 Ga0307415_100720003 3300032126 Bacteria 903
579 Ga0307510_10008010 3300033180 Bacteria 12572
580 Ga0307510_10009232 3300033180 Bacteria 11752
581 Ga0307510_10091891 3300033180 Bacteria 2874
582 Ga0315913_1001156 3300033430 Bacteria 27893
583 Ga0315915_1000018 3300033464 Bacteria 129799
584 Ga0373926_0031892 3300035083 Bacteria 1859
585 Ga0373923_0038193 3300035111 Bacteria 1967
586 Ga0373939_0038944 3300035114 Bacteria 1421
587 Ga0373931_0012955 3300035691 Bacteria 4050
588 Ga0373935_0015285 3300035692 Bacteria 4637
589 Ga0373933_0316103 3300035724 Bacteria 1012
590 Ga0373925_0334138 3300037068 Bacteria 1228
591 Ga0237819_07783 3300038705 Bacteria 1516
592 Ga0439439_0082230 3300041406 Bacteria 872
593 Ga0439465_0012279 3300041413 Bacteria 2680
594 Ga0439465_0014651 3300041413 Bacteria 2444
595 Ga0439465_0017784 3300041413 Bacteria 2221
596 Ga0451789_1320373 3300041443 Bacteria 979
597 Ga0451793_0833877 3300041452 Bacteria 1235
598 Ga0451835_0294912 3300041492 Bacteria 2336
599 Ga0451835_0715463 3300041492 Bacteria 692
600 Ga0451837_0008034 3300041494 Bacteria 658
601 Ga0451839_0155811 3300041496 Bacteria 972
602 Ga0451839_0966459 3300041496 Bacteria 885
603 Ga0451841_1205379 3300041498 Bacteria 1973
604 Ga0451847_0701608 3300041503 Bacteria 928
605 Ga0451849_0541387 3300041505 Bacteria 1429
606 Ga0451849_0570312 3300041505 Bacteria 838
607 Ga0451849_0658622 3300041505 Bacteria 860
608 Ga0451849_0739266 3300041505 Bacteria 699
609 Ga0451851_0833168 3300041507 Bacteria 1916
610 Ga0451853_0671269 3300041512 Bacteria 900
611 Ga0451853_2803001 3300041512 Bacteria 644
612 Ga0439445_0167846 3300042004 Bacteria 642
613 Ga0439432_014871 3300042006 Bacteria 2631
614 Ga0439432_027227 3300042006 Bacteria 1868
615 Ga0439449_0007729 3300042007 Bacteria 4084
616 Ga0439449_0026273 3300042007 Bacteria 2173
617 Ga0439462_0022361 3300042015 Bacteria 1654
618 Ga0439462_0064861 3300042015 Bacteria 989
619 Ga0450920_053273 3300042122 Bacteria 813
620 Ga0439434_0020910 3300042435 Bacteria 1966
621 Ga0439459_0009683 3300042438 Bacteria 1669
622 Ga0450918_002564 3300042531 Bacteria 3433
623 Ga0466969_0086893 3300044656 Bacteria 1485
624 Ga0466972_0033010 3300044658 Bacteria 2539
625 Ga0466972_0087033 3300044658 Bacteria 1484
626 Ga0466965_0137957 3300044683 Bacteria 1268
627 Ga0466966_0000610 3300044684 Bacteria 22674
628 Ga0466961_0000124 3300044693 Bacteria 51384
629 Ga0466964_0267288 3300044706 Bacteria 850
630 Ga0466968_0051502 3300044735 Bacteria 1759
631 Ga0466959_0061235 3300045049 Bacteria 2737
632 Ga0495617_009312 3300046452 Bacteria 3371
633 Ga0495617_092591 3300046452 Bacteria 985
634 Ga0495592_0414968 3300046454 Bacteria 850
635 Ga0495603_0007138 3300046455 Bacteria 6706
636 Ga0495603_0024002 3300046455 Bacteria 3689
637 Ga0495590_0130245 3300046457 Bacteria 904
638 Ga0495629_0026056 3300046459 Bacteria 4155
639 Ga0495638_0000475 3300046460 Bacteria 48300
640 Ga0495638_0005749 3300046460 Bacteria 9130
641 Ga0495638_0052465 3300046460 Bacteria 2540
642 Ga0495638_0160086 3300046460 Bacteria 1299
643 Ga0495651_0032791 3300046462 Bacteria 4051
644 Ga0495651_0124663 3300046462 Bacteria 1887
645 Ga0495653_0205731 3300046463 Bacteria 1333
646 Ga0495650_0095026 3300046471 Bacteria 1127
647 Ga0495650_0164761 3300046471 Bacteria 788
648 Ga0495605_0003451 3300046474 Bacteria 9403
649 Ga0495605_0099694 3300046474 Bacteria 1337
650 Ga0495664_0080043 3300046477 Bacteria 1958
651 Ga0495585_0043282 3300046492 Bacteria 2519
652 Ga0495585_0047449 3300046492 Bacteria 2392
653 Ga0495594_0113865 3300046499 Bacteria 1526
654 Ga0495607_0000697 3300046501 Bacteria 32441
655 Ga0495607_0014846 3300046501 Bacteria 5062
656 Ga0495583_0030954 3300046506 Bacteria 2600
657 Ga0495583_0070141 3300046506 Bacteria 1542
658 Ga0495606_0093908 3300046507 Bacteria 1839
659 Ga0495606_0193121 3300046507 Bacteria 1166
660 Ga0495606_0308698 3300046507 Bacteria 854
661 Ga0495608_0246503 3300046511 Bacteria 1115
662 Ga0495610_0035010 3300046512 Bacteria 2582
663 Ga0495610_0036676 3300046512 Bacteria 2503
664 Ga0495616_0009361 3300046513 Bacteria 5741
665 Ga0495616_0113891 3300046513 Bacteria 1254
666 Ga0495620_0011838 3300046515 Bacteria 4535
667 Ga0495620_0102183 3300046515 Bacteria 1142
668 Ga0495628_0458413 3300046516 Bacteria 925
669 Ga0495628_0750170 3300046516 Bacteria 686
670 Ga0495630_0081544 3300046517 Bacteria 2441
671 Ga0495631_0012439 3300046518 Bacteria 4154
672 Ga0495631_0082092 3300046518 Bacteria 1390
673 Ga0495631_0143918 3300046518 Bacteria 1023
674 Ga0495632_0021912 3300046519 Bacteria 3434
675 Ga0495632_0042216 3300046519 Bacteria 2287
676 Ga0495632_0068598 3300046519 Bacteria 1708
677 Ga0495632_0219567 3300046519 Bacteria 860
678 Ga0495632_0321702 3300046519 Bacteria 683
679 Ga0495643_0026331 3300046522 Bacteria 3283
680 Ga0495643_0071034 3300046522 Bacteria 1828
681 Ga0495643_0104346 3300046522 Bacteria 1449
682 Ga0495643_0112480 3300046522 Bacteria 1383
683 Ga0495643_0193244 3300046522 Bacteria 981
684 Ga0495644_0068026 3300046523 Bacteria 1338
685 Ga0495648_0028240 3300046524 Bacteria 3741
686 Ga0495648_0041644 3300046524 Bacteria 2898
687 Ga0495648_0043160 3300046524 Bacteria 2830
688 Ga0495648_0093652 3300046524 Bacteria 1675
689 Ga0495663_0040163 3300046525 Bacteria 1420
690 Ga0495666_0039895 3300046526 Bacteria 2279
691 Ga0495666_0216057 3300046526 Bacteria 879
692 Ga0495654_0000122 3300046530 Bacteria 86717
693 Ga0495654_0089343 3300046530 Bacteria 1432
694 Ga0495640_0007377 3300046533 Bacteria 8655
695 Ga0495598_0022520 3300046537 Bacteria 1687
696 Ga0495609_0029333 3300046538 Bacteria 2505
697 Ga0495609_0138545 3300046538 Bacteria 1039
698 Ga0495609_0180022 3300046538 Bacteria 890
699 Ga0495597_0005508 3300046542 Bacteria 6697
700 Ga0495597_0061568 3300046542 Bacteria 1634
701 Ga0495597_0081875 3300046542 Bacteria 1380
702 Ga0495597_0176732 3300046542 Bacteria 864
703 Ga0495633_0016222 3300046558 Bacteria 3848
704 Ga0495633_0134140 3300046558 Bacteria 1145
705 Ga0495633_0142925 3300046558 Bacteria 1106
706 Ga0495633_0177625 3300046558 Bacteria 980
707 Ga0495656_0116356 3300046615 Bacteria 1257
708 Ga0495668_0006686 3300046616 Bacteria 7508
709 Ga0495668_0019058 3300046616 Bacteria 3960
710 Ga0495668_0238381 3300046616 Bacteria 996
711 Ga0495611_0089472 3300046648 Bacteria 1422
712 Ga0495611_0130673 3300046648 Bacteria 1171
713 Ga0495611_0211511 3300046648 Bacteria 903
714 Ga0495625_0011467 3300046660 Bacteria 7226
715 Ga0495625_0085040 3300046660 Bacteria 2196
716 Ga0495625_0134998 3300046660 Bacteria 1668
717 Ga0495625_0157846 3300046660 Bacteria 1521
718 Ga0495625_0567067 3300046660 Bacteria 686
719 Ga0495635_0004183 3300046663 Bacteria 10013
720 Ga0495659_0102406 3300046664 Bacteria 1110
721 Ga0495661_0062750 3300046665 Bacteria 2200
722 Ga0495661_0118040 3300046665 Bacteria 1469
723 Ga0495588_0009969 3300046674 Bacteria 4404
724 Ga0495588_0135215 3300046674 Bacteria 1301
725 Ga0495623_0229800 3300046679 Bacteria 1053
726 Ga0495658_0320330 3300046683 Bacteria 983
727 Ga0495669_0082174 3300046684 Bacteria 1480
728 Ga0495613_0139892 3300046689 Bacteria 1730
729 Ga0495624_0016398 3300046690 Bacteria 4986
730 Ga0495624_0220545 3300046690 Bacteria 1150
731 Ga0495624_0273426 3300046690 Bacteria 1020
732 Ga0495670_0070486 3300046691 Bacteria 1769
733 Ga0495671_0053020 3300046692 Bacteria 2014
734 Ga0495671_0069331 3300046692 Bacteria 1733
735 Ga0495649_0201636 3300046694 Bacteria 1033
736 Ga0495600_0005392 3300046809 Bacteria 7711
737 Ga0495600_0621838 3300046809 Bacteria 655
738 Ga0495660_0022531 3300046810 Bacteria 3595
739 Ga0495581_0282479 3300047315 Bacteria 970
740 Ga0495604_0017983 3300047317 Bacteria 5656
741 Ga0495604_0633633 3300047317 Bacteria 683
742 Ga0495636_0050396 3300047318 Bacteria 1743
743 Ga0495636_0112417 3300047318 Bacteria 1199
744 Ga0495636_0135577 3300047318 Bacteria 1097
745 Ga0495674_0607347 3300047319 Bacteria 866
746 Ga0495676_0056474 3300047321 Bacteria 3104
747 Ga0495676_0067566 3300047321 Bacteria 2765
748 Ga0495683_0083541 3300047323 Bacteria 1555
749 Ga0495683_0210562 3300047323 Bacteria 872
750 Ga0495687_000722 3300047443 Bacteria 36591
751 Ga0495687_008590 3300047443 Bacteria 5827
752 Ga0495677_0173425 3300047445 Bacteria 835
753 Ga0495673_0058242 3300047469 Bacteria 1666
754 Ga0495681_0053412 3300047470 Bacteria 1892
755 Ga0495681_0147187 3300047470 Bacteria 991
756 Ga0495681_0238557 3300047470 Bacteria 723
757 Ga0495684_0392864 3300047471 Bacteria 976
758 Ga0495686_0148562 3300047472 Bacteria 1377
759 Ga0495593_0080512 3300047673 Bacteria 1685
760 Ga0495593_0127556 3300047673 Bacteria 1293
761 Ga0495615_0024434 3300048090 Bacteria 1394
762 Ga0495615_0054486 3300048090 Bacteria 1038
763 Ga0495626_0070685 3300048091 Bacteria 1570
764 Ga0495626_0107361 3300048091 Bacteria 1212
765 Ga0495626_0124031 3300048091 Bacteria 1108
766 Ga0496100_0250714 3300048903 Bacteria 1309
767 Ga0496101_0453909 3300048904 Bacteria 1011
768 Ga0496102_0179347 3300048905 Bacteria 1995
769 Ga0496102_0210896 3300048905 Bacteria 1831
770 Ga0496102_0261022 3300048905 Bacteria 1633
771 Ga0496103_0033739 3300048906 Bacteria 3127
772 Ga0496104_0065692 3300048907 Bacteria 3443
773 Ga0496104_0089310 3300048907 Bacteria 2944
774 Ga0496104_0366715 3300048907 Bacteria 1353
775 Ga0496104_0371974 3300048907 Bacteria 1342
776 Ga0496104_0415966 3300048907 Bacteria 1257
777 Ga0496104_0542953 3300048907 Bacteria 1073
778 Ga0496105_0228114 3300048908 Bacteria 1514
779 Ga0496105_0252150 3300048908 Bacteria 1429
780 Ga0496106_0000355 3300048909 Bacteria 32404
781 Ga0496106_0000765 3300048909 Bacteria 23253
782 Ga0496106_0361939 3300048909 Bacteria 1165
783 Ga0496106_1054562 3300048909 Bacteria 638
784 Ga0496107_0193401 3300048910 Bacteria 1512
785 Ga0496107_0205141 3300048910 Bacteria 1465
786 Ga0496107_0467417 3300048910 Bacteria 936
787 Ga0496107_0703893 3300048910 Bacteria 743
788 Ga0496108_0168853 3300048911 Bacteria 1892
789 Ga0496109_0304420 3300048912 Bacteria 1503
790 Ga0496110_0294672 3300048913 Bacteria 1478
791 Ga0496110_0543292 3300048913 Bacteria 1056
792 Ga0496110_1134035 3300048913 Bacteria 690
793 Ga0496111_0000161 3300048914 Bacteria 30179
794 Ga0496111_0301663 3300048914 Bacteria 1187
795 Ga0496112_0038171 3300048915 Bacteria 4690
796 Ga0496112_0081591 3300048915 Bacteria 3198
797 Ga0496112_0242117 3300048915 Bacteria 1756
798 Ga0496113_0079333 3300048916 Bacteria 2513
799 Ga0496114_0074011 3300048917 Bacteria 2868
800 Ga0496114_0347666 3300048917 Bacteria 1311
801 Ga0496114_0352134 3300048917 Bacteria 1302
802 Ga0496114_0438122 3300048917 Bacteria 1157
803 Ga0496114_1011355 3300048917 Bacteria 715
804 Ga0496115_0140404 3300048918 Bacteria 1993
805 Ga0496115_0181795 3300048918 Bacteria 1738
806 Ga0496115_0347057 3300048918 Bacteria 1211
807 Ga0496115_0557753 3300048918 Bacteria 915
808 Ga0496116_0000243 3300048919 Bacteria 99201
809 Ga0496116_0035198 3300048919 Bacteria 3520
810 Ga0496116_0050570 3300048919 Bacteria 2768
811 Ga0496116_0068841 3300048919 Bacteria 2253
812 Ga0496116_0098206 3300048919 Bacteria 1758
813 Ga0496116_0146092 3300048919 Bacteria 1322
814 Ga0496116_0180012 3300048919 Bacteria 1133
815 Ga0496117_0000016 3300048920 Bacteria 523642
816 Ga0496117_0250894 3300048920 Bacteria 965
817 Ga0496117_0312662 3300048920 Bacteria 827
818 Ga0496118_0000618 3300048921 Bacteria 58468
819 Ga0496118_0000758 3300048921 Bacteria 52123
820 Ga0496118_0018278 3300048921 Bacteria 6330
821 Ga0496118_0062355 3300048921 Bacteria 2753
822 Ga0496118_0086264 3300048921 Bacteria 2182
823 Ga0496118_0290398 3300048921 Bacteria 904
824 Ga0496119_0020692 3300048922 Bacteria 4785
825 Ga0496119_0037805 3300048922 Bacteria 3129
826 Ga0496119_0039638 3300048922 Bacteria 3025
827 Ga0496119_0047807 3300048922 Bacteria 2658
828 Ga0496119_0330102 3300048922 Bacteria 744
829 Ga0496120_0000056 3300048923 Bacteria 180367
830 Ga0496120_0168459 3300048923 Bacteria 1085
831 Ga0496121_0000212 3300048924 Bacteria 127508
832 Ga0496121_0000490 3300048924 Bacteria 75983
833 Ga0496121_0005284 3300048924 Bacteria 16633
834 Ga0496121_0010821 3300048924 Bacteria 10209
835 Ga0496121_0012780 3300048924 Bacteria 9094
836 Ga0496121_0025866 3300048924 Bacteria 5553
837 Ga0496121_0035931 3300048924 Bacteria 4427
838 Ga0496121_0043504 3300048924 Bacteria 3888
839 Ga0496121_0070165 3300048924 Bacteria 2824
840 Ga0496121_0101889 3300048924 Bacteria 2213
841 Ga0496121_0156854 3300048924 Bacteria 1669
842 Ga0496121_0216720 3300048924 Bacteria 1351
843 Ga0496121_0297240 3300048924 Bacteria 1097
844 Ga0496121_0383331 3300048924 Bacteria 926
845 Ga0496121_0388202 3300048924 Bacteria 918
846 Ga0496121_0485862 3300048924 Bacteria 787
847 Ga0496122_0000002 3300048925 Bacteria 905834
848 Ga0496122_0000106 3300048925 Bacteria 193672
849 Ga0496122_0000821 3300048925 Bacteria 59417
850 Ga0496122_0014427 3300048925 Bacteria 7643
851 Ga0496122_0017699 3300048925 Bacteria 6637
852 Ga0496122_0076238 3300048925 Bacteria 2360
853 Ga0496122_0082285 3300048925 Bacteria 2237
854 Ga0496122_0220255 3300048925 Bacteria 1090
855 Ga0496122_0232361 3300048925 Bacteria 1047
856 Ga0496123_0000002 3300048926 Bacteria 1811682
857 Ga0496123_0000022 3300048926 Bacteria 361832
858 Ga0496123_0000872 3300048926 Bacteria 47911
859 Ga0496123_0023293 3300048926 Bacteria 4742
860 Ga0496124_0000080 3300048927 Bacteria 210439
861 Ga0496124_0000861 3300048927 Bacteria 49579
862 Ga0496124_0004878 3300048927 Bacteria 15431
863 Ga0496124_0010860 3300048927 Bacteria 9165
864 Ga0496124_0070834 3300048927 Bacteria 2891
865 Ga0496124_0071440 3300048927 Bacteria 2877
866 Ga0496124_0078437 3300048927 Bacteria 2722
867 Ga0496124_0083348 3300048927 Bacteria 2623
868 Ga0496124_0217545 3300048927 Bacteria 1439
869 Ga0496124_0454531 3300048927 Bacteria 872
870 Ga0496125_0000884 3300048928 Bacteria 47543
871 Ga0496125_0012755 3300048928 Bacteria 8310
872 Ga0496125_0017939 3300048928 Bacteria 6728
873 Ga0496125_0093394 3300048928 Bacteria 2245
874 Ga0496125_0152717 3300048928 Bacteria 1583
875 Ga0496125_0186194 3300048928 Bacteria 1377
876 Ga0496125_0247645 3300048928 Bacteria 1126
877 Ga0496126_0000554 3300048929 Bacteria 71982
878 Ga0496126_0031476 3300048929 Bacteria 5011
879 Ga0496126_0035266 3300048929 Bacteria 4690
880 Ga0496126_0040035 3300048929 Bacteria 4346
881 Ga0496126_0047672 3300048929 Bacteria 3922
882 Ga0496126_0338791 3300048929 Bacteria 1232
883 Ga0496126_0661002 3300048929 Bacteria 816
884 Ga0496126_0954233 3300048929 Bacteria 646
885 Ga0495678_093929 3300049459 Bacteria 1051
886 Ga0495678_119790 3300049459 Bacteria 885
887 Ga0495682_0022972 3300049460 Bacteria 2330
888 Ga0495682_0142163 3300049460 Bacteria 857
889 Ga0501032_0175641 3300049569 Bacteria 1403
890 Ga0501033_0234037 3300049570 Bacteria 1304
891 Ga0501040_0149053 3300049576 Bacteria 1650
892 Ga0501043_0493959 3300049579 Bacteria 915
893 Ga0501046_0298107 3300049580 Bacteria 1178
894 Ga0501046_0426917 3300049580 Bacteria 955
895 Ga0501047_0013443 3300049581 Bacteria 7760
896 Ga0501047_0062731 3300049581 Bacteria 3585
897 Ga0501048_0113852 3300049582 Bacteria 1911
898 Ga0501068_0094612 3300049584 Bacteria 1847
899 Ga0501069_0152351 3300049585 Bacteria 1329
900 Ga0501074_0248955 3300049590 Bacteria 1264
901 Ga0501083_0183352 3300049744 Bacteria 1366
902 Ga0501044_0005038 3300049823 Bacteria 14756
903 Ga0501045_0077606 3300049824 Bacteria 2448
904 nmdc:mga03683_133364_c1 3300050489 Bacteria 1113
905 nmdc:mga03n38_116525_c1 3300050490 Bacteria 1308
906 nmdc:mga03n38_191024_c1 3300050490 Bacteria 1055
907 nmdc:mga03n38_262522_c1 3300050490 Bacteria 916
908 nmdc:mga03n38_57184_c1 3300050490 Bacteria 1763
909 nmdc:mga00v17_120638_c1 3300050491 Bacteria 1669
910 nmdc:mga00v17_208578_c1 3300050491 Bacteria 1264
911 nmdc:mga00v17_241926_c1 3300050491 Bacteria 1170
912 nmdc:mga00v17_361451_c1 3300050491 Bacteria 944
913 nmdc:mga00v17_3_c1 3300050491 Bacteria 242367
914 nmdc:mga00v17_610338_c1 3300050491 Bacteria 703
915 nmdc:mga00v17_643630_c1 3300050491 Bacteria 682
916 nmdc:mga00v17_73752_c1 3300050491 Bacteria 2120
917 nmdc:mga0yw44_105055_c1 3300050492 Bacteria 1804
918 nmdc:mga0yw44_128_c2 3300050492 Bacteria 13634
919 nmdc:mga0yw44_14433_c1 3300050492 Bacteria 4196
920 nmdc:mga0yw44_16961_c1 3300050492 Bacteria 3949
921 nmdc:mga0yw44_173880_c1 3300050492 Bacteria 1415
922 nmdc:mga0yw44_174167_c1 3300050492 Bacteria 1414
923 nmdc:mga0yw44_22166_c1 3300050492 Bacteria 3557
924 nmdc:mga0yw44_226943_c1 3300050492 Bacteria 1239
925 nmdc:mga0yw44_279131_c1 3300050492 Bacteria 1116
926 nmdc:mga0yw44_372467_c1 3300050492 Bacteria 963
927 nmdc:mga0yw44_4892_c2 3300050492 Bacteria 4759
928 nmdc:mga0yw44_526297_c1 3300050492 Bacteria 802
929 nmdc:mga0k408_1383_c1 3300050493 Bacteria 13098
930 nmdc:mga0k408_168347_c1 3300050493 Bacteria 1306
931 nmdc:mga0k408_180506_c1 3300050493 Bacteria 1259
932 nmdc:mga0k408_186098_c1 3300050493 Bacteria 1239
933 nmdc:mga0k408_71765_c1 3300050493 Bacteria 2021
934 nmdc:mga0k408_86721_c1 3300050493 Bacteria 1838
935 nmdc:mga06z11_11929_c1 3300050494 Bacteria 3764
936 nmdc:mga06z11_121100_c1 3300050494 Bacteria 1460
937 nmdc:mga06z11_134937_c1 3300050494 Bacteria 1390
938 nmdc:mga06z11_193209_c1 3300050494 Bacteria 1179
939 nmdc:mga06z11_240677_c1 3300050494 Bacteria 1063
940 nmdc:mga06z11_287022_c1 3300050494 Bacteria 976
941 nmdc:mga06z11_293678_c1 3300050494 Bacteria 965
942 nmdc:mga06z11_297023_c1 3300050494 Bacteria 960
943 nmdc:mga06z11_5003_c1 3300050494 Bacteria 5269
944 nmdc:mga06z11_507743_c1 3300050494 Bacteria 731
945 nmdc:mga06z11_7911_c1 3300050494 Bacteria 4402
946 nmdc:mga06z11_80852_c1 3300050494 Bacteria 1743
947 nmdc:mga04h51_24731_c1 3300050495 Bacteria 1842
948 nmdc:mga04h51_32606_c1 3300050495 Bacteria 1653
949 nmdc:mga04h51_70588_c1 3300050495 Bacteria 1219
950 nmdc:mga07m45_139712_c1 3300050496 Bacteria 1403
951 nmdc:mga07m45_3676_c1 3300050496 Bacteria 7416
952 nmdc:mga07m45_51883_c2 3300050496 Bacteria 1963
953 nmdc:mga07m45_52506_c1 3300050496 Bacteria 2301
954 nmdc:mga07m45_5718_c1 3300050496 Bacteria 6219
955 nmdc:mga07m45_73781_c1 3300050496 Bacteria 1943
956 nmdc:mga07m45_8545_c1 3300050496 Bacteria 5269
957 nmdc:mga05p37_190489_c1 3300050507 Bacteria 2490
958 nmdc:mga05p37_521040_c1 3300050507 Bacteria 1360
959 nmdc:mga09592_446558_c1 3300050508 Bacteria 1116
960 nmdc:mga0qj67_464114_c1 3300050509 Bacteria 1019
961 nmdc:mga0qj67_76368_c1 3300050509 Bacteria 2679
962 nmdc:mga08y16_415999_c1 3300050511 Bacteria 1374
963 nmdc:mga08y16_65581_c1 3300050511 Bacteria 3790
964 nmdc:mga0rr50_293273_c1 3300050513 Bacteria 1359
965 nmdc:mga0sz30_12371_c1 3300050516 Bacteria 3320
966 nmdc:mga0sz30_294193_c1 3300050516 Bacteria 724
967 nmdc:mga0sz30_34918_c1 3300050516 Bacteria 2096
968 nmdc:mga0sz30_37069_c1 3300050516 Bacteria 2040
969 nmdc:mga0sz30_4699_c1 3300050516 Bacteria 4957
970 nmdc:mga0sz30_49798_c2 3300050516 Bacteria 1346
971 nmdc:mga0sz30_51562_c1 3300050516 Bacteria 1746
972 nmdc:mga0sz30_65067_c1 3300050516 Bacteria 1563
973 nmdc:mga0sz30_982_c1 3300050516 Bacteria 10245
974 Ga0500610_0072093 3300053079 Bacteria 1801
975 Ga0500610_0156237 3300053079 Bacteria 1139
976 Ga0495655_0062339 3300053083 Bacteria 1021
977 Ga0495619_0104837 3300053085 Bacteria 1928
978 Ga0500578_0150466 3300053086 Bacteria 1450
979 Ga0500643_000055 3300053087 Bacteria 134904
980 Ga0500647_0134699 3300053091 Bacteria 1163
981 Ga0500651_0066988 3300053093 Bacteria 2236
982 Ga0500651_0312622 3300053093 Bacteria 899
983 Ga0500566_0000041 3300053094 Bacteria 65580
984 Ga0500640_197320 3300053095 Bacteria 707
985 Ga0500641_0026061 3300053096 Bacteria 2267
986 Ga0500648_117904 3300053097 Bacteria 1457
987 Ga0500650_0225016 3300053098 Bacteria 848
988 Ga0500654_121663 3300053099 Bacteria 1024
989 Ga0500557_000017 3300053105 Bacteria 96699
990 Ga0500557_037856 3300053105 Bacteria 1498
991 Ga0500560_000033 3300053107 Bacteria 15664
992 Ga0500569_008436 3300053109 Bacteria 2356
993 Ga0500569_014543 3300053109 Bacteria 1950
994 Ga0500572_009460 3300053111 Bacteria 2304
995 Ga0500592_018694 3300053116 Bacteria 1113
996 Ga0500594_0001940 3300053118 Bacteria 4473
997 Ga0500594_0070772 3300053118 Bacteria 1025
998 Ga0500594_0185452 3300053118 Bacteria 680
999 Ga0500595_000891 3300053119 Bacteria 17010
1000 Ga0500595_001184 3300053119 Bacteria 14382
1001 Ga0500595_062568 3300053119 Bacteria 1120
1002 Ga0500608_165189 3300053122 Bacteria 955
1003 Ga0500618_000285 3300053125 Bacteria 38522
1004 Ga0500618_042067 3300053125 Bacteria 1047
1005 Ga0500621_083986 3300053126 Bacteria 1274
1006 Ga0500642_0000171 3300053130 Bacteria 26884
1007 Ga0500642_0085072 3300053130 Bacteria 1457
1008 Ga0500642_0088117 3300053130 Bacteria 1432
1009 Ga0500652_209416 3300053131 Bacteria 788
1010 Ga0500655_036861 3300053133 Bacteria 953
1011 Ga0500658_0020608 3300053134 Bacteria 2490
1012 Ga0500559_0022060 3300053136 Bacteria 2700
1013 Ga0500559_0030989 3300053136 Bacteria 2294
1014 Ga0500559_0319043 3300053136 Bacteria 728
1015 Ga0500561_0000034 3300053137 Bacteria 28171
1016 Ga0500564_166616 3300053138 Bacteria 929
1017 Ga0500568_0000109 3300053139 Bacteria 76714
1018 Ga0500568_0000202 3300053139 Bacteria 52432
1019 Ga0500568_0003149 3300053139 Bacteria 9399
1020 Ga0500568_0083646 3300053139 Bacteria 1209
1021 Ga0500573_0041459 3300053140 Bacteria 2657
1022 Ga0500577_0122383 3300053142 Bacteria 1084
1023 Ga0500577_0321596 3300053142 Bacteria 676
1024 Ga0500588_0071588 3300053146 Bacteria 1138
1025 Ga0500603_013184 3300053150 Bacteria 1913
1026 Ga0500604_0013214 3300053151 Bacteria 2234
1027 Ga0500606_122139 3300053152 Bacteria 867
1028 Ga0500616_0000472 3300053153 Bacteria 52191
1029 Ga0500616_0098621 3300053153 Bacteria 1432
1030 Ga0500619_211016 3300053154 Bacteria 649
1031 Ga0500620_130632 3300053155 Bacteria 879
1032 Ga0500622_0000134 3300053156 Bacteria 78418
1033 Ga0500622_0018187 3300053156 Bacteria 3737
1034 Ga0500622_0029086 3300053156 Bacteria 2907
1035 Ga0500622_0085531 3300053156 Bacteria 1573
1036 Ga0500624_000323 3300053157 Bacteria 16314
1037 Ga0500634_0192563 3300053161 Bacteria 904
1038 Ga0500638_121376 3300053162 Bacteria 1195
1039 Ga0500636_0000107 3300053177 Bacteria 42896
1040 Ga0500636_0141890 3300053177 Bacteria 1328
1041 Ga0500636_0252480 3300053177 Bacteria 898
1042 Ga0500637_0000240 3300053178 Bacteria 20394
1043 Ga0500645_036326 3300053730 Bacteria 1466
1044 Ga0500552_000443 3300053733 Bacteria 3833
1045 Ga0500596_006036 3300053735 Bacteria 2082
1046 Ga0500599_001227 3300053736 Bacteria 2930
1047 Ga0500601_012419 3300053737 Bacteria 961
1048 Ga0587072_023949 3300059643 Bacteria 1100
1049 Ga0501082_0039710 3300060353 Bacteria 4060

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0454531 Ga0496124_0454531_284_826 179
2 3300048922 Ga0496119_0037805 Ga0496119_0037805_2085_2729 182
3 3300048924 Ga0496121_0000490 Ga0496121_0000490_5259_5903 182
4 3300048925 Ga0496122_0082285 Ga0496122_0082285_649_1293 182
5 3300048928 Ga0496125_0000884 Ga0496125_0000884_34021_34665 182
6 3300048929 Ga0496126_0035266 Ga0496126_0035266_92_736 182
7 3300025245 Ga0207425_1007795 Ga0207425_10077952 184
8 3300026023 Ga0207677_10077226 Ga0207677_100772263 184
9 3300026035 Ga0207703_10557029 Ga0207703_105570292 184
10 iso_pu_bacteria 2513237087 2513591697 184
11 iso_pu_bacteria 2828305725 2828307559 184
12 iso_pu_bacteria 2775506901 2776265753 185
13 iso_pu_bacteria 2894232714 2894232959 185
14 iso_pu_bacteria 8006984368 8006984706 185
15 3300009036 Ga0105244_10100660 Ga0105244_101006602 186
16 3300009147 Ga0114129_10039885 Ga0114129_100398851 186
17 3300031507 Ga0307509_10399802 Ga0307509_103998021 186
18 3300031507 Ga0307509_10476074 Ga0307509_104760742 186
19 3300046501 Ga0495607_0000697 Ga0495607_0000697_29282_29881 186
20 3300048091 Ga0495626_0107361 Ga0495626_0107361_557_1156 186
21 3300048919 Ga0496116_0050570 Ga0496116_0050570_56_721 186
22 3300048924 Ga0496121_0070165 Ga0496121_0070165_1629_2273 186
23 3300048925 Ga0496122_0000821 Ga0496122_0000821_21528_22172 186
24 3300048926 Ga0496123_0000872 Ga0496123_0000872_39134_39778 186
25 3300048928 Ga0496125_0017939 Ga0496125_0017939_4593_5237 186
26 3300048929 Ga0496126_0338791 Ga0496126_0338791_466_1110 186
27 3300050507 nmdc:mga05p37_521040_c1 nmdc:mga05p37_521040_c1_729_1322 186
28 3300050516 nmdc:mga0sz30_294193_c1 nmdc:mga0sz30_294193_c1_12_575 186
29 iso_pu_bacteria 2509276019 2509377457 186
30 iso_pu_bacteria 2509276021 2509391255 186
31 iso_pu_bacteria 2509276033 2509445434 186
32 iso_pu_bacteria 2510065019 2510135991 186
33 iso_pu_bacteria 2510065057 2510302947 186
34 iso_pu_bacteria 2510461069 2510840866 186
35 iso_pu_bacteria 2510461076 2510892531 186
36 iso_pu_bacteria 2510917030 2511200350 186
37 iso_pu_bacteria 2511231027 2511389048 186
38 iso_pu_bacteria 2511231052 2511496939 186
39 iso_pu_bacteria 2512047086 2512528845 186
40 iso_pu_bacteria 2512875026 2512969043 186
41 iso_pu_bacteria 2513237084 2513568289 186
42 iso_pu_bacteria 2513237085 2513578170 186
43 iso_pu_bacteria 2513237086 2513583380 186
44 iso_pu_bacteria 2513237089 2513605565 186
45 iso_pu_bacteria 2513237091 2513614946 186
46 iso_pu_bacteria 2513237093 2513634805 186
47 iso_pu_bacteria 2513237103 2513713831 186
48 iso_pu_bacteria 2513237140 2513883934 186
49 iso_pu_bacteria 2513237143 2513901600 186
50 iso_pu_bacteria 2513237144 2513910530 186
51 iso_pu_bacteria 2513237146 2513927961 186
52 iso_pu_bacteria 2513237156 2513986235 186
53 iso_pu_bacteria 2513237159 2514002288 186
54 iso_pu_bacteria 2513237160 2514007707 186
55 iso_pu_bacteria 2513237162 2514021928 186
56 iso_pu_bacteria 2515075009 2515109071 186
57 iso_pu_bacteria 2515154107 2515612198 186
58 iso_pu_bacteria 2515154113 2515632425 186
59 iso_pu_bacteria 2515154114 2515640688 186
60 iso_pu_bacteria 2515154116 2515661645 186
61 iso_pu_bacteria 2515154134 2515737888 186
62 iso_pu_bacteria 2516143018 2516206697 186
63 iso_pu_bacteria 2516653046 2516895831 186
64 iso_pu_bacteria 2516653077 2517041414 186
65 iso_pu_bacteria 2516653085 2517079951 186
66 iso_pu_bacteria 2517093000 2517097970 186
67 iso_pu_bacteria 2517287029 2517410251 186
68 iso_pu_bacteria 2517487022 2517566204 186
69 iso_pu_bacteria 2524023207 2524449167 186
70 iso_pu_bacteria 2529292951 2530649223 186
71 iso_pu_bacteria 2537561587 2537873171 186
72 iso_pu_bacteria 2551306084 2551678699 186
73 iso_pu_bacteria 2551306084 2551681937 186
74 iso_pu_bacteria 2551306085 2551683258 186
75 iso_pu_bacteria 2551306086 2551696700 186
76 iso_pu_bacteria 2551306087 2551699863 186
77 iso_pu_bacteria 2551306089 2551709114 186
78 iso_pu_bacteria 2551306089 2551714117 186
79 iso_pu_bacteria 2551306090 2551716762 186
80 iso_pu_bacteria 2551306091 2551731410 186
81 iso_pu_bacteria 2551306092 2551739065 186
82 iso_pu_bacteria 2551306093 2551744240 186
83 iso_pu_bacteria 2554235003 2554245651 186
84 iso_pu_bacteria 2558860100 2558864992 186
85 iso_pu_bacteria 2558860242 2559296520 186
86 iso_pu_bacteria 2582581298 2585222486 186
87 iso_pu_bacteria 2582581866 2585395795 186
88 iso_pu_bacteria 2585427526 2585525809 186
89 iso_pu_bacteria 2585427528 2585541661 186
90 iso_pu_bacteria 2585427529 2585544562 186
91 iso_pu_bacteria 2585427593 2585840120 186
92 iso_pu_bacteria 2599185170 2599420971 186
93 iso_pu_bacteria 2599185210 2599602985 186
94 iso_pu_bacteria 2600255279 2601610606 186
95 iso_pu_bacteria 2600255308 2601747064 186
96 iso_pu_bacteria 2615840624 2616294764 186
97 iso_pu_bacteria 2643221568 2643853748 186
98 iso_pu_bacteria 2643221693 2644520647 186
99 iso_pu_bacteria 2657244999 2657685760 186
100 iso_pu_bacteria 2690316117 2692319201 186
101 iso_pu_bacteria 2718217882 2719184467 186
102 iso_pu_bacteria 2718217927 2719389663 186
103 iso_pu_bacteria 2718217997 2719668323 186
104 iso_pu_bacteria 2718218009 2719728487 186
105 iso_pu_bacteria 2718218199 2720489016 186
106 iso_pu_bacteria 2718218232 2720609708 186
107 iso_pu_bacteria 2718218233 2720617139 186
108 iso_pu_bacteria 2718218235 2720628271 186
109 iso_pu_bacteria 2718218269 2720772235 186
110 iso_pu_bacteria 2718218363 2721144175 186
111 iso_pu_bacteria 2718218365 2721156273 186
112 iso_pu_bacteria 2718218366 2721161550 186
113 iso_pu_bacteria 2718218423 2721402431 186
114 iso_pu_bacteria 2721755514 2722842695 186
115 iso_pu_bacteria 2721755556 2723029655 186
116 iso_pu_bacteria 2721755684 2723564024 186
117 iso_pu_bacteria 2721755685 2723569559 186
118 iso_pu_bacteria 2721755809 2724036265 186
119 iso_pu_bacteria 2721755810 2724041512 186
120 iso_pu_bacteria 2721755819 2724092264 186
121 iso_pu_bacteria 2721755822 2724101106 186
122 iso_pu_bacteria 2721755823 2724112632 186
123 iso_pu_bacteria 2724679232 2725947040 186
124 iso_pu_bacteria 2728369352 2730110188 186
125 iso_pu_bacteria 2728369365 2730160583 186
126 iso_pu_bacteria 2728369397 2730295806 186
127 iso_pu_bacteria 2738541333 2739036275 186
128 iso_pu_bacteria 2751185821 2753463805 186
129 iso_pu_bacteria 2765235802 2765463889 186
130 iso_pu_bacteria 2765235942 2766069236 186
131 iso_pu_bacteria 2767802442 2770197920 186
132 iso_pu_bacteria 2775506902 2776269003 186
133 iso_pu_bacteria 2775506904 2776283860 186
134 iso_pu_bacteria 2791355082 2792583712 186
135 iso_pu_bacteria 2791355091 2792621525 186
136 iso_pu_bacteria 2791355092 2792627787 186
137 iso_pu_bacteria 2791355094 2792640254 186
138 iso_pu_bacteria 2791355256 2793297466 186
139 iso_pu_bacteria 2791355259 2793317384 186
140 iso_pu_bacteria 2791355260 2793325315 186
141 iso_pu_bacteria 2791355261 2793330458 186
142 iso_pu_bacteria 2791355262 2793336623 186
143 iso_pu_bacteria 2791355263 2793342541 186
144 iso_pu_bacteria 2791355264 2793345351 186
145 iso_pu_bacteria 2791355265 2793354905 186
146 iso_pu_bacteria 2791355266 2793362315 186
147 iso_pu_bacteria 2791355267 2793365139 186
148 iso_pu_bacteria 2802428858 2802720677 186
149 iso_pu_bacteria 2802428859 2802727866 186
150 iso_pu_bacteria 2802428860 2802733019 186
151 iso_pu_bacteria 2802428861 2802740246 186
152 iso_pu_bacteria 2802428862 2802746188 186
153 iso_pu_bacteria 2802428863 2802753524 186
154 iso_pu_bacteria 2802429268 2804754976 186
155 iso_pu_bacteria 2802429605 2805927116 186
156 iso_pu_bacteria 2802429606 2805934460 186
157 iso_pu_bacteria 2802429633 2806046378 186
158 iso_pu_bacteria 2802429634 2806053086 186
159 iso_pu_bacteria 2802429635 2806059706 186
160 iso_pu_bacteria 2802429636 2806068556 186
161 iso_pu_bacteria 2802429637 2806074978 186
162 iso_pu_bacteria 2808606387 2808986971 186
163 iso_pu_bacteria 2818991439 2819560726 186
164 iso_pu_bacteria 2838016132 2838016460 186
165 iso_pu_bacteria 2838022645 2838028359 186
166 iso_pu_bacteria 2838035591 2838041331 186
167 iso_pu_bacteria 2838042994 2838048098 186
168 iso_pu_bacteria 2838048938 2838050094 186
169 iso_pu_bacteria 2838061910 2838068251 186
170 iso_pu_bacteria 2838068647 2838068997 186
171 iso_pu_bacteria 2838074704 2838078610 186
172 iso_pu_bacteria 2838661181 2838665724 186
173 iso_pu_bacteria 2838668709 2838669582 186
174 iso_pu_bacteria 2838675328 2838677783 186
175 iso_pu_bacteria 2838680041 2838685329 186
176 iso_pu_bacteria 2838686498 2838687694 186
177 iso_pu_bacteria 2838694306 2838700066 186
178 iso_pu_bacteria 2838701080 2838701954 186
179 iso_pu_bacteria 2838707686 2838713170 186
180 iso_pu_bacteria 2838714209 2838717312 186
181 iso_pu_bacteria 2838719591 2838722079 186
182 iso_pu_bacteria 2838724970 2838728061 186
183 iso_pu_bacteria 2838729681 2838735581 186
184 iso_pu_bacteria 2838742623 2838748483 186
185 iso_pu_bacteria 2839993093 2839993841 186
186 iso_pu_bacteria 2840764183 2840766845 186
187 iso_pu_bacteria 2841846520 2841849722 186
188 iso_pu_bacteria 2841851746 2841854241 186
189 iso_pu_bacteria 2841859092 2841861243 186
190 iso_pu_bacteria 2841864319 2841868619 186
191 iso_pu_bacteria 2842110456 2842111377 186
192 iso_pu_bacteria 2842118031 2842123534 186
193 iso_pu_bacteria 2842124991 2842127530 186
194 iso_pu_bacteria 2842130223 2842132676 186
195 iso_pu_bacteria 2842152218 2842154670 186
196 iso_pu_bacteria 2842156927 2842159391 186
197 iso_pu_bacteria 2842163707 2842163830 186
198 iso_pu_bacteria 2842170452 2842173168 186
199 iso_pu_bacteria 2842175837 2842178290 186
200 iso_pu_bacteria 2842180545 2842183040 186
201 iso_pu_bacteria 2842187318 2842190419 186
202 iso_pu_bacteria 2842192696 2842198512 186
203 iso_pu_bacteria 2842198810 2842204335 186
204 iso_pu_bacteria 2842205361 2842209348 186
205 iso_pu_bacteria 2842211629 2842214733 186
206 iso_pu_bacteria 2842217011 2842223822 186
207 iso_pu_bacteria 2842224351 2842227453 186
208 iso_pu_bacteria 2842229732 2842232751 186
209 iso_pu_bacteria 2842237096 2842242583 186
210 iso_pu_bacteria 2842243621 2842247006 186
211 iso_pu_bacteria 2842250916 2842251623 186
212 iso_pu_bacteria 2842257432 2842259308 186
213 iso_pu_bacteria 2842264693 2842265334 186
214 iso_pu_bacteria 2842271015 2842272274 186
215 iso_pu_bacteria 2842278818 2842282608 186
216 iso_pu_bacteria 2842291075 2842296650 186
217 iso_pu_bacteria 2842304105 2842309246 186
218 iso_pu_bacteria 2842311132 2842313492 186
219 iso_pu_bacteria 2842317721 2842323390 186
220 iso_pu_bacteria 2842341865 2842342568 186
221 iso_pu_bacteria 2842363717 2842365657 186
222 iso_pu_bacteria 2842370503 2842374672 186
223 iso_pu_bacteria 2842377471 2842383051 186
224 iso_pu_bacteria 2842384541 2842390183 186
225 iso_pu_bacteria 2842395702 2842400368 186
226 iso_pu_bacteria 2842402390 2842405706 186
227 iso_pu_bacteria 2842409023 2842412290 186
228 iso_pu_bacteria 2842415677 2842418936 186
229 iso_pu_bacteria 2842422224 2842423143 186
230 iso_pu_bacteria 2842428310 2842428613 186
231 iso_pu_bacteria 2842434925 2842435227 186
232 iso_pu_bacteria 2842441272 2842441910 186
233 iso_pu_bacteria 2842447887 2842448041 186
234 iso_pu_bacteria 2842462802 2842463039 186
235 iso_pu_bacteria 2842469257 2842469559 186
236 iso_pu_bacteria 2842489311 2842489601 186
237 iso_pu_bacteria 2842495871 2842500433 186
238 iso_pu_bacteria 2842515876 2842518490 186
239 iso_pu_bacteria 2842521101 2842525843 186
240 iso_pu_bacteria 2842871566 2842873433 186
241 iso_pu_bacteria 2844454524 2844460689 186
242 iso_pu_bacteria 2847417321 2847422293 186
243 iso_pu_bacteria 2848992105 2848998256 186
244 iso_pu_bacteria 2850079185 2850084709 186
245 iso_pu_bacteria 2854896431 2854899811 186
246 iso_pu_bacteria 2854916844 2854920969 186
247 iso_pu_bacteria 2855825444 2855829352 186
248 iso_pu_bacteria 2855839649 2855844451 186
249 iso_pu_bacteria 2855872281 2855875676 186
250 iso_pu_bacteria 2857516855 2857518249 186
251 iso_pu_bacteria 2858800743 2858806088 186
252 iso_pu_bacteria 2894652903 2894653227 186
253 iso_pu_bacteria 2896384573 2896389292 186
254 iso_pu_bacteria 2899792073 2899793524 186
255 iso_pu_bacteria 2899845264 2899847719 186
256 iso_pu_bacteria 2904578770 2904579468 186
257 iso_pu_bacteria 2913295892 2913297002 186
258 iso_pu_bacteria 2915980308 2915982753 186
259 iso_pu_bacteria 2915986958 2915988129 186
260 iso_pu_bacteria 2915993759 2915993827 186
261 iso_pu_bacteria 2916000859 2916005470 186
262 iso_pu_bacteria 2916007675 2916008816 186
263 iso_pu_bacteria 2916014648 2916021498 186
264 iso_pu_bacteria 2916021584 2916021659 186
265 iso_pu_bacteria 2916028427 2916028530 186
266 iso_pu_bacteria 2916035215 2916037525 186
267 iso_pu_bacteria 2916041962 2916042011 186
268 iso_pu_bacteria 2916048683 2916048783 186
269 iso_pu_bacteria 2916055098 2916059867 186
270 iso_pu_bacteria 2916061851 2916067091 186
271 iso_pu_bacteria 2916068649 2916074781 186
272 iso_pu_bacteria 2916076590 2916077496 186
273 iso_pu_bacteria 2919100787 2919103071 186
274 iso_pu_bacteria 2919114240 2919117577 186
275 iso_pu_bacteria 2919119836 2919120865 186
276 iso_pu_bacteria 2919166419 2919168220 186
277 iso_pu_bacteria 2920760137 2920764922 186
278 iso_pu_bacteria 2921201388 2921205317 186
279 iso_pu_bacteria 2921208531 2921212107 186
280 iso_pu_bacteria 2921237296 2921237334 186
281 iso_pu_bacteria 2921244191 2921249223 186
282 iso_pu_bacteria 2921250672 2921253115 186
283 iso_pu_bacteria 2921257292 2921259462 186
284 iso_pu_bacteria 2921263974 2921268090 186
285 iso_pu_bacteria 2921282425 2921288642 186
286 iso_pu_bacteria 2921289301 2921295094 186
287 iso_pu_bacteria 2921296804 2921298801 186
288 iso_pu_bacteria 2924144063 2924150423 186
289 iso_pu_bacteria 2924150972 2924157188 186
290 iso_pu_bacteria 2924158325 2924161701 186
291 iso_pu_bacteria 2924165586 2924171202 186
292 iso_pu_bacteria 2924172951 2924175043 186
293 iso_pu_bacteria 2924179722 2924182714 186
294 iso_pu_bacteria 2924186466 2924189117 186
295 iso_pu_bacteria 2924193448 2924196813 186
296 iso_pu_bacteria 2924200457 2924200537 186
297 iso_pu_bacteria 2924207177 2924212086 186
298 iso_pu_bacteria 2924214083 2924217765 186
299 iso_pu_bacteria 2924221636 2924223655 186
300 iso_pu_bacteria 2924228884 2924233404 186
301 iso_pu_bacteria 2926754445 2926759015 186
302 iso_pu_bacteria 2926760298 2926763468 186
303 iso_pu_bacteria 2928521798 2928522272 186
304 iso_pu_bacteria 2933006813 2933009947 186
305 iso_pu_bacteria 2933011516 2933014116 186
306 iso_pu_bacteria 2933016740 2933020663 186
307 iso_pu_bacteria 2933570622 2933575653 186
308 iso_pu_bacteria 2933586486 2933587931 186
309 iso_pu_bacteria 2933594066 2933595916 186
310 iso_pu_bacteria 2933599457 2933599664 186
311 iso_pu_bacteria 2935894831 2935899543 186
312 iso_pu_bacteria 2935901341 2935902930 186
313 iso_pu_bacteria 2936367885 2936374150 186
314 iso_pu_bacteria 2936375103 2936375331 186
315 iso_pu_bacteria 2936381700 2936383143 186
316 iso_pu_bacteria 2936996657 2936998401 186
317 iso_pu_bacteria 2937002841 2937002993 186
318 iso_pu_bacteria 2937009748 2937009842 186
319 iso_pu_bacteria 2937016420 2937020004 186
320 iso_pu_bacteria 2937023124 2937025160 186
321 iso_pu_bacteria 2937029754 2937032865 186
322 iso_pu_bacteria 2937036028 2937041944 186
323 iso_pu_bacteria 2937042894 2937049090 186
324 iso_pu_bacteria 2937049772 2937054580 186
325 iso_pu_bacteria 2937056579 2937058646 186
326 iso_pu_bacteria 2937063883 2937063922 186
327 iso_pu_bacteria 2937071275 2937077741 186
328 iso_pu_bacteria 2937078374 2937081125 186
329 iso_pu_bacteria 2937084907 2937090076 186
330 iso_pu_bacteria 2937091812 2937094422 186
331 iso_pu_bacteria 2937098957 2937101438 186
332 iso_pu_bacteria 2937106411 2937108024 186
333 iso_pu_bacteria 2937113482 2937115422 186
334 iso_pu_bacteria 2937119839 2937120089 186
335 iso_pu_bacteria 2937126314 2937128216 186
336 iso_pu_bacteria 2954011201 2954014303 186
337 iso_pu_bacteria 2957375807 2957377369 186
338 iso_pu_bacteria 2957382221 2957382269 186
339 iso_pu_bacteria 2957388812 2957395522 186
340 iso_pu_bacteria 2957395598 2957397980 186
341 iso_pu_bacteria 2957402308 2957404285 186
342 iso_pu_bacteria 2957408893 2957414782 186
343 iso_pu_bacteria 2957415311 2957421116 186
344 iso_pu_bacteria 2957422303 2957424619 186
345 iso_pu_bacteria 2957430029 2957431348 186
346 iso_pu_bacteria 2957437181 2957441401 186
347 iso_pu_bacteria 2957443900 2957446013 186
348 iso_pu_bacteria 2957450854 2957451114 186
349 iso_pu_bacteria 2957457609 2957461747 186
350 iso_pu_bacteria 2957464669 2957465972 186
351 iso_pu_bacteria 2957471148 2957474521 186
352 iso_pu_bacteria 2957478035 2957483292 186
353 iso_pu_bacteria 2957484790 2957491264 186
354 iso_pu_bacteria 2957491536 2957496577 186
355 iso_pu_bacteria 2957498199 2957502015 186
356 iso_pu_bacteria 2957505466 2957505533 186
357 iso_pu_bacteria 2960584000 2960584081 186
358 iso_pu_bacteria 2960591022 2960593909 186
359 iso_pu_bacteria 2960597568 2960603098 186
360 iso_pu_bacteria 2960603979 2960604158 186
361 iso_pu_bacteria 2960610863 2960610942 186
362 iso_pu_bacteria 2960617483 2960622307 186
363 iso_pu_bacteria 2960624210 2960624367 186
364 iso_pu_bacteria 2960631154 2960637884 186
365 iso_pu_bacteria 2960637947 2960637983 186
366 iso_pu_bacteria 2960645483 2960649240 186
367 iso_pu_bacteria 2960652885 2960653278 186
368 iso_pu_bacteria 2960660292 2960663687 186
369 iso_pu_bacteria 2960667422 2960667508 186
370 iso_pu_bacteria 2960674078 2960676581 186
371 iso_pu_bacteria 2960680706 2960683244 186
372 iso_pu_bacteria 2960693952 2960700386 186
373 iso_pu_bacteria 2964607997 2964611034 186
374 iso_pu_bacteria 2964615318 2964615463 186
375 iso_pu_bacteria 2964621998 2964628164 186
376 iso_pu_bacteria 2964628898 2964628964 186
377 iso_pu_bacteria 2964636051 2964640183 186
378 iso_pu_bacteria 2964643177 2964643434 186
379 iso_pu_bacteria 2964649959 2964653973 186
380 iso_pu_bacteria 2964656573 2964656666 186
381 iso_pu_bacteria 2964663802 2964664054 186
382 iso_pu_bacteria 2964670856 2964676917 186
383 iso_pu_bacteria 2964678106 2964682321 186
384 iso_pu_bacteria 2964685014 2964690732 186
385 iso_pu_bacteria 2964691889 2964695938 186
386 iso_pu_bacteria 2964698721 2964698852 186
387 iso_pu_bacteria 2964705432 2964707586 186
388 iso_pu_bacteria 2964712639 2964717768 186
389 iso_pu_bacteria 2964719344 2964721809 186
390 iso_pu_bacteria 2967664464 2967664506 186
391 iso_pu_bacteria 2967671571 2967672461 186
392 iso_pu_bacteria 2967678726 2967683263 186
393 iso_pu_bacteria 2967686174 2967690160 186
394 iso_pu_bacteria 2967693043 2967698573 186
395 iso_pu_bacteria 2967699805 2967706179 186
396 iso_pu_bacteria 2967706974 2967711839 186
397 iso_pu_bacteria 2967714385 2967718646 186
398 iso_pu_bacteria 2967721400 2967723159 186
399 iso_pu_bacteria 2967728569 2967730016 186
400 iso_pu_bacteria 2967735183 2967737466 186
401 iso_pu_bacteria 2967742019 2967748071 186
402 iso_pu_bacteria 2967748971 2967749230 186
403 iso_pu_bacteria 2967755722 2967755982 186
404 iso_pu_bacteria 2967762386 2967762535 186
405 iso_pu_bacteria 2967769361 2967769401 186
406 iso_pu_bacteria 2967775926 2967777265 186
407 iso_pu_bacteria 2970019648 2970019696 186
408 iso_pu_bacteria 2970026789 2970027030 186
409 iso_pu_bacteria 2970033650 2970033909 186
410 iso_pu_bacteria 2970040964 2970044090 186
411 iso_pu_bacteria 2970047711 2970051034 186
412 iso_pu_bacteria 2970054988 2970058363 186
413 iso_pu_bacteria 2970061556 2970065197 186
414 iso_pu_bacteria 2970068827 2970075852 186
415 iso_pu_bacteria 2970076120 2970077957 186
416 iso_pu_bacteria 2970082768 2970084517 186
417 iso_pu_bacteria 2970088815 2970091854 186
418 iso_pu_bacteria 2970095765 2970097702 186
419 iso_pu_bacteria 2970102677 2970102937 186
420 iso_pu_bacteria 2970109326 2970111390 186
421 iso_pu_bacteria 2970116247 2970119002 186
422 iso_pu_bacteria 2970122695 2970124091 186
423 iso_pu_bacteria 2970129317 2970135384 186
424 iso_pu_bacteria 2970136068 2970141699 186
425 iso_pu_bacteria 2970143518 2970146300 186
426 iso_pu_bacteria 2970149975 2970152183 186
427 iso_pu_bacteria 2970156795 2970160094 186
428 iso_pu_bacteria 2970164137 2970164822 186
429 iso_pu_bacteria 2970170962 2970171238 186
430 iso_pu_bacteria 2970177841 2970179965 186
431 iso_pu_bacteria 2970184632 2970191449 186
432 iso_pu_bacteria 2970191845 2970195056 186
433 iso_pu_bacteria 2977516862 2977521727 186
434 iso_pu_bacteria 2977523885 2977525815 186
435 iso_pu_bacteria 2977530762 2977535509 186
436 iso_pu_bacteria 2977537788 2977539891 186
437 iso_pu_bacteria 2977544691 2977545656 186
438 iso_pu_bacteria 2977551784 2977556209 186
439 iso_pu_bacteria 2977558990 2977559116 186
440 iso_pu_bacteria 2977565890 2977566026 186
441 iso_pu_bacteria 2977572785 2977574537 186
442 iso_pu_bacteria 2977579622 2977584975 186
443 iso_pu_bacteria 2978969890 2978970847 186
444 iso_pu_bacteria 2979089926 2979091497 186
445 iso_pu_bacteria 2979095461 2979097017 186
446 iso_pu_bacteria 2979100975 2979101309 186
447 iso_pu_bacteria 2984509177 2984510734 186
448 iso_pu_bacteria 2984518228 2984518565 186
449 iso_pu_bacteria 2984537506 2984539084 186
450 iso_pu_bacteria 2984587000 2984587956 186
451 iso_pu_bacteria 2984601300 2984605782 186
452 iso_pu_bacteria 2996893221 2996894462 186
453 iso_pu_bacteria 3002141150 3002142273 186
454 iso_pu_bacteria 639633055 639645162 186
455 iso_pu_bacteria 648276728 648735463 186
456 iso_pu_bacteria 650716007 650842938 186
457 iso_pu_bacteria 8003570095 8003574350 186
458 iso_pu_bacteria 8003992118 8003996975 186
459 iso_pu_bacteria 8003999396 8004004673 186
460 iso_pu_bacteria 8005275841 8005278008 186
461 iso_pu_bacteria 8005282627 8005286223 186
462 iso_pu_bacteria 8005289223 8005295500 186
463 iso_pu_bacteria 8005301065 8005306331 186
464 iso_pu_bacteria 8005307578 8005307702 186
465 iso_pu_bacteria 8005376324 8005380036 186
466 iso_pu_bacteria 8005382845 8005383439 186
467 iso_pu_bacteria 8005395548 8005399033 186
468 iso_pu_bacteria 8005430974 8005434716 186
469 iso_pu_bacteria 8005460587 8005467440 186
470 iso_pu_bacteria 8005497431 8005502529 186
471 iso_pu_bacteria 8005556819 8005563542 186
472 iso_pu_bacteria 8005563573 8005565315 186
473 iso_pu_bacteria 8005570704 8005572383 186
474 iso_pu_bacteria 8005619151 8005623737 186
475 iso_pu_bacteria 8005668836 8005673957 186
476 iso_pu_bacteria 8005688590 8005693973 186
477 iso_pu_bacteria 8005695170 8005701191 186
478 iso_pu_bacteria 8018127388 8018131883 186
479 iso_pu_bacteria 8018150411 8018153733 186
480 iso_pu_bacteria 8018163183 8018165724 186
481 iso_pu_bacteria 8018176218 8018176557 186
482 iso_pu_bacteria 8023680758 8023687887 186
483 iso_pu_bacteria 8024479707 8024484826 186
484 iso_pu_bacteria 8024501048 8024507141 186
485 iso_pu_bacteria 8049293176 8049298090 186
486 iso_pu_bacteria 8054460903 8054464557 186
487 iso_pu_bacteria 8056375014 8056377692 186
488 iso_pu_bacteria 8056382006 8056382471 186
489 iso_pu_bacteria 8057874678 8057877802 186
490 3300005843 Ga0068860_100137173 Ga0068860_1001371732 187
491 3300014968 Ga0157379_10010498 Ga0157379_100104982 187
492 3300025292 Ga0209676_1004568 Ga0209676_10045685 187
493 3300025298 Ga0209050_1006975 Ga0209050_10069755 187
494 3300025941 Ga0207711_10423180 Ga0207711_104231802 187
495 3300028381 Ga0268264_10088538 Ga0268264_100885383 187
496 3300031616 Ga0307508_10067924 Ga0307508_100679242 187
497 3300031911 Ga0307412_10000922 Ga0307412_1000092218 187
498 3300046542 Ga0495597_0005508 Ga0495597_0005508_284_886 187
499 3300047443 Ga0495687_000722 Ga0495687_000722_7691_8293 187
500 3300048919 Ga0496116_0068841 Ga0496116_0068841_43_687 187
501 3300048927 Ga0496124_0217545 Ga0496124_0217545_59_703 187
502 iso_pu_bacteria 2507262055 2507511238 187
503 iso_pu_bacteria 2508501009 2508545040 187
504 iso_pu_bacteria 2508501042 2508693786 187
505 iso_pu_bacteria 2513237092 2513623677 187
506 iso_pu_bacteria 2513237094 2513640865 187
507 iso_pu_bacteria 2513237095 2513650794 187
508 iso_pu_bacteria 2513237101 2513693802 187
509 iso_pu_bacteria 2513237104 2513719730 187
510 iso_pu_bacteria 2513237139 2513874849 187
511 iso_pu_bacteria 2513237161 2514010431 187
512 iso_pu_bacteria 2515154112 2515625187 187
513 iso_pu_bacteria 2517093001 2517100857 187
514 iso_pu_bacteria 2524023205 2524437952 187
515 iso_pu_bacteria 2528768022 2528849252 187
516 iso_pu_bacteria 2599185292 2599907674 187
517 iso_pu_bacteria 2617270735 2617350527 187
518 iso_pu_bacteria 2617270741 2617373359 187
519 iso_pu_bacteria 2643221569 2643858732 187
520 iso_pu_bacteria 2643221594 2643982108 187
521 iso_pu_bacteria 2643221621 2644120498 187
522 iso_pu_bacteria 2643221733 2644728096 187
523 iso_pu_bacteria 2643221736 2644742395 187
524 iso_pu_bacteria 2721755755 2723843409 187
525 iso_pu_bacteria 2744054633 2745082317 187
526 iso_pu_bacteria 2791355196 2793061791 187
527 iso_pu_bacteria 2791355199 2793077866 187
528 iso_pu_bacteria 2802429603 2805916852 187
529 iso_pu_bacteria 2808606395 2809034212 187
530 iso_pu_bacteria 2816332527 2818238390 187
531 iso_pu_bacteria 2821123053 2821127246 187
532 iso_pu_bacteria 2824600985 2824607948 187
533 iso_pu_bacteria 2824609381 2824611491 187
534 iso_pu_bacteria 2824653114 2824657229 187
535 iso_pu_bacteria 2824661429 2824663387 187
536 iso_pu_bacteria 2824671348 2824675252 187
537 iso_pu_bacteria 2824679649 2824684024 187
538 iso_pu_bacteria 2824687955 2824690119 187
539 iso_pu_bacteria 2824696289 2824698670 187
540 iso_pu_bacteria 2824704595 2824708265 187
541 iso_pu_bacteria 2824732956 2824740251 187
542 iso_pu_bacteria 2824746037 2824746066 187
543 iso_pu_bacteria 2824753945 2824754480 187
544 iso_pu_bacteria 2824763712 2824765474 187
545 iso_pu_bacteria 2824773399 2824773523 187
546 iso_pu_bacteria 2838122688 2838129087 187
547 iso_pu_bacteria 2838736955 2838740610 187
548 iso_pu_bacteria 2841760612 2841763820 187
549 iso_pu_bacteria 2841840854 2841844451 187
550 iso_pu_bacteria 2841941048 2841943395 187
551 iso_pu_bacteria 2841949485 2841953876 187
552 iso_pu_bacteria 2841957949 2841962132 187
553 iso_pu_bacteria 2841966195 2841971408 187
554 iso_pu_bacteria 2841974524 2841981223 187
555 iso_pu_bacteria 2841983080 2841990370 187
556 iso_pu_bacteria 2842038055 2842042467 187
557 iso_pu_bacteria 2842045827 2842050510 187
558 iso_pu_bacteria 2842140634 2842144481 187
559 iso_pu_bacteria 2844104063 2844109276 187
560 iso_pu_bacteria 2847939898 2847944032 187
561 iso_pu_bacteria 2851182111 2851183073 187
562 iso_pu_bacteria 2851246043 2851251383 187
563 iso_pu_bacteria 2857509624 2857512410 187
564 iso_pu_bacteria 2857531043 2857534773 187
565 iso_pu_bacteria 2857537821 2857540166 187
566 iso_pu_bacteria 2857576091 2857578390 187
567 iso_pu_bacteria 2858950400 2858954127 187
568 iso_pu_bacteria 2874590934 2874597979 187
569 iso_pu_bacteria 2874604998 2874611680 187
570 iso_pu_bacteria 2874628541 2874633900 187
571 iso_pu_bacteria 2874645413 2874651507 187
572 iso_pu_bacteria 2876761206 2876768757 187
573 iso_pu_bacteria 2876771140 2876776580 187
574 iso_pu_bacteria 2876808645 2876814241 187
575 iso_pu_bacteria 2876818435 2876824830 187
576 iso_pu_bacteria 2879074833 2879081557 187
577 iso_pu_bacteria 2879099564 2879109080 187
578 iso_pu_bacteria 2879110137 2879114918 187
579 iso_pu_bacteria 2879127579 2879134267 187
580 iso_pu_bacteria 2879142872 2879145906 187
581 iso_pu_bacteria 2885366525 2885366699 187
582 iso_pu_bacteria 2885409591 2885410597 187
583 iso_pu_bacteria 2888378607 2888381282 187
584 iso_pu_bacteria 2888388044 2888389393 187
585 iso_pu_bacteria 2888419890 2888421719 187
586 iso_pu_bacteria 2889033259 2889037730 187
587 iso_pu_bacteria 2904711408 2904712614 187
588 iso_pu_bacteria 2906626472 2906630775 187
589 iso_pu_bacteria 2908775508 2908781819 187
590 iso_pu_bacteria 2922361189 2922361673 187
591 iso_pu_bacteria 2922368715 2922370906 187
592 iso_pu_bacteria 2922386360 2922387069 187
593 iso_pu_bacteria 2922393267 2922401221 187
594 iso_pu_bacteria 2929615660 2929619310 187
595 iso_pu_bacteria 2929624759 2929628220 187
596 iso_pu_bacteria 2932784394 2932785609 187
597 iso_pu_bacteria 2932794094 2932796974 187
598 iso_pu_bacteria 2932801729 2932807271 187
599 iso_pu_bacteria 2932809354 2932813806 187
600 iso_pu_bacteria 2932818245 2932822225 187
601 iso_pu_bacteria 2932828146 2932830673 187
602 iso_pu_bacteria 2933577622 2933581231 187
603 iso_pu_bacteria 2935608549 2935612532 187
604 iso_pu_bacteria 2935616580 2935620714 187
605 iso_pu_bacteria 2935638405 2935639792 187
606 iso_pu_bacteria 2935648319 2935650432 187
607 iso_pu_bacteria 2935656913 2935658579 187
608 iso_pu_bacteria 2935665750 2935667370 187
609 iso_pu_bacteria 2935675223 2935677572 187
610 iso_pu_bacteria 2935684952 2935690487 187
611 iso_pu_bacteria 2935694250 2935697182 187
612 iso_pu_bacteria 2935703347 2935705110 187
613 iso_pu_bacteria 2935713505 2935717817 187
614 iso_pu_bacteria 2935722832 2935727033 187
615 iso_pu_bacteria 2935732158 2935735803 187
616 iso_pu_bacteria 2935741537 2935744926 187
617 iso_pu_bacteria 2935750917 2935755496 187
618 iso_pu_bacteria 2935760218 2935761990 187
619 iso_pu_bacteria 2935769743 2935774642 187
620 iso_pu_bacteria 2935777560 2935781928 187
621 iso_pu_bacteria 2935785616 2935789343 187
622 iso_pu_bacteria 2935793552 2935797614 187
623 iso_pu_bacteria 2935801545 2935803489 187
624 iso_pu_bacteria 2935810662 2935811415 187
625 iso_pu_bacteria 2935819856 2935824021 187
626 iso_pu_bacteria 2935827899 2935829275 187
627 iso_pu_bacteria 2935837841 2935842746 187
628 iso_pu_bacteria 2935847175 2935852832 187
629 iso_pu_bacteria 2935855204 2935858522 187
630 iso_pu_bacteria 2935864058 2935867057 187
631 iso_pu_bacteria 2935873716 2935877187 187
632 iso_pu_bacteria 2935883170 2935884604 187
633 iso_pu_bacteria 2935908558 2935912016 187
634 iso_pu_bacteria 2935916978 2935922227 187
635 iso_pu_bacteria 2935926038 2935929045 187
636 iso_pu_bacteria 2935934488 2935935676 187
637 iso_pu_bacteria 2935942939 2935947242 187
638 iso_pu_bacteria 2935951376 2935953664 187
639 iso_pu_bacteria 2935967501 2935968690 187
640 iso_pu_bacteria 2935975950 2935976902 187
641 iso_pu_bacteria 2935984226 2935986141 187
642 iso_pu_bacteria 2935992306 2935995177 187
643 iso_pu_bacteria 2936002035 2936004064 187
644 iso_pu_bacteria 2936011229 2936013009 187
645 iso_pu_bacteria 2936019824 2936021904 187
646 iso_pu_bacteria 2936028420 2936030302 187
647 iso_pu_bacteria 2936037263 2936037997 187
648 iso_pu_bacteria 2936046547 2936048098 187
649 iso_pu_bacteria 2936055302 2936059731 187
650 iso_pu_bacteria 2940556831 2940561223 187
651 iso_pu_bacteria 2941479691 2941480005 187
652 iso_pu_bacteria 2941538514 2941544405 187
653 iso_pu_bacteria 3005445848 3005451061 187
654 iso_pu_bacteria 3005483717 3005487568 187
655 iso_pu_bacteria 3005506211 3005511307 187
656 iso_pu_bacteria 3005587118 3005592856 187
657 iso_pu_bacteria 3005594810 3005596298 187
658 iso_pu_bacteria 8006926726 8006927408 187
659 iso_pu_bacteria 8006964411 8006966785 187
660 iso_pu_bacteria 8006994254 8006994697 187
661 iso_pu_bacteria 8016511872 8016516739 187
662 iso_pu_bacteria 8016522445 8016524081 187
663 iso_pu_bacteria 8016530956 8016537625 187
664 iso_pu_bacteria 8016539877 8016541898 187
665 iso_pu_bacteria 8016557553 8016559768 187
666 iso_pu_bacteria 8016566248 8016567281 187
667 iso_pu_bacteria 8016575299 8016579993 187
668 iso_pu_bacteria 8016583857 8016588849 187
669 iso_pu_bacteria 8016595262 8016597710 187
670 iso_pu_bacteria 8016603502 8016604609 187
671 iso_pu_bacteria 8016613128 8016620404 187
672 iso_pu_bacteria 8016622563 8016629569 187
673 iso_pu_bacteria 8016630954 8016637824 187
674 iso_pu_bacteria 8017057580 8017059823 187
675 iso_pu_bacteria 8019530166 8019537304 187
676 iso_pu_bacteria 8019538911 8019539018 187
677 iso_pu_bacteria 8019547302 8019548506 187
678 iso_pu_bacteria 8019576017 8019579303 187
679 iso_pu_bacteria 8019586578 8019597358 187
680 iso_pu_bacteria 8019597564 8019604328 187
681 iso_pu_bacteria 8019608314 8019614208 187
682 iso_pu_bacteria 8019619141 8019624885 187
683 iso_pu_bacteria 8019629233 8019637302 187
684 iso_pu_bacteria 8019638758 8019642287 187
685 iso_pu_bacteria 8019648815 8019650274 187
686 iso_pu_bacteria 8019659431 8019665156 187
687 iso_pu_bacteria 8019668869 8019674689 187
688 iso_pu_bacteria 8019678201 8019681410 187
689 iso_pu_bacteria 8019687851 8019694364 187
690 iso_pu_bacteria 8055742211 8055749432 187
691 iso_pu_bacteria 8056673599 8056680828 187
692 iso_pu_bacteria 8057529695 8057534253 187
693 3300005546 Ga0070696_100194535 Ga0070696_1001945352 188
694 3300005548 Ga0070665_100151094 Ga0070665_1001510943 188
695 3300005614 Ga0068856_100207790 Ga0068856_1002077902 188
696 3300005618 Ga0068864_100057625 Ga0068864_1000576252 188
697 3300005840 Ga0068870_10257109 Ga0068870_102571092 188
698 3300005842 Ga0068858_100254176 Ga0068858_1002541762 188
699 3300006038 Ga0075365_10170772 Ga0075365_101707722 188
700 3300006042 Ga0075368_10150941 Ga0075368_101509412 188
701 3300006048 Ga0075363_100106500 Ga0075363_1001065002 188
702 3300006048 Ga0075363_100147378 Ga0075363_1001473782 188
703 3300006048 Ga0075363_100152898 Ga0075363_1001528982 188
704 3300006051 Ga0075364_10161287 Ga0075364_101612872 188
705 3300006177 Ga0075362_10141902 Ga0075362_101419022 188
706 3300006178 Ga0075367_10015631 Ga0075367_100156313 188
707 3300006178 Ga0075367_10077326 Ga0075367_100773262 188
708 3300006195 Ga0075366_10418172 Ga0075366_104181722 188
709 3300006237 Ga0097621_100059180 Ga0097621_1000591803 188
710 3300006353 Ga0075370_10193974 Ga0075370_101939742 188
711 3300006358 Ga0068871_100036259 Ga0068871_1000362594 188
712 3300006880 Ga0075429_100532299 Ga0075429_1005322992 188
713 3300009094 Ga0111539_10126014 Ga0111539_101260142 188
714 3300009094 Ga0111539_10616218 Ga0111539_106162182 188
715 3300009176 Ga0105242_10891563 Ga0105242_108915631 188
716 3300009553 Ga0105249_10059087 Ga0105249_100590873 188
717 3300011119 Ga0105246_10069899 Ga0105246_100698992 188
718 3300014326 Ga0157380_10026681 Ga0157380_100266814 188
719 3300025900 Ga0207710_10072061 Ga0207710_100720612 188
720 3300025901 Ga0207688_10177792 Ga0207688_101777922 188
721 3300025907 Ga0207645_10126071 Ga0207645_101260712 188
722 3300025914 Ga0207671_10327052 Ga0207671_103270521 188
723 3300025919 Ga0207657_10098320 Ga0207657_100983202 188
724 3300025925 Ga0207650_10463716 Ga0207650_104637161 188
725 3300025931 Ga0207644_10628225 Ga0207644_106282252 188
726 3300025937 Ga0207669_10485848 Ga0207669_104858482 188
727 3300025941 Ga0207711_10393349 Ga0207711_103933492 188
728 3300025945 Ga0207679_10572631 Ga0207679_105726312 188
729 3300025961 Ga0207712_10119224 Ga0207712_101192242 188
730 3300025972 Ga0207668_10246103 Ga0207668_102461032 188
731 3300025981 Ga0207640_10413084 Ga0207640_104130842 188
732 3300026023 Ga0207677_10263275 Ga0207677_102632752 188
733 3300026035 Ga0207703_10142070 Ga0207703_101420702 188
734 3300026067 Ga0207678_10604252 Ga0207678_106042522 188
735 3300026078 Ga0207702_10022544 Ga0207702_100225444 188
736 3300026095 Ga0207676_10082940 Ga0207676_100829402 188
737 3300026121 Ga0207683_10032928 Ga0207683_100329284 188
738 3300026121 Ga0207683_10106287 Ga0207683_101062872 188
739 3300027866 Ga0209813_10022390 Ga0209813_100223902 188
740 3300027866 Ga0209813_10035770 Ga0209813_100357702 188
741 3300028379 Ga0268266_10217032 Ga0268266_102170322 188
742 3300028786 Ga0307517_10053505 Ga0307517_100535052 188
743 3300031456 Ga0307513_10137393 Ga0307513_101373932 188
744 3300031456 Ga0307513_10256567 Ga0307513_102565672 188
745 3300031456 Ga0307513_10407625 Ga0307513_104076251 188
746 3300031507 Ga0307509_10012410 Ga0307509_100124107 188
747 3300031616 Ga0307508_10052399 Ga0307508_100523992 188
748 3300031730 Ga0307516_10001211 Ga0307516_100012115 188
749 3300031852 Ga0307410_10161173 Ga0307410_101611732 188
750 3300033180 Ga0307510_10091891 Ga0307510_100918912 188
751 3300035114 Ga0373939_0038944 Ga0373939_0038944_507_1103 188
752 3300035691 Ga0373931_0012955 Ga0373931_0012955_2387_2983 188
753 3300037068 Ga0373925_0334138 Ga0373925_0334138_115_711 188
754 3300046517 Ga0495630_0081544 Ga0495630_0081544_1601_2200 188
755 3300046522 Ga0495643_0071034 Ga0495643_0071034_215_820 188
756 3300046526 Ga0495666_0216057 Ga0495666_0216057_82_681 188
757 3300046690 Ga0495624_0016398 Ga0495624_0016398_2949_3548 188
758 3300047321 Ga0495676_0067566 Ga0495676_0067566_1538_2137 188
759 3300047673 Ga0495593_0080512 Ga0495593_0080512_139_738 188
760 3300050490 nmdc:mga03n38_57184_c1 nmdc:mga03n38_57184_c1_134_733 188
761 3300050492 nmdc:mga0yw44_173880_c1 nmdc:mga0yw44_173880_c1_145_744 188
762 3300050493 nmdc:mga0k408_1383_c1 nmdc:mga0k408_1383_c1_7271_7870 188
763 3300050494 nmdc:mga06z11_287022_c1 nmdc:mga06z11_287022_c1_290_862 188
764 3300050494 nmdc:mga06z11_297023_c1 nmdc:mga06z11_297023_c1_105_704 188
765 3300050495 nmdc:mga04h51_32606_c1 nmdc:mga04h51_32606_c1_901_1500 188
766 3300050496 nmdc:mga07m45_3676_c1 nmdc:mga07m45_3676_c1_6663_7262 188
767 3300050511 nmdc:mga08y16_415999_c1 nmdc:mga08y16_415999_c1_526_1098 188
768 3300050516 nmdc:mga0sz30_4699_c1 nmdc:mga0sz30_4699_c1_839_1438 188
769 iso_pu_bacteria 2585427633 2585992848 188
770 iso_pu_bacteria 2585427634 2586003578 188
771 iso_pu_bacteria 2600254933 2600376885 188
772 iso_pu_bacteria 2643221558 2643814035 188
773 iso_pu_bacteria 2818991461 2819688529 188
774 iso_pu_bacteria 2899803654 2899807110 188
775 iso_pu_bacteria 2917699015 2917701652 188
776 iso_pu_bacteria 2919171160 2919176410 188
777 3300003187 JGI25151J46595_10005027 JGI25151J46595_100050274 189
778 3300003771 Ga0055526_1005610 Ga0055526_10056106 189
779 3300003771 Ga0055526_1011504 Ga0055526_10115042 189
780 3300003771 Ga0055526_1016600 Ga0055526_10166002 189
781 3300003771 Ga0055526_1036630 Ga0055526_10366302 189
782 3300003771 Ga0055526_1044756 Ga0055526_10447562 189
783 3300003773 Ga0055537_1004444 Ga0055537_10044442 189
784 3300003775 Ga0055524_1001893 Ga0055524_10018937 189
785 3300003781 Ga0055536_1000380 Ga0055536_100038020 189
786 3300003784 Ga0055534_1009966 Ga0055534_10099662 189
787 3300005719 Ga0068861_100136783 Ga0068861_1001367832 189
788 3300006038 Ga0075365_10217976 Ga0075365_102179762 189
789 3300006038 Ga0075365_10396613 Ga0075365_103966132 189
790 3300006042 Ga0075368_10057000 Ga0075368_100570002 189
791 3300006051 Ga0075364_10177937 Ga0075364_101779372 189
792 3300006058 Ga0075432_10174647 Ga0075432_101746471 189
793 3300006178 Ga0075367_10039713 Ga0075367_100397133 189
794 3300006846 Ga0075430_100138044 Ga0075430_1001380441 189
795 3300006946 Ga0079104_1000044 Ga0079104_100004481 189
796 3300009551 Ga0105238_10118785 Ga0105238_101187852 189
797 3300014325 Ga0163163_10686487 Ga0163163_106864871 189
798 3300017792 Ga0163161_10402324 Ga0163161_104023243 189
799 3300025263 Ga0209565_1000021 Ga0209565_1000021270 189
800 3300025291 Ga0209675_1000149 Ga0209675_100014962 189
801 3300025292 Ga0209676_1000014 Ga0209676_1000014715 189
802 3300025294 Ga0209025_1000522 Ga0209025_100052236 189
803 3300025294 Ga0209025_1001542 Ga0209025_10015422 189
804 3300025294 Ga0209025_1062800 Ga0209025_10628001 189
805 3300025295 Ga0209564_1000455 Ga0209564_100045536 189
806 3300025295 Ga0209564_1001045 Ga0209564_100104510 189
807 3300025295 Ga0209564_1002205 Ga0209564_100220510 189
808 3300025299 Ga0209256_1000625 Ga0209256_10006257 189
809 3300025303 Ga0209051_1048392 Ga0209051_10483922 189
810 3300025901 Ga0207688_10029829 Ga0207688_100298292 189
811 3300025924 Ga0207694_10165446 Ga0207694_101654462 189
812 3300025972 Ga0207668_10576598 Ga0207668_105765981 189
813 3300025972 Ga0207668_10862784 Ga0207668_108627841 189
814 3300027111 Ga0209281_1000129 Ga0209281_100012991 189
815 3300031548 Ga0307408_100450104 Ga0307408_1004501042 189
816 3300031730 Ga0307516_10306367 Ga0307516_103063672 189
817 3300031903 Ga0307407_10166996 Ga0307407_101669961 189
818 3300031995 Ga0307409_100052103 Ga0307409_1000521032 189
819 3300046512 Ga0495610_0036676 Ga0495610_0036676_961_1536 189
820 3300048913 Ga0496110_0294672 Ga0496110_0294672_90_665 189
821 3300048914 Ga0496111_0000161 Ga0496111_0000161_8361_8936 189
822 3300048924 Ga0496121_0005284 Ga0496121_0005284_8599_9174 189
823 3300048924 Ga0496121_0012780 Ga0496121_0012780_7797_8372 189
824 3300048924 Ga0496121_0101889 Ga0496121_0101889_1391_2008 189
825 3300048925 Ga0496122_0076238 Ga0496122_0076238_1019_1594 189
826 3300048926 Ga0496123_0023293 Ga0496123_0023293_482_1057 189
827 3300048927 Ga0496124_0010860 Ga0496124_0010860_3154_3729 189
828 3300048927 Ga0496124_0078437 Ga0496124_0078437_1425_2000 189
829 3300049570 Ga0501033_0234037 Ga0501033_0234037_325_936 189
830 3300049576 Ga0501040_0149053 Ga0501040_0149053_526_1101 189
831 3300049579 Ga0501043_0493959 Ga0501043_0493959_34_645 189
832 3300049580 Ga0501046_0426917 Ga0501046_0426917_114_725 189
833 3300049581 Ga0501047_0013443 Ga0501047_0013443_6822_7433 189
834 3300049582 Ga0501048_0113852 Ga0501048_0113852_200_775 189
835 3300049590 Ga0501074_0248955 Ga0501074_0248955_128_703 189
836 3300049823 Ga0501044_0005038 Ga0501044_0005038_6213_6824 189
837 3300049824 Ga0501045_0077606 Ga0501045_0077606_858_1433 189
838 3300050490 nmdc:mga03n38_262522_c1 nmdc:mga03n38_262522_c1_238_813 189
839 3300050491 nmdc:mga00v17_208578_c1 nmdc:mga00v17_208578_c1_314_970 189
840 3300050491 nmdc:mga00v17_610338_c1 nmdc:mga00v17_610338_c1_89_661 189
841 3300050491 nmdc:mga00v17_643630_c1 nmdc:mga00v17_643630_c1_91_666 189
842 3300050492 nmdc:mga0yw44_279131_c1 nmdc:mga0yw44_279131_c1_59_631 189
843 3300050492 nmdc:mga0yw44_526297_c1 nmdc:mga0yw44_526297_c1_170_757 189
844 3300050494 nmdc:mga06z11_5003_c1 nmdc:mga06z11_5003_c1_1227_1814 189
845 3300050509 nmdc:mga0qj67_76368_c1 nmdc:mga0qj67_76368_c1_348_923 189
846 3300053125 Ga0500618_000285 Ga0500618_000285_29583_30158 189
847 3300053155 Ga0500620_130632 Ga0500620_130632_88_663 189
848 iso_pu_bacteria 2599185236 2599720742 189
849 iso_pu_bacteria 2841911363 2841916896 189
850 iso_pu_bacteria 2841917233 2841917600 189
851 3300002739 JGI25158J39367_1000856 JGI25158J39367_10008565 190
852 3300002987 JGI25159J45721_1002192 JGI25159J45721_10021924 190
853 3300002987 JGI25159J45721_1013501 JGI25159J45721_10135012 190
854 3300003187 JGI25151J46595_10000463 JGI25151J46595_1000046314 190
855 3300003187 JGI25151J46595_10017428 JGI25151J46595_100174283 190
856 3300003187 JGI25151J46595_10022275 JGI25151J46595_100222752 190
857 3300003187 JGI25151J46595_10053605 JGI25151J46595_100536052 190
858 3300003187 JGI25151J46595_10059344 JGI25151J46595_100593442 190
859 3300003214 JGI25165J46597_1002684 JGI25165J46597_10026844 190
860 3300003215 JGI25153J46596_10000681 JGI25153J46596_100006812 190
861 3300003215 JGI25153J46596_10006921 JGI25153J46596_100069213 190
862 3300003215 JGI25153J46596_10019799 JGI25153J46596_100197991 190
863 3300003215 JGI25153J46596_10023467 JGI25153J46596_100234671 190
864 3300003215 JGI25153J46596_10024497 JGI25153J46596_100244972 190
865 3300003316 rootH1_10031368 rootH1_100313682 190
866 3300003323 rootH1_10247466 rootH1_102474662 190
867 3300003323 rootH1_10290538 rootH1_102905382 190
868 3300003354 JGI25160J50197_1000797 JGI25160J50197_100079715 190
869 3300003354 JGI25160J50197_1004179 JGI25160J50197_10041797 190
870 3300003374 JGI25161J50226_1000233 JGI25161J50226_100023315 190
871 3300003374 JGI25161J50226_1009245 JGI25161J50226_10092451 190
872 3300003578 Ga0006562J51391_1010713 Ga0006562J51391_10107133 190
873 3300003659 JGI25404J52841_10005354 JGI25404J52841_100053542 190
874 3300003771 Ga0055526_1001056 Ga0055526_100105613 190
875 3300003771 Ga0055526_1004150 Ga0055526_10041507 190
876 3300003771 Ga0055526_1009661 Ga0055526_10096612 190
877 3300003771 Ga0055526_1010437 Ga0055526_10104373 190
878 3300003771 Ga0055526_1036771 Ga0055526_10367712 190
879 3300003771 Ga0055526_1046453 Ga0055526_10464531 190
880 3300003775 Ga0055524_1000751 Ga0055524_100075122 190
881 3300003775 Ga0055524_1004819 Ga0055524_10048192 190
882 3300003775 Ga0055524_1006307 Ga0055524_10063072 190
883 3300003775 Ga0055524_1012728 Ga0055524_10127284 190
884 3300003775 Ga0055524_1014427 Ga0055524_10144272 190
885 3300003775 Ga0055524_1052904 Ga0055524_10529041 190
886 3300003790 Ga0055528_1000054 Ga0055528_100005488 190
887 3300003790 Ga0055528_1000343 Ga0055528_100034336 190
888 3300003790 Ga0055528_1000764 Ga0055528_100076414 190
889 3300003790 Ga0055528_1003831 Ga0055528_10038312 190
890 3300003790 Ga0055528_1010860 Ga0055528_10108603 190
891 3300003790 Ga0055528_1024968 Ga0055528_10249682 190
892 3300003791 Ga0055530_10016080 Ga0055530_100160802 190
893 3300003792 Ga0055540_1000077 Ga0055540_100007771 190
894 3300003792 Ga0055540_1002166 Ga0055540_10021665 190
895 3300003792 Ga0055540_1007797 Ga0055540_10077974 190
896 3300003792 Ga0055540_1030799 Ga0055540_10307992 190
897 3300003794 Ga0055531_10001197 Ga0055531_100011971 190
898 3300003794 Ga0055531_10009606 Ga0055531_100096064 190
899 3300003794 Ga0055531_10049381 Ga0055531_100493812 190
900 3300003856 Ga0058692_1002629 Ga0058692_10026295 190
901 3300004625 Ga0055543_1000770 Ga0055543_100077015 190
902 3300004625 Ga0055543_1001585 Ga0055543_10015856 190
903 3300004625 Ga0055543_1004072 Ga0055543_10040723 190
904 3300005262 Ga0065165_1000062 Ga0065165_100006229 190
905 3300005262 Ga0065165_1000254 Ga0065165_100025477 190
906 3300005262 Ga0065165_1001892 Ga0065165_100189212 190
907 3300005262 Ga0065165_1018148 Ga0065165_10181483 190
908 3300005262 Ga0065165_1036576 Ga0065165_10365762 190
909 3300005295 Ga0065707_10020470 Ga0065707_100204701 190
910 3300005327 Ga0070658_10096070 Ga0070658_100960702 190
911 3300005328 Ga0070676_10131218 Ga0070676_101312181 190
912 3300005330 Ga0070690_100288724 Ga0070690_1002887242 190
913 3300005331 Ga0070670_100222172 Ga0070670_1002221722 190
914 3300005334 Ga0068869_100096373 Ga0068869_1000963733 190
915 3300005334 Ga0068869_100275493 Ga0068869_1002754932 190
916 3300005334 Ga0068869_100951250 Ga0068869_1009512501 190
917 3300005336 Ga0070680_100878964 Ga0070680_1008789641 190
918 3300005337 Ga0070682_100105754 Ga0070682_1001057542 190
919 3300005338 Ga0068868_100370495 Ga0068868_1003704952 190
920 3300005339 Ga0070660_100596084 Ga0070660_1005960841 190
921 3300005344 Ga0070661_100166232 Ga0070661_1001662321 190
922 3300005344 Ga0070661_100387547 Ga0070661_1003875472 190
923 3300005347 Ga0070668_100027793 Ga0070668_1000277934 190
924 3300005347 Ga0070668_100134154 Ga0070668_1001341542 190
925 3300005347 Ga0070668_100451299 Ga0070668_1004512991 190
926 3300005347 Ga0070668_100673554 Ga0070668_1006735542 190
927 3300005353 Ga0070669_100510440 Ga0070669_1005104402 190
928 3300005355 Ga0070671_100425483 Ga0070671_1004254832 190
929 3300005355 Ga0070671_100555232 Ga0070671_1005552321 190
930 3300005355 Ga0070671_100634209 Ga0070671_1006342092 190
931 3300005356 Ga0070674_100239932 Ga0070674_1002399322 190
932 3300005364 Ga0070673_100443570 Ga0070673_1004435701 190
933 3300005364 Ga0070673_100524575 Ga0070673_1005245752 190
934 3300005366 Ga0070659_100276800 Ga0070659_1002768002 190
935 3300005366 Ga0070659_100421550 Ga0070659_1004215502 190
936 3300005367 Ga0070667_100105184 Ga0070667_1001051842 190
937 3300005440 Ga0070705_100406545 Ga0070705_1004065452 190
938 3300005441 Ga0070700_100465060 Ga0070700_1004650602 190
939 3300005444 Ga0070694_100524386 Ga0070694_1005243861 190
940 3300005445 Ga0070708_100577764 Ga0070708_1005777642 190
941 3300005455 Ga0070663_100051087 Ga0070663_1000510872 190
942 3300005455 Ga0070663_100057161 Ga0070663_1000571613 190
943 3300005455 Ga0070663_100199903 Ga0070663_1001999032 190
944 3300005456 Ga0070678_100599044 Ga0070678_1005990442 190
945 3300005456 Ga0070678_101243152 Ga0070678_1012431521 190
946 3300005457 Ga0070662_100289137 Ga0070662_1002891372 190
947 3300005457 Ga0070662_100657402 Ga0070662_1006574022 190
948 3300005459 Ga0068867_100167283 Ga0068867_1001672832 190
949 3300005466 Ga0070685_10384864 Ga0070685_103848642 190
950 3300005471 Ga0070698_100101177 Ga0070698_1001011773 190
951 3300005518 Ga0070699_100116843 Ga0070699_1001168433 190
952 3300005530 Ga0070679_100022779 Ga0070679_1000227796 190
953 3300005535 Ga0070684_100508830 Ga0070684_1005088302 190
954 3300005539 Ga0068853_100160170 Ga0068853_1001601702 190
955 3300005539 Ga0068853_100915293 Ga0068853_1009152932 190
956 3300005544 Ga0070686_100623035 Ga0070686_1006230351 190
957 3300005545 Ga0070695_100049566 Ga0070695_1000495663 190
958 3300005545 Ga0070695_100056057 Ga0070695_1000560572 190
959 3300005546 Ga0070696_100014883 Ga0070696_1000148832 190
960 3300005547 Ga0070693_100089430 Ga0070693_1000894302 190
961 3300005548 Ga0070665_100010206 Ga0070665_1000102062 190
962 3300005548 Ga0070665_100309953 Ga0070665_1003099532 190
963 3300005548 Ga0070665_100379044 Ga0070665_1003790442 190
964 3300005548 Ga0070665_100470355 Ga0070665_1004703552 190
965 3300005549 Ga0070704_100029644 Ga0070704_1000296443 190
966 3300005549 Ga0070704_100521192 Ga0070704_1005211921 190
967 3300005563 Ga0068855_100030747 Ga0068855_1000307473 190
968 3300005577 Ga0068857_100623354 Ga0068857_1006233542 190
969 3300005578 Ga0068854_100344494 Ga0068854_1003444942 190
970 3300005578 Ga0068854_100367034 Ga0068854_1003670341 190
971 3300005614 Ga0068856_101036051 Ga0068856_1010360512 190
972 3300005615 Ga0070702_100038055 Ga0070702_1000380553 190
973 3300005616 Ga0068852_100025826 Ga0068852_1000258262 190
974 3300005616 Ga0068852_100261872 Ga0068852_1002618722 190
975 3300005617 Ga0068859_100149727 Ga0068859_1001497272 190
976 3300005617 Ga0068859_100752044 Ga0068859_1007520442 190
977 3300005719 Ga0068861_100091696 Ga0068861_1000916962 190
978 3300005841 Ga0068863_100128828 Ga0068863_1001288282 190
979 3300005841 Ga0068863_100337581 Ga0068863_1003375812 190
980 3300005841 Ga0068863_100917553 Ga0068863_1009175531 190
981 3300005842 Ga0068858_101389051 Ga0068858_1013890511 190
982 3300005843 Ga0068860_100000312 Ga0068860_10000031232 190
983 3300005843 Ga0068860_100131015 Ga0068860_1001310152 190
984 3300005843 Ga0068860_100483380 Ga0068860_1004833802 190
985 3300005843 Ga0068860_100849333 Ga0068860_1008493332 190
986 3300005844 Ga0068862_100441046 Ga0068862_1004410462 190
987 3300005937 Ga0081455_10018391 Ga0081455_100183916 190
988 3300005937 Ga0081455_10072627 Ga0081455_100726273 190
989 3300005983 Ga0081540_1003077 Ga0081540_10030776 190
990 3300005983 Ga0081540_1003847 Ga0081540_100384710 190
991 3300005983 Ga0081540_1015210 Ga0081540_10152104 190
992 3300005985 Ga0081539_10024214 Ga0081539_100242143 190
993 3300006038 Ga0075365_10011642 Ga0075365_100116422 190
994 3300006038 Ga0075365_10016024 Ga0075365_100160242 190
995 3300006038 Ga0075365_10019199 Ga0075365_100191993 190
996 3300006038 Ga0075365_10019469 Ga0075365_100194694 190
997 3300006038 Ga0075365_10077252 Ga0075365_100772522 190
998 3300006038 Ga0075365_10192833 Ga0075365_101928332 190
999 3300006042 Ga0075368_10268398 Ga0075368_102683981 190
1000 3300006048 Ga0075363_100036248 Ga0075363_1000362482 190
1001 3300006048 Ga0075363_100115464 Ga0075363_1001154642 190
1002 3300006048 Ga0075363_100189770 Ga0075363_1001897701 190
1003 3300006048 Ga0075363_100205378 Ga0075363_1002053782 190
1004 3300006048 Ga0075363_100301451 Ga0075363_1003014512 190
1005 3300006048 Ga0075363_100332875 Ga0075363_1003328751 190
1006 3300006051 Ga0075364_10131203 Ga0075364_101312032 190
1007 3300006051 Ga0075364_10188523 Ga0075364_101885232 190
1008 3300006051 Ga0075364_10523433 Ga0075364_105234331 190
1009 3300006177 Ga0075362_10031083 Ga0075362_100310833 190
1010 3300006177 Ga0075362_10056513 Ga0075362_100565132 190
1011 3300006177 Ga0075362_10219497 Ga0075362_102194972 190
1012 3300006178 Ga0075367_10002993 Ga0075367_100029932 190
1013 3300006178 Ga0075367_10116915 Ga0075367_101169152 190
1014 3300006178 Ga0075367_10118573 Ga0075367_101185732 190
1015 3300006178 Ga0075367_10140357 Ga0075367_101403572 190
1016 3300006178 Ga0075367_10148001 Ga0075367_101480011 190
1017 3300006178 Ga0075367_10307874 Ga0075367_103078741 190
1018 3300006186 Ga0075369_10001157 Ga0075369_100011578 190
1019 3300006186 Ga0075369_10008423 Ga0075369_100084232 190
1020 3300006186 Ga0075369_10020074 Ga0075369_100200742 190
1021 3300006186 Ga0075369_10058365 Ga0075369_100583652 190
1022 3300006186 Ga0075369_10062446 Ga0075369_100624462 190
1023 3300006186 Ga0075369_10070913 Ga0075369_100709131 190
1024 3300006186 Ga0075369_10128222 Ga0075369_101282222 190
1025 3300006186 Ga0075369_10175197 Ga0075369_101751971 190
1026 3300006195 Ga0075366_10005356 Ga0075366_100053567 190
1027 3300006195 Ga0075366_10179281 Ga0075366_101792812 190
1028 3300006237 Ga0097621_100217989 Ga0097621_1002179892 190
1029 3300006237 Ga0097621_100424722 Ga0097621_1004247222 190
1030 3300006237 Ga0097621_101089209 Ga0097621_1010892091 190
1031 3300006353 Ga0075370_10004301 Ga0075370_100043015 190
1032 3300006353 Ga0075370_10006606 Ga0075370_100066062 190
1033 3300006353 Ga0075370_10060852 Ga0075370_100608522 190
1034 3300006353 Ga0075370_10083155 Ga0075370_100831552 190
1035 3300006353 Ga0075370_10151398 Ga0075370_101513982 190
1036 3300006353 Ga0075370_10238967 Ga0075370_102389672 190
1037 3300006353 Ga0075370_10654863 Ga0075370_106548631 190
1038 3300006844 Ga0075428_100341164 Ga0075428_1003411642 190
1039 3300006844 Ga0075428_100372345 Ga0075428_1003723451 190
1040 3300006881 Ga0068865_100188398 Ga0068865_1001883982 190
1041 3300006931 Ga0097620_100149730 Ga0097620_1001497302 190
1042 3300006931 Ga0097620_100752115 Ga0097620_1007521152 190
1043 3300006941 Ga0099825_1027405 Ga0099825_10274052 190
1044 3300006944 Ga0099823_1018479 Ga0099823_10184792 190
1045 3300006946 Ga0079104_1010264 Ga0079104_10102643 190
1046 3300006946 Ga0079104_1013037 Ga0079104_10130373 190
1047 3300006948 Ga0099826_10000071 Ga0099826_1000007128 190
1048 3300006948 Ga0099826_10063147 Ga0099826_100631472 190
1049 3300006948 Ga0099826_10263439 Ga0099826_102634392 190
1050 3300009092 Ga0105250_10067231 Ga0105250_100672312 190
1051 3300009092 Ga0105250_10110873 Ga0105250_101108731 190
1052 3300009093 Ga0105240_10006408 Ga0105240_1000640811 190
1053 3300009093 Ga0105240_10238268 Ga0105240_102382682 190
1054 3300009093 Ga0105240_11142676 Ga0105240_111426762 190
1055 3300009098 Ga0105245_10280154 Ga0105245_102801542 190
1056 3300009098 Ga0105245_10557569 Ga0105245_105575692 190
1057 3300009098 Ga0105245_10828231 Ga0105245_108282311 190
1058 3300009101 Ga0105247_10324831 Ga0105247_103248312 190
1059 3300009147 Ga0114129_10134378 Ga0114129_101343782 190
1060 3300009148 Ga0105243_10006759 Ga0105243_1000675910 190
1061 3300009148 Ga0105243_10081705 Ga0105243_100817052 190
1062 3300009148 Ga0105243_10479925 Ga0105243_104799252 190
1063 3300009148 Ga0105243_11085061 Ga0105243_110850611 190
1064 3300009174 Ga0105241_10197760 Ga0105241_101977602 190
1065 3300009174 Ga0105241_10906272 Ga0105241_109062721 190
1066 3300009176 Ga0105242_10152004 Ga0105242_101520042 190
1067 3300009177 Ga0105248_10077894 Ga0105248_100778942 190
1068 3300009177 Ga0105248_10769494 Ga0105248_107694941 190
1069 3300009177 Ga0105248_10832293 Ga0105248_108322932 190
1070 3300009177 Ga0105248_11853285 Ga0105248_118532851 190
1071 3300009545 Ga0105237_10030303 Ga0105237_100303035 190
1072 3300009545 Ga0105237_10061732 Ga0105237_100617322 190
1073 3300009545 Ga0105237_10260453 Ga0105237_102604532 190
1074 3300009545 Ga0105237_10340975 Ga0105237_103409752 190
1075 3300009545 Ga0105237_10860403 Ga0105237_108604032 190
1076 3300009545 Ga0105237_11071292 Ga0105237_110712921 190
1077 3300009551 Ga0105238_10261162 Ga0105238_102611622 190
1078 3300009551 Ga0105238_10922997 Ga0105238_109229972 190
1079 3300009553 Ga0105249_10001039 Ga0105249_1000103922 190
1080 3300009553 Ga0105249_10105017 Ga0105249_101050171 190
1081 3300009553 Ga0105249_10517587 Ga0105249_105175872 190
1082 3300009553 Ga0105249_10557109 Ga0105249_105571092 190
1083 3300009765 Ga0123341_1000044 Ga0123341_100004426 190
1084 3300010375 Ga0105239_10023525 Ga0105239_100235254 190
1085 3300010375 Ga0105239_10147958 Ga0105239_101479582 190
1086 3300010375 Ga0105239_10492903 Ga0105239_104929032 190
1087 3300010375 Ga0105239_10704658 Ga0105239_107046582 190
1088 3300010375 Ga0105239_10910710 Ga0105239_109107102 190
1089 3300012505 Ga0157339_1007446 Ga0157339_10074461 190
1090 3300012507 Ga0157342_1012805 Ga0157342_10128051 190
1091 3300012515 Ga0157338_1025190 Ga0157338_10251901 190
1092 3300013100 Ga0157373_10040827 Ga0157373_100408272 190
1093 3300013100 Ga0157373_10145800 Ga0157373_101458002 190
1094 3300013102 Ga0157371_10000002 Ga0157371_10000002533 190
1095 3300013102 Ga0157371_10051710 Ga0157371_100517103 190
1096 3300013104 Ga0157370_10000211 Ga0157370_1000021150 190
1097 3300013104 Ga0157370_10421021 Ga0157370_104210212 190
1098 3300013105 Ga0157369_10238175 Ga0157369_102381752 190
1099 3300013105 Ga0157369_10270702 Ga0157369_102707022 190
1100 3300013250 Ga0171462_1009 Ga0171462_100911 190
1101 3300013297 Ga0157378_10434649 Ga0157378_104346492 190
1102 3300013306 Ga0163162_11377263 Ga0163162_113772632 190
1103 3300013307 Ga0157372_10582116 Ga0157372_105821162 190
1104 3300013308 Ga0157375_10060268 Ga0157375_100602684 190
1105 3300013308 Ga0157375_10735844 Ga0157375_107358442 190
1106 3300014325 Ga0163163_10330721 Ga0163163_103307212 190
1107 3300014325 Ga0163163_10410330 Ga0163163_104103302 190
1108 3300014326 Ga0157380_11420697 Ga0157380_114206972 190
1109 3300014745 Ga0157377_10059883 Ga0157377_100598832 190
1110 3300014969 Ga0157376_10377837 Ga0157376_103778372 190
1111 3300014969 Ga0157376_10992808 Ga0157376_109928082 190
1112 3300017792 Ga0163161_10056284 Ga0163161_100562842 190
1113 3300021320 Ga0214544_1000001 Ga0214544_1000001118 190
1114 3300021320 Ga0214544_1000018 Ga0214544_1000018178 190
1115 3300021321 Ga0214542_1000005 Ga0214542_1000005118 190
1116 3300021321 Ga0214542_1000307 Ga0214542_100030765 190
1117 3300021321 Ga0214542_1015078 Ga0214542_10150783 190
1118 3300021324 Ga0214545_1000003 Ga0214545_1000003646 190
1119 3300021324 Ga0214545_1035348 Ga0214545_10353482 190
1120 3300021327 Ga0214543_1000002 Ga0214543_1000002118 190
1121 3300021327 Ga0214543_1000012 Ga0214543_100001239 190
1122 3300021327 Ga0214543_1000195 Ga0214543_100019522 190
1123 3300022739 Ga0228711_1002598 Ga0228711_10025985 190
1124 3300022740 Ga0228710_1002752 Ga0228710_100275223 190
1125 3300025208 Ga0209436_100007 Ga0209436_100007107 190
1126 3300025230 Ga0209563_102920 Ga0209563_1029203 190
1127 3300025245 Ga0207425_1005546 Ga0207425_10055462 190
1128 3300025245 Ga0207425_1005811 Ga0207425_10058113 190
1129 3300025245 Ga0207425_1021884 Ga0207425_10218841 190
1130 3300025245 Ga0207425_1037312 Ga0207425_10373121 190
1131 3300025253 Ga0209677_103599 Ga0209677_1035992 190
1132 3300025258 Ga0209129_1001290 Ga0209129_100129015 190
1133 3300025258 Ga0209129_1001482 Ga0209129_10014826 190
1134 3300025261 Ga0209233_1000820 Ga0209233_10008208 190
1135 3300025261 Ga0209233_1020687 Ga0209233_10206872 190
1136 3300025261 Ga0209233_1052103 Ga0209233_10521032 190
1137 3300025273 Ga0209673_1000005 Ga0209673_1000005178 190
1138 3300025273 Ga0209673_1000067 Ga0209673_1000067144 190
1139 3300025273 Ga0209673_1000294 Ga0209673_100029472 190
1140 3300025273 Ga0209673_1000968 Ga0209673_100096825 190
1141 3300025273 Ga0209673_1006587 Ga0209673_10065874 190
1142 3300025273 Ga0209673_1008320 Ga0209673_10083204 190
1143 3300025273 Ga0209673_1039849 Ga0209673_10398492 190
1144 3300025284 Ga0209130_1000001 Ga0209130_1000001663 190
1145 3300025284 Ga0209130_1000235 Ga0209130_100023562 190
1146 3300025292 Ga0209676_1014385 Ga0209676_10143852 190
1147 3300025292 Ga0209676_1022321 Ga0209676_10223212 190
1148 3300025294 Ga0209025_1000260 Ga0209025_100026051 190
1149 3300025294 Ga0209025_1001148 Ga0209025_100114813 190
1150 3300025294 Ga0209025_1002894 Ga0209025_10028945 190
1151 3300025294 Ga0209025_1011728 Ga0209025_10117282 190
1152 3300025294 Ga0209025_1015802 Ga0209025_10158022 190
1153 3300025294 Ga0209025_1047398 Ga0209025_10473982 190
1154 3300025294 Ga0209025_1062878 Ga0209025_10628781 190
1155 3300025294 Ga0209025_1085713 Ga0209025_10857132 190
1156 3300025295 Ga0209564_1000019 Ga0209564_1000019298 190
1157 3300025295 Ga0209564_1000092 Ga0209564_1000092144 190
1158 3300025295 Ga0209564_1000336 Ga0209564_100033638 190
1159 3300025295 Ga0209564_1019591 Ga0209564_10195913 190
1160 3300025295 Ga0209564_1023165 Ga0209564_10231652 190
1161 3300025295 Ga0209564_1024220 Ga0209564_10242202 190
1162 3300025295 Ga0209564_1025025 Ga0209564_10250252 190
1163 3300025295 Ga0209564_1082394 Ga0209564_10823941 190
1164 3300025297 Ga0209758_1000026 Ga0209758_1000026222 190
1165 3300025297 Ga0209758_1000113 Ga0209758_100011351 190
1166 3300025297 Ga0209758_1000203 Ga0209758_10002037 190
1167 3300025297 Ga0209758_1001957 Ga0209758_100195720 190
1168 3300025297 Ga0209758_1005269 Ga0209758_10052696 190
1169 3300025297 Ga0209758_1016444 Ga0209758_10164444 190
1170 3300025297 Ga0209758_1021268 Ga0209758_10212682 190
1171 3300025297 Ga0209758_1024965 Ga0209758_10249653 190
1172 3300025297 Ga0209758_1025005 Ga0209758_10250052 190
1173 3300025297 Ga0209758_1027504 Ga0209758_10275041 190
1174 3300025297 Ga0209758_1032051 Ga0209758_10320512 190
1175 3300025297 Ga0209758_1050289 Ga0209758_10502892 190
1176 3300025297 Ga0209758_1090053 Ga0209758_10900532 190
1177 3300025298 Ga0209050_1006608 Ga0209050_10066084 190
1178 3300025298 Ga0209050_1007063 Ga0209050_10070632 190
1179 3300025299 Ga0209256_1000170 Ga0209256_100017084 190
1180 3300025299 Ga0209256_1000182 Ga0209256_100018269 190
1181 3300025299 Ga0209256_1000475 Ga0209256_10004758 190
1182 3300025299 Ga0209256_1001533 Ga0209256_100153320 190
1183 3300025299 Ga0209256_1002121 Ga0209256_10021214 190
1184 3300025299 Ga0209256_1011067 Ga0209256_10110672 190
1185 3300025299 Ga0209256_1028898 Ga0209256_10288982 190
1186 3300025299 Ga0209256_1037619 Ga0209256_10376191 190
1187 3300025302 Ga0207426_1000045 Ga0207426_1000045272 190
1188 3300025302 Ga0207426_1000213 Ga0207426_100021318 190
1189 3300025302 Ga0207426_1000282 Ga0207426_100028246 190
1190 3300025302 Ga0207426_1007399 Ga0207426_10073992 190
1191 3300025302 Ga0207426_1014504 Ga0207426_10145044 190
1192 3300025302 Ga0207426_1014578 Ga0207426_10145783 190
1193 3300025303 Ga0209051_1000027 Ga0209051_1000027266 190
1194 3300025303 Ga0209051_1002417 Ga0209051_10024176 190
1195 3300025303 Ga0209051_1004473 Ga0209051_10044736 190
1196 3300025303 Ga0209051_1046772 Ga0209051_10467722 190
1197 3300025303 Ga0209051_1090810 Ga0209051_10908101 190
1198 3300025304 Ga0209257_1000691 Ga0209257_100069130 190
1199 3300025304 Ga0209257_1001012 Ga0209257_10010128 190
1200 3300025304 Ga0209257_1004723 Ga0209257_10047233 190
1201 3300025304 Ga0209257_1013830 Ga0209257_10138304 190
1202 3300025304 Ga0209257_1097072 Ga0209257_10970721 190
1203 3300025315 Ga0207697_10142880 Ga0207697_101428801 190
1204 3300025321 Ga0207656_10108821 Ga0207656_101088212 190
1205 3300025900 Ga0207710_10055505 Ga0207710_100555052 190
1206 3300025901 Ga0207688_10109504 Ga0207688_101095042 190
1207 3300025901 Ga0207688_10309236 Ga0207688_103092361 190
1208 3300025903 Ga0207680_10277081 Ga0207680_102770812 190
1209 3300025904 Ga0207647_10013465 Ga0207647_100134653 190
1210 3300025909 Ga0207705_10057184 Ga0207705_100571842 190
1211 3300025911 Ga0207654_10062106 Ga0207654_100621062 190
1212 3300025911 Ga0207654_10065549 Ga0207654_100655492 190
1213 3300025911 Ga0207654_10069120 Ga0207654_100691202 190
1214 3300025911 Ga0207654_10292045 Ga0207654_102920451 190
1215 3300025912 Ga0207707_10046761 Ga0207707_100467614 190
1216 3300025913 Ga0207695_10000006 Ga0207695_10000006969 190
1217 3300025914 Ga0207671_10014700 Ga0207671_100147002 190
1218 3300025916 Ga0207663_10593912 Ga0207663_105939121 190
1219 3300025917 Ga0207660_10036633 Ga0207660_100366334 190
1220 3300025919 Ga0207657_10113701 Ga0207657_101137012 190
1221 3300025919 Ga0207657_10379728 Ga0207657_103797281 190
1222 3300025919 Ga0207657_10430543 Ga0207657_104305432 190
1223 3300025920 Ga0207649_10141205 Ga0207649_101412052 190
1224 3300025920 Ga0207649_10249054 Ga0207649_102490541 190
1225 3300025920 Ga0207649_10842690 Ga0207649_108426901 190
1226 3300025921 Ga0207652_10023360 Ga0207652_100233602 190
1227 3300025923 Ga0207681_10068436 Ga0207681_100684362 190
1228 3300025923 Ga0207681_10498612 Ga0207681_104986122 190
1229 3300025923 Ga0207681_10554154 Ga0207681_105541542 190
1230 3300025924 Ga0207694_10164256 Ga0207694_101642562 190
1231 3300025931 Ga0207644_10192733 Ga0207644_101927332 190
1232 3300025933 Ga0207706_10024422 Ga0207706_100244224 190
1233 3300025933 Ga0207706_10057307 Ga0207706_100573072 190
1234 3300025934 Ga0207686_10082920 Ga0207686_100829202 190
1235 3300025935 Ga0207709_10068948 Ga0207709_100689483 190
1236 3300025936 Ga0207670_10347911 Ga0207670_103479112 190
1237 3300025937 Ga0207669_10033791 Ga0207669_100337912 190
1238 3300025938 Ga0207704_10027972 Ga0207704_100279722 190
1239 3300025938 Ga0207704_10514269 Ga0207704_105142692 190
1240 3300025939 Ga0207665_10256041 Ga0207665_102560412 190
1241 3300025949 Ga0207667_10164362 Ga0207667_101643622 190
1242 3300025960 Ga0207651_10046470 Ga0207651_100464702 190
1243 3300025960 Ga0207651_10528808 Ga0207651_105288082 190
1244 3300025961 Ga0207712_10002059 Ga0207712_1000205914 190
1245 3300025972 Ga0207668_10158531 Ga0207668_101585312 190
1246 3300025986 Ga0207658_10398316 Ga0207658_103983162 190
1247 3300025986 Ga0207658_10828175 Ga0207658_108281751 190
1248 3300026035 Ga0207703_10902943 Ga0207703_109029431 190
1249 3300026067 Ga0207678_10035692 Ga0207678_100356922 190
1250 3300026067 Ga0207678_10079006 Ga0207678_100790063 190
1251 3300026067 Ga0207678_10131896 Ga0207678_101318962 190
1252 3300026067 Ga0207678_10200935 Ga0207678_102009352 190
1253 3300026075 Ga0207708_10042979 Ga0207708_100429793 190
1254 3300026078 Ga0207702_10694754 Ga0207702_106947542 190
1255 3300026088 Ga0207641_10274170 Ga0207641_102741702 190
1256 3300026088 Ga0207641_10874901 Ga0207641_108749012 190
1257 3300026089 Ga0207648_10089924 Ga0207648_100899243 190
1258 3300026095 Ga0207676_10876357 Ga0207676_108763571 190
1259 3300026116 Ga0207674_10031489 Ga0207674_100314892 190
1260 3300026116 Ga0207674_10046886 Ga0207674_100468862 190
1261 3300026118 Ga0207675_100196543 Ga0207675_1001965432 190
1262 3300026118 Ga0207675_100222835 Ga0207675_1002228352 190
1263 3300026118 Ga0207675_100336881 Ga0207675_1003368812 190
1264 3300027111 Ga0209281_1000655 Ga0209281_10006553 190
1265 3300027111 Ga0209281_1000805 Ga0209281_100080525 190
1266 3300027296 Ga0209389_1000140 Ga0209389_100014019 190
1267 3300027312 Ga0209371_1000012 Ga0209371_1000012282 190
1268 3300027312 Ga0209371_1000472 Ga0209371_100047224 190
1269 3300027312 Ga0209371_1001239 Ga0209371_10012393 190
1270 3300027361 Ga0209489_100775 Ga0209489_10077519 190
1271 3300027363 Ga0209700_100798 Ga0209700_10079852 190
1272 3300027666 Ga0209282_1000038 Ga0209282_1000038115 190
1273 3300027666 Ga0209282_1000323 Ga0209282_100032318 190
1274 3300027666 Ga0209282_1051722 Ga0209282_10517222 190
1275 3300027866 Ga0209813_10124828 Ga0209813_101248282 190
1276 3300028379 Ga0268266_10001288 Ga0268266_100012882 190
1277 3300028379 Ga0268266_10029665 Ga0268266_100296654 190
1278 3300028379 Ga0268266_10089824 Ga0268266_100898243 190
1279 3300028379 Ga0268266_10171474 Ga0268266_101714742 190
1280 3300028379 Ga0268266_10330020 Ga0268266_103300202 190
1281 3300028379 Ga0268266_10598029 Ga0268266_105980291 190
1282 3300028379 Ga0268266_10858996 Ga0268266_108589962 190
1283 3300028380 Ga0268265_10805015 Ga0268265_108050152 190
1284 3300028381 Ga0268264_10000030 Ga0268264_1000003030 190
1285 3300028786 Ga0307517_10000392 Ga0307517_1000039240 190
1286 3300028786 Ga0307517_10352816 Ga0307517_103528161 190
1287 3300028794 Ga0307515_10010751 Ga0307515_100107512 190
1288 3300028794 Ga0307515_10099536 Ga0307515_100995362 190
1289 3300028794 Ga0307515_10397974 Ga0307515_103979742 190
1290 3300030500 Ga0268256_1000013 Ga0268256_1000013282 190
1291 3300030500 Ga0268256_1004420 Ga0268256_10044206 190
1292 3300030521 Ga0307511_10077584 Ga0307511_100775842 190
1293 3300031456 Ga0307513_10001322 Ga0307513_1000132217 190
1294 3300031507 Ga0307509_10005540 Ga0307509_100055402 190
1295 3300031507 Ga0307509_10119947 Ga0307509_101199472 190
1296 3300031548 Ga0307408_100237788 Ga0307408_1002377882 190
1297 3300031616 Ga0307508_10000051 Ga0307508_10000051115 190
1298 3300031616 Ga0307508_10060988 Ga0307508_100609884 190
1299 3300031616 Ga0307508_10097443 Ga0307508_100974433 190
1300 3300031730 Ga0307516_10003513 Ga0307516_100035133 190
1301 3300031730 Ga0307516_10037984 Ga0307516_100379842 190
1302 3300031730 Ga0307516_10275574 Ga0307516_102755742 190
1303 3300031824 Ga0307413_10183716 Ga0307413_101837162 190
1304 3300031901 Ga0307406_10378326 Ga0307406_103783261 190
1305 3300031901 Ga0307406_10418996 Ga0307406_104189961 190
1306 3300031967 Ga0315914_1002543 Ga0315914_10025435 190
1307 3300031995 Ga0307409_100199817 Ga0307409_1001998172 190
1308 3300031995 Ga0307409_100632366 Ga0307409_1006323662 190
1309 3300032004 Ga0307414_10994044 Ga0307414_109940441 190
1310 3300032005 Ga0307411_10402263 Ga0307411_104022632 190
1311 3300032005 Ga0307411_10408919 Ga0307411_104089192 190
1312 3300032005 Ga0307411_10738894 Ga0307411_107388941 190
1313 3300032126 Ga0307415_100240560 Ga0307415_1002405602 190
1314 3300032126 Ga0307415_100720003 Ga0307415_1007200032 190
1315 3300033180 Ga0307510_10008010 Ga0307510_100080108 190
1316 3300033180 Ga0307510_10009232 Ga0307510_100092329 190
1317 3300033430 Ga0315913_1001156 Ga0315913_10011565 190
1318 3300033464 Ga0315915_1000018 Ga0315915_1000018115 190
1319 3300035083 Ga0373926_0031892 Ga0373926_0031892_361_939 190
1320 3300035111 Ga0373923_0038193 Ga0373923_0038193_971_1549 190
1321 3300035692 Ga0373935_0015285 Ga0373935_0015285_542_1120 190
1322 3300035724 Ga0373933_0316103 Ga0373933_0316103_424_1002 190
1323 3300038705 Ga0237819_07783 Ga0237819_07783_506_1084 190
1324 3300041406 Ga0439439_0082230 Ga0439439_0082230_100_672 190
1325 3300041413 Ga0439465_0012279 Ga0439465_0012279_1884_2456 190
1326 3300041413 Ga0439465_0014651 Ga0439465_0014651_700_1272 190
1327 3300041413 Ga0439465_0017784 Ga0439465_0017784_851_1468 190
1328 3300041443 Ga0451789_1320373 Ga0451789_1320373_163_735 190
1329 3300041452 Ga0451793_0833877 Ga0451793_0833877_464_1042 190
1330 3300041492 Ga0451835_0294912 Ga0451835_0294912_1335_1907 190
1331 3300041492 Ga0451835_0715463 Ga0451835_0715463_18_590 190
1332 3300041494 Ga0451837_0008034 Ga0451837_0008034_20_592 190
1333 3300041496 Ga0451839_0155811 Ga0451839_0155811_101_679 190
1334 3300041496 Ga0451839_0966459 Ga0451839_0966459_94_666 190
1335 3300041498 Ga0451841_1205379 Ga0451841_1205379_50_622 190
1336 3300041503 Ga0451847_0701608 Ga0451847_0701608_254_826 190
1337 3300041505 Ga0451849_0541387 Ga0451849_0541387_681_1253 190
1338 3300041505 Ga0451849_0570312 Ga0451849_0570312_60_638 190
1339 3300041505 Ga0451849_0658622 Ga0451849_0658622_97_675 190
1340 3300041505 Ga0451849_0739266 Ga0451849_0739266_32_604 190
1341 3300041507 Ga0451851_0833168 Ga0451851_0833168_785_1357 190
1342 3300041512 Ga0451853_0671269 Ga0451853_0671269_190_762 190
1343 3300041512 Ga0451853_2803001 Ga0451853_2803001_18_590 190
1344 3300042004 Ga0439445_0167846 Ga0439445_0167846_36_608 190
1345 3300042006 Ga0439432_014871 Ga0439432_014871_1294_1866 190
1346 3300042006 Ga0439432_027227 Ga0439432_027227_174_746 190
1347 3300042007 Ga0439449_0007729 Ga0439449_0007729_1298_1870 190
1348 3300042007 Ga0439449_0026273 Ga0439449_0026273_1471_2043 190
1349 3300042015 Ga0439462_0022361 Ga0439462_0022361_82_711 190
1350 3300042015 Ga0439462_0064861 Ga0439462_0064861_235_807 190
1351 3300042122 Ga0450920_053273 Ga0450920_053273_61_633 190
1352 3300042435 Ga0439434_0020910 Ga0439434_0020910_569_1186 190
1353 3300042438 Ga0439459_0009683 Ga0439459_0009683_915_1493 190
1354 3300042531 Ga0450918_002564 Ga0450918_002564_1506_2123 190
1355 3300044656 Ga0466969_0086893 Ga0466969_0086893_225_803 190
1356 3300044658 Ga0466972_0033010 Ga0466972_0033010_1358_1936 190
1357 3300044658 Ga0466972_0087033 Ga0466972_0087033_471_1049 190
1358 3300044683 Ga0466965_0137957 Ga0466965_0137957_98_676 190
1359 3300044684 Ga0466966_0000610 Ga0466966_0000610_21447_22025 190
1360 3300044693 Ga0466961_0000124 Ga0466961_0000124_1391_1969 190
1361 3300044706 Ga0466964_0267288 Ga0466964_0267288_21_599 190
1362 3300044735 Ga0466968_0051502 Ga0466968_0051502_763_1341 190
1363 3300045049 Ga0466959_0061235 Ga0466959_0061235_1208_1786 190
1364 3300046452 Ga0495617_009312 Ga0495617_009312_1448_2026 190
1365 3300046452 Ga0495617_092591 Ga0495617_092591_369_941 190
1366 3300046454 Ga0495592_0414968 Ga0495592_0414968_157_735 190
1367 3300046455 Ga0495603_0007138 Ga0495603_0007138_864_1442 190
1368 3300046455 Ga0495603_0024002 Ga0495603_0024002_2896_3474 190
1369 3300046457 Ga0495590_0130245 Ga0495590_0130245_75_653 190
1370 3300046459 Ga0495629_0026056 Ga0495629_0026056_988_1566 190
1371 3300046460 Ga0495638_0000475 Ga0495638_0000475_19235_19807 190
1372 3300046460 Ga0495638_0005749 Ga0495638_0005749_996_1574 190
1373 3300046460 Ga0495638_0052465 Ga0495638_0052465_1184_1756 190
1374 3300046460 Ga0495638_0160086 Ga0495638_0160086_237_815 190
1375 3300046462 Ga0495651_0032791 Ga0495651_0032791_2717_3295 190
1376 3300046462 Ga0495651_0124663 Ga0495651_0124663_377_955 190
1377 3300046463 Ga0495653_0205731 Ga0495653_0205731_189_767 190
1378 3300046471 Ga0495650_0095026 Ga0495650_0095026_446_1018 190
1379 3300046471 Ga0495650_0164761 Ga0495650_0164761_26_604 190
1380 3300046474 Ga0495605_0003451 Ga0495605_0003451_486_1112 190
1381 3300046474 Ga0495605_0099694 Ga0495605_0099694_599_1177 190
1382 3300046477 Ga0495664_0080043 Ga0495664_0080043_1317_1895 190
1383 3300046492 Ga0495585_0043282 Ga0495585_0043282_1254_1826 190
1384 3300046492 Ga0495585_0047449 Ga0495585_0047449_1027_1653 190
1385 3300046499 Ga0495594_0113865 Ga0495594_0113865_336_914 190
1386 3300046501 Ga0495607_0014846 Ga0495607_0014846_2025_2597 190
1387 3300046506 Ga0495583_0030954 Ga0495583_0030954_1652_2287 190
1388 3300046506 Ga0495583_0070141 Ga0495583_0070141_697_1269 190
1389 3300046507 Ga0495606_0093908 Ga0495606_0093908_22_594 190
1390 3300046507 Ga0495606_0193121 Ga0495606_0193121_548_1120 190
1391 3300046507 Ga0495606_0308698 Ga0495606_0308698_219_797 190
1392 3300046511 Ga0495608_0246503 Ga0495608_0246503_231_809 190
1393 3300046512 Ga0495610_0035010 Ga0495610_0035010_1107_1679 190
1394 3300046513 Ga0495616_0009361 Ga0495616_0009361_1482_2108 190
1395 3300046513 Ga0495616_0113891 Ga0495616_0113891_13_591 190
1396 3300046515 Ga0495620_0011838 Ga0495620_0011838_1513_2085 190
1397 3300046515 Ga0495620_0102183 Ga0495620_0102183_400_978 190
1398 3300046516 Ga0495628_0458413 Ga0495628_0458413_272_850 190
1399 3300046516 Ga0495628_0750170 Ga0495628_0750170_28_606 190
1400 3300046518 Ga0495631_0012439 Ga0495631_0012439_1454_2080 190
1401 3300046518 Ga0495631_0082092 Ga0495631_0082092_391_963 190
1402 3300046518 Ga0495631_0143918 Ga0495631_0143918_423_1001 190
1403 3300046519 Ga0495632_0021912 Ga0495632_0021912_332_910 190
1404 3300046519 Ga0495632_0042216 Ga0495632_0042216_632_1204 190
1405 3300046519 Ga0495632_0068598 Ga0495632_0068598_493_1119 190
1406 3300046519 Ga0495632_0219567 Ga0495632_0219567_200_778 190
1407 3300046519 Ga0495632_0321702 Ga0495632_0321702_36_671 190
1408 3300046522 Ga0495643_0026331 Ga0495643_0026331_326_904 190
1409 3300046522 Ga0495643_0104346 Ga0495643_0104346_12_590 190
1410 3300046522 Ga0495643_0112480 Ga0495643_0112480_701_1327 190
1411 3300046522 Ga0495643_0193244 Ga0495643_0193244_48_620 190
1412 3300046523 Ga0495644_0068026 Ga0495644_0068026_131_709 190
1413 3300046524 Ga0495648_0028240 Ga0495648_0028240_2972_3550 190
1414 3300046524 Ga0495648_0041644 Ga0495648_0041644_397_975 190
1415 3300046524 Ga0495648_0043160 Ga0495648_0043160_746_1318 190
1416 3300046524 Ga0495648_0093652 Ga0495648_0093652_1020_1646 190
1417 3300046525 Ga0495663_0040163 Ga0495663_0040163_67_639 190
1418 3300046526 Ga0495666_0039895 Ga0495666_0039895_1389_1967 190
1419 3300046530 Ga0495654_0000122 Ga0495654_0000122_86051_86689 190
1420 3300046530 Ga0495654_0089343 Ga0495654_0089343_421_993 190
1421 3300046533 Ga0495640_0007377 Ga0495640_0007377_1739_2317 190
1422 3300046537 Ga0495598_0022520 Ga0495598_0022520_857_1435 190
1423 3300046538 Ga0495609_0029333 Ga0495609_0029333_1066_1644 190
1424 3300046538 Ga0495609_0138545 Ga0495609_0138545_340_966 190
1425 3300046538 Ga0495609_0180022 Ga0495609_0180022_233_805 190
1426 3300046542 Ga0495597_0061568 Ga0495597_0061568_602_1174 190
1427 3300046542 Ga0495597_0081875 Ga0495597_0081875_41_619 190
1428 3300046542 Ga0495597_0176732 Ga0495597_0176732_216_794 190
1429 3300046558 Ga0495633_0016222 Ga0495633_0016222_755_1327 190
1430 3300046558 Ga0495633_0134140 Ga0495633_0134140_528_1106 190
1431 3300046558 Ga0495633_0142925 Ga0495633_0142925_386_958 190
1432 3300046558 Ga0495633_0177625 Ga0495633_0177625_311_889 190
1433 3300046615 Ga0495656_0116356 Ga0495656_0116356_139_717 190
1434 3300046616 Ga0495668_0006686 Ga0495668_0006686_2492_3118 190
1435 3300046616 Ga0495668_0019058 Ga0495668_0019058_2720_3298 190
1436 3300046616 Ga0495668_0238381 Ga0495668_0238381_253_831 190
1437 3300046648 Ga0495611_0089472 Ga0495611_0089472_104_676 190
1438 3300046648 Ga0495611_0130673 Ga0495611_0130673_409_987 190
1439 3300046648 Ga0495611_0211511 Ga0495611_0211511_151_729 190
1440 3300046660 Ga0495625_0011467 Ga0495625_0011467_2696_3322 190
1441 3300046660 Ga0495625_0085040 Ga0495625_0085040_232_804 190
1442 3300046660 Ga0495625_0134998 Ga0495625_0134998_787_1359 190
1443 3300046660 Ga0495625_0157846 Ga0495625_0157846_839_1417 190
1444 3300046660 Ga0495625_0567067 Ga0495625_0567067_98_670 190
1445 3300046663 Ga0495635_0004183 Ga0495635_0004183_701_1279 190
1446 3300046664 Ga0495659_0102406 Ga0495659_0102406_84_662 190
1447 3300046665 Ga0495661_0062750 Ga0495661_0062750_46_624 190
1448 3300046665 Ga0495661_0118040 Ga0495661_0118040_740_1312 190
1449 3300046674 Ga0495588_0009969 Ga0495588_0009969_3639_4217 190
1450 3300046674 Ga0495588_0135215 Ga0495588_0135215_370_948 190
1451 3300046679 Ga0495623_0229800 Ga0495623_0229800_203_781 190
1452 3300046683 Ga0495658_0320330 Ga0495658_0320330_76_654 190
1453 3300046684 Ga0495669_0082174 Ga0495669_0082174_441_1031 190
1454 3300046689 Ga0495613_0139892 Ga0495613_0139892_827_1405 190
1455 3300046690 Ga0495624_0220545 Ga0495624_0220545_102_680 190
1456 3300046690 Ga0495624_0273426 Ga0495624_0273426_109_687 190
1457 3300046691 Ga0495670_0070486 Ga0495670_0070486_29_655 190
1458 3300046692 Ga0495671_0053020 Ga0495671_0053020_1363_1935 190
1459 3300046692 Ga0495671_0069331 Ga0495671_0069331_788_1366 190
1460 3300046694 Ga0495649_0201636 Ga0495649_0201636_211_783 190
1461 3300046809 Ga0495600_0005392 Ga0495600_0005392_4730_5308 190
1462 3300046809 Ga0495600_0621838 Ga0495600_0621838_61_639 190
1463 3300046810 Ga0495660_0022531 Ga0495660_0022531_1924_2496 190
1464 3300047315 Ga0495581_0282479 Ga0495581_0282479_302_880 190
1465 3300047317 Ga0495604_0017983 Ga0495604_0017983_3062_3640 190
1466 3300047317 Ga0495604_0633633 Ga0495604_0633633_85_663 190
1467 3300047318 Ga0495636_0050396 Ga0495636_0050396_1077_1703 190
1468 3300047318 Ga0495636_0112417 Ga0495636_0112417_167_739 190
1469 3300047318 Ga0495636_0135577 Ga0495636_0135577_105_704 190
1470 3300047319 Ga0495674_0607347 Ga0495674_0607347_70_648 190
1471 3300047321 Ga0495676_0056474 Ga0495676_0056474_73_651 190
1472 3300047323 Ga0495683_0083541 Ga0495683_0083541_917_1489 190
1473 3300047323 Ga0495683_0210562 Ga0495683_0210562_133_711 190
1474 3300047443 Ga0495687_008590 Ga0495687_008590_2287_2865 190
1475 3300047445 Ga0495677_0173425 Ga0495677_0173425_71_649 190
1476 3300047469 Ga0495673_0058242 Ga0495673_0058242_775_1353 190
1477 3300047470 Ga0495681_0053412 Ga0495681_0053412_929_1501 190
1478 3300047470 Ga0495681_0147187 Ga0495681_0147187_380_958 190
1479 3300047470 Ga0495681_0238557 Ga0495681_0238557_134_712 190
1480 3300047471 Ga0495684_0392864 Ga0495684_0392864_91_669 190
1481 3300047472 Ga0495686_0148562 Ga0495686_0148562_48_620 190
1482 3300047673 Ga0495593_0127556 Ga0495593_0127556_609_1187 190
1483 3300048090 Ga0495615_0024434 Ga0495615_0024434_476_1048 190
1484 3300048090 Ga0495615_0054486 Ga0495615_0054486_430_1008 190
1485 3300048091 Ga0495626_0070685 Ga0495626_0070685_566_1138 190
1486 3300048091 Ga0495626_0124031 Ga0495626_0124031_26_604 190
1487 3300048903 Ga0496100_0250714 Ga0496100_0250714_36_614 190
1488 3300048904 Ga0496101_0453909 Ga0496101_0453909_356_937 190
1489 3300048905 Ga0496102_0179347 Ga0496102_0179347_1360_1938 190
1490 3300048905 Ga0496102_0210896 Ga0496102_0210896_379_957 190
1491 3300048905 Ga0496102_0261022 Ga0496102_0261022_106_684 190
1492 3300048906 Ga0496103_0033739 Ga0496103_0033739_2538_3116 190
1493 3300048907 Ga0496104_0065692 Ga0496104_0065692_1999_2577 190
1494 3300048907 Ga0496104_0089310 Ga0496104_0089310_2306_2884 190
1495 3300048907 Ga0496104_0366715 Ga0496104_0366715_228_806 190
1496 3300048907 Ga0496104_0371974 Ga0496104_0371974_537_1115 190
1497 3300048907 Ga0496104_0415966 Ga0496104_0415966_244_822 190
1498 3300048907 Ga0496104_0542953 Ga0496104_0542953_403_981 190
1499 3300048908 Ga0496105_0228114 Ga0496105_0228114_753_1331 190
1500 3300048908 Ga0496105_0252150 Ga0496105_0252150_472_1050 190
1501 3300048909 Ga0496106_0000355 Ga0496106_0000355_25778_26350 190
1502 3300048909 Ga0496106_0000765 Ga0496106_0000765_456_1034 190
1503 3300048909 Ga0496106_0361939 Ga0496106_0361939_38_610 190
1504 3300048909 Ga0496106_1054562 Ga0496106_1054562_48_626 190
1505 3300048910 Ga0496107_0193401 Ga0496107_0193401_454_1026 190
1506 3300048910 Ga0496107_0205141 Ga0496107_0205141_853_1431 190
1507 3300048910 Ga0496107_0467417 Ga0496107_0467417_92_670 190
1508 3300048910 Ga0496107_0703893 Ga0496107_0703893_51_629 190
1509 3300048911 Ga0496108_0168853 Ga0496108_0168853_408_986 190
1510 3300048912 Ga0496109_0304420 Ga0496109_0304420_899_1477 190
1511 3300048913 Ga0496110_0543292 Ga0496110_0543292_199_777 190
1512 3300048913 Ga0496110_1134035 Ga0496110_1134035_35_613 190
1513 3300048914 Ga0496111_0301663 Ga0496111_0301663_522_1100 190
1514 3300048915 Ga0496112_0038171 Ga0496112_0038171_3904_4482 190
1515 3300048915 Ga0496112_0081591 Ga0496112_0081591_2019_2597 190
1516 3300048915 Ga0496112_0242117 Ga0496112_0242117_850_1428 190
1517 3300048916 Ga0496113_0079333 Ga0496113_0079333_1143_1715 190
1518 3300048917 Ga0496114_0074011 Ga0496114_0074011_836_1420 190
1519 3300048917 Ga0496114_0347666 Ga0496114_0347666_338_916 190
1520 3300048917 Ga0496114_0352134 Ga0496114_0352134_32_610 190
1521 3300048917 Ga0496114_0438122 Ga0496114_0438122_257_835 190
1522 3300048917 Ga0496114_1011355 Ga0496114_1011355_34_612 190
1523 3300048918 Ga0496115_0140404 Ga0496115_0140404_1267_1845 190
1524 3300048918 Ga0496115_0181795 Ga0496115_0181795_1126_1704 190
1525 3300048918 Ga0496115_0347057 Ga0496115_0347057_299_877 190
1526 3300048918 Ga0496115_0557753 Ga0496115_0557753_16_594 190
1527 3300048919 Ga0496116_0000243 Ga0496116_0000243_62339_62914 190
1528 3300048919 Ga0496116_0035198 Ga0496116_0035198_1092_1664 190
1529 3300048919 Ga0496116_0098206 Ga0496116_0098206_931_1503 190
1530 3300048919 Ga0496116_0146092 Ga0496116_0146092_329_901 190
1531 3300048919 Ga0496116_0180012 Ga0496116_0180012_192_770 190
1532 3300048920 Ga0496117_0000016 Ga0496117_0000016_429489_430061 190
1533 3300048920 Ga0496117_0250894 Ga0496117_0250894_246_818 190
1534 3300048920 Ga0496117_0312662 Ga0496117_0312662_19_597 190
1535 3300048921 Ga0496118_0000618 Ga0496118_0000618_41306_41884 190
1536 3300048921 Ga0496118_0000758 Ga0496118_0000758_12049_12621 190
1537 3300048921 Ga0496118_0018278 Ga0496118_0018278_4466_5038 190
1538 3300048921 Ga0496118_0062355 Ga0496118_0062355_130_702 190
1539 3300048921 Ga0496118_0086264 Ga0496118_0086264_504_1079 190
1540 3300048921 Ga0496118_0290398 Ga0496118_0290398_268_846 190
1541 3300048922 Ga0496119_0020692 Ga0496119_0020692_818_1396 190
1542 3300048922 Ga0496119_0039638 Ga0496119_0039638_1103_1675 190
1543 3300048922 Ga0496119_0047807 Ga0496119_0047807_870_1442 190
1544 3300048922 Ga0496119_0330102 Ga0496119_0330102_11_586 190
1545 3300048923 Ga0496120_0000056 Ga0496120_0000056_118466_119038 190
1546 3300048923 Ga0496120_0168459 Ga0496120_0168459_459_1031 190
1547 3300048924 Ga0496121_0000212 Ga0496121_0000212_59330_59908 190
1548 3300048924 Ga0496121_0010821 Ga0496121_0010821_3506_4078 190
1549 3300048924 Ga0496121_0025866 Ga0496121_0025866_3857_4435 190
1550 3300048924 Ga0496121_0035931 Ga0496121_0035931_1425_2003 190
1551 3300048924 Ga0496121_0043504 Ga0496121_0043504_3050_3622 190
1552 3300048924 Ga0496121_0156854 Ga0496121_0156854_92_670 190
1553 3300048924 Ga0496121_0216720 Ga0496121_0216720_81_659 190
1554 3300048924 Ga0496121_0297240 Ga0496121_0297240_218_796 190
1555 3300048924 Ga0496121_0383331 Ga0496121_0383331_96_668 190
1556 3300048924 Ga0496121_0388202 Ga0496121_0388202_267_839 190
1557 3300048924 Ga0496121_0485862 Ga0496121_0485862_44_616 190
1558 3300048925 Ga0496122_0000002 Ga0496122_0000002_430150_430722 190
1559 3300048925 Ga0496122_0000106 Ga0496122_0000106_65611_66201 190
1560 3300048925 Ga0496122_0014427 Ga0496122_0014427_2875_3447 190
1561 3300048925 Ga0496122_0017699 Ga0496122_0017699_1309_1884 190
1562 3300048925 Ga0496122_0220255 Ga0496122_0220255_159_737 190
1563 3300048925 Ga0496122_0232361 Ga0496122_0232361_198_773 190
1564 3300048926 Ga0496123_0000002 Ga0496123_0000002_1380961_1381533 190
1565 3300048926 Ga0496123_0000002 Ga0496123_0000002_430150_430722 190
1566 3300048926 Ga0496123_0000022 Ga0496123_0000022_295956_296546 190
1567 3300048927 Ga0496124_0000080 Ga0496124_0000080_209096_209668 190
1568 3300048927 Ga0496124_0000861 Ga0496124_0000861_12504_13082 190
1569 3300048927 Ga0496124_0004878 Ga0496124_0004878_529_1101 190
1570 3300048927 Ga0496124_0070834 Ga0496124_0070834_1262_1837 190
1571 3300048927 Ga0496124_0071440 Ga0496124_0071440_2178_2750 190
1572 3300048927 Ga0496124_0083348 Ga0496124_0083348_1673_2263 190
1573 3300048928 Ga0496125_0012755 Ga0496125_0012755_2283_2855 190
1574 3300048928 Ga0496125_0093394 Ga0496125_0093394_996_1574 190
1575 3300048928 Ga0496125_0152717 Ga0496125_0152717_171_743 190
1576 3300048928 Ga0496125_0186194 Ga0496125_0186194_380_958 190
1577 3300048928 Ga0496125_0247645 Ga0496125_0247645_182_754 190
1578 3300048929 Ga0496126_0000554 Ga0496126_0000554_62802_63377 190
1579 3300048929 Ga0496126_0031476 Ga0496126_0031476_3932_4510 190
1580 3300048929 Ga0496126_0040035 Ga0496126_0040035_1814_2392 190
1581 3300048929 Ga0496126_0047672 Ga0496126_0047672_2242_2820 190
1582 3300048929 Ga0496126_0661002 Ga0496126_0661002_20_598 190
1583 3300048929 Ga0496126_0954233 Ga0496126_0954233_17_595 190
1584 3300049459 Ga0495678_093929 Ga0495678_093929_209_787 190
1585 3300049459 Ga0495678_119790 Ga0495678_119790_251_823 190
1586 3300049460 Ga0495682_0022972 Ga0495682_0022972_1358_1984 190
1587 3300049460 Ga0495682_0142163 Ga0495682_0142163_261_839 190
1588 3300049569 Ga0501032_0175641 Ga0501032_0175641_698_1270 190
1589 3300049580 Ga0501046_0298107 Ga0501046_0298107_28_600 190
1590 3300049581 Ga0501047_0062731 Ga0501047_0062731_86_658 190
1591 3300049584 Ga0501068_0094612 Ga0501068_0094612_785_1357 190
1592 3300049585 Ga0501069_0152351 Ga0501069_0152351_693_1271 190
1593 3300049744 Ga0501083_0183352 Ga0501083_0183352_475_1047 190
1594 3300050489 nmdc:mga03683_133364_c1 nmdc:mga03683_133364_c1_373_945 190
1595 3300050490 nmdc:mga03n38_116525_c1 nmdc:mga03n38_116525_c1_363_941 190
1596 3300050490 nmdc:mga03n38_191024_c1 nmdc:mga03n38_191024_c1_275_847 190
1597 3300050491 nmdc:mga00v17_120638_c1 nmdc:mga00v17_120638_c1_292_870 190
1598 3300050491 nmdc:mga00v17_241926_c1 nmdc:mga00v17_241926_c1_70_732 190
1599 3300050491 nmdc:mga00v17_361451_c1 nmdc:mga00v17_361451_c1_142_720 190
1600 3300050491 nmdc:mga00v17_3_c1 nmdc:mga00v17_3_c1_210389_210961 190
1601 3300050491 nmdc:mga00v17_73752_c1 nmdc:mga00v17_73752_c1_1380_1958 190
1602 3300050492 nmdc:mga0yw44_105055_c1 nmdc:mga0yw44_105055_c1_799_1377 190
1603 3300050492 nmdc:mga0yw44_128_c2 nmdc:mga0yw44_128_c2_4634_5206 190
1604 3300050492 nmdc:mga0yw44_14433_c1 nmdc:mga0yw44_14433_c1_3143_3715 190
1605 3300050492 nmdc:mga0yw44_16961_c1 nmdc:mga0yw44_16961_c1_328_906 190
1606 3300050492 nmdc:mga0yw44_174167_c1 nmdc:mga0yw44_174167_c1_396_974 190
1607 3300050492 nmdc:mga0yw44_22166_c1 nmdc:mga0yw44_22166_c1_1910_2488 190
1608 3300050492 nmdc:mga0yw44_226943_c1 nmdc:mga0yw44_226943_c1_421_999 190
1609 3300050492 nmdc:mga0yw44_372467_c1 nmdc:mga0yw44_372467_c1_210_785 190
1610 3300050492 nmdc:mga0yw44_4892_c2 nmdc:mga0yw44_4892_c2_843_1421 190
1611 3300050493 nmdc:mga0k408_168347_c1 nmdc:mga0k408_168347_c1_565_1143 190
1612 3300050493 nmdc:mga0k408_180506_c1 nmdc:mga0k408_180506_c1_211_789 190
1613 3300050493 nmdc:mga0k408_186098_c1 nmdc:mga0k408_186098_c1_445_1023 190
1614 3300050493 nmdc:mga0k408_71765_c1 nmdc:mga0k408_71765_c1_232_804 190
1615 3300050493 nmdc:mga0k408_86721_c1 nmdc:mga0k408_86721_c1_456_1028 190
1616 3300050494 nmdc:mga06z11_11929_c1 nmdc:mga06z11_11929_c1_732_1316 190
1617 3300050494 nmdc:mga06z11_121100_c1 nmdc:mga06z11_121100_c1_473_1051 190
1618 3300050494 nmdc:mga06z11_134937_c1 nmdc:mga06z11_134937_c1_346_918 190
1619 3300050494 nmdc:mga06z11_193209_c1 nmdc:mga06z11_193209_c1_190_768 190
1620 3300050494 nmdc:mga06z11_240677_c1 nmdc:mga06z11_240677_c1_354_932 190
1621 3300050494 nmdc:mga06z11_293678_c1 nmdc:mga06z11_293678_c1_16_594 190
1622 3300050494 nmdc:mga06z11_507743_c1 nmdc:mga06z11_507743_c1_95_673 190
1623 3300050494 nmdc:mga06z11_7911_c1 nmdc:mga06z11_7911_c1_2228_2800 190
1624 3300050494 nmdc:mga06z11_80852_c1 nmdc:mga06z11_80852_c1_528_1100 190
1625 3300050495 nmdc:mga04h51_24731_c1 nmdc:mga04h51_24731_c1_646_1224 190
1626 3300050495 nmdc:mga04h51_70588_c1 nmdc:mga04h51_70588_c1_200_778 190
1627 3300050496 nmdc:mga07m45_139712_c1 nmdc:mga07m45_139712_c1_316_888 190
1628 3300050496 nmdc:mga07m45_51883_c2 nmdc:mga07m45_51883_c2_1074_1652 190
1629 3300050496 nmdc:mga07m45_52506_c1 nmdc:mga07m45_52506_c1_15_587 190
1630 3300050496 nmdc:mga07m45_5718_c1 nmdc:mga07m45_5718_c1_4884_5462 190
1631 3300050496 nmdc:mga07m45_73781_c1 nmdc:mga07m45_73781_c1_1055_1633 190
1632 3300050496 nmdc:mga07m45_8545_c1 nmdc:mga07m45_8545_c1_3622_4194 190
1633 3300050507 nmdc:mga05p37_190489_c1 nmdc:mga05p37_190489_c1_749_1327 190
1634 3300050508 nmdc:mga09592_446558_c1 nmdc:mga09592_446558_c1_194_772 190
1635 3300050509 nmdc:mga0qj67_464114_c1 nmdc:mga0qj67_464114_c1_74_652 190
1636 3300050511 nmdc:mga08y16_65581_c1 nmdc:mga08y16_65581_c1_2127_2705 190
1637 3300050513 nmdc:mga0rr50_293273_c1 nmdc:mga0rr50_293273_c1_43_621 190
1638 3300050516 nmdc:mga0sz30_12371_c1 nmdc:mga0sz30_12371_c1_2613_3191 190
1639 3300050516 nmdc:mga0sz30_34918_c1 nmdc:mga0sz30_34918_c1_292_864 190
1640 3300050516 nmdc:mga0sz30_37069_c1 nmdc:mga0sz30_37069_c1_627_1289 190
1641 3300050516 nmdc:mga0sz30_49798_c2 nmdc:mga0sz30_49798_c2_213_785 190
1642 3300050516 nmdc:mga0sz30_51562_c1 nmdc:mga0sz30_51562_c1_73_651 190
1643 3300050516 nmdc:mga0sz30_65067_c1 nmdc:mga0sz30_65067_c1_260_832 190
1644 3300050516 nmdc:mga0sz30_982_c1 nmdc:mga0sz30_982_c1_1550_2122 190
1645 3300053079 Ga0500610_0072093 Ga0500610_0072093_33_659 190
1646 3300053079 Ga0500610_0156237 Ga0500610_0156237_326_904 190
1647 3300053083 Ga0495655_0062339 Ga0495655_0062339_392_964 190
1648 3300053085 Ga0495619_0104837 Ga0495619_0104837_996_1574 190
1649 3300053086 Ga0500578_0150466 Ga0500578_0150466_505_1083 190
1650 3300053087 Ga0500643_000055 Ga0500643_000055_48953_49531 190
1651 3300053091 Ga0500647_0134699 Ga0500647_0134699_173_751 190
1652 3300053093 Ga0500651_0066988 Ga0500651_0066988_1224_1796 190
1653 3300053093 Ga0500651_0312622 Ga0500651_0312622_24_602 190
1654 3300053094 Ga0500566_0000041 Ga0500566_0000041_8528_9106 190
1655 3300053095 Ga0500640_197320 Ga0500640_197320_34_612 190
1656 3300053096 Ga0500641_0026061 Ga0500641_0026061_1107_1685 190
1657 3300053097 Ga0500648_117904 Ga0500648_117904_215_793 190
1658 3300053098 Ga0500650_0225016 Ga0500650_0225016_162_788 190
1659 3300053099 Ga0500654_121663 Ga0500654_121663_31_609 190
1660 3300053105 Ga0500557_000017 Ga0500557_000017_66795_67373 190
1661 3300053105 Ga0500557_037856 Ga0500557_037856_351_977 190
1662 3300053107 Ga0500560_000033 Ga0500560_000033_11062_11634 190
1663 3300053109 Ga0500569_008436 Ga0500569_008436_1592_2170 190
1664 3300053109 Ga0500569_014543 Ga0500569_014543_646_1272 190
1665 3300053111 Ga0500572_009460 Ga0500572_009460_1013_1591 190
1666 3300053116 Ga0500592_018694 Ga0500592_018694_90_668 190
1667 3300053118 Ga0500594_0001940 Ga0500594_0001940_3442_4068 190
1668 3300053118 Ga0500594_0070772 Ga0500594_0070772_358_936 190
1669 3300053118 Ga0500594_0185452 Ga0500594_0185452_46_624 190
1670 3300053119 Ga0500595_000891 Ga0500595_000891_15303_15965 190
1671 3300053119 Ga0500595_001184 Ga0500595_001184_1004_1582 190
1672 3300053119 Ga0500595_062568 Ga0500595_062568_149_727 190
1673 3300053122 Ga0500608_165189 Ga0500608_165189_221_799 190
1674 3300053125 Ga0500618_042067 Ga0500618_042067_23_601 190
1675 3300053126 Ga0500621_083986 Ga0500621_083986_218_796 190
1676 3300053130 Ga0500642_0000171 Ga0500642_0000171_893_1471 190
1677 3300053130 Ga0500642_0085072 Ga0500642_0085072_457_1035 190
1678 3300053130 Ga0500642_0088117 Ga0500642_0088117_461_1039 190
1679 3300053131 Ga0500652_209416 Ga0500652_209416_145_723 190
1680 3300053133 Ga0500655_036861 Ga0500655_036861_138_716 190
1681 3300053134 Ga0500658_0020608 Ga0500658_0020608_1069_1641 190
1682 3300053136 Ga0500559_0022060 Ga0500559_0022060_1602_2180 190
1683 3300053136 Ga0500559_0030989 Ga0500559_0030989_1524_2102 190
1684 3300053136 Ga0500559_0319043 Ga0500559_0319043_109_687 190
1685 3300053137 Ga0500561_0000034 Ga0500561_0000034_4139_4711 190
1686 3300053138 Ga0500564_166616 Ga0500564_166616_118_696 190
1687 3300053139 Ga0500568_0000109 Ga0500568_0000109_61742_62368 190
1688 3300053139 Ga0500568_0000202 Ga0500568_0000202_10402_10977 190
1689 3300053139 Ga0500568_0003149 Ga0500568_0003149_5486_6058 190
1690 3300053139 Ga0500568_0083646 Ga0500568_0083646_207_785 190
1691 3300053140 Ga0500573_0041459 Ga0500573_0041459_172_750 190
1692 3300053142 Ga0500577_0122383 Ga0500577_0122383_461_1033 190
1693 3300053142 Ga0500577_0321596 Ga0500577_0321596_92_664 190
1694 3300053146 Ga0500588_0071588 Ga0500588_0071588_298_924 190
1695 3300053150 Ga0500603_013184 Ga0500603_013184_954_1616 190
1696 3300053151 Ga0500604_0013214 Ga0500604_0013214_395_967 190
1697 3300053152 Ga0500606_122139 Ga0500606_122139_85_657 190
1698 3300053153 Ga0500616_0000472 Ga0500616_0000472_23076_23702 190
1699 3300053153 Ga0500616_0098621 Ga0500616_0098621_49_621 190
1700 3300053154 Ga0500619_211016 Ga0500619_211016_61_639 190
1701 3300053156 Ga0500622_0000134 Ga0500622_0000134_5619_6254 190
1702 3300053156 Ga0500622_0018187 Ga0500622_0018187_1600_2178 190
1703 3300053156 Ga0500622_0029086 Ga0500622_0029086_2070_2648 190
1704 3300053156 Ga0500622_0085531 Ga0500622_0085531_602_1180 190
1705 3300053157 Ga0500624_000323 Ga0500624_000323_15233_15805 190
1706 3300053161 Ga0500634_0192563 Ga0500634_0192563_46_618 190
1707 3300053162 Ga0500638_121376 Ga0500638_121376_318_980 190
1708 3300053177 Ga0500636_0000107 Ga0500636_0000107_1511_2089 190
1709 3300053177 Ga0500636_0141890 Ga0500636_0141890_578_1156 190
1710 3300053177 Ga0500636_0252480 Ga0500636_0252480_292_870 190
1711 3300053178 Ga0500637_0000240 Ga0500637_0000240_15305_15967 190
1712 3300053730 Ga0500645_036326 Ga0500645_036326_689_1267 190
1713 3300053733 Ga0500552_000443 Ga0500552_000443_2792_3370 190
1714 3300053735 Ga0500596_006036 Ga0500596_006036_1298_1876 190
1715 3300053736 Ga0500599_001227 Ga0500599_001227_345_923 190
1716 3300053737 Ga0500601_012419 Ga0500601_012419_58_636 190
1717 3300059643 Ga0587072_023949 Ga0587072_023949_23_595 190
1718 3300060353 Ga0501082_0039710 Ga0501082_0039710_1950_2522 190
1719 iso_pu_bacteria 8005626139 8005626296 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

73

203

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.8076 32 172
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.7791 32 177
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.7479 32 172
3nvo-assembly2.cif.gz_B-2 the soluble domain structure of the zntb zn2+ efflux system 0.6195 68 170
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.6183 32 177
ID Description Score Start End Superfamily
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8298 45 174 1.20.120.550
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8188 45 174 1.20.120.550
3mq1A01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7193 83 170 1.20.58.970
af_Q553K8_226_392_1.20.58.340 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.6702 65 170 1.20.58.340
3mq1A01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6404 83 170 1.20.58.970
ID Description Score Start End GO Terms
AF-A0A413G513-F1-model_v4 TRAP transporter small permease 0.9023 32 174 GO:0005886
GO:0015740
GO:0022857
AF-A0A1I1BFZ3-F1-model_v4 TRAP-type C4-dicarboxylate transport system, small permease component 0.8997 32 172 GO:0005886
GO:0015740
GO:0022857
AF-A0A2V1JWP9-F1-model_v4 TRAP transporter small permease protein 0.8988 33 175 GO:0005886
GO:0015740
GO:0022857
AF-A0A1Y1S3F3-F1-model_v4 C4-dicarboxylate ABC transporter permease 0.8987 32 173 GO:0005886
GO:0015740
GO:0022857
AF-A0A2T0KET4-F1-model_v4 TRAP-type C4-dicarboxylate transport system permease small subunit 0.8972 32 170 GO:0005886
GO:0015740
GO:0022857

Feature Viewer

pLDDT pTM Quality
77.03 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map