F495417

General Info

Members Datasets Scaffolds Average Seq Length
1708 435 3416 131

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100147002|Ga0070697_1001470022
Length 150
Sequence MRAPIIPTPPNNPRASRSHSLASIEYYATGRRKTSAARVFLRPGKGAITVNHREFDKYFTTEALRTQVRRPLLLTETGEKFDILATVNGGGEHGQAGAVRLGIARALVAYNAELRKQLKKDGLLTSDSRIKERKKYGLAGARKRFQFSKR

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
95 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
98 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
127 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
214 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
222 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
223 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
224 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
225 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
226 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
235 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
236 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
237 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
238 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
240 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
242 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
243 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
244 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
245 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
246 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
247 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
248 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
249 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
250 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
254 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
257 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
258 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
259 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
260 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
261 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
262 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
263 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
264 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
265 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
266 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
267 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
268 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
269 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
270 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
271 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
272 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
273 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
274 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
275 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
276 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
277 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
278 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
279 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
280 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
281 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
282 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
283 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
284 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
285 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
286 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
287 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
288 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
289 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
290 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
291 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
292 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
293 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
294 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
295 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
296 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
297 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
298 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
299 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
300 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
301 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
302 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
303 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
304 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
305 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
306 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
307 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
308 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
309 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
310 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
311 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
312 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
313 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
314 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
315 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
316 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
317 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
318 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
319 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
320 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
321 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
322 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
323 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
324 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
325 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
326 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
327 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
328 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
329 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
330 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
331 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
332 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
333 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
334 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
335 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
336 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
337 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
338 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
339 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
340 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
341 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
342 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
343 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
344 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
345 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
346 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
347 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
348 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
349 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
350 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
351 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
352 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
353 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
354 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
355 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
356 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
357 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
358 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
361 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
362 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
378 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
379 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
380 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
381 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
382 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
383 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
384 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
385 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
386 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
387 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
388 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
389 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
390 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
391 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
392 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
393 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
394 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
395 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
396 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
400 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
401 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
402 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
403 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
404 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
405 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
406 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
407 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
408 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
409 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
410 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
411 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
412 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
413 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
414 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
415 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
416 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
417 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
418 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
419 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
420 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
421 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
422 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
423 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
424 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
425 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
426 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
435 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 2.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.99
Nodule 0
Rhizoplane 0.59
Rhizosphere 96.72
Stem 0
Stem Tuber 0
Unclassified 1.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100147002 3300005536 Bacteria 1985
2 SwRhRL2b_contig_1211040 2162886007 Bacteria 1595
3 SwRhRL2b_contig_2962400 2162886007 Bacteria 1673
4 ARcpr5yngRDRAFT_c003349 3300000043 Bacteria 1588
5 ARcpr5yngRDRAFT_c022595 3300000043 Bacteria 535
6 ARSoilOldRDRAFT_c005267 3300000044 Bacteria 1092
7 JGI24746J21847_1002952 3300001977 Bacteria 2677
8 JGI24743J22301_10018312 3300001991 Bacteria 1323
9 JGI24750J21931_1011992 3300002070 Bacteria 1145
10 JGI24745J21846_1007836 3300002073 Bacteria 1198
11 JGI24749J21850_1009285 3300002076 Bacteria 1375
12 JGI24749J21850_1018564 3300002076 Bacteria 982
13 JGI24035J26624_1002635 3300002126 Bacteria 1673
14 JGI24034J26672_10009727 3300002239 Bacteria 1422
15 Ga0007429J51699_1076987 3300003579 Bacteria 1461
16 Ga0058859_10072819 3300004798 Bacteria 1202
17 Ga0058859_10076617 3300004798 Bacteria 885
18 Ga0058859_10112349 3300004798 Bacteria 1363
19 Ga0058859_11758504 3300004798 Bacteria 1073
20 Ga0058863_11888265 3300004799 Bacteria 1214
21 Ga0058863_11933612 3300004799 Bacteria 970
22 Ga0058861_11944745 3300004800 Bacteria 616
23 Ga0058860_10075353 3300004801 Bacteria 1803
24 Ga0058860_12072903 3300004801 Bacteria 1074
25 Ga0058862_10000370 3300004803 Bacteria 1720
26 Ga0058862_10073603 3300004803 Unclassified 956
27 Ga0058862_12246224 3300004803 Bacteria 770
28 Ga0058862_12876188 3300004803 Bacteria 800
29 Ga0065704_10031862 3300005289 Bacteria 918
30 Ga0065704_10094226 3300005289 Bacteria 2554
31 Ga0065704_10095758 3300005289 Bacteria 2469
32 Ga0065712_10010362 3300005290 Bacteria 2377
33 Ga0065712_10070291 3300005290 Bacteria 6142
34 Ga0065712_10109991 3300005290 Bacteria 1845
35 Ga0065715_10008080 3300005293 Bacteria 4736
36 Ga0065715_10267676 3300005293 Bacteria 1120
37 Ga0065715_10308589 3300005293 Bacteria 1025
38 Ga0065715_10495517 3300005293 Bacteria 765
39 Ga0065715_10910357 3300005293 Bacteria 572
40 Ga0065707_10002448 3300005295 Bacteria 6187
41 Ga0065707_10005263 3300005295 Bacteria 3881
42 Ga0065707_10090343 3300005295 Bacteria 4158
43 Ga0065707_10214064 3300005295 Bacteria 1252
44 Ga0065707_10368142 3300005295 Bacteria 894
45 Ga0070658_10068414 3300005327 Bacteria 2903
46 Ga0070658_10301255 3300005327 Bacteria 1367
47 Ga0070658_10330334 3300005327 Bacteria 1303
48 Ga0070676_10005855 3300005328 Bacteria 6560
49 Ga0070676_10007899 3300005328 Bacteria 5717
50 Ga0070676_10127180 3300005328 Bacteria 1607
51 Ga0070676_10696132 3300005328 Bacteria 742
52 Ga0070676_10697997 3300005328 Bacteria 741
53 Ga0070676_11264948 3300005328 Bacteria 562
54 Ga0070683_100147764 3300005329 Bacteria 2228
55 Ga0070690_100067037 3300005330 Bacteria 2325
56 Ga0070690_100137740 3300005330 Bacteria 1654
57 Ga0070690_100178665 3300005330 Bacteria 1465
58 Ga0070690_100216256 3300005330 Bacteria 1340
59 Ga0070690_100341436 3300005330 Bacteria 1084
60 Ga0070670_100015682 3300005331 Bacteria 6504
61 Ga0070670_100023037 3300005331 Bacteria 5358
62 Ga0070670_100132059 3300005331 Bacteria 2157
63 Ga0070670_100203273 3300005331 Bacteria 1721
64 Ga0070670_100334986 3300005331 Bacteria 1327
65 Ga0070670_100919282 3300005331 Bacteria 794
66 Ga0070670_101486820 3300005331 Bacteria 622
67 Ga0070670_102069694 3300005331 Bacteria 524
68 Ga0070677_10003332 3300005333 Bacteria 5175
69 Ga0070677_10089005 3300005333 Bacteria 1338
70 Ga0070677_10091512 3300005333 Bacteria 1324
71 Ga0070677_10191605 3300005333 Bacteria 980
72 Ga0070677_10207197 3300005333 Bacteria 950
73 Ga0070677_10208811 3300005333 Bacteria 947
74 Ga0070677_10263014 3300005333 Bacteria 862
75 Ga0070677_10823769 3300005333 Bacteria 531
76 Ga0068869_100006495 3300005334 Bacteria 7421
77 Ga0068869_100025663 3300005334 Bacteria 4094
78 Ga0068869_100035749 3300005334 Bacteria 3523
79 Ga0068869_100704100 3300005334 Bacteria 861
80 Ga0068869_100712881 3300005334 Bacteria 856
81 Ga0068869_101146594 3300005334 Bacteria 681
82 Ga0070666_10003133 3300005335 Bacteria 10048
83 Ga0070666_10407629 3300005335 Bacteria 978
84 Ga0070666_10735424 3300005335 Bacteria 725
85 Ga0070680_100155041 3300005336 Bacteria 1924
86 Ga0070680_100316842 3300005336 Bacteria 1324
87 Ga0070680_100500387 3300005336 Bacteria 1040
88 Ga0070680_100754747 3300005336 Bacteria 838
89 Ga0070682_100388553 3300005337 Bacteria 1052
90 Ga0070682_100788543 3300005337 Unclassified 771
91 Ga0070682_100928432 3300005337 Bacteria 717
92 Ga0068868_100001652 3300005338 Bacteria 15233
93 Ga0068868_100014737 3300005338 Bacteria 5767
94 Ga0068868_101357689 3300005338 Bacteria 662
95 Ga0068868_101362895 3300005338 Bacteria 661
96 Ga0068868_101448124 3300005338 Bacteria 642
97 Ga0068868_101624810 3300005338 Bacteria 608
98 Ga0070660_100024567 3300005339 Bacteria 4471
99 Ga0070660_100371508 3300005339 Bacteria 1180
100 Ga0070689_100016249 3300005340 Bacteria 5443
101 Ga0070689_100100601 3300005340 Bacteria 2287
102 Ga0070689_100201197 3300005340 Bacteria 1626
103 Ga0070689_100203010 3300005340 Bacteria 1619
104 Ga0070689_100422021 3300005340 Bacteria 1131
105 Ga0070689_100634648 3300005340 Unclassified 928
106 Ga0070689_102026809 3300005340 Bacteria 526
107 Ga0070691_10001877 3300005341 Bacteria 9186
108 Ga0070691_10289880 3300005341 Bacteria 891
109 Ga0070687_100036278 3300005343 Bacteria 2455
110 Ga0070687_100047270 3300005343 Bacteria 2206
111 Ga0070687_100163315 3300005343 Bacteria 1318
112 Ga0070687_100171046 3300005343 Bacteria 1293
113 Ga0070687_100184043 3300005343 Bacteria 1253
114 Ga0070687_100770520 3300005343 Unclassified 679
115 Ga0070661_100035459 3300005344 Bacteria 3622
116 Ga0070661_100165281 3300005344 Bacteria 1678
117 Ga0070661_100177661 3300005344 Bacteria 1619
118 Ga0070661_101116916 3300005344 Unclassified 657
119 Ga0070692_10014680 3300005345 Bacteria 3686
120 Ga0070692_10163407 3300005345 Bacteria 1277
121 Ga0070692_10282281 3300005345 Bacteria 1007
122 Ga0070668_100012677 3300005347 Bacteria 6275
123 Ga0070668_100148722 3300005347 Bacteria 1892
124 Ga0070668_100187517 3300005347 Bacteria 1692
125 Ga0070668_100256345 3300005347 Bacteria 1453
126 Ga0070668_100389346 3300005347 Bacteria 1188
127 Ga0070669_100002909 3300005353 Bacteria 12341
128 Ga0070669_100016666 3300005353 Bacteria 5244
129 Ga0070669_100047172 3300005353 Bacteria 3142
130 Ga0070669_100081078 3300005353 Bacteria 2416
131 Ga0070669_100100746 3300005353 Bacteria 2178
132 Ga0070669_100102047 3300005353 Bacteria 2165
133 Ga0070669_100104529 3300005353 Bacteria 2141
134 Ga0070669_100139243 3300005353 Bacteria 1869
135 Ga0070669_100148910 3300005353 Bacteria 1810
136 Ga0070669_100217862 3300005353 Bacteria 1508
137 Ga0070669_100262496 3300005353 Bacteria 1378
138 Ga0070669_100365178 3300005353 Bacteria 1175
139 Ga0070669_101132111 3300005353 Unclassified 675
140 Ga0070675_100010206 3300005354 Bacteria 7326
141 Ga0070675_100045822 3300005354 Bacteria 3579
142 Ga0070675_100077322 3300005354 Bacteria 2770
143 Ga0070675_100091376 3300005354 Bacteria 2550
144 Ga0070675_100094782 3300005354 Bacteria 2505
145 Ga0070675_100121983 3300005354 Bacteria 2214
146 Ga0070675_100128765 3300005354 Bacteria 2155
147 Ga0070675_100151004 3300005354 Bacteria 1992
148 Ga0070675_100338965 3300005354 Bacteria 1331
149 Ga0070675_100380140 3300005354 Bacteria 1257
150 Ga0070675_101710015 3300005354 Bacteria 580
151 Ga0070675_101956775 3300005354 Bacteria 541
152 Ga0070671_100006808 3300005355 Bacteria 9148
153 Ga0070671_100068999 3300005355 Bacteria 2948
154 Ga0070671_100596042 3300005355 Bacteria 955
155 Ga0070671_101193581 3300005355 Bacteria 670
156 Ga0070674_100003104 3300005356 Bacteria 9248
157 Ga0070674_100111607 3300005356 Bacteria 2008
158 Ga0070674_100133131 3300005356 Bacteria 1856
159 Ga0070674_100319727 3300005356 Bacteria 1244
160 Ga0070674_101351760 3300005356 Bacteria 637
161 Ga0070673_100004179 3300005364 Bacteria 9107
162 Ga0070673_100020375 3300005364 Bacteria 4783
163 Ga0070673_100083908 3300005364 Bacteria 2589
164 Ga0070673_100228227 3300005364 Bacteria 1614
165 Ga0070673_100232258 3300005364 Bacteria 1600
166 Ga0070673_100294713 3300005364 Bacteria 1426
167 Ga0070673_100316899 3300005364 Bacteria 1377
168 Ga0070673_100341975 3300005364 Bacteria 1326
169 Ga0070673_100346926 3300005364 Bacteria 1317
170 Ga0070673_100778217 3300005364 Bacteria 883
171 Ga0070688_100012388 3300005365 Bacteria 4777
172 Ga0070688_100017737 3300005365 Bacteria 4091
173 Ga0070659_100251203 3300005366 Bacteria 1466
174 Ga0070659_100289674 3300005366 Bacteria 1363
175 Ga0070667_100022611 3300005367 Bacteria 5213
176 Ga0070667_100188117 3300005367 Bacteria 1828
177 Ga0070667_100455037 3300005367 Bacteria 1170
178 Ga0070667_100877510 3300005367 Bacteria 834
179 Ga0070667_100891475 3300005367 Unclassified 828
180 Ga0070667_101599386 3300005367 Bacteria 612
181 Ga0070703_10053562 3300005406 Bacteria 1298
182 Ga0070703_10352230 3300005406 Bacteria 629
183 Ga0070701_10003090 3300005438 Bacteria 6523
184 Ga0070701_10004454 3300005438 Bacteria 5679
185 Ga0070701_10006684 3300005438 Bacteria 4868
186 Ga0070701_10009058 3300005438 Bacteria 4344
187 Ga0070701_10021556 3300005438 Bacteria 3078
188 Ga0070701_10462916 3300005438 Bacteria 816
189 Ga0070701_10484110 3300005438 Bacteria 800
190 Ga0070701_10783527 3300005438 Bacteria 649
191 Ga0070705_100000076 3300005440 Bacteria 53948
192 Ga0070705_100006120 3300005440 Bacteria 5892
193 Ga0070705_100009393 3300005440 Bacteria 4862
194 Ga0070705_100013530 3300005440 Bacteria 4176
195 Ga0070705_100021151 3300005440 Bacteria 3456
196 Ga0070705_100026540 3300005440 Bacteria 3153
197 Ga0070705_100063862 3300005440 Bacteria 2197
198 Ga0070705_100161642 3300005440 Bacteria 1498
199 Ga0070705_100191403 3300005440 Bacteria 1395
200 Ga0070705_100643553 3300005440 Bacteria 826
201 Ga0070705_101114998 3300005440 Bacteria 646
202 Ga0070705_101609144 3300005440 Bacteria 547
203 Ga0070700_100003649 3300005441 Bacteria 7956
204 Ga0070700_100040663 3300005441 Bacteria 2847
205 Ga0070700_100046665 3300005441 Bacteria 2677
206 Ga0070700_100050416 3300005441 Bacteria 2588
207 Ga0070700_100050950 3300005441 Bacteria 2575
208 Ga0070700_100081025 3300005441 Bacteria 2096
209 Ga0070700_100136326 3300005441 Bacteria 1662
210 Ga0070700_100214347 3300005441 Bacteria 1360
211 Ga0070700_100539038 3300005441 Bacteria 905
212 Ga0070700_100949311 3300005441 Bacteria 703
213 Ga0070700_101067743 3300005441 Bacteria 668
214 Ga0070700_101216793 3300005441 Bacteria 629
215 Ga0070700_101230028 3300005441 Bacteria 626
216 Ga0070694_100005583 3300005444 Bacteria 7625
217 Ga0070694_100030315 3300005444 Bacteria 3536
218 Ga0070694_100054773 3300005444 Bacteria 2703
219 Ga0070694_100067741 3300005444 Bacteria 2451
220 Ga0070694_100078557 3300005444 Bacteria 2289
221 Ga0070694_100078952 3300005444 Bacteria 2284
222 Ga0070694_100226790 3300005444 Bacteria 1404
223 Ga0070694_100632669 3300005444 Bacteria 864
224 Ga0070694_100731656 3300005444 Bacteria 807
225 Ga0070694_100912770 3300005444 Bacteria 725
226 Ga0070694_101462127 3300005444 Bacteria 578
227 Ga0070708_100010728 3300005445 Bacteria 7435
228 Ga0070708_100224113 3300005445 Bacteria 1764
229 Ga0070708_100398608 3300005445 Bacteria 1297
230 Ga0070708_100475618 3300005445 Bacteria 1179
231 Ga0070708_100794561 3300005445 Bacteria 890
232 Ga0070708_100975645 3300005445 Bacteria 795
233 Ga0070708_101371943 3300005445 Bacteria 660
234 Ga0070663_100028704 3300005455 Bacteria 3792
235 Ga0070663_100149308 3300005455 Bacteria 1791
236 Ga0070663_100194090 3300005455 Bacteria 1582
237 Ga0070663_100876079 3300005455 Bacteria 774
238 Ga0070663_101231151 3300005455 Bacteria 659
239 Ga0070663_102105276 3300005455 Bacteria 509
240 Ga0070678_100037639 3300005456 Bacteria 3399
241 Ga0070678_100074082 3300005456 Bacteria 2557
242 Ga0070678_100090564 3300005456 Bacteria 2345
243 Ga0070678_100331050 3300005456 Bacteria 1303
244 Ga0070678_100365421 3300005456 Bacteria 1244
245 Ga0070678_100434777 3300005456 Bacteria 1146
246 Ga0070678_100446061 3300005456 Bacteria 1133
247 Ga0070678_100641814 3300005456 Bacteria 952
248 Ga0070678_101247466 3300005456 Bacteria 690
249 Ga0070662_100012481 3300005457 Bacteria 5634
250 Ga0070662_100122161 3300005457 Bacteria 1997
251 Ga0070662_100135969 3300005457 Bacteria 1900
252 Ga0070662_100137752 3300005457 Bacteria 1889
253 Ga0070662_100212030 3300005457 Bacteria 1541
254 Ga0070662_100316083 3300005457 Unclassified 1272
255 Ga0070662_100471889 3300005457 Bacteria 1044
256 Ga0070662_101371842 3300005457 Bacteria 609
257 Ga0070681_10005835 3300005458 Bacteria 11920
258 Ga0070681_10674934 3300005458 Bacteria 949
259 Ga0070681_10695017 3300005458 Bacteria 933
260 Ga0070681_10798702 3300005458 Bacteria 861
261 Ga0070681_11048532 3300005458 Bacteria 736
262 Ga0068867_100000885 3300005459 Bacteria 20261
263 Ga0068867_100010068 3300005459 Bacteria 6663
264 Ga0068867_100036300 3300005459 Bacteria 3577
265 Ga0068867_100040168 3300005459 Bacteria 3412
266 Ga0068867_100049313 3300005459 Bacteria 3100
267 Ga0068867_100140450 3300005459 Bacteria 1887
268 Ga0068867_100482487 3300005459 Bacteria 1062
269 Ga0068867_101099836 3300005459 Bacteria 725
270 Ga0070685_10015040 3300005466 Bacteria 4108
271 Ga0070685_10045758 3300005466 Bacteria 2510
272 Ga0070685_10155309 3300005466 Bacteria 1454
273 Ga0070685_10185633 3300005466 Bacteria 1342
274 Ga0070685_10325275 3300005466 Bacteria 1043
275 Ga0070706_100031504 3300005467 Bacteria 4889
276 Ga0070706_100098530 3300005467 Bacteria 2716
277 Ga0070706_100106631 3300005467 Bacteria 2607
278 Ga0070706_100151364 3300005467 Bacteria 2166
279 Ga0070706_100166042 3300005467 Bacteria 2061
280 Ga0070707_100048094 3300005468 Bacteria 4085
281 Ga0070707_100069308 3300005468 Bacteria 3396
282 Ga0070707_100098727 3300005468 Bacteria 2828
283 Ga0070707_100123795 3300005468 Bacteria 2511
284 Ga0070707_100333848 3300005468 Bacteria 1473
285 Ga0070707_100405305 3300005468 Bacteria 1324
286 Ga0070707_100424058 3300005468 Bacteria 1291
287 Ga0070707_100701501 3300005468 Bacteria 975
288 Ga0070707_100854801 3300005468 Bacteria 874
289 Ga0070707_101846689 3300005468 Bacteria 572
290 Ga0070707_102078359 3300005468 Bacteria 535
291 Ga0070707_102149136 3300005468 Bacteria 526
292 Ga0070698_100001357 3300005471 Bacteria 27226
293 Ga0070698_100002475 3300005471 Bacteria 20373
294 Ga0070698_100006000 3300005471 Bacteria 13235
295 Ga0070698_100022654 3300005471 Bacteria 6569
296 Ga0070698_100143944 3300005471 Bacteria 2334
297 Ga0070698_100316590 3300005471 Bacteria 1491
298 Ga0070698_100351894 3300005471 Bacteria 1405
299 Ga0070698_100649966 3300005471 Bacteria 996
300 Ga0070698_101055418 3300005471 Bacteria 760
301 Ga0070698_101413678 3300005471 Bacteria 647
302 Ga0070699_100000371 3300005518 Bacteria 43874
303 Ga0070699_100008552 3300005518 Bacteria 8868
304 Ga0070699_100079001 3300005518 Bacteria 2865
305 Ga0070699_100314171 3300005518 Bacteria 1407
306 Ga0070699_100695669 3300005518 Bacteria 929
307 Ga0070699_100924740 3300005518 Bacteria 799
308 Ga0070679_100100821 3300005530 Bacteria 2874
309 Ga0070679_100187120 3300005530 Bacteria 2041
310 Ga0070679_100401531 3300005530 Bacteria 1316
311 Ga0070679_100700449 3300005530 Bacteria 956
312 Ga0070684_100043653 3300005535 Bacteria 3873
313 Ga0070684_100522116 3300005535 Bacteria 1101
314 Ga0070697_100100227 3300005536 Bacteria 2405
315 Ga0070697_100310323 3300005536 Bacteria 1357
316 Ga0070697_100332980 3300005536 Bacteria 1309
317 Ga0070697_100399986 3300005536 Bacteria 1192
318 Ga0070697_100520085 3300005536 Bacteria 1042
319 Ga0070697_100551342 3300005536 Bacteria 1011
320 Ga0070697_100612298 3300005536 Bacteria 958
321 Ga0068853_100505311 3300005539 Bacteria 1141
322 Ga0070672_100003923 3300005543 Bacteria 9693
323 Ga0070672_100016175 3300005543 Bacteria 5336
324 Ga0070672_100066892 3300005543 Bacteria 2846
325 Ga0070672_100085240 3300005543 Bacteria 2539
326 Ga0070672_100107450 3300005543 Bacteria 2271
327 Ga0070672_100127690 3300005543 Bacteria 2087
328 Ga0070672_100187328 3300005543 Bacteria 1726
329 Ga0070672_100233593 3300005543 Bacteria 1545
330 Ga0070672_100240086 3300005543 Bacteria 1524
331 Ga0070672_100254807 3300005543 Bacteria 1479
332 Ga0070672_101404136 3300005543 Bacteria 624
333 Ga0070672_101833463 3300005543 Bacteria 545
334 Ga0070672_102007816 3300005543 Bacteria 521
335 Ga0070686_100000959 3300005544 Bacteria 16611
336 Ga0070686_100023758 3300005544 Bacteria 3668
337 Ga0070686_100149884 3300005544 Bacteria 1632
338 Ga0070686_100193263 3300005544 Bacteria 1454
339 Ga0070686_100214551 3300005544 Bacteria 1387
340 Ga0070686_100272221 3300005544 Bacteria 1245
341 Ga0070686_100398924 3300005544 Bacteria 1045
342 Ga0070695_100000627 3300005545 Bacteria 18740
343 Ga0070695_100007666 3300005545 Bacteria 6394
344 Ga0070695_100014109 3300005545 Bacteria 4811
345 Ga0070695_100017212 3300005545 Bacteria 4382
346 Ga0070695_100030280 3300005545 Bacteria 3369
347 Ga0070695_100149039 3300005545 Bacteria 1631
348 Ga0070695_100153035 3300005545 Bacteria 1611
349 Ga0070695_100374529 3300005545 Bacteria 1073
350 Ga0070695_100423060 3300005545 Bacteria 1015
351 Ga0070695_100451009 3300005545 Bacteria 985
352 Ga0070695_100493719 3300005545 Bacteria 945
353 Ga0070695_100517199 3300005545 Bacteria 925
354 Ga0070695_101222842 3300005545 Bacteria 618
355 Ga0070696_100003302 3300005546 Bacteria 10767
356 Ga0070696_100017615 3300005546 Bacteria 4823
357 Ga0070696_100034024 3300005546 Bacteria 3505
358 Ga0070696_100197226 3300005546 Bacteria 1501
359 Ga0070696_100471817 3300005546 Bacteria 994
360 Ga0070696_100646717 3300005546 Bacteria 857
361 Ga0070696_100999257 3300005546 Bacteria 699
362 Ga0070693_100594838 3300005547 Bacteria 798
363 Ga0070665_100056230 3300005548 Bacteria 3945
364 Ga0070665_100348243 3300005548 Bacteria 1487
365 Ga0070665_100946927 3300005548 Bacteria 874
366 Ga0070665_100983789 3300005548 Bacteria 856
367 Ga0070704_100002209 3300005549 Bacteria 10848
368 Ga0070704_100005029 3300005549 Bacteria 7685
369 Ga0070704_100012909 3300005549 Bacteria 5169
370 Ga0070704_100020686 3300005549 Bacteria 4249
371 Ga0070704_100040602 3300005549 Bacteria 3204
372 Ga0070704_100056374 3300005549 Bacteria 2790
373 Ga0070704_100056974 3300005549 Bacteria 2777
374 Ga0070704_100058763 3300005549 Bacteria 2740
375 Ga0070704_100116080 3300005549 Bacteria 2046
376 Ga0070704_100134640 3300005549 Bacteria 1921
377 Ga0070704_100156187 3300005549 Bacteria 1799
378 Ga0070704_100257609 3300005549 Bacteria 1436
379 Ga0070704_100604052 3300005549 Bacteria 964
380 Ga0070704_100866344 3300005549 Bacteria 810
381 Ga0070704_101537837 3300005549 Bacteria 612
382 Ga0068855_100024107 3300005563 Bacteria 7283
383 Ga0070664_100005905 3300005564 Bacteria 9890
384 Ga0070664_100084187 3300005564 Bacteria 2745
385 Ga0070664_100111144 3300005564 Bacteria 2392
386 Ga0070664_100194747 3300005564 Bacteria 1807
387 Ga0070664_100272878 3300005564 Bacteria 1524
388 Ga0070664_100299054 3300005564 Bacteria 1454
389 Ga0070664_100387490 3300005564 Bacteria 1277
390 Ga0070664_100721486 3300005564 Bacteria 929
391 Ga0070664_101544233 3300005564 Bacteria 628
392 Ga0070664_101754948 3300005564 Bacteria 588
393 Ga0070664_101770852 3300005564 Bacteria 586
394 Ga0068857_100103534 3300005577 Bacteria 2555
395 Ga0068857_100601035 3300005577 Bacteria 1040
396 Ga0068857_101750960 3300005577 Bacteria 608
397 Ga0068857_102054285 3300005577 Bacteria 561
398 Ga0068854_100108485 3300005578 Bacteria 2090
399 Ga0068854_100427354 3300005578 Bacteria 1102
400 Ga0068854_100605331 3300005578 Unclassified 936
401 Ga0068854_101226769 3300005578 Bacteria 673
402 Ga0068856_100546339 3300005614 Bacteria 1180
403 Ga0070702_100024575 3300005615 Bacteria 3216
404 Ga0070702_100089961 3300005615 Bacteria 1859
405 Ga0070702_100182026 3300005615 Bacteria 1376
406 Ga0070702_100273601 3300005615 Bacteria 1156
407 Ga0070702_100280066 3300005615 Bacteria 1144
408 Ga0070702_100377833 3300005615 Bacteria 1006
409 Ga0070702_100649535 3300005615 Bacteria 797
410 Ga0068852_100684464 3300005616 Bacteria 1035
411 Ga0068859_100011646 3300005617 Bacteria 8840
412 Ga0068859_100018030 3300005617 Bacteria 7094
413 Ga0068859_100018092 3300005617 Bacteria 7082
414 Ga0068859_100070054 3300005617 Bacteria 3542
415 Ga0068859_100136036 3300005617 Bacteria 2530
416 Ga0068859_100298806 3300005617 Bacteria 1703
417 Ga0068859_100523525 3300005617 Bacteria 1281
418 Ga0068859_100946310 3300005617 Bacteria 945
419 Ga0068859_101312417 3300005617 Bacteria 797
420 Ga0068859_101691441 3300005617 Bacteria 699
421 Ga0068864_100050967 3300005618 Bacteria 3564
422 Ga0068864_100090822 3300005618 Bacteria 2693
423 Ga0068864_100170387 3300005618 Bacteria 1985
424 Ga0068864_100178646 3300005618 Bacteria 1939
425 Ga0068864_100300623 3300005618 Bacteria 1502
426 Ga0068864_100338360 3300005618 Bacteria 1417
427 Ga0068864_100702915 3300005618 Bacteria 988
428 Ga0068864_101064766 3300005618 Bacteria 804
429 Ga0068864_101859805 3300005618 Bacteria 608
430 Ga0068866_10195500 3300005718 Bacteria 1205
431 Ga0068861_100005216 3300005719 Bacteria 8753
432 Ga0068861_100025482 3300005719 Bacteria 4290
433 Ga0068861_100037738 3300005719 Bacteria 3592
434 Ga0068861_100063675 3300005719 Bacteria 2835
435 Ga0068861_100082536 3300005719 Bacteria 2519
436 Ga0068861_100104975 3300005719 Bacteria 2255
437 Ga0068861_100294632 3300005719 Bacteria 1402
438 Ga0068861_100326568 3300005719 Bacteria 1338
439 Ga0068861_100395818 3300005719 Bacteria 1224
440 Ga0068861_101073412 3300005719 Bacteria 772
441 Ga0068851_10131463 3300005834 Bacteria 1354
442 Ga0068870_10008497 3300005840 Bacteria 4622
443 Ga0068870_10011633 3300005840 Bacteria 4088
444 Ga0068870_10020579 3300005840 Bacteria 3215
445 Ga0068870_10131662 3300005840 Bacteria 1453
446 Ga0068870_10165695 3300005840 Bacteria 1315
447 Ga0068870_10246543 3300005840 Bacteria 1105
448 Ga0068870_10539188 3300005840 Bacteria 784
449 Ga0068870_10705237 3300005840 Bacteria 696
450 Ga0068863_100006615 3300005841 Bacteria 11377
451 Ga0068863_100118121 3300005841 Bacteria 2527
452 Ga0068863_100202679 3300005841 Bacteria 1909
453 Ga0068863_100432211 3300005841 Bacteria 1290
454 Ga0068858_100025699 3300005842 Bacteria 5478
455 Ga0068858_100033536 3300005842 Bacteria 4763
456 Ga0068858_100063626 3300005842 Bacteria 3413
457 Ga0068858_100496511 3300005842 Bacteria 1179
458 Ga0068858_100753593 3300005842 Bacteria 949
459 Ga0068858_101080021 3300005842 Bacteria 788
460 Ga0068858_102524993 3300005842 Bacteria 507
461 Ga0068858_102544430 3300005842 Bacteria 505
462 Ga0068860_100021507 3300005843 Bacteria 6246
463 Ga0068860_100073920 3300005843 Bacteria 3240
464 Ga0068860_100148866 3300005843 Bacteria 2253
465 Ga0068860_100304578 3300005843 Bacteria 1562
466 Ga0068860_101377052 3300005843 Unclassified 727
467 Ga0068862_100016772 3300005844 Bacteria 6098
468 Ga0068862_100054990 3300005844 Bacteria 3409
469 Ga0068862_100186013 3300005844 Bacteria 1866
470 Ga0068862_100543549 3300005844 Bacteria 1108
471 Ga0068862_101265866 3300005844 Bacteria 738
472 Ga0068862_101541431 3300005844 Bacteria 671
473 Ga0068862_101873278 3300005844 Bacteria 609
474 Ga0068862_101879519 3300005844 Bacteria 608
475 Ga0068862_101930583 3300005844 Bacteria 600
476 Ga0068862_102309549 3300005844 Unclassified 549
477 Ga0081455_10513376 3300005937 Bacteria 802
478 Ga0081539_10001150 3300005985 Bacteria 47947
479 Ga0081539_10097667 3300005985 Bacteria 1504
480 Ga0081539_10215515 3300005985 Bacteria 877
481 Ga0075365_10162009 3300006038 Bacteria 1559
482 Ga0075368_10023290 3300006042 Bacteria 2364
483 Ga0075363_100051410 3300006048 Bacteria 2197
484 Ga0075363_100234583 3300006048 Bacteria 1054
485 Ga0075364_10029861 3300006051 Bacteria 3497
486 Ga0075432_10221773 3300006058 Bacteria 756
487 Ga0075362_10065225 3300006177 Bacteria 1653
488 Ga0075367_10035318 3300006178 Bacteria 2893
489 Ga0075367_10508540 3300006178 Bacteria 764
490 Ga0075366_10002927 3300006195 Bacteria 8874
491 Ga0075366_10126966 3300006195 Bacteria 1538
492 Ga0075366_10172994 3300006195 Bacteria 1311
493 Ga0075366_10500136 3300006195 Bacteria 751
494 Ga0075366_10724929 3300006195 Bacteria 618
495 Ga0097621_100030713 3300006237 Bacteria 4257
496 Ga0097621_100070007 3300006237 Bacteria 2897
497 Ga0097621_100086917 3300006237 Bacteria 2610
498 Ga0097621_100112574 3300006237 Bacteria 2301
499 Ga0097621_100725513 3300006237 Bacteria 916
500 Ga0075370_10068466 3300006353 Bacteria 2027
501 Ga0075370_10301526 3300006353 Bacteria 953
502 Ga0068871_100052850 3300006358 Bacteria 3291
503 Ga0068871_100081886 3300006358 Bacteria 2675
504 Ga0068871_100105676 3300006358 Bacteria 2363
505 Ga0068871_100259384 3300006358 Bacteria 1516
506 Ga0075428_100000003 3300006844 Bacteria 365483
507 Ga0075428_100000778 3300006844 Bacteria 33262
508 Ga0075428_100003237 3300006844 Bacteria 17826
509 Ga0075428_100025549 3300006844 Bacteria 6539
510 Ga0075428_100033838 3300006844 Bacteria 5638
511 Ga0075428_100035237 3300006844 Bacteria 5517
512 Ga0075428_100111152 3300006844 Bacteria 2986
513 Ga0075428_100174740 3300006844 Bacteria 2327
514 Ga0075428_100190074 3300006844 Bacteria 2221
515 Ga0075428_100197964 3300006844 Bacteria 2173
516 Ga0075428_100323567 3300006844 Bacteria 1657
517 Ga0075428_100338635 3300006844 Bacteria 1616
518 Ga0075428_100341442 3300006844 Bacteria 1608
519 Ga0075428_100344167 3300006844 Bacteria 1601
520 Ga0075428_100443597 3300006844 Bacteria 1390
521 Ga0075428_100520209 3300006844 Bacteria 1273
522 Ga0075428_100547556 3300006844 Bacteria 1237
523 Ga0075428_100792455 3300006844 Bacteria 1007
524 Ga0075428_101780533 3300006844 Bacteria 641
525 Ga0075430_100000569 3300006846 Bacteria 28027
526 Ga0075430_100002777 3300006846 Bacteria 14635
527 Ga0075430_100003418 3300006846 Bacteria 13271
528 Ga0075430_100012378 3300006846 Bacteria 7256
529 Ga0075430_100018937 3300006846 Bacteria 5857
530 Ga0075430_100022143 3300006846 Bacteria 5403
531 Ga0075430_100161080 3300006846 Bacteria 1868
532 Ga0075430_100209952 3300006846 Bacteria 1615
533 Ga0075430_100210553 3300006846 Bacteria 1613
534 Ga0075430_100295305 3300006846 Bacteria 1340
535 Ga0075430_100576620 3300006846 Bacteria 928
536 Ga0075430_100736538 3300006846 Bacteria 813
537 Ga0075430_101452058 3300006846 Bacteria 564
538 Ga0075431_100003313 3300006847 Bacteria 15598
539 Ga0075431_100004064 3300006847 Bacteria 14265
540 Ga0075431_100024757 3300006847 Bacteria 6153
541 Ga0075431_100028120 3300006847 Bacteria 5773
542 Ga0075431_100063209 3300006847 Bacteria 3820
543 Ga0075431_100190458 3300006847 Bacteria 2102
544 Ga0075431_100301822 3300006847 Bacteria 1617
545 Ga0075431_100504645 3300006847 Bacteria 1200
546 Ga0075431_100776267 3300006847 Bacteria 932
547 Ga0075431_100839283 3300006847 Bacteria 890
548 Ga0075431_100987950 3300006847 Bacteria 809
549 Ga0075433_10014462 3300006852 Bacteria 6449
550 Ga0075433_10023108 3300006852 Bacteria 5229
551 Ga0075433_10075217 3300006852 Bacteria 2972
552 Ga0075433_10076442 3300006852 Bacteria 2948
553 Ga0075433_10116216 3300006852 Bacteria 2374
554 Ga0075433_10148051 3300006852 Bacteria 2088
555 Ga0075433_10303244 3300006852 Bacteria 1414
556 Ga0075433_10391253 3300006852 Bacteria 1227
557 Ga0075434_100000096 3300006871 Bacteria 48926
558 Ga0075434_100016254 3300006871 Bacteria 7152
559 Ga0075434_100023994 3300006871 Bacteria 5955
560 Ga0075434_100081437 3300006871 Bacteria 3234
561 Ga0075434_100108662 3300006871 Bacteria 2784
562 Ga0075434_100108898 3300006871 Bacteria 2780
563 Ga0075434_100198020 3300006871 Bacteria 2028
564 Ga0075434_100207097 3300006871 Bacteria 1982
565 Ga0075434_100472331 3300006871 Bacteria 1275
566 Ga0075434_102483683 3300006871 Bacteria 519
567 Ga0075429_100006960 3300006880 Bacteria 9827
568 Ga0075429_100013415 3300006880 Bacteria 7106
569 Ga0075429_100014249 3300006880 Bacteria 6894
570 Ga0075429_100014471 3300006880 Bacteria 6837
571 Ga0075429_100043782 3300006880 Bacteria 3895
572 Ga0075429_100049016 3300006880 Bacteria 3672
573 Ga0075429_100175669 3300006880 Bacteria 1876
574 Ga0075429_100238591 3300006880 Bacteria 1592
575 Ga0075429_100304009 3300006880 Bacteria 1397
576 Ga0075429_100333343 3300006880 Bacteria 1328
577 Ga0075429_101061717 3300006880 Bacteria 708
578 Ga0068865_100013019 3300006881 Bacteria 5245
579 Ga0068865_100021831 3300006881 Bacteria 4167
580 Ga0068865_100067200 3300006881 Bacteria 2531
581 Ga0068865_100182871 3300006881 Bacteria 1615
582 Ga0068865_100193232 3300006881 Bacteria 1575
583 Ga0068865_100363010 3300006881 Bacteria 1177
584 Ga0068865_100394005 3300006881 Bacteria 1133
585 Ga0068865_100873335 3300006881 Bacteria 780
586 Ga0075436_100077618 3300006914 Bacteria 2300
587 Ga0075436_100718475 3300006914 Bacteria 741
588 Ga0097620_100011646 3300006931 Bacteria 8840
589 Ga0097620_100018031 3300006931 Bacteria 7094
590 Ga0097620_100018092 3300006931 Bacteria 7082
591 Ga0097620_100070054 3300006931 Bacteria 3542
592 Ga0097620_100136044 3300006931 Bacteria 2530
593 Ga0097620_100298804 3300006931 Bacteria 1703
594 Ga0097620_100523533 3300006931 Bacteria 1281
595 Ga0097620_100946387 3300006931 Bacteria 945
596 Ga0097620_101312440 3300006931 Bacteria 797
597 Ga0097620_101691898 3300006931 Bacteria 699
598 Ga0075435_100047371 3300007076 Bacteria 3451
599 Ga0075435_100055864 3300007076 Bacteria 3190
600 Ga0075435_100087638 3300007076 Bacteria 2565
601 Ga0075435_100129908 3300007076 Bacteria 2108
602 Ga0075435_100204308 3300007076 Bacteria 1674
603 Ga0075435_100684890 3300007076 Bacteria 891
604 Ga0075435_101068008 3300007076 Bacteria 705
605 Ga0075435_101297816 3300007076 Bacteria 637
606 Ga0105240_10876919 3300009093 Bacteria 967
607 Ga0111539_10000001 3300009094 Bacteria 1035431
608 Ga0111539_10000256 3300009094 Bacteria 63726
609 Ga0111539_10000556 3300009094 Bacteria 47801
610 Ga0111539_10001554 3300009094 Bacteria 30569
611 Ga0111539_10002176 3300009094 Bacteria 26185
612 Ga0111539_10003416 3300009094 Bacteria 20919
613 Ga0111539_10010487 3300009094 Bacteria 11660
614 Ga0111539_10011334 3300009094 Bacteria 11198
615 Ga0111539_10031982 3300009094 Bacteria 6392
616 Ga0111539_10045723 3300009094 Bacteria 5240
617 Ga0111539_10053659 3300009094 Bacteria 4798
618 Ga0111539_10414114 3300009094 Bacteria 1570
619 Ga0111539_10745347 3300009094 Bacteria 1140
620 Ga0111539_10835677 3300009094 Bacteria 1071
621 Ga0111539_11369008 3300009094 Bacteria 821
622 Ga0111539_12965615 3300009094 Bacteria 549
623 Ga0105245_10240146 3300009098 Bacteria 1756
624 Ga0105245_10498559 3300009098 Bacteria 1233
625 Ga0105245_10893211 3300009098 Bacteria 930
626 Ga0105245_12750634 3300009098 Bacteria 545
627 Ga0105247_10204412 3300009101 Bacteria 1329
628 Ga0105247_10266557 3300009101 Bacteria 1176
629 Ga0114129_10000453 3300009147 Bacteria 48900
630 Ga0114129_10008028 3300009147 Bacteria 15034
631 Ga0114129_10014525 3300009147 Bacteria 11222
632 Ga0114129_10039729 3300009147 Bacteria 6636
633 Ga0114129_10045746 3300009147 Bacteria 6151
634 Ga0114129_10051481 3300009147 Bacteria 5781
635 Ga0114129_10051617 3300009147 Bacteria 5773
636 Ga0114129_10063635 3300009147 Bacteria 5150
637 Ga0114129_10122808 3300009147 Bacteria 3573
638 Ga0114129_10232946 3300009147 Bacteria 2479
639 Ga0114129_10380138 3300009147 Bacteria 1865
640 Ga0114129_10519284 3300009147 Bacteria 1553
641 Ga0114129_10541504 3300009147 Bacteria 1515
642 Ga0114129_10583509 3300009147 Bacteria 1450
643 Ga0114129_10614926 3300009147 Bacteria 1406
644 Ga0114129_10669811 3300009147 Bacteria 1337
645 Ga0114129_10684612 3300009147 Bacteria 1320
646 Ga0114129_10719079 3300009147 Bacteria 1282
647 Ga0114129_10744791 3300009147 Bacteria 1255
648 Ga0114129_10767336 3300009147 Bacteria 1233
649 Ga0114129_10832440 3300009147 Unclassified 1175
650 Ga0114129_11006521 3300009147 Bacteria 1049
651 Ga0114129_11542837 3300009147 Bacteria 815
652 Ga0114129_11651434 3300009147 Bacteria 783
653 Ga0114129_11956676 3300009147 Bacteria 710
654 Ga0114129_12757696 3300009147 Bacteria 585
655 Ga0105243_10006872 3300009148 Bacteria 8771
656 Ga0105243_10049077 3300009148 Bacteria 3329
657 Ga0105243_10102632 3300009148 Bacteria 2377
658 Ga0105243_10238046 3300009148 Bacteria 1618
659 Ga0105243_10722013 3300009148 Bacteria 974
660 Ga0105242_10029873 3300009176 Bacteria 4350
661 Ga0105242_10031995 3300009176 Bacteria 4205
662 Ga0105242_10051025 3300009176 Bacteria 3370
663 Ga0105242_10179556 3300009176 Bacteria 1867
664 Ga0105242_11065867 3300009176 Bacteria 820
665 Ga0105242_11478796 3300009176 Bacteria 709
666 Ga0105242_12190908 3300009176 Bacteria 598
667 Ga0105242_12829814 3300009176 Bacteria 536
668 Ga0105248_10256222 3300009177 Bacteria 1970
669 Ga0105248_10387559 3300009177 Bacteria 1573
670 Ga0105248_10496743 3300009177 Bacteria 1375
671 Ga0105248_11170831 3300009177 Bacteria 869
672 Ga0105248_11704032 3300009177 Bacteria 714
673 Ga0105248_12089301 3300009177 Unclassified 644
674 Ga0105238_10037296 3300009551 Bacteria 4941
675 Ga0105238_10248539 3300009551 Bacteria 1756
676 Ga0105238_11343725 3300009551 Bacteria 741
677 Ga0105249_10001486 3300009553 Bacteria 20547
678 Ga0105249_10007331 3300009553 Bacteria 9615
679 Ga0105249_10034398 3300009553 Bacteria 4593
680 Ga0105249_10072287 3300009553 Bacteria 3188
681 Ga0105249_10192381 3300009553 Bacteria 1992
682 Ga0105249_10203760 3300009553 Bacteria 1937
683 Ga0105249_10668731 3300009553 Bacteria 1097
684 Ga0105249_10786454 3300009553 Bacteria 1015
685 Ga0105249_11277432 3300009553 Bacteria 805
686 Ga0105239_10554026 3300010375 Bacteria 1309
687 Ga0105239_11275159 3300010375 Bacteria 847
688 Ga0105246_10051919 3300011119 Bacteria 2816
689 Ga0105246_10326461 3300011119 Bacteria 1249
690 Ga0157325_1031265 3300012485 Bacteria 535
691 Ga0157316_1023494 3300012510 Bacteria 694
692 Ga0157373_11197719 3300013100 Bacteria 572
693 Ga0157371_11067614 3300013102 Bacteria 618
694 Ga0157371_11134845 3300013102 Bacteria 600
695 Ga0157374_10207795 3300013296 Bacteria 1919
696 Ga0157374_10208790 3300013296 Bacteria 1914
697 Ga0157374_10217476 3300013296 Bacteria 1874
698 Ga0157378_10015942 3300013297 Bacteria 6582
699 Ga0157378_10068524 3300013297 Bacteria 3182
700 Ga0157378_10140642 3300013297 Bacteria 2241
701 Ga0157378_10183746 3300013297 Bacteria 1968
702 Ga0157378_10384089 3300013297 Bacteria 1380
703 Ga0157378_11248585 3300013297 Bacteria 783
704 Ga0157378_11971182 3300013297 Bacteria 634
705 Ga0163162_10018956 3300013306 Bacteria 6748
706 Ga0163162_10048937 3300013306 Bacteria 4236
707 Ga0163162_10088231 3300013306 Bacteria 3181
708 Ga0163162_10391958 3300013306 Bacteria 1521
709 Ga0163162_10489768 3300013306 Bacteria 1361
710 Ga0163162_11070058 3300013306 Bacteria 913
711 Ga0163162_11518556 3300013306 Bacteria 763
712 Ga0157372_10758466 3300013307 Bacteria 1128
713 Ga0157375_10021929 3300013308 Bacteria 5870
714 Ga0157375_10069408 3300013308 Bacteria 3530
715 Ga0157375_10159205 3300013308 Bacteria 2399
716 Ga0157375_10219291 3300013308 Bacteria 2060
717 Ga0157375_10452628 3300013308 Bacteria 1449
718 Ga0157375_10605409 3300013308 Bacteria 1255
719 Ga0157375_11246320 3300013308 Bacteria 873
720 Ga0157375_11390688 3300013308 Unclassified 826
721 Ga0157375_11586179 3300013308 Bacteria 774
722 Ga0163163_10087359 3300014325 Bacteria 3128
723 Ga0163163_10259333 3300014325 Bacteria 1789
724 Ga0163163_10543879 3300014325 Bacteria 1224
725 Ga0163163_12039094 3300014325 Bacteria 633
726 Ga0157380_10006529 3300014326 Bacteria 8225
727 Ga0157380_10025676 3300014326 Bacteria 4469
728 Ga0157380_10034047 3300014326 Bacteria 3928
729 Ga0157380_10047540 3300014326 Bacteria 3376
730 Ga0157380_10086191 3300014326 Bacteria 2580
731 Ga0157380_10105617 3300014326 Bacteria 2354
732 Ga0157380_10124516 3300014326 Bacteria 2189
733 Ga0157380_10277324 3300014326 Bacteria 1532
734 Ga0157380_10436334 3300014326 Bacteria 1254
735 Ga0157380_10460398 3300014326 Bacteria 1224
736 Ga0157380_10851157 3300014326 Bacteria 934
737 Ga0157380_11091757 3300014326 Bacteria 836
738 Ga0157380_11785892 3300014326 Bacteria 674
739 Ga0157380_12159682 3300014326 Unclassified 620
740 Ga0157380_12965523 3300014326 Bacteria 540
741 Ga0157377_10002798 3300014745 Bacteria 7775
742 Ga0157377_10004148 3300014745 Bacteria 6619
743 Ga0157377_10012987 3300014745 Bacteria 4204
744 Ga0157377_10050653 3300014745 Bacteria 2339
745 Ga0157377_10098216 3300014745 Bacteria 1740
746 Ga0157377_10151182 3300014745 Bacteria 1435
747 Ga0157377_10840991 3300014745 Bacteria 680
748 Ga0157379_10133061 3300014968 Bacteria 2239
749 Ga0157379_10862597 3300014968 Bacteria 857
750 Ga0157376_10044426 3300014969 Bacteria 3652
751 Ga0157376_10137687 3300014969 Bacteria 2187
752 Ga0157376_11114186 3300014969 Bacteria 815
753 Ga0157376_12127105 3300014969 Bacteria 600
754 Ga0182007_10197610 3300015262 Bacteria 702
755 Ga0163161_10084815 3300017792 Bacteria 2336
756 Ga0163161_10217216 3300017792 Bacteria 1479
757 Ga0163161_10330083 3300017792 Bacteria 1208
758 Ga0163161_10574704 3300017792 Bacteria 926
759 Ga0163161_10829968 3300017792 Bacteria 779
760 Ga0197907_11193868 3300020069 Bacteria 956
761 Ga0206356_10137321 3300020070 Bacteria 799
762 Ga0206356_10718982 3300020070 Bacteria 835
763 Ga0206352_10891523 3300020078 Bacteria 928
764 Ga0206352_11001177 3300020078 Bacteria 771
765 Ga0224712_10046082 3300022467 Bacteria 1672
766 Ga0207666_1006867 3300025271 Bacteria 1486
767 Ga0207666_1033726 3300025271 Bacteria 790
768 Ga0207673_1003013 3300025290 Bacteria 1953
769 Ga0207697_10001427 3300025315 Bacteria 13067
770 Ga0207697_10051861 3300025315 Bacteria 1696
771 Ga0207697_10108540 3300025315 Bacteria 1187
772 Ga0207697_10110154 3300025315 Bacteria 1178
773 Ga0207656_10018782 3300025321 Bacteria 2726
774 Ga0207653_10097414 3300025885 Bacteria 1037
775 Ga0207653_10159409 3300025885 Bacteria 834
776 Ga0207682_10022373 3300025893 Bacteria 2490
777 Ga0207682_10041929 3300025893 Bacteria 1869
778 Ga0207682_10112153 3300025893 Bacteria 1202
779 Ga0207682_10119807 3300025893 Bacteria 1166
780 Ga0207682_10147834 3300025893 Bacteria 1058
781 Ga0207682_10217493 3300025893 Bacteria 883
782 Ga0207682_10423909 3300025893 Bacteria 629
783 Ga0207642_10188054 3300025899 Bacteria 1131
784 Ga0207642_10261535 3300025899 Bacteria 987
785 Ga0207688_10035561 3300025901 Bacteria 2760
786 Ga0207688_10060015 3300025901 Bacteria 2142
787 Ga0207680_10264567 3300025903 Bacteria 1191
788 Ga0207680_10688919 3300025903 Bacteria 732
789 Ga0207647_10130816 3300025904 Bacteria 1475
790 Ga0207647_10143886 3300025904 Bacteria 1396
791 Ga0207645_10006662 3300025907 Bacteria 8248
792 Ga0207645_10008924 3300025907 Bacteria 6964
793 Ga0207645_10048236 3300025907 Bacteria 2719
794 Ga0207645_10340368 3300025907 Bacteria 1003
795 Ga0207645_10551519 3300025907 Bacteria 782
796 Ga0207645_10626992 3300025907 Bacteria 730
797 Ga0207643_10001047 3300025908 Bacteria 16402
798 Ga0207643_10011722 3300025908 Bacteria 4736
799 Ga0207643_10034076 3300025908 Bacteria 2852
800 Ga0207643_10046591 3300025908 Bacteria 2451
801 Ga0207643_10061467 3300025908 Bacteria 2145
802 Ga0207643_10142866 3300025908 Bacteria 1431
803 Ga0207643_10491508 3300025908 Bacteria 784
804 Ga0207643_10630191 3300025908 Bacteria 691
805 Ga0207643_10844171 3300025908 Bacteria 594
806 Ga0207705_10050889 3300025909 Bacteria 2982
807 Ga0207705_10074653 3300025909 Bacteria 2462
808 Ga0207705_10079915 3300025909 Bacteria 2382
809 Ga0207684_10007674 3300025910 Bacteria 9678
810 Ga0207684_10012878 3300025910 Bacteria 7244
811 Ga0207684_10104749 3300025910 Bacteria 2419
812 Ga0207684_10120936 3300025910 Bacteria 2245
813 Ga0207684_10138055 3300025910 Bacteria 2094
814 Ga0207684_10735611 3300025910 Bacteria 837
815 Ga0207707_10033264 3300025912 Bacteria 4513
816 Ga0207707_10258488 3300025912 Bacteria 1511
817 Ga0207707_10985195 3300025912 Bacteria 692
818 Ga0207695_10042256 3300025913 Bacteria 4871
819 Ga0207660_10142568 3300025917 Bacteria 1833
820 Ga0207660_10436523 3300025917 Bacteria 1058
821 Ga0207660_10552679 3300025917 Bacteria 936
822 Ga0207662_10001548 3300025918 Bacteria 11228
823 Ga0207662_10006309 3300025918 Bacteria 6389
824 Ga0207662_10024202 3300025918 Bacteria 3494
825 Ga0207662_10031397 3300025918 Bacteria 3086
826 Ga0207662_10045994 3300025918 Bacteria 2581
827 Ga0207662_10172007 3300025918 Bacteria 1389
828 Ga0207662_10558402 3300025918 Bacteria 793
829 Ga0207662_10752953 3300025918 Unclassified 685
830 Ga0207657_10031657 3300025919 Bacteria 4787
831 Ga0207657_10379936 3300025919 Bacteria 1112
832 Ga0207657_10662959 3300025919 Bacteria 812
833 Ga0207657_10690767 3300025919 Bacteria 793
834 Ga0207649_10012964 3300025920 Bacteria 4645
835 Ga0207649_10120137 3300025920 Bacteria 1770
836 Ga0207649_10164974 3300025920 Bacteria 1538
837 Ga0207649_11590658 3300025920 Unclassified 517
838 Ga0207652_10043098 3300025921 Bacteria 3842
839 Ga0207652_10329372 3300025921 Bacteria 1379
840 Ga0207652_10335523 3300025921 Bacteria 1365
841 Ga0207652_11871534 3300025921 Bacteria 505
842 Ga0207646_10006266 3300025922 Bacteria 12339
843 Ga0207646_10035023 3300025922 Bacteria 4537
844 Ga0207646_10043174 3300025922 Bacteria 4050
845 Ga0207646_10129506 3300025922 Bacteria 2271
846 Ga0207646_10673670 3300025922 Bacteria 926
847 Ga0207646_10690908 3300025922 Bacteria 913
848 Ga0207646_10711274 3300025922 Bacteria 898
849 Ga0207646_10785565 3300025922 Bacteria 848
850 Ga0207646_10847906 3300025922 Bacteria 812
851 Ga0207646_11178175 3300025922 Bacteria 672
852 Ga0207646_11559698 3300025922 Bacteria 571
853 Ga0207681_10005244 3300025923 Bacteria 7961
854 Ga0207681_10027115 3300025923 Bacteria 3701
855 Ga0207681_10030741 3300025923 Bacteria 3503
856 Ga0207681_10052317 3300025923 Bacteria 2769
857 Ga0207681_10056849 3300025923 Bacteria 2670
858 Ga0207681_10114257 3300025923 Bacteria 1969
859 Ga0207681_10160062 3300025923 Bacteria 1696
860 Ga0207681_10194382 3300025923 Bacteria 1554
861 Ga0207681_10432437 3300025923 Bacteria 1068
862 Ga0207681_10788190 3300025923 Bacteria 793
863 Ga0207681_10938560 3300025923 Bacteria 725
864 Ga0207681_11385375 3300025923 Bacteria 590
865 Ga0207694_10036129 3300025924 Bacteria 3791
866 Ga0207694_10420650 3300025924 Bacteria 1113
867 Ga0207650_10009527 3300025925 Bacteria 6637
868 Ga0207650_10132917 3300025925 Bacteria 1949
869 Ga0207650_10185286 3300025925 Bacteria 1660
870 Ga0207650_10247797 3300025925 Bacteria 1441
871 Ga0207650_10258141 3300025925 Bacteria 1413
872 Ga0207650_10364830 3300025925 Bacteria 1190
873 Ga0207659_10000870 3300025926 Bacteria 17967
874 Ga0207659_10011245 3300025926 Bacteria 5650
875 Ga0207659_10012718 3300025926 Bacteria 5370
876 Ga0207659_10019696 3300025926 Bacteria 4447
877 Ga0207659_10032768 3300025926 Bacteria 3570
878 Ga0207659_10075714 3300025926 Bacteria 2471
879 Ga0207659_10078984 3300025926 Bacteria 2426
880 Ga0207659_10121801 3300025926 Bacteria 2000
881 Ga0207659_10126298 3300025926 Bacteria 1967
882 Ga0207659_10169706 3300025926 Bacteria 1720
883 Ga0207659_10198749 3300025926 Bacteria 1600
884 Ga0207659_10944632 3300025926 Bacteria 742
885 Ga0207687_10168341 3300025927 Bacteria 1688
886 Ga0207687_10381714 3300025927 Bacteria 1155
887 Ga0207700_10058601 3300025928 Bacteria 2910
888 Ga0207644_10011771 3300025931 Bacteria 5792
889 Ga0207644_10028840 3300025931 Bacteria 3846
890 Ga0207644_10030496 3300025931 Bacteria 3751
891 Ga0207644_10207718 3300025931 Bacteria 1547
892 Ga0207644_10209190 3300025931 Bacteria 1542
893 Ga0207644_10412163 3300025931 Bacteria 1106
894 Ga0207644_10981345 3300025931 Bacteria 709
895 Ga0207690_10316569 3300025932 Bacteria 1225
896 Ga0207690_10320328 3300025932 Bacteria 1219
897 Ga0207690_10565755 3300025932 Bacteria 925
898 Ga0207706_10008180 3300025933 Bacteria 9647
899 Ga0207706_10107017 3300025933 Bacteria 2461
900 Ga0207706_10222577 3300025933 Bacteria 1652
901 Ga0207706_10249295 3300025933 Bacteria 1551
902 Ga0207706_10251598 3300025933 Bacteria 1543
903 Ga0207706_10317935 3300025933 Bacteria 1355
904 Ga0207706_10327486 3300025933 Bacteria 1333
905 Ga0207706_10391389 3300025933 Bacteria 1206
906 Ga0207706_10419949 3300025933 Bacteria 1159
907 Ga0207706_10479888 3300025933 Bacteria 1074
908 Ga0207706_10509691 3300025933 Bacteria 1038
909 Ga0207706_10533335 3300025933 Bacteria 1011
910 Ga0207706_10883243 3300025933 Bacteria 756
911 Ga0207686_10025437 3300025934 Bacteria 3443
912 Ga0207709_10032782 3300025935 Bacteria 3045
913 Ga0207709_10136337 3300025935 Bacteria 1681
914 Ga0207709_10153390 3300025935 Bacteria 1598
915 Ga0207709_11228933 3300025935 Bacteria 618
916 Ga0207670_10107367 3300025936 Bacteria 2004
917 Ga0207670_10191452 3300025936 Bacteria 1548
918 Ga0207670_10320444 3300025936 Bacteria 1220
919 Ga0207670_10792728 3300025936 Bacteria 789
920 Ga0207670_10999993 3300025936 Bacteria 704
921 Ga0207670_11311826 3300025936 Bacteria 614
922 Ga0207669_10098491 3300025937 Bacteria 1925
923 Ga0207669_10102358 3300025937 Bacteria 1897
924 Ga0207669_10105067 3300025937 Bacteria 1878
925 Ga0207669_10364281 3300025937 Bacteria 1121
926 Ga0207669_10388303 3300025937 Bacteria 1090
927 Ga0207669_10526485 3300025937 Bacteria 950
928 Ga0207669_10639604 3300025937 Bacteria 869
929 Ga0207669_10844508 3300025937 Bacteria 762
930 Ga0207669_10855998 3300025937 Bacteria 757
931 Ga0207704_10002986 3300025938 Bacteria 7651
932 Ga0207704_10007854 3300025938 Bacteria 5063
933 Ga0207704_10068195 3300025938 Bacteria 2241
934 Ga0207704_10137926 3300025938 Bacteria 1701
935 Ga0207704_10324224 3300025938 Bacteria 1189
936 Ga0207704_10757454 3300025938 Bacteria 808
937 Ga0207704_11080266 3300025938 Bacteria 681
938 Ga0207704_11095205 3300025938 Bacteria 677
939 Ga0207704_11147818 3300025938 Bacteria 661
940 Ga0207691_10001775 3300025940 Bacteria 21233
941 Ga0207691_10003846 3300025940 Bacteria 14566
942 Ga0207691_10009893 3300025940 Bacteria 9154
943 Ga0207691_10040136 3300025940 Bacteria 4326
944 Ga0207691_10057301 3300025940 Bacteria 3546
945 Ga0207691_10058941 3300025940 Bacteria 3492
946 Ga0207691_10109652 3300025940 Bacteria 2456
947 Ga0207691_10113155 3300025940 Bacteria 2412
948 Ga0207691_10182155 3300025940 Bacteria 1835
949 Ga0207691_10296865 3300025940 Bacteria 1389
950 Ga0207691_10313968 3300025940 Bacteria 1345
951 Ga0207691_10325489 3300025940 Bacteria 1317
952 Ga0207691_10433291 3300025940 Bacteria 1120
953 Ga0207711_10165572 3300025941 Bacteria 2004
954 Ga0207711_10370987 3300025941 Bacteria 1327
955 Ga0207711_10437452 3300025941 Bacteria 1217
956 Ga0207711_10559472 3300025941 Bacteria 1067
957 Ga0207711_11298564 3300025941 Bacteria 670
958 Ga0207689_10006066 3300025942 Bacteria 10688
959 Ga0207689_10052846 3300025942 Bacteria 3347
960 Ga0207689_10061204 3300025942 Bacteria 3095
961 Ga0207689_10148826 3300025942 Bacteria 1930
962 Ga0207689_10174341 3300025942 Bacteria 1773
963 Ga0207689_10203480 3300025942 Bacteria 1635
964 Ga0207689_10756134 3300025942 Bacteria 820
965 Ga0207689_10954881 3300025942 Bacteria 723
966 Ga0207689_11024386 3300025942 Bacteria 696
967 Ga0207661_10082495 3300025944 Bacteria 2658
968 Ga0207661_10857994 3300025944 Bacteria 836
969 Ga0207679_10008779 3300025945 Bacteria 6446
970 Ga0207679_10015483 3300025945 Bacteria 5041
971 Ga0207679_10027538 3300025945 Bacteria 3932
972 Ga0207679_10124067 3300025945 Bacteria 2061
973 Ga0207679_10137199 3300025945 Bacteria 1971
974 Ga0207679_10149918 3300025945 Bacteria 1896
975 Ga0207679_10204503 3300025945 Bacteria 1652
976 Ga0207679_10495782 3300025945 Bacteria 1089
977 Ga0207679_10586988 3300025945 Bacteria 1003
978 Ga0207667_10059715 3300025949 Bacteria 3992
979 Ga0207651_10006568 3300025960 Bacteria 6109
980 Ga0207651_10027078 3300025960 Bacteria 3595
981 Ga0207651_10129112 3300025960 Bacteria 1931
982 Ga0207651_10134395 3300025960 Bacteria 1899
983 Ga0207651_10225050 3300025960 Bacteria 1519
984 Ga0207651_10283997 3300025960 Bacteria 1369
985 Ga0207651_10420584 3300025960 Bacteria 1141
986 Ga0207651_10455102 3300025960 Bacteria 1099
987 Ga0207651_10526274 3300025960 Bacteria 1025
988 Ga0207651_10548019 3300025960 Bacteria 1005
989 Ga0207651_10554088 3300025960 Bacteria 1000
990 Ga0207651_11805843 3300025960 Bacteria 550
991 Ga0207712_10021850 3300025961 Bacteria 4206
992 Ga0207712_10041989 3300025961 Bacteria 3147
993 Ga0207712_10042665 3300025961 Bacteria 3126
994 Ga0207712_10172237 3300025961 Bacteria 1693
995 Ga0207712_10490448 3300025961 Bacteria 1049
996 Ga0207712_10566055 3300025961 Bacteria 979
997 Ga0207668_10019392 3300025972 Bacteria 4299
998 Ga0207668_10021261 3300025972 Bacteria 4136
999 Ga0207668_10029456 3300025972 Bacteria 3598
1000 Ga0207668_10452157 3300025972 Bacteria 1096
1001 Ga0207640_10163970 3300025981 Bacteria 1648
1002 Ga0207640_10164302 3300025981 Bacteria 1647
1003 Ga0207640_10167292 3300025981 Bacteria 1634
1004 Ga0207640_10251579 3300025981 Bacteria 1372
1005 Ga0207640_10418859 3300025981 Bacteria 1095
1006 Ga0207640_10919650 3300025981 Bacteria 765
1007 Ga0207640_11150935 3300025981 Bacteria 688
1008 Ga0207640_11237613 3300025981 Bacteria 665
1009 Ga0207658_10042421 3300025986 Bacteria 3300
1010 Ga0207658_11529795 3300025986 Bacteria 610
1011 Ga0207677_10062701 3300026023 Bacteria 2580
1012 Ga0207677_10112518 3300026023 Bacteria 2030
1013 Ga0207677_10342839 3300026023 Bacteria 1249
1014 Ga0207677_10975411 3300026023 Bacteria 767
1015 Ga0207703_10024937 3300026035 Bacteria 4705
1016 Ga0207703_10036382 3300026035 Bacteria 3918
1017 Ga0207703_10258933 3300026035 Bacteria 1572
1018 Ga0207703_10282745 3300026035 Bacteria 1507
1019 Ga0207703_10549249 3300026035 Bacteria 1089
1020 Ga0207703_11666833 3300026035 Unclassified 613
1021 Ga0207639_11052134 3300026041 Bacteria 763
1022 Ga0207639_11360876 3300026041 Bacteria 666
1023 Ga0207639_11496665 3300026041 Bacteria 633
1024 Ga0207639_11925039 3300026041 Bacteria 552
1025 Ga0207678_10044307 3300026067 Bacteria 3849
1026 Ga0207678_10109435 3300026067 Bacteria 2357
1027 Ga0207678_10231548 3300026067 Bacteria 1582
1028 Ga0207678_10786617 3300026067 Bacteria 840
1029 Ga0207678_10929032 3300026067 Bacteria 769
1030 Ga0207678_11189739 3300026067 Bacteria 675
1031 Ga0207678_11378279 3300026067 Bacteria 624
1032 Ga0207708_10000967 3300026075 Bacteria 21533
1033 Ga0207708_10008662 3300026075 Bacteria 7531
1034 Ga0207708_10012845 3300026075 Bacteria 6247
1035 Ga0207708_10030957 3300026075 Bacteria 4061
1036 Ga0207708_10034054 3300026075 Bacteria 3873
1037 Ga0207708_10044381 3300026075 Bacteria 3387
1038 Ga0207708_10060530 3300026075 Bacteria 2890
1039 Ga0207708_10181216 3300026075 Bacteria 1672
1040 Ga0207708_10194552 3300026075 Bacteria 1616
1041 Ga0207708_10457474 3300026075 Bacteria 1064
1042 Ga0207708_10863489 3300026075 Bacteria 782
1043 Ga0207708_10980930 3300026075 Bacteria 734
1044 Ga0207708_11364354 3300026075 Bacteria 622
1045 Ga0207702_10185359 3300026078 Bacteria 1919
1046 Ga0207702_10273059 3300026078 Bacteria 1595
1047 Ga0207641_10094459 3300026088 Bacteria 2623
1048 Ga0207641_10205734 3300026088 Bacteria 1817
1049 Ga0207641_10535162 3300026088 Bacteria 1141
1050 Ga0207641_10797149 3300026088 Bacteria 934
1051 Ga0207641_11470162 3300026088 Bacteria 683
1052 Ga0207648_10000077 3300026089 Bacteria 93009
1053 Ga0207648_10002077 3300026089 Bacteria 21828
1054 Ga0207648_10003205 3300026089 Bacteria 17228
1055 Ga0207648_10089214 3300026089 Bacteria 2693
1056 Ga0207648_10094697 3300026089 Bacteria 2612
1057 Ga0207648_10149334 3300026089 Bacteria 2062
1058 Ga0207648_10262793 3300026089 Bacteria 1540
1059 Ga0207648_10277472 3300026089 Bacteria 1498
1060 Ga0207648_11040338 3300026089 Bacteria 767
1061 Ga0207676_10066274 3300026095 Bacteria 2879
1062 Ga0207676_10136694 3300026095 Bacteria 2092
1063 Ga0207676_10154705 3300026095 Bacteria 1979
1064 Ga0207676_10176922 3300026095 Bacteria 1865
1065 Ga0207676_10318381 3300026095 Bacteria 1427
1066 Ga0207676_10322601 3300026095 Bacteria 1418
1067 Ga0207676_10638724 3300026095 Bacteria 1026
1068 Ga0207676_10839484 3300026095 Bacteria 898
1069 Ga0207676_12026500 3300026095 Bacteria 574
1070 Ga0207674_10118202 3300026116 Bacteria 2621
1071 Ga0207674_10123415 3300026116 Bacteria 2556
1072 Ga0207674_10332818 3300026116 Bacteria 1468
1073 Ga0207674_10352580 3300026116 Bacteria 1422
1074 Ga0207674_10398721 3300026116 Bacteria 1330
1075 Ga0207674_10567205 3300026116 Unclassified 1097
1076 Ga0207675_100009620 3300026118 Bacteria 9045
1077 Ga0207675_100022197 3300026118 Bacteria 5909
1078 Ga0207675_100036685 3300026118 Bacteria 4572
1079 Ga0207675_100037149 3300026118 Bacteria 4543
1080 Ga0207675_100043225 3300026118 Bacteria 4208
1081 Ga0207675_100095349 3300026118 Bacteria 2799
1082 Ga0207675_100197290 3300026118 Bacteria 1932
1083 Ga0207675_100427063 3300026118 Bacteria 1310
1084 Ga0207675_100670427 3300026118 Bacteria 1044
1085 Ga0207675_101105366 3300026118 Bacteria 812
1086 Ga0207675_101271651 3300026118 Bacteria 756
1087 Ga0207683_10006547 3300026121 Bacteria 9975
1088 Ga0207683_10017764 3300026121 Bacteria 6066
1089 Ga0207683_10034722 3300026121 Bacteria 4384
1090 Ga0207683_10057306 3300026121 Bacteria 3420
1091 Ga0207683_10248418 3300026121 Bacteria 1623
1092 Ga0207683_10265974 3300026121 Bacteria 1566
1093 Ga0207683_10497481 3300026121 Bacteria 1126
1094 Ga0207683_10529881 3300026121 Bacteria 1089
1095 Ga0207683_10879226 3300026121 Bacteria 832
1096 Ga0207683_11195470 3300026121 Bacteria 705
1097 Ga0207683_11421503 3300026121 Bacteria 641
1098 Ga0207698_10336815 3300026142 Bacteria 1419
1099 Ga0207698_12601585 3300026142 Bacteria 515
1100 Ga0209967_1006233 3300027364 Bacteria 1615
1101 Ga0209984_1021509 3300027424 Bacteria 885
1102 Ga0209995_1045465 3300027471 Bacteria 743
1103 Ga0209970_1029486 3300027614 Bacteria 950
1104 Ga0209983_1061069 3300027665 Bacteria 833
1105 Ga0209971_1009093 3300027682 Bacteria 2357
1106 Ga0209971_1068666 3300027682 Bacteria 860
1107 Ga0209998_10116203 3300027717 Bacteria 671
1108 Ga0209813_10026775 3300027866 Bacteria 1669
1109 Ga0207428_10000002 3300027907 Bacteria 854851
1110 Ga0207428_10000106 3300027907 Bacteria 115682
1111 Ga0207428_10000186 3300027907 Bacteria 86221
1112 Ga0207428_10003255 3300027907 Bacteria 15830
1113 Ga0207428_10006966 3300027907 Bacteria 10362
1114 Ga0207428_10018274 3300027907 Bacteria 5992
1115 Ga0207428_10023208 3300027907 Bacteria 5220
1116 Ga0207428_10025959 3300027907 Bacteria 4895
1117 Ga0207428_10055767 3300027907 Bacteria 3140
1118 Ga0207428_10102466 3300027907 Bacteria 2210
1119 Ga0207428_10782344 3300027907 Bacteria 679
1120 Ga0268266_10218629 3300028379 Bacteria 1750
1121 Ga0268266_10302203 3300028379 Bacteria 1493
1122 Ga0268266_10846861 3300028379 Bacteria 884
1123 Ga0268266_11402681 3300028379 Bacteria 674
1124 Ga0268266_12015843 3300028379 Bacteria 550
1125 Ga0268265_10007329 3300028380 Bacteria 7447
1126 Ga0268265_10061708 3300028380 Bacteria 2877
1127 Ga0268265_10101841 3300028380 Bacteria 2321
1128 Ga0268265_10116245 3300028380 Bacteria 2194
1129 Ga0268265_10219653 3300028380 Bacteria 1662
1130 Ga0268265_10339545 3300028380 Bacteria 1367
1131 Ga0268265_10444716 3300028380 Bacteria 1209
1132 Ga0268265_10481784 3300028380 Bacteria 1165
1133 Ga0268265_10929808 3300028380 Bacteria 855
1134 Ga0268265_11088991 3300028380 Bacteria 793
1135 Ga0268265_11168237 3300028380 Bacteria 766
1136 Ga0268265_11202574 3300028380 Bacteria 755
1137 Ga0268265_11728888 3300028380 Bacteria 631
1138 Ga0268264_10031383 3300028381 Bacteria 4356
1139 Ga0268264_10114744 3300028381 Bacteria 2365
1140 Ga0268264_10298873 3300028381 Bacteria 1515
1141 Ga0268264_10424303 3300028381 Bacteria 1283
1142 Ga0268264_11276321 3300028381 Bacteria 744
1143 Ga0265316_10534630 3300031344 Bacteria 835
1144 Ga0307408_100008918 3300031548 Bacteria 6627
1145 Ga0307408_100019678 3300031548 Bacteria 4548
1146 Ga0307408_100482265 3300031548 Bacteria 1082
1147 Ga0307408_100594873 3300031548 Bacteria 982
1148 Ga0307408_101712421 3300031548 Bacteria 599
1149 Ga0307405_10004553 3300031731 Bacteria 6569
1150 Ga0307405_10023835 3300031731 Bacteria 3485
1151 Ga0307405_11730889 3300031731 Bacteria 554
1152 Ga0307413_10009818 3300031824 Bacteria 4604
1153 Ga0307413_10020674 3300031824 Bacteria 3507
1154 Ga0307413_10458115 3300031824 Bacteria 1014
1155 Ga0307413_10771913 3300031824 Bacteria 805
1156 Ga0307410_10011385 3300031852 Bacteria 5084
1157 Ga0307410_10066919 3300031852 Bacteria 2477
1158 Ga0307410_10109783 3300031852 Bacteria 1994
1159 Ga0307410_10166253 3300031852 Bacteria 1658
1160 Ga0307410_10181548 3300031852 Bacteria 1593
1161 Ga0307410_10240348 3300031852 Bacteria 1403
1162 Ga0307410_10352167 3300031852 Bacteria 1177
1163 Ga0307410_10625981 3300031852 Bacteria 900
1164 Ga0307410_10641211 3300031852 Bacteria 890
1165 Ga0307410_10681163 3300031852 Bacteria 865
1166 Ga0307406_10013139 3300031901 Bacteria 4736
1167 Ga0307406_10863004 3300031901 Bacteria 768
1168 Ga0307407_10000966 3300031903 Bacteria 9805
1169 Ga0307407_11130093 3300031903 Bacteria 610
1170 Ga0307412_10008019 3300031911 Bacteria 6022
1171 Ga0307412_10175853 3300031911 Bacteria 1605
1172 Ga0307412_10464286 3300031911 Bacteria 1046
1173 Ga0307412_10655259 3300031911 Bacteria 896
1174 Ga0307412_10717232 3300031911 Bacteria 860
1175 Ga0307412_11034947 3300031911 Bacteria 727
1176 Ga0307409_100023260 3300031995 Bacteria 4289
1177 Ga0307409_100143739 3300031995 Bacteria 2060
1178 Ga0307409_100256052 3300031995 Bacteria 1603
1179 Ga0307409_100553008 3300031995 Bacteria 1130
1180 Ga0307409_100672259 3300031995 Bacteria 1032
1181 Ga0307409_101085355 3300031995 Bacteria 821
1182 Ga0307409_101235906 3300031995 Bacteria 771
1183 Ga0307409_101588912 3300031995 Bacteria 682
1184 Ga0307409_102302097 3300031995 Bacteria 568
1185 Ga0307416_100021939 3300032002 Bacteria 4598
1186 Ga0307416_100144917 3300032002 Bacteria 2166
1187 Ga0307416_100228176 3300032002 Bacteria 1793
1188 Ga0307416_100266111 3300032002 Bacteria 1679
1189 Ga0307416_100310080 3300032002 Bacteria 1574
1190 Ga0307416_100720972 3300032002 Bacteria 1088
1191 Ga0307414_10013912 3300032004 Bacteria 4804
1192 Ga0307414_10064525 3300032004 Bacteria 2608
1193 Ga0307414_10335531 3300032004 Bacteria 1292
1194 Ga0307414_10519133 3300032004 Bacteria 1057
1195 Ga0307414_10682195 3300032004 Bacteria 929
1196 Ga0307414_10772809 3300032004 Bacteria 874
1197 Ga0307414_11211716 3300032004 Bacteria 699
1198 Ga0307414_12168704 3300032004 Bacteria 519
1199 Ga0307411_10071316 3300032005 Bacteria 2354
1200 Ga0307411_10137617 3300032005 Bacteria 1796
1201 Ga0307411_10251169 3300032005 Bacteria 1391
1202 Ga0307411_10757873 3300032005 Bacteria 851
1203 Ga0307411_11180018 3300032005 Bacteria 693
1204 Ga0307411_11810351 3300032005 Bacteria 567
1205 Ga0307415_100004186 3300032126 Bacteria 7451
1206 Ga0307415_100719442 3300032126 Bacteria 903
1207 Ga0307415_100995470 3300032126 Bacteria 779
1208 Ga0307415_102187643 3300032126 Unclassified 541
1209 Ga0316593_10153375 3300032168 Bacteria 839
1210 Ga0316588_1067427 3300033528 Bacteria 877
1211 Ga0316588_1096612 3300033528 Bacteria 738
1212 Ga0316596_1053483 3300033541 Bacteria 1071
1213 Ga0316596_1054650 3300033541 Bacteria 1060
1214 Ga0373948_0001060 3300034817 Bacteria 3715
1215 Ga0373928_0073371 3300035084 Bacteria 851
1216 Ga0373949_0017113 3300035090 Bacteria 1631
1217 Ga0373951_0045363 3300035091 Bacteria 1069
1218 Ga0373923_0012900 3300035111 Bacteria 3103
1219 Ga0373923_0253719 3300035111 Bacteria 824
1220 Ga0373932_0019250 3300035112 Bacteria 1777
1221 Ga0373932_0050304 3300035112 Bacteria 1234
1222 Ga0373936_0275752 3300035113 Bacteria 755
1223 Ga0373939_0063081 3300035114 Bacteria 1186
1224 Ga0373945_0042155 3300035116 Bacteria 1653
1225 Ga0373954_0437169 3300035118 Bacteria 647
1226 Ga0373956_0085816 3300035119 Bacteria 1448
1227 Ga0373960_0236391 3300035121 Bacteria 659
1228 Ga0373943_0089578 3300035170 Bacteria 1591
1229 Ga0373946_0006741 3300035171 Bacteria 4172
1230 Ga0373961_0014437 3300035241 Bacteria 2006
1231 Ga0373962_0032279 3300035242 Bacteria 1440
1232 Ga0373962_0078208 3300035242 Bacteria 1000
1233 Ga0373962_0366357 3300035242 Unclassified 524
1234 Ga0316574_0007019 3300035398 Bacteria 6137
1235 Ga0316574_0714287 3300035398 Bacteria 614
1236 Ga0373931_0095999 3300035691 Bacteria 1660
1237 Ga0373931_0133592 3300035691 Bacteria 1431
1238 Ga0373935_1374485 3300035692 Bacteria 528
1239 Ga0373933_0080197 3300035724 Bacteria 2000
1240 Ga0373933_0515753 3300035724 Bacteria 783
1241 Ga0373937_0137669 3300036401 Bacteria 2283
1242 Ga0373925_0000311 3300037068 Bacteria 50919
1243 Ga0373925_0242716 3300037068 Bacteria 1443
1244 Ga0373925_0497161 3300037068 Bacteria 1001
1245 Ga0373925_0603800 3300037068 Bacteria 904
1246 Ga0395900_1078683 3300037418 Bacteria 721
1247 Ga0395905_0145471 3300037471 Bacteria 2230
1248 Ga0242420_039736 3300038996 Bacteria 896
1249 Ga0439439_0021237 3300041406 Bacteria 1617
1250 Ga0439439_0056618 3300041406 Bacteria 1036
1251 Ga0439439_0093848 3300041406 Bacteria 822
1252 Ga0439453_0004947 3300041408 Bacteria 2008
1253 Ga0439453_0035013 3300041408 Bacteria 966
1254 Ga0439453_0059523 3300041408 Bacteria 788
1255 Ga0451802_0851433 3300041460 Bacteria 768
1256 Ga0451855_0889241 3300041511 Bacteria 889
1257 Ga0451853_2675013 3300041512 Bacteria 1016
1258 Ga0451853_2950042 3300041512 Bacteria 765
1259 Ga0451853_3274084 3300041512 Bacteria 1633
1260 Ga0439433_0078076 3300041999 Bacteria 803
1261 Ga0439433_0196205 3300041999 Bacteria 532
1262 Ga0439443_004394 3300042003 Bacteria 1833
1263 Ga0439448_0232652 3300042005 Bacteria 649
1264 Ga0439448_0283780 3300042005 Bacteria 587
1265 Ga0439450_003067 3300042008 Bacteria 2718
1266 Ga0439450_195886 3300042008 Bacteria 539
1267 Ga0450913_017786 3300042117 Bacteria 631
1268 Ga0450919_026133 3300042121 Bacteria 664
1269 Ga0450920_083156 3300042122 Unclassified 657
1270 Ga0450890_089665 3300042127 Bacteria 509
1271 Ga0450896_041911 3300042133 Bacteria 714
1272 Ga0450910_086617 3300042147 Bacteria 552
1273 Ga0439446_0054925 3300042156 Bacteria 1195
1274 Ga0439446_0061363 3300042156 Bacteria 1137
1275 Ga0439446_0136544 3300042156 Bacteria 799
1276 Ga0439434_0134363 3300042435 Bacteria 813
1277 Ga0439434_0136833 3300042435 Bacteria 806
1278 Ga0439434_0209993 3300042435 Bacteria 658
1279 Ga0439435_0027305 3300042436 Bacteria 1526
1280 Ga0439435_0027412 3300042436 Bacteria 1524
1281 Ga0439435_0047665 3300042436 Bacteria 1218
1282 Ga0439444_0032673 3300042437 Bacteria 985
1283 Ga0439444_0047928 3300042437 Bacteria 860
1284 Ga0439459_0091528 3300042438 Bacteria 732
1285 Ga0439464_0019815 3300042439 Bacteria 1838
1286 Ga0439464_0082263 3300042439 Bacteria 963
1287 Ga0439464_0126192 3300042439 Bacteria 791
1288 Ga0450916_002307 3300042530 Bacteria 2014
1289 Ga0450918_074231 3300042531 Bacteria 642
1290 Ga0451577_0013678 3300042876 Bacteria 7585
1291 Ga0451577_0325959 3300042876 Bacteria 1393
1292 Ga0451577_0969094 3300042876 Bacteria 764
1293 Ga0439440_0215815 3300042993 Bacteria 574
1294 Ga0453683_0107591 3300044673 Bacteria 1753
1295 Ga0453683_1182115 3300044673 Bacteria 512
1296 Ga0453684_0000503 3300044712 Bacteria 152937
1297 Ga0453684_0113267 3300044712 Bacteria 3291
1298 Ga0453684_0132153 3300044712 Bacteria 2994
1299 Ga0453684_0337097 3300044712 Bacteria 1704
1300 Ga0451576_0012703 3300045051 Bacteria 9454
1301 Ga0451576_0045741 3300045051 Bacteria 4608
1302 Ga0451576_0145001 3300045051 Bacteria 2476
1303 Ga0451576_0251899 3300045051 Bacteria 1845
1304 Ga0451576_0313527 3300045051 Bacteria 1641
1305 Ga0451576_0425129 3300045051 Bacteria 1394
1306 Ga0451576_0502199 3300045051 Bacteria 1274
1307 Ga0451576_1056404 3300045051 Bacteria 850
1308 Ga0451576_1133463 3300045051 Bacteria 818
1309 Ga0451576_1654162 3300045051 Bacteria 663
1310 Ga0495603_0042437 3300046455 Bacteria 2719
1311 Ga0495603_0073077 3300046455 Bacteria 2015
1312 Ga0495590_0149698 3300046457 Bacteria 846
1313 Ga0495629_0000007 3300046459 Bacteria 358693
1314 Ga0495629_0754036 3300046459 Bacteria 644
1315 Ga0495629_0814378 3300046459 Bacteria 615
1316 Ga0495641_0463798 3300046461 Bacteria 577
1317 Ga0495651_0073290 3300046462 Bacteria 2600
1318 Ga0495653_0071834 3300046463 Bacteria 2586
1319 Ga0495653_0323443 3300046463 Bacteria 999
1320 Ga0495582_0100746 3300046473 Bacteria 1617
1321 Ga0495582_0165832 3300046473 Bacteria 1257
1322 Ga0495582_0277453 3300046473 Bacteria 962
1323 Ga0495582_0481622 3300046473 Bacteria 717
1324 Ga0495605_0390536 3300046474 Bacteria 580
1325 Ga0495639_0000012 3300046475 Bacteria 83750
1326 Ga0495639_0396859 3300046475 Bacteria 696
1327 Ga0495639_0447078 3300046475 Bacteria 656
1328 Ga0495662_0074163 3300046476 Bacteria 1651
1329 Ga0495664_0095864 3300046477 Bacteria 1786
1330 Ga0495584_0014678 3300046491 Bacteria 3991
1331 Ga0495585_0128758 3300046492 Bacteria 1334
1332 Ga0495594_0015783 3300046499 Bacteria 3972
1333 Ga0495594_0045017 3300046499 Bacteria 2422
1334 Ga0495594_0073004 3300046499 Bacteria 1909
1335 Ga0495608_0378188 3300046511 Bacteria 868
1336 Ga0495618_0181503 3300046514 Bacteria 1337
1337 Ga0495628_0029181 3300046516 Bacteria 4475
1338 Ga0495630_0036176 3300046517 Bacteria 3691
1339 Ga0495630_0373853 3300046517 Bacteria 1091
1340 Ga0495637_0113572 3300046520 Bacteria 1048
1341 Ga0495643_0303540 3300046522 Bacteria 727
1342 Ga0495644_0113518 3300046523 Bacteria 1029
1343 Ga0495644_0127774 3300046523 Bacteria 968
1344 Ga0495663_0072209 3300046525 Bacteria 1100
1345 Ga0495663_0114505 3300046525 Bacteria 898
1346 Ga0495666_0000130 3300046526 Bacteria 31549
1347 Ga0495642_0064110 3300046528 Bacteria 1528
1348 Ga0495642_0271724 3300046528 Bacteria 742
1349 Ga0495652_0467598 3300046529 Bacteria 880
1350 Ga0495654_0235229 3300046530 Bacteria 769
1351 Ga0495665_0026207 3300046531 Bacteria 3132
1352 Ga0495665_0377814 3300046531 Bacteria 720
1353 Ga0495640_0212601 3300046533 Bacteria 1222
1354 Ga0495640_0280884 3300046533 Bacteria 1037
1355 Ga0495586_0000452 3300046535 Bacteria 24682
1356 Ga0495586_0084433 3300046535 Bacteria 1748
1357 Ga0495586_0352153 3300046535 Bacteria 846
1358 Ga0495587_0011763 3300046536 Bacteria 5534
1359 Ga0495598_0089131 3300046537 Bacteria 1003
1360 Ga0495598_0266602 3300046537 Bacteria 639
1361 Ga0495598_0311821 3300046537 Bacteria 597
1362 Ga0495609_0032513 3300046538 Bacteria 2369
1363 Ga0495621_0001834 3300046539 Bacteria 5592
1364 Ga0495621_0033128 3300046539 Bacteria 1780
1365 Ga0495621_0039662 3300046539 Bacteria 1648
1366 Ga0495621_0094254 3300046539 Bacteria 1132
1367 Ga0495621_0128222 3300046539 Bacteria 985
1368 Ga0495621_0543780 3300046539 Bacteria 504
1369 Ga0495645_0088172 3300046543 Bacteria 2219
1370 Ga0495622_0004965 3300046557 Bacteria 6162
1371 Ga0495667_0609930 3300046559 Bacteria 679
1372 Ga0495656_0012496 3300046615 Bacteria 3135
1373 Ga0495656_0194272 3300046615 Bacteria 1004
1374 Ga0495656_0366461 3300046615 Bacteria 749
1375 Ga0495656_0368434 3300046615 Bacteria 747
1376 Ga0495625_0889900 3300046660 Bacteria 511
1377 Ga0495635_0000679 3300046663 Bacteria 21909
1378 Ga0495635_0256896 3300046663 Bacteria 1177
1379 Ga0495659_0006070 3300046664 Bacteria 3819
1380 Ga0495659_0013976 3300046664 Bacteria 2620
1381 Ga0495659_0031626 3300046664 Bacteria 1848
1382 Ga0495659_0045751 3300046664 Bacteria 1578
1383 Ga0495659_0066297 3300046664 Bacteria 1344
1384 Ga0495659_0085565 3300046664 Bacteria 1203
1385 Ga0495659_0093347 3300046664 Bacteria 1158
1386 Ga0495659_0185267 3300046664 Bacteria 849
1387 Ga0495661_0531246 3300046665 Bacteria 558
1388 Ga0495588_0061845 3300046674 Bacteria 1940
1389 Ga0495657_0036170 3300046675 Bacteria 3415
1390 Ga0495599_0176158 3300046678 Bacteria 1319
1391 Ga0495623_0400902 3300046679 Bacteria 738
1392 Ga0495647_0051594 3300046681 Bacteria 1599
1393 Ga0495647_0222184 3300046681 Bacteria 834
1394 Ga0495658_0014928 3300046683 Bacteria 3979
1395 Ga0495658_0095424 3300046683 Bacteria 1768
1396 Ga0495658_0352374 3300046683 Bacteria 936
1397 Ga0495658_0538806 3300046683 Bacteria 747
1398 Ga0495658_0907001 3300046683 Bacteria 563
1399 Ga0495658_1006891 3300046683 Bacteria 532
1400 Ga0495669_0005426 3300046684 Bacteria 5321
1401 Ga0495669_0021180 3300046684 Bacteria 2819
1402 Ga0495669_0024880 3300046684 Bacteria 2609
1403 Ga0495613_0012840 3300046689 Bacteria 6227
1404 Ga0495613_1022714 3300046689 Bacteria 530
1405 Ga0495624_0125400 3300046690 Bacteria 1576
1406 Ga0495670_0080926 3300046691 Bacteria 1655
1407 Ga0495670_0516666 3300046691 Bacteria 649
1408 Ga0495600_0101091 3300046809 Bacteria 1879
1409 Ga0495581_0029132 3300047315 Bacteria 3201
1410 Ga0495581_0260122 3300047315 Bacteria 1015
1411 Ga0495604_0045142 3300047317 Bacteria 3440
1412 Ga0495636_0008993 3300047318 Bacteria 3930
1413 Ga0495636_0098358 3300047318 Bacteria 1277
1414 Ga0495636_0145141 3300047318 Bacteria 1062
1415 Ga0495636_0389641 3300047318 Bacteria 662
1416 Ga0495674_0166038 3300047319 Bacteria 1844
1417 Ga0495672_0002243 3300047320 Bacteria 17978
1418 Ga0495672_0255157 3300047320 Bacteria 849
1419 Ga0495676_0088829 3300047321 Bacteria 2316
1420 Ga0495676_0334433 3300047321 Bacteria 1015
1421 Ga0495680_0049064 3300047322 Bacteria 3310
1422 Ga0495675_0346546 3300047444 Bacteria 874
1423 Ga0495685_074964 3300047447 Bacteria 1130
1424 Ga0495684_0000698 3300047471 Bacteria 26972
1425 Ga0495684_0003319 3300047471 Bacteria 12629
1426 Ga0496102_0490156 3300048905 Bacteria 1151
1427 Ga0496106_0469282 3300048909 Bacteria 1011
1428 Ga0496108_0330485 3300048911 Bacteria 1329
1429 Ga0496108_0539261 3300048911 Bacteria 1018
1430 Ga0496110_0782904 3300048913 Bacteria 858
1431 Ga0496111_0493404 3300048914 Bacteria 902
1432 Ga0496113_0048566 3300048916 Bacteria 3158
1433 Ga0496114_0472935 3300048917 Bacteria 1109
1434 Ga0496114_0675390 3300048917 Unclassified 907
1435 Ga0496117_0195705 3300048920 Bacteria 1147
1436 Ga0496125_0102918 3300048928 Bacteria 2097
1437 Ga0501306_084633 3300049127 Bacteria 551
1438 Ga0501306_092216 3300049127 Bacteria 534
1439 Ga0501306_105065 3300049127 Bacteria 508
1440 Ga0501305_008421 3300049161 Bacteria 1334
1441 Ga0501305_114997 3300049161 Bacteria 512
1442 Ga0501291_017618 3300049514 Bacteria 1102
1443 Ga0501299_013839 3300049522 Bacteria 1396
1444 Ga0501299_134125 3300049522 Bacteria 610
1445 Ga0501313_053531 3300049529 Bacteria 562
1446 Ga0501316_050721 3300049532 Bacteria 597
1447 Ga0501320_027563 3300049536 Bacteria 691
1448 Ga0501031_0892738 3300049568 Bacteria 569
1449 Ga0501033_0092201 3300049570 Bacteria 2216
1450 Ga0501036_0270137 3300049572 Bacteria 1424
1451 Ga0501037_0337708 3300049573 Bacteria 1041
1452 Ga0501038_0232636 3300049574 Bacteria 1466
1453 Ga0501038_1394604 3300049574 Bacteria 504
1454 Ga0501039_0028362 3300049575 Bacteria 4310
1455 Ga0501039_0138245 3300049575 Bacteria 1913
1456 Ga0501039_0346295 3300049575 Bacteria 1168
1457 Ga0501039_0759527 3300049575 Bacteria 757
1458 Ga0501039_1326358 3300049575 Bacteria 555
1459 Ga0501040_0083706 3300049576 Bacteria 2213
1460 Ga0501040_0190846 3300049576 Bacteria 1454
1461 Ga0501040_0226496 3300049576 Bacteria 1331
1462 Ga0501040_0388631 3300049576 Bacteria 1001
1463 Ga0501040_1198277 3300049576 Bacteria 551
1464 Ga0501040_1381737 3300049576 Bacteria 511
1465 Ga0501041_0020068 3300049577 Bacteria 3991
1466 Ga0501041_0076869 3300049577 Bacteria 2054
1467 Ga0501041_0117118 3300049577 Bacteria 1655
1468 Ga0501041_0169482 3300049577 Bacteria 1366
1469 Ga0501041_0597332 3300049577 Bacteria 704
1470 Ga0501041_0822886 3300049577 Bacteria 596
1471 Ga0501041_0848145 3300049577 Bacteria 586
1472 Ga0501042_0004037 3300049578 Bacteria 9302
1473 Ga0501042_0174881 3300049578 Bacteria 1549
1474 Ga0501042_0487478 3300049578 Bacteria 895
1475 Ga0501042_1072138 3300049578 Bacteria 587
1476 Ga0501043_0610080 3300049579 Bacteria 805
1477 Ga0501046_0115527 3300049580 Bacteria 2047
1478 Ga0501046_0737742 3300049580 Unclassified 692
1479 Ga0501048_0005773 3300049582 Bacteria 9407
1480 Ga0501048_0089215 3300049582 Bacteria 2175
1481 Ga0501048_0494707 3300049582 Bacteria 877
1482 Ga0501068_0353970 3300049584 Bacteria 944
1483 Ga0501068_0555714 3300049584 Bacteria 747
1484 Ga0501068_0801529 3300049584 Bacteria 618
1485 Ga0501070_0915956 3300049586 Bacteria 683
1486 Ga0501071_0269461 3300049587 Bacteria 1287
1487 Ga0501071_0668035 3300049587 Bacteria 800
1488 Ga0501072_0032796 3300049588 Bacteria 4068
1489 Ga0501072_0153510 3300049588 Bacteria 1836
1490 Ga0501072_0264539 3300049588 Bacteria 1369
1491 Ga0501072_0303265 3300049588 Bacteria 1270
1492 Ga0501072_0945031 3300049588 Bacteria 673
1493 Ga0501072_0964684 3300049588 Bacteria 665
1494 Ga0501073_0276250 3300049589 Bacteria 1159
1495 Ga0501074_0209031 3300049590 Bacteria 1391
1496 Ga0501074_0210036 3300049590 Bacteria 1387
1497 Ga0501074_0310784 3300049590 Bacteria 1120
1498 Ga0501075_0062611 3300049591 Bacteria 2804
1499 Ga0501075_0103757 3300049591 Bacteria 2161
1500 Ga0501075_0387991 3300049591 Bacteria 1064
1501 Ga0501076_0103804 3300049592 Bacteria 2293
1502 Ga0501076_0155208 3300049592 Bacteria 1863
1503 Ga0501076_0331219 3300049592 Bacteria 1249
1504 Ga0501076_0589397 3300049592 Bacteria 917
1505 Ga0501076_0714547 3300049592 Bacteria 827
1506 Ga0501076_0855521 3300049592 Bacteria 750
1507 Ga0501077_0187494 3300049593 Bacteria 1314
1508 Ga0501206_025981 3300049653 Bacteria 854
1509 Ga0501233_249902 3300049668 Bacteria 533
1510 Ga0501249_018081 3300049679 Bacteria 1522
1511 Ga0501249_020496 3300049679 Bacteria 1438
1512 Ga0501225_0085357 3300049705 Bacteria 910
1513 Ga0501234_076969 3300049707 Bacteria 584
1514 Ga0501079_0005100 3300049741 Bacteria 9757
1515 Ga0501079_0667030 3300049741 Bacteria 819
1516 Ga0501079_1209837 3300049741 Bacteria 595
1517 Ga0501080_0320367 3300049742 Bacteria 1404
1518 Ga0501080_0364717 3300049742 Bacteria 1303
1519 Ga0501080_0861821 3300049742 Bacteria 791
1520 Ga0501080_0945016 3300049742 Bacteria 750
1521 Ga0501080_1131244 3300049742 Bacteria 675
1522 Ga0501081_0006494 3300049743 Bacteria 7595
1523 Ga0501081_0446260 3300049743 Bacteria 961
1524 Ga0501081_0448335 3300049743 Bacteria 958
1525 Ga0501081_0514622 3300049743 Bacteria 892
1526 Ga0501081_0701762 3300049743 Bacteria 760
1527 Ga0501081_0778372 3300049743 Bacteria 720
1528 Ga0501081_1137096 3300049743 Bacteria 591
1529 Ga0501083_0331635 3300049744 Bacteria 989
1530 Ga0501083_0752517 3300049744 Bacteria 634
1531 Ga0501241_034479 3300049758 Bacteria 965
1532 Ga0501035_0246049 3300049822 Bacteria 1520
1533 Ga0501035_0341931 3300049822 Bacteria 1254
1534 Ga0501044_0776367 3300049823 Bacteria 839
1535 Ga0501045_0020867 3300049824 Bacteria 4683
1536 Ga0501045_0125774 3300049824 Bacteria 1905
1537 Ga0501045_0138908 3300049824 Bacteria 1807
1538 Ga0501045_1405099 3300049824 Bacteria 507
1539 Ga0501212_031095 3300049851 Bacteria 861
1540 nmdc:mga03n38_605094_c1 3300050490 Bacteria 625
1541 nmdc:mga03n38_90392_c1 3300050490 Bacteria 1456
1542 nmdc:mga00v17_78219_c1 3300050491 Bacteria 2061
1543 nmdc:mga0yw44_151342_c1 3300050492 Bacteria 880
1544 nmdc:mga0k408_104182_c1 3300050493 Bacteria 1674
1545 nmdc:mga0k408_186_c1 3300050493 Bacteria 32647
1546 nmdc:mga0k408_36556_c1 3300050493 Bacteria 2819
1547 nmdc:mga0k408_97156_c1 3300050493 Bacteria 1734
1548 nmdc:mga06z11_166314_c1 3300050494 Bacteria 1264
1549 nmdc:mga06z11_185961_c1 3300050494 Unclassified 1200
1550 nmdc:mga06z11_2360_c1 3300050494 Bacteria 7187
1551 nmdc:mga06z11_382614_c1 3300050494 Bacteria 845
1552 nmdc:mga04h51_27271_c1 3300050495 Bacteria 1773
1553 nmdc:mga04h51_4376_c1 3300050495 Bacteria 3508
1554 nmdc:mga07m45_108910_c2 3300050496 Unclassified 1265
1555 nmdc:mga07m45_11312_c1 3300050496 Bacteria 4685
1556 nmdc:mga05p37_111981_c1 3300050507 Bacteria 3356
1557 nmdc:mga05p37_12059_c1 3300050507 Bacteria 10315
1558 nmdc:mga05p37_1286506_c1 3300050507 Bacteria 747
1559 nmdc:mga05p37_13371_c1 3300050507 Bacteria 9835
1560 nmdc:mga05p37_13677_c1 3300050507 Bacteria 9725
1561 nmdc:mga05p37_13826_c1 3300050507 Bacteria 9670
1562 nmdc:mga05p37_14186_c1 3300050507 Bacteria 9565
1563 nmdc:mga05p37_159631_c1 3300050507 Bacteria 2754
1564 nmdc:mga05p37_187783_c1 3300050507 Bacteria 2512
1565 nmdc:mga05p37_292570_c1 3300050507 Bacteria 1938
1566 nmdc:mga05p37_31700_c1 3300050507 Bacteria 6459
1567 nmdc:mga05p37_321074_c1 3300050507 Bacteria 1833
1568 nmdc:mga05p37_449891_c1 3300050507 Bacteria 1491
1569 nmdc:mga05p37_458220_c1 3300050507 Bacteria 1474
1570 nmdc:mga05p37_469636_c1 3300050507 Bacteria 1452
1571 nmdc:mga05p37_553621_c1 3300050507 Bacteria 1309
1572 nmdc:mga05p37_58091_c1 3300050507 Bacteria 4764
1573 nmdc:mga05p37_72501_c1 3300050507 Bacteria 4238
1574 nmdc:mga05p37_78598_c1 3300050507 Bacteria 4063
1575 nmdc:mga05p37_85593_c1 3300050507 Bacteria 3885
1576 nmdc:mga05p37_907848_c1 3300050507 Bacteria 949
1577 nmdc:mga09592_120012_c1 3300050508 Bacteria 2258
1578 nmdc:mga09592_14369_c1 3300050508 Bacteria 6463
1579 nmdc:mga09592_1473045_c1 3300050508 Bacteria 555
1580 nmdc:mga09592_1746_c1 3300050508 Bacteria 17461
1581 nmdc:mga09592_180420_c1 3300050508 Bacteria 1826
1582 nmdc:mga09592_186937_c1 3300050508 Bacteria 1793
1583 nmdc:mga09592_245186_c1 3300050508 Bacteria 1553
1584 nmdc:mga09592_311174_c1 3300050508 Bacteria 1365
1585 nmdc:mga09592_31280_c1 3300050508 Bacteria 4434
1586 nmdc:mga09592_401135_c1 3300050508 Bacteria 1185
1587 nmdc:mga09592_40518_c1 3300050508 Bacteria 3913
1588 nmdc:mga09592_519798_c1 3300050508 Bacteria 1024
1589 nmdc:mga09592_64885_c1 3300050508 Bacteria 3092
1590 nmdc:mga09592_90545_c1 3300050508 Bacteria 2614
1591 nmdc:mga09592_94812_c1 3300050508 Bacteria 2552
1592 nmdc:mga09592_9883_c1 3300050508 Bacteria 7759
1593 nmdc:mga0qj67_133506_c1 3300050509 Bacteria 2011
1594 nmdc:mga0qj67_1380665_c1 3300050509 Bacteria 544
1595 nmdc:mga0qj67_1398_c1 3300050509 Bacteria 16934
1596 nmdc:mga0qj67_174387_c1 3300050509 Bacteria 1746
1597 nmdc:mga0qj67_272286_c1 3300050509 Bacteria 1373
1598 nmdc:mga0qj67_451036_c1 3300050509 Bacteria 1036
1599 nmdc:mga0qj67_474044_c1 3300050509 Bacteria 1007
1600 nmdc:mga0qj67_476354_c1 3300050509 Bacteria 1005
1601 nmdc:mga0qj67_536_c1 3300050509 Bacteria 25813
1602 nmdc:mga0qj67_54751_c1 3300050509 Bacteria 3159
1603 nmdc:mga0qj67_626400_c1 3300050509 Bacteria 859
1604 nmdc:mga0qj67_8727_c1 3300050509 Bacteria 7529
1605 nmdc:mga0qj67_98600_c1 3300050509 Bacteria 2354
1606 nmdc:mga06r32_1394_c1 3300050510 Bacteria 21834
1607 nmdc:mga06r32_196081_c1 3300050510 Bacteria 2007
1608 nmdc:mga06r32_2058103_c1 3300050510 Unclassified 504
1609 nmdc:mga06r32_232824_c1 3300050510 Bacteria 1830
1610 nmdc:mga06r32_31886_c1 3300050510 Bacteria 4953
1611 nmdc:mga06r32_4278_c1 3300050510 Bacteria 12786
1612 nmdc:mga06r32_75664_c1 3300050510 Bacteria 3268
1613 nmdc:mga06r32_93539_c1 3300050510 Bacteria 2940
1614 nmdc:mga08y16_11077_c1 3300050511 Bacteria 9468
1615 nmdc:mga08y16_1122399_c1 3300050511 Bacteria 760
1616 nmdc:mga08y16_11913_c1 3300050511 Bacteria 9135
1617 nmdc:mga08y16_122911_c1 3300050511 Bacteria 2701
1618 nmdc:mga08y16_154128_c1 3300050511 Bacteria 2388
1619 nmdc:mga08y16_2262_c1 3300050511 Bacteria 19741
1620 nmdc:mga08y16_2394_c1 3300050511 Bacteria 19262
1621 nmdc:mga08y16_373436_c1 3300050511 Bacteria 1463
1622 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
1623 nmdc:mga08y16_44618_c1 3300050511 Bacteria 4645
1624 nmdc:mga08y16_7076_c1 3300050511 Bacteria 11776
1625 nmdc:mga08y16_842_c1 3300050511 Bacteria 29430
1626 nmdc:mga08y16_9481_c1 3300050511 Bacteria 10218
1627 nmdc:mga08y16_9590_c1 3300050511 Bacteria 10164
1628 nmdc:mga0n895_1150126_c1 3300050512 Unclassified 752
1629 nmdc:mga0n895_11531_c1 3300050512 Bacteria 7892
1630 nmdc:mga0n895_129884_c1 3300050512 Bacteria 2544
1631 nmdc:mga0n895_149205_c1 3300050512 Bacteria 2368
1632 nmdc:mga0n895_163133_c1 3300050512 Bacteria 2260
1633 nmdc:mga0n895_253422_c1 3300050512 Bacteria 1786
1634 nmdc:mga0n895_27601_c1 3300050512 Bacteria 5396
1635 nmdc:mga0n895_33625_c1 3300050512 Bacteria 4929
1636 nmdc:mga0n895_455780_c1 3300050512 Bacteria 1291
1637 nmdc:mga0n895_50818_c1 3300050512 Bacteria 4065
1638 nmdc:mga0n895_57722_c1 3300050512 Bacteria 3827
1639 nmdc:mga0n895_78657_c1 3300050512 Bacteria 3283
1640 nmdc:mga0n895_81259_c1 3300050512 Bacteria 3230
1641 nmdc:mga0n895_875665_c1 3300050512 Bacteria 885
1642 nmdc:mga0rr50_1012592_c1 3300050513 Bacteria 708
1643 nmdc:mga0rr50_14044_c1 3300050513 Bacteria 5237
1644 nmdc:mga0rr50_1502545_c1 3300050513 Bacteria 569
1645 nmdc:mga0rr50_214174_c1 3300050513 Bacteria 1588
1646 nmdc:mga0rr50_236618_c1 3300050513 Bacteria 1513
1647 nmdc:mga0rr50_330446_c1 3300050513 Bacteria 1280
1648 nmdc:mga0rr50_62289_c1 3300050513 Bacteria 2813
1649 nmdc:mga0rr50_77904_c1 3300050513 Bacteria 2549
1650 nmdc:mga08x19_23138_c1 3300050514 Bacteria 3854
1651 nmdc:mga08x19_482652_c1 3300050514 Bacteria 874
1652 nmdc:mga08x19_502417_c1 3300050514 Bacteria 856
1653 nmdc:mga08x19_770591_c1 3300050514 Bacteria 683
1654 nmdc:mga0a205_1169544_c1 3300050515 Bacteria 617
1655 nmdc:mga0a205_121148_c1 3300050515 Bacteria 2515
1656 nmdc:mga0a205_1277638_c1 3300050515 Bacteria 582
1657 nmdc:mga0a205_1447104_c1 3300050515 Bacteria 535
1658 nmdc:mga0a205_148308_c1 3300050515 Bacteria 2246
1659 nmdc:mga0a205_149775_c1 3300050515 Bacteria 2233
1660 nmdc:mga0a205_259_c1 3300050515 Bacteria 38100
1661 nmdc:mga0a205_27341_c1 3300050515 Bacteria 5448
1662 nmdc:mga0a205_284368_c1 3300050515 Bacteria 1529
1663 nmdc:mga0a205_3512_c1 3300050515 Bacteria 14003
1664 nmdc:mga0a205_530720_c1 3300050515 Bacteria 1033
1665 nmdc:mga0a205_71450_c1 3300050515 Bacteria 3352
1666 nmdc:mga0a205_828723_c1 3300050515 Bacteria 772
1667 nmdc:mga0a205_84893_c1 3300050515 Bacteria 3058
1668 Ga0495601_0017272 3300053077 Bacteria 4378
1669 Ga0495601_0044413 3300053077 Bacteria 2793
1670 Ga0495595_0132469 3300053084 Bacteria 1219
1671 Ga0495619_0028241 3300053085 Bacteria 3619
1672 Ga0495619_0053335 3300053085 Bacteria 2675
1673 Ga0495619_0093220 3300053085 Bacteria 2041
1674 Ga0500555_107513 3300053103 Bacteria 704
1675 Ga0500645_081433 3300053730 Bacteria 923
1676 Ga0501084_0156511 3300054114 Bacteria 1922
1677 Ga0501084_0442296 3300054114 Bacteria 1099
1678 Ga0590071_000041 3300059421 Bacteria 32697
1679 Ga0590071_000580 3300059421 Bacteria 10531
1680 Ga0590074_000103 3300059423 Bacteria 9537
1681 Ga0590074_008432 3300059423 Bacteria 1716
1682 Ga0590074_018564 3300059423 Bacteria 1190
1683 Ga0590075_000191 3300059424 Bacteria 17028
1684 Ga0590075_000837 3300059424 Bacteria 8088
1685 Ga0590075_175784 3300059424 Bacteria 566
1686 Ga0590077_000066 3300059426 Bacteria 26485
1687 Ga0590077_000903 3300059426 Bacteria 7581
1688 Ga0590077_035613 3300059426 Bacteria 1096
1689 Ga0590077_045941 3300059426 Bacteria 976
1690 Ga0587070_080562 3300059491 Bacteria 713
1691 Ga0587073_0162582 3300059492 Bacteria 641
1692 Ga0587073_0308417 3300059492 Bacteria 518
1693 Ga0587080_091636 3300059503 Bacteria 638
1694 Ga0587090_067671 3300059510 Bacteria 691
1695 Ga0587101_089551 3300059623 Bacteria 596
1696 Ga0587101_118129 3300059623 Bacteria 545
1697 Ga0587109_134399 3300059624 Bacteria 599
1698 Ga0587067_119610 3300059640 Bacteria 631
1699 Ga0587114_105393 3300059655 Bacteria 554
1700 Ga0501082_0040635 3300060353 Bacteria 4011
1701 Ga0501082_0073372 3300060353 Bacteria 2948
1702 Ga0501082_0236383 3300060353 Bacteria 1590
1703 Ga0501082_0657887 3300060353 Bacteria 917
1704 Ga0501082_1103586 3300060353 Bacteria 694
1705 Ga0530510_0040980 3300061734 Bacteria 3344
1706 Ga0530510_0136503 3300061734 Bacteria 1806
1707 Ga0530510_1089771 3300061734 Bacteria 612
1708 Ga0530510_1497373 3300061734 Bacteria 518
1709 Ga0070697_100147002
1710 SwRhRL2b_contig_1211040
1711 SwRhRL2b_contig_2962400
1712 ARcpr5yngRDRAFT_c003349
1713 ARcpr5yngRDRAFT_c022595
1714 ARSoilOldRDRAFT_c005267
1715 JGI24746J21847_1002952
1716 JGI24743J22301_10018312
1717 JGI24750J21931_1011992
1718 JGI24745J21846_1007836
1719 JGI24749J21850_1009285
1720 JGI24749J21850_1018564
1721 JGI24035J26624_1002635
1722 JGI24034J26672_10009727
1723 Ga0007429J51699_1076987
1724 Ga0058859_10072819
1725 Ga0058859_10076617
1726 Ga0058859_10112349
1727 Ga0058859_11758504
1728 Ga0058863_11888265
1729 Ga0058863_11933612
1730 Ga0058861_11944745
1731 Ga0058860_10075353
1732 Ga0058860_12072903
1733 Ga0058862_10000370
1734 Ga0058862_10073603
1735 Ga0058862_12246224
1736 Ga0058862_12876188
1737 Ga0065704_10031862
1738 Ga0065704_10094226
1739 Ga0065704_10095758
1740 Ga0065712_10010362
1741 Ga0065712_10070291
1742 Ga0065712_10109991
1743 Ga0065715_10008080
1744 Ga0065715_10267676
1745 Ga0065715_10308589
1746 Ga0065715_10495517
1747 Ga0065715_10910357
1748 Ga0065707_10002448
1749 Ga0065707_10005263
1750 Ga0065707_10090343
1751 Ga0065707_10214064
1752 Ga0065707_10368142
1753 Ga0070658_10068414
1754 Ga0070658_10301255
1755 Ga0070658_10330334
1756 Ga0070676_10005855
1757 Ga0070676_10007899
1758 Ga0070676_10127180
1759 Ga0070676_10696132
1760 Ga0070676_10697997
1761 Ga0070676_11264948
1762 Ga0070683_100147764
1763 Ga0070690_100067037
1764 Ga0070690_100137740
1765 Ga0070690_100178665
1766 Ga0070690_100216256
1767 Ga0070690_100341436
1768 Ga0070670_100015682
1769 Ga0070670_100023037
1770 Ga0070670_100132059
1771 Ga0070670_100203273
1772 Ga0070670_100334986
1773 Ga0070670_100919282
1774 Ga0070670_101486820
1775 Ga0070670_102069694
1776 Ga0070677_10003332
1777 Ga0070677_10089005
1778 Ga0070677_10091512
1779 Ga0070677_10191605
1780 Ga0070677_10207197
1781 Ga0070677_10208811
1782 Ga0070677_10263014
1783 Ga0070677_10823769
1784 Ga0068869_100006495
1785 Ga0068869_100025663
1786 Ga0068869_100035749
1787 Ga0068869_100704100
1788 Ga0068869_100712881
1789 Ga0068869_101146594
1790 Ga0070666_10003133
1791 Ga0070666_10407629
1792 Ga0070666_10735424
1793 Ga0070680_100155041
1794 Ga0070680_100316842
1795 Ga0070680_100500387
1796 Ga0070680_100754747
1797 Ga0070682_100388553
1798 Ga0070682_100788543
1799 Ga0070682_100928432
1800 Ga0068868_100001652
1801 Ga0068868_100014737
1802 Ga0068868_101357689
1803 Ga0068868_101362895
1804 Ga0068868_101448124
1805 Ga0068868_101624810
1806 Ga0070660_100024567
1807 Ga0070660_100371508
1808 Ga0070689_100016249
1809 Ga0070689_100100601
1810 Ga0070689_100201197
1811 Ga0070689_100203010
1812 Ga0070689_100422021
1813 Ga0070689_100634648
1814 Ga0070689_102026809
1815 Ga0070691_10001877
1816 Ga0070691_10289880
1817 Ga0070687_100036278
1818 Ga0070687_100047270
1819 Ga0070687_100163315
1820 Ga0070687_100171046
1821 Ga0070687_100184043
1822 Ga0070687_100770520
1823 Ga0070661_100035459
1824 Ga0070661_100165281
1825 Ga0070661_100177661
1826 Ga0070661_101116916
1827 Ga0070692_10014680
1828 Ga0070692_10163407
1829 Ga0070692_10282281
1830 Ga0070668_100012677
1831 Ga0070668_100148722
1832 Ga0070668_100187517
1833 Ga0070668_100256345
1834 Ga0070668_100389346
1835 Ga0070669_100002909
1836 Ga0070669_100016666
1837 Ga0070669_100047172
1838 Ga0070669_100081078
1839 Ga0070669_100100746
1840 Ga0070669_100102047
1841 Ga0070669_100104529
1842 Ga0070669_100139243
1843 Ga0070669_100148910
1844 Ga0070669_100217862
1845 Ga0070669_100262496
1846 Ga0070669_100365178
1847 Ga0070669_101132111
1848 Ga0070675_100010206
1849 Ga0070675_100045822
1850 Ga0070675_100077322
1851 Ga0070675_100091376
1852 Ga0070675_100094782
1853 Ga0070675_100121983
1854 Ga0070675_100128765
1855 Ga0070675_100151004
1856 Ga0070675_100338965
1857 Ga0070675_100380140
1858 Ga0070675_101710015
1859 Ga0070675_101956775
1860 Ga0070671_100006808
1861 Ga0070671_100068999
1862 Ga0070671_100596042
1863 Ga0070671_101193581
1864 Ga0070674_100003104
1865 Ga0070674_100111607
1866 Ga0070674_100133131
1867 Ga0070674_100319727
1868 Ga0070674_101351760
1869 Ga0070673_100004179
1870 Ga0070673_100020375
1871 Ga0070673_100083908
1872 Ga0070673_100228227
1873 Ga0070673_100232258
1874 Ga0070673_100294713
1875 Ga0070673_100316899
1876 Ga0070673_100341975
1877 Ga0070673_100346926
1878 Ga0070673_100778217
1879 Ga0070688_100012388
1880 Ga0070688_100017737
1881 Ga0070659_100251203
1882 Ga0070659_100289674
1883 Ga0070667_100022611
1884 Ga0070667_100188117
1885 Ga0070667_100455037
1886 Ga0070667_100877510
1887 Ga0070667_100891475
1888 Ga0070667_101599386
1889 Ga0070703_10053562
1890 Ga0070703_10352230
1891 Ga0070701_10003090
1892 Ga0070701_10004454
1893 Ga0070701_10006684
1894 Ga0070701_10009058
1895 Ga0070701_10021556
1896 Ga0070701_10462916
1897 Ga0070701_10484110
1898 Ga0070701_10783527
1899 Ga0070705_100000076
1900 Ga0070705_100006120
1901 Ga0070705_100009393
1902 Ga0070705_100013530
1903 Ga0070705_100021151
1904 Ga0070705_100026540
1905 Ga0070705_100063862
1906 Ga0070705_100161642
1907 Ga0070705_100191403
1908 Ga0070705_100643553
1909 Ga0070705_101114998
1910 Ga0070705_101609144
1911 Ga0070700_100003649
1912 Ga0070700_100040663
1913 Ga0070700_100046665
1914 Ga0070700_100050416
1915 Ga0070700_100050950
1916 Ga0070700_100081025
1917 Ga0070700_100136326
1918 Ga0070700_100214347
1919 Ga0070700_100539038
1920 Ga0070700_100949311
1921 Ga0070700_101067743
1922 Ga0070700_101216793
1923 Ga0070700_101230028
1924 Ga0070694_100005583
1925 Ga0070694_100030315
1926 Ga0070694_100054773
1927 Ga0070694_100067741
1928 Ga0070694_100078557
1929 Ga0070694_100078952
1930 Ga0070694_100226790
1931 Ga0070694_100632669
1932 Ga0070694_100731656
1933 Ga0070694_100912770
1934 Ga0070694_101462127
1935 Ga0070708_100010728
1936 Ga0070708_100224113
1937 Ga0070708_100398608
1938 Ga0070708_100475618
1939 Ga0070708_100794561
1940 Ga0070708_100975645
1941 Ga0070708_101371943
1942 Ga0070663_100028704
1943 Ga0070663_100149308
1944 Ga0070663_100194090
1945 Ga0070663_100876079
1946 Ga0070663_101231151
1947 Ga0070663_102105276
1948 Ga0070678_100037639
1949 Ga0070678_100074082
1950 Ga0070678_100090564
1951 Ga0070678_100331050
1952 Ga0070678_100365421
1953 Ga0070678_100434777
1954 Ga0070678_100446061
1955 Ga0070678_100641814
1956 Ga0070678_101247466
1957 Ga0070662_100012481
1958 Ga0070662_100122161
1959 Ga0070662_100135969
1960 Ga0070662_100137752
1961 Ga0070662_100212030
1962 Ga0070662_100316083
1963 Ga0070662_100471889
1964 Ga0070662_101371842
1965 Ga0070681_10005835
1966 Ga0070681_10674934
1967 Ga0070681_10695017
1968 Ga0070681_10798702
1969 Ga0070681_11048532
1970 Ga0068867_100000885
1971 Ga0068867_100010068
1972 Ga0068867_100036300
1973 Ga0068867_100040168
1974 Ga0068867_100049313
1975 Ga0068867_100140450
1976 Ga0068867_100482487
1977 Ga0068867_101099836
1978 Ga0070685_10015040
1979 Ga0070685_10045758
1980 Ga0070685_10155309
1981 Ga0070685_10185633
1982 Ga0070685_10325275
1983 Ga0070706_100031504
1984 Ga0070706_100098530
1985 Ga0070706_100106631
1986 Ga0070706_100151364
1987 Ga0070706_100166042
1988 Ga0070707_100048094
1989 Ga0070707_100069308
1990 Ga0070707_100098727
1991 Ga0070707_100123795
1992 Ga0070707_100333848
1993 Ga0070707_100405305
1994 Ga0070707_100424058
1995 Ga0070707_100701501
1996 Ga0070707_100854801
1997 Ga0070707_101846689
1998 Ga0070707_102078359
1999 Ga0070707_102149136
2000 Ga0070698_100001357
2001 Ga0070698_100002475
2002 Ga0070698_100006000
2003 Ga0070698_100022654
2004 Ga0070698_100143944
2005 Ga0070698_100316590
2006 Ga0070698_100351894
2007 Ga0070698_100649966
2008 Ga0070698_101055418
2009 Ga0070698_101413678
2010 Ga0070699_100000371
2011 Ga0070699_100008552
2012 Ga0070699_100079001
2013 Ga0070699_100314171
2014 Ga0070699_100695669
2015 Ga0070699_100924740
2016 Ga0070679_100100821
2017 Ga0070679_100187120
2018 Ga0070679_100401531
2019 Ga0070679_100700449
2020 Ga0070684_100043653
2021 Ga0070684_100522116
2022 Ga0070697_100100227
2023 Ga0070697_100310323
2024 Ga0070697_100332980
2025 Ga0070697_100399986
2026 Ga0070697_100520085
2027 Ga0070697_100551342
2028 Ga0070697_100612298
2029 Ga0068853_100505311
2030 Ga0070672_100003923
2031 Ga0070672_100016175
2032 Ga0070672_100066892
2033 Ga0070672_100085240
2034 Ga0070672_100107450
2035 Ga0070672_100127690
2036 Ga0070672_100187328
2037 Ga0070672_100233593
2038 Ga0070672_100240086
2039 Ga0070672_100254807
2040 Ga0070672_101404136
2041 Ga0070672_101833463
2042 Ga0070672_102007816
2043 Ga0070686_100000959
2044 Ga0070686_100023758
2045 Ga0070686_100149884
2046 Ga0070686_100193263
2047 Ga0070686_100214551
2048 Ga0070686_100272221
2049 Ga0070686_100398924
2050 Ga0070695_100000627
2051 Ga0070695_100007666
2052 Ga0070695_100014109
2053 Ga0070695_100017212
2054 Ga0070695_100030280
2055 Ga0070695_100149039
2056 Ga0070695_100153035
2057 Ga0070695_100374529
2058 Ga0070695_100423060
2059 Ga0070695_100451009
2060 Ga0070695_100493719
2061 Ga0070695_100517199
2062 Ga0070695_101222842
2063 Ga0070696_100003302
2064 Ga0070696_100017615
2065 Ga0070696_100034024
2066 Ga0070696_100197226
2067 Ga0070696_100471817
2068 Ga0070696_100646717
2069 Ga0070696_100999257
2070 Ga0070693_100594838
2071 Ga0070665_100056230
2072 Ga0070665_100348243
2073 Ga0070665_100946927
2074 Ga0070665_100983789
2075 Ga0070704_100002209
2076 Ga0070704_100005029
2077 Ga0070704_100012909
2078 Ga0070704_100020686
2079 Ga0070704_100040602
2080 Ga0070704_100056374
2081 Ga0070704_100056974
2082 Ga0070704_100058763
2083 Ga0070704_100116080
2084 Ga0070704_100134640
2085 Ga0070704_100156187
2086 Ga0070704_100257609
2087 Ga0070704_100604052
2088 Ga0070704_100866344
2089 Ga0070704_101537837
2090 Ga0068855_100024107
2091 Ga0070664_100005905
2092 Ga0070664_100084187
2093 Ga0070664_100111144
2094 Ga0070664_100194747
2095 Ga0070664_100272878
2096 Ga0070664_100299054
2097 Ga0070664_100387490
2098 Ga0070664_100721486
2099 Ga0070664_101544233
2100 Ga0070664_101754948
2101 Ga0070664_101770852
2102 Ga0068857_100103534
2103 Ga0068857_100601035
2104 Ga0068857_101750960
2105 Ga0068857_102054285
2106 Ga0068854_100108485
2107 Ga0068854_100427354
2108 Ga0068854_100605331
2109 Ga0068854_101226769
2110 Ga0068856_100546339
2111 Ga0070702_100024575
2112 Ga0070702_100089961
2113 Ga0070702_100182026
2114 Ga0070702_100273601
2115 Ga0070702_100280066
2116 Ga0070702_100377833
2117 Ga0070702_100649535
2118 Ga0068852_100684464
2119 Ga0068859_100011646
2120 Ga0068859_100018030
2121 Ga0068859_100018092
2122 Ga0068859_100070054
2123 Ga0068859_100136036
2124 Ga0068859_100298806
2125 Ga0068859_100523525
2126 Ga0068859_100946310
2127 Ga0068859_101312417
2128 Ga0068859_101691441
2129 Ga0068864_100050967
2130 Ga0068864_100090822
2131 Ga0068864_100170387
2132 Ga0068864_100178646
2133 Ga0068864_100300623
2134 Ga0068864_100338360
2135 Ga0068864_100702915
2136 Ga0068864_101064766
2137 Ga0068864_101859805
2138 Ga0068866_10195500
2139 Ga0068861_100005216
2140 Ga0068861_100025482
2141 Ga0068861_100037738
2142 Ga0068861_100063675
2143 Ga0068861_100082536
2144 Ga0068861_100104975
2145 Ga0068861_100294632
2146 Ga0068861_100326568
2147 Ga0068861_100395818
2148 Ga0068861_101073412
2149 Ga0068851_10131463
2150 Ga0068870_10008497
2151 Ga0068870_10011633
2152 Ga0068870_10020579
2153 Ga0068870_10131662
2154 Ga0068870_10165695
2155 Ga0068870_10246543
2156 Ga0068870_10539188
2157 Ga0068870_10705237
2158 Ga0068863_100006615
2159 Ga0068863_100118121
2160 Ga0068863_100202679
2161 Ga0068863_100432211
2162 Ga0068858_100025699
2163 Ga0068858_100033536
2164 Ga0068858_100063626
2165 Ga0068858_100496511
2166 Ga0068858_100753593
2167 Ga0068858_101080021
2168 Ga0068858_102524993
2169 Ga0068858_102544430
2170 Ga0068860_100021507
2171 Ga0068860_100073920
2172 Ga0068860_100148866
2173 Ga0068860_100304578
2174 Ga0068860_101377052
2175 Ga0068862_100016772
2176 Ga0068862_100054990
2177 Ga0068862_100186013
2178 Ga0068862_100543549
2179 Ga0068862_101265866
2180 Ga0068862_101541431
2181 Ga0068862_101873278
2182 Ga0068862_101879519
2183 Ga0068862_101930583
2184 Ga0068862_102309549
2185 Ga0081455_10513376
2186 Ga0081539_10001150
2187 Ga0081539_10097667
2188 Ga0081539_10215515
2189 Ga0075365_10162009
2190 Ga0075368_10023290
2191 Ga0075363_100051410
2192 Ga0075363_100234583
2193 Ga0075364_10029861
2194 Ga0075432_10221773
2195 Ga0075362_10065225
2196 Ga0075367_10035318
2197 Ga0075367_10508540
2198 Ga0075366_10002927
2199 Ga0075366_10126966
2200 Ga0075366_10172994
2201 Ga0075366_10500136
2202 Ga0075366_10724929
2203 Ga0097621_100030713
2204 Ga0097621_100070007
2205 Ga0097621_100086917
2206 Ga0097621_100112574
2207 Ga0097621_100725513
2208 Ga0075370_10068466
2209 Ga0075370_10301526
2210 Ga0068871_100052850
2211 Ga0068871_100081886
2212 Ga0068871_100105676
2213 Ga0068871_100259384
2214 Ga0075428_100000003
2215 Ga0075428_100000778
2216 Ga0075428_100003237
2217 Ga0075428_100025549
2218 Ga0075428_100033838
2219 Ga0075428_100035237
2220 Ga0075428_100111152
2221 Ga0075428_100174740
2222 Ga0075428_100190074
2223 Ga0075428_100197964
2224 Ga0075428_100323567
2225 Ga0075428_100338635
2226 Ga0075428_100341442
2227 Ga0075428_100344167
2228 Ga0075428_100443597
2229 Ga0075428_100520209
2230 Ga0075428_100547556
2231 Ga0075428_100792455
2232 Ga0075428_101780533
2233 Ga0075430_100000569
2234 Ga0075430_100002777
2235 Ga0075430_100003418
2236 Ga0075430_100012378
2237 Ga0075430_100018937
2238 Ga0075430_100022143
2239 Ga0075430_100161080
2240 Ga0075430_100209952
2241 Ga0075430_100210553
2242 Ga0075430_100295305
2243 Ga0075430_100576620
2244 Ga0075430_100736538
2245 Ga0075430_101452058
2246 Ga0075431_100003313
2247 Ga0075431_100004064
2248 Ga0075431_100024757
2249 Ga0075431_100028120
2250 Ga0075431_100063209
2251 Ga0075431_100190458
2252 Ga0075431_100301822
2253 Ga0075431_100504645
2254 Ga0075431_100776267
2255 Ga0075431_100839283
2256 Ga0075431_100987950
2257 Ga0075433_10014462
2258 Ga0075433_10023108
2259 Ga0075433_10075217
2260 Ga0075433_10076442
2261 Ga0075433_10116216
2262 Ga0075433_10148051
2263 Ga0075433_10303244
2264 Ga0075433_10391253
2265 Ga0075434_100000096
2266 Ga0075434_100016254
2267 Ga0075434_100023994
2268 Ga0075434_100081437
2269 Ga0075434_100108662
2270 Ga0075434_100108898
2271 Ga0075434_100198020
2272 Ga0075434_100207097
2273 Ga0075434_100472331
2274 Ga0075434_102483683
2275 Ga0075429_100006960
2276 Ga0075429_100013415
2277 Ga0075429_100014249
2278 Ga0075429_100014471
2279 Ga0075429_100043782
2280 Ga0075429_100049016
2281 Ga0075429_100175669
2282 Ga0075429_100238591
2283 Ga0075429_100304009
2284 Ga0075429_100333343
2285 Ga0075429_101061717
2286 Ga0068865_100013019
2287 Ga0068865_100021831
2288 Ga0068865_100067200
2289 Ga0068865_100182871
2290 Ga0068865_100193232
2291 Ga0068865_100363010
2292 Ga0068865_100394005
2293 Ga0068865_100873335
2294 Ga0075436_100077618
2295 Ga0075436_100718475
2296 Ga0097620_100011646
2297 Ga0097620_100018031
2298 Ga0097620_100018092
2299 Ga0097620_100070054
2300 Ga0097620_100136044
2301 Ga0097620_100298804
2302 Ga0097620_100523533
2303 Ga0097620_100946387
2304 Ga0097620_101312440
2305 Ga0097620_101691898
2306 Ga0075435_100047371
2307 Ga0075435_100055864
2308 Ga0075435_100087638
2309 Ga0075435_100129908
2310 Ga0075435_100204308
2311 Ga0075435_100684890
2312 Ga0075435_101068008
2313 Ga0075435_101297816
2314 Ga0105240_10876919
2315 Ga0111539_10000001
2316 Ga0111539_10000256
2317 Ga0111539_10000556
2318 Ga0111539_10001554
2319 Ga0111539_10002176
2320 Ga0111539_10003416
2321 Ga0111539_10010487
2322 Ga0111539_10011334
2323 Ga0111539_10031982
2324 Ga0111539_10045723
2325 Ga0111539_10053659
2326 Ga0111539_10414114
2327 Ga0111539_10745347
2328 Ga0111539_10835677
2329 Ga0111539_11369008
2330 Ga0111539_12965615
2331 Ga0105245_10240146
2332 Ga0105245_10498559
2333 Ga0105245_10893211
2334 Ga0105245_12750634
2335 Ga0105247_10204412
2336 Ga0105247_10266557
2337 Ga0114129_10000453
2338 Ga0114129_10008028
2339 Ga0114129_10014525
2340 Ga0114129_10039729
2341 Ga0114129_10045746
2342 Ga0114129_10051481
2343 Ga0114129_10051617
2344 Ga0114129_10063635
2345 Ga0114129_10122808
2346 Ga0114129_10232946
2347 Ga0114129_10380138
2348 Ga0114129_10519284
2349 Ga0114129_10541504
2350 Ga0114129_10583509
2351 Ga0114129_10614926
2352 Ga0114129_10669811
2353 Ga0114129_10684612
2354 Ga0114129_10719079
2355 Ga0114129_10744791
2356 Ga0114129_10767336
2357 Ga0114129_10832440
2358 Ga0114129_11006521
2359 Ga0114129_11542837
2360 Ga0114129_11651434
2361 Ga0114129_11956676
2362 Ga0114129_12757696
2363 Ga0105243_10006872
2364 Ga0105243_10049077
2365 Ga0105243_10102632
2366 Ga0105243_10238046
2367 Ga0105243_10722013
2368 Ga0105242_10029873
2369 Ga0105242_10031995
2370 Ga0105242_10051025
2371 Ga0105242_10179556
2372 Ga0105242_11065867
2373 Ga0105242_11478796
2374 Ga0105242_12190908
2375 Ga0105242_12829814
2376 Ga0105248_10256222
2377 Ga0105248_10387559
2378 Ga0105248_10496743
2379 Ga0105248_11170831
2380 Ga0105248_11704032
2381 Ga0105248_12089301
2382 Ga0105238_10037296
2383 Ga0105238_10248539
2384 Ga0105238_11343725
2385 Ga0105249_10001486
2386 Ga0105249_10007331
2387 Ga0105249_10034398
2388 Ga0105249_10072287
2389 Ga0105249_10192381
2390 Ga0105249_10203760
2391 Ga0105249_10668731
2392 Ga0105249_10786454
2393 Ga0105249_11277432
2394 Ga0105239_10554026
2395 Ga0105239_11275159
2396 Ga0105246_10051919
2397 Ga0105246_10326461
2398 Ga0157325_1031265
2399 Ga0157316_1023494
2400 Ga0157373_11197719
2401 Ga0157371_11067614
2402 Ga0157371_11134845
2403 Ga0157374_10207795
2404 Ga0157374_10208790
2405 Ga0157374_10217476
2406 Ga0157378_10015942
2407 Ga0157378_10068524
2408 Ga0157378_10140642
2409 Ga0157378_10183746
2410 Ga0157378_10384089
2411 Ga0157378_11248585
2412 Ga0157378_11971182
2413 Ga0163162_10018956
2414 Ga0163162_10048937
2415 Ga0163162_10088231
2416 Ga0163162_10391958
2417 Ga0163162_10489768
2418 Ga0163162_11070058
2419 Ga0163162_11518556
2420 Ga0157372_10758466
2421 Ga0157375_10021929
2422 Ga0157375_10069408
2423 Ga0157375_10159205
2424 Ga0157375_10219291
2425 Ga0157375_10452628
2426 Ga0157375_10605409
2427 Ga0157375_11246320
2428 Ga0157375_11390688
2429 Ga0157375_11586179
2430 Ga0163163_10087359
2431 Ga0163163_10259333
2432 Ga0163163_10543879
2433 Ga0163163_12039094
2434 Ga0157380_10006529
2435 Ga0157380_10025676
2436 Ga0157380_10034047
2437 Ga0157380_10047540
2438 Ga0157380_10086191
2439 Ga0157380_10105617
2440 Ga0157380_10124516
2441 Ga0157380_10277324
2442 Ga0157380_10436334
2443 Ga0157380_10460398
2444 Ga0157380_10851157
2445 Ga0157380_11091757
2446 Ga0157380_11785892
2447 Ga0157380_12159682
2448 Ga0157380_12965523
2449 Ga0157377_10002798
2450 Ga0157377_10004148
2451 Ga0157377_10012987
2452 Ga0157377_10050653
2453 Ga0157377_10098216
2454 Ga0157377_10151182
2455 Ga0157377_10840991
2456 Ga0157379_10133061
2457 Ga0157379_10862597
2458 Ga0157376_10044426
2459 Ga0157376_10137687
2460 Ga0157376_11114186
2461 Ga0157376_12127105
2462 Ga0182007_10197610
2463 Ga0163161_10084815
2464 Ga0163161_10217216
2465 Ga0163161_10330083
2466 Ga0163161_10574704
2467 Ga0163161_10829968
2468 Ga0197907_11193868
2469 Ga0206356_10137321
2470 Ga0206356_10718982
2471 Ga0206352_10891523
2472 Ga0206352_11001177
2473 Ga0224712_10046082
2474 Ga0207666_1006867
2475 Ga0207666_1033726
2476 Ga0207673_1003013
2477 Ga0207697_10001427
2478 Ga0207697_10051861
2479 Ga0207697_10108540
2480 Ga0207697_10110154
2481 Ga0207656_10018782
2482 Ga0207653_10097414
2483 Ga0207653_10159409
2484 Ga0207682_10022373
2485 Ga0207682_10041929
2486 Ga0207682_10112153
2487 Ga0207682_10119807
2488 Ga0207682_10147834
2489 Ga0207682_10217493
2490 Ga0207682_10423909
2491 Ga0207642_10188054
2492 Ga0207642_10261535
2493 Ga0207688_10035561
2494 Ga0207688_10060015
2495 Ga0207680_10264567
2496 Ga0207680_10688919
2497 Ga0207647_10130816
2498 Ga0207647_10143886
2499 Ga0207645_10006662
2500 Ga0207645_10008924
2501 Ga0207645_10048236
2502 Ga0207645_10340368
2503 Ga0207645_10551519
2504 Ga0207645_10626992
2505 Ga0207643_10001047
2506 Ga0207643_10011722
2507 Ga0207643_10034076
2508 Ga0207643_10046591
2509 Ga0207643_10061467
2510 Ga0207643_10142866
2511 Ga0207643_10491508
2512 Ga0207643_10630191
2513 Ga0207643_10844171
2514 Ga0207705_10050889
2515 Ga0207705_10074653
2516 Ga0207705_10079915
2517 Ga0207684_10007674
2518 Ga0207684_10012878
2519 Ga0207684_10104749
2520 Ga0207684_10120936
2521 Ga0207684_10138055
2522 Ga0207684_10735611
2523 Ga0207707_10033264
2524 Ga0207707_10258488
2525 Ga0207707_10985195
2526 Ga0207695_10042256
2527 Ga0207660_10142568
2528 Ga0207660_10436523
2529 Ga0207660_10552679
2530 Ga0207662_10001548
2531 Ga0207662_10006309
2532 Ga0207662_10024202
2533 Ga0207662_10031397
2534 Ga0207662_10045994
2535 Ga0207662_10172007
2536 Ga0207662_10558402
2537 Ga0207662_10752953
2538 Ga0207657_10031657
2539 Ga0207657_10379936
2540 Ga0207657_10662959
2541 Ga0207657_10690767
2542 Ga0207649_10012964
2543 Ga0207649_10120137
2544 Ga0207649_10164974
2545 Ga0207649_11590658
2546 Ga0207652_10043098
2547 Ga0207652_10329372
2548 Ga0207652_10335523
2549 Ga0207652_11871534
2550 Ga0207646_10006266
2551 Ga0207646_10035023
2552 Ga0207646_10043174
2553 Ga0207646_10129506
2554 Ga0207646_10673670
2555 Ga0207646_10690908
2556 Ga0207646_10711274
2557 Ga0207646_10785565
2558 Ga0207646_10847906
2559 Ga0207646_11178175
2560 Ga0207646_11559698
2561 Ga0207681_10005244
2562 Ga0207681_10027115
2563 Ga0207681_10030741
2564 Ga0207681_10052317
2565 Ga0207681_10056849
2566 Ga0207681_10114257
2567 Ga0207681_10160062
2568 Ga0207681_10194382
2569 Ga0207681_10432437
2570 Ga0207681_10788190
2571 Ga0207681_10938560
2572 Ga0207681_11385375
2573 Ga0207694_10036129
2574 Ga0207694_10420650
2575 Ga0207650_10009527
2576 Ga0207650_10132917
2577 Ga0207650_10185286
2578 Ga0207650_10247797
2579 Ga0207650_10258141
2580 Ga0207650_10364830
2581 Ga0207659_10000870
2582 Ga0207659_10011245
2583 Ga0207659_10012718
2584 Ga0207659_10019696
2585 Ga0207659_10032768
2586 Ga0207659_10075714
2587 Ga0207659_10078984
2588 Ga0207659_10121801
2589 Ga0207659_10126298
2590 Ga0207659_10169706
2591 Ga0207659_10198749
2592 Ga0207659_10944632
2593 Ga0207687_10168341
2594 Ga0207687_10381714
2595 Ga0207700_10058601
2596 Ga0207644_10011771
2597 Ga0207644_10028840
2598 Ga0207644_10030496
2599 Ga0207644_10207718
2600 Ga0207644_10209190
2601 Ga0207644_10412163
2602 Ga0207644_10981345
2603 Ga0207690_10316569
2604 Ga0207690_10320328
2605 Ga0207690_10565755
2606 Ga0207706_10008180
2607 Ga0207706_10107017
2608 Ga0207706_10222577
2609 Ga0207706_10249295
2610 Ga0207706_10251598
2611 Ga0207706_10317935
2612 Ga0207706_10327486
2613 Ga0207706_10391389
2614 Ga0207706_10419949
2615 Ga0207706_10479888
2616 Ga0207706_10509691
2617 Ga0207706_10533335
2618 Ga0207706_10883243
2619 Ga0207686_10025437
2620 Ga0207709_10032782
2621 Ga0207709_10136337
2622 Ga0207709_10153390
2623 Ga0207709_11228933
2624 Ga0207670_10107367
2625 Ga0207670_10191452
2626 Ga0207670_10320444
2627 Ga0207670_10792728
2628 Ga0207670_10999993
2629 Ga0207670_11311826
2630 Ga0207669_10098491
2631 Ga0207669_10102358
2632 Ga0207669_10105067
2633 Ga0207669_10364281
2634 Ga0207669_10388303
2635 Ga0207669_10526485
2636 Ga0207669_10639604
2637 Ga0207669_10844508
2638 Ga0207669_10855998
2639 Ga0207704_10002986
2640 Ga0207704_10007854
2641 Ga0207704_10068195
2642 Ga0207704_10137926
2643 Ga0207704_10324224
2644 Ga0207704_10757454
2645 Ga0207704_11080266
2646 Ga0207704_11095205
2647 Ga0207704_11147818
2648 Ga0207691_10001775
2649 Ga0207691_10003846
2650 Ga0207691_10009893
2651 Ga0207691_10040136
2652 Ga0207691_10057301
2653 Ga0207691_10058941
2654 Ga0207691_10109652
2655 Ga0207691_10113155
2656 Ga0207691_10182155
2657 Ga0207691_10296865
2658 Ga0207691_10313968
2659 Ga0207691_10325489
2660 Ga0207691_10433291
2661 Ga0207711_10165572
2662 Ga0207711_10370987
2663 Ga0207711_10437452
2664 Ga0207711_10559472
2665 Ga0207711_11298564
2666 Ga0207689_10006066
2667 Ga0207689_10052846
2668 Ga0207689_10061204
2669 Ga0207689_10148826
2670 Ga0207689_10174341
2671 Ga0207689_10203480
2672 Ga0207689_10756134
2673 Ga0207689_10954881
2674 Ga0207689_11024386
2675 Ga0207661_10082495
2676 Ga0207661_10857994
2677 Ga0207679_10008779
2678 Ga0207679_10015483
2679 Ga0207679_10027538
2680 Ga0207679_10124067
2681 Ga0207679_10137199
2682 Ga0207679_10149918
2683 Ga0207679_10204503
2684 Ga0207679_10495782
2685 Ga0207679_10586988
2686 Ga0207667_10059715
2687 Ga0207651_10006568
2688 Ga0207651_10027078
2689 Ga0207651_10129112
2690 Ga0207651_10134395
2691 Ga0207651_10225050
2692 Ga0207651_10283997
2693 Ga0207651_10420584
2694 Ga0207651_10455102
2695 Ga0207651_10526274
2696 Ga0207651_10548019
2697 Ga0207651_10554088
2698 Ga0207651_11805843
2699 Ga0207712_10021850
2700 Ga0207712_10041989
2701 Ga0207712_10042665
2702 Ga0207712_10172237
2703 Ga0207712_10490448
2704 Ga0207712_10566055
2705 Ga0207668_10019392
2706 Ga0207668_10021261
2707 Ga0207668_10029456
2708 Ga0207668_10452157
2709 Ga0207640_10163970
2710 Ga0207640_10164302
2711 Ga0207640_10167292
2712 Ga0207640_10251579
2713 Ga0207640_10418859
2714 Ga0207640_10919650
2715 Ga0207640_11150935
2716 Ga0207640_11237613
2717 Ga0207658_10042421
2718 Ga0207658_11529795
2719 Ga0207677_10062701
2720 Ga0207677_10112518
2721 Ga0207677_10342839
2722 Ga0207677_10975411
2723 Ga0207703_10024937
2724 Ga0207703_10036382
2725 Ga0207703_10258933
2726 Ga0207703_10282745
2727 Ga0207703_10549249
2728 Ga0207703_11666833
2729 Ga0207639_11052134
2730 Ga0207639_11360876
2731 Ga0207639_11496665
2732 Ga0207639_11925039
2733 Ga0207678_10044307
2734 Ga0207678_10109435
2735 Ga0207678_10231548
2736 Ga0207678_10786617
2737 Ga0207678_10929032
2738 Ga0207678_11189739
2739 Ga0207678_11378279
2740 Ga0207708_10000967
2741 Ga0207708_10008662
2742 Ga0207708_10012845
2743 Ga0207708_10030957
2744 Ga0207708_10034054
2745 Ga0207708_10044381
2746 Ga0207708_10060530
2747 Ga0207708_10181216
2748 Ga0207708_10194552
2749 Ga0207708_10457474
2750 Ga0207708_10863489
2751 Ga0207708_10980930
2752 Ga0207708_11364354
2753 Ga0207702_10185359
2754 Ga0207702_10273059
2755 Ga0207641_10094459
2756 Ga0207641_10205734
2757 Ga0207641_10535162
2758 Ga0207641_10797149
2759 Ga0207641_11470162
2760 Ga0207648_10000077
2761 Ga0207648_10002077
2762 Ga0207648_10003205
2763 Ga0207648_10089214
2764 Ga0207648_10094697
2765 Ga0207648_10149334
2766 Ga0207648_10262793
2767 Ga0207648_10277472
2768 Ga0207648_11040338
2769 Ga0207676_10066274
2770 Ga0207676_10136694
2771 Ga0207676_10154705
2772 Ga0207676_10176922
2773 Ga0207676_10318381
2774 Ga0207676_10322601
2775 Ga0207676_10638724
2776 Ga0207676_10839484
2777 Ga0207676_12026500
2778 Ga0207674_10118202
2779 Ga0207674_10123415
2780 Ga0207674_10332818
2781 Ga0207674_10352580
2782 Ga0207674_10398721
2783 Ga0207674_10567205
2784 Ga0207675_100009620
2785 Ga0207675_100022197
2786 Ga0207675_100036685
2787 Ga0207675_100037149
2788 Ga0207675_100043225
2789 Ga0207675_100095349
2790 Ga0207675_100197290
2791 Ga0207675_100427063
2792 Ga0207675_100670427
2793 Ga0207675_101105366
2794 Ga0207675_101271651
2795 Ga0207683_10006547
2796 Ga0207683_10017764
2797 Ga0207683_10034722
2798 Ga0207683_10057306
2799 Ga0207683_10248418
2800 Ga0207683_10265974
2801 Ga0207683_10497481
2802 Ga0207683_10529881
2803 Ga0207683_10879226
2804 Ga0207683_11195470
2805 Ga0207683_11421503
2806 Ga0207698_10336815
2807 Ga0207698_12601585
2808 Ga0209967_1006233
2809 Ga0209984_1021509
2810 Ga0209995_1045465
2811 Ga0209970_1029486
2812 Ga0209983_1061069
2813 Ga0209971_1009093
2814 Ga0209971_1068666
2815 Ga0209998_10116203
2816 Ga0209813_10026775
2817 Ga0207428_10000002
2818 Ga0207428_10000106
2819 Ga0207428_10000186
2820 Ga0207428_10003255
2821 Ga0207428_10006966
2822 Ga0207428_10018274
2823 Ga0207428_10023208
2824 Ga0207428_10025959
2825 Ga0207428_10055767
2826 Ga0207428_10102466
2827 Ga0207428_10782344
2828 Ga0268266_10218629
2829 Ga0268266_10302203
2830 Ga0268266_10846861
2831 Ga0268266_11402681
2832 Ga0268266_12015843
2833 Ga0268265_10007329
2834 Ga0268265_10061708
2835 Ga0268265_10101841
2836 Ga0268265_10116245
2837 Ga0268265_10219653
2838 Ga0268265_10339545
2839 Ga0268265_10444716
2840 Ga0268265_10481784
2841 Ga0268265_10929808
2842 Ga0268265_11088991
2843 Ga0268265_11168237
2844 Ga0268265_11202574
2845 Ga0268265_11728888
2846 Ga0268264_10031383
2847 Ga0268264_10114744
2848 Ga0268264_10298873
2849 Ga0268264_10424303
2850 Ga0268264_11276321
2851 Ga0265316_10534630
2852 Ga0307408_100008918
2853 Ga0307408_100019678
2854 Ga0307408_100482265
2855 Ga0307408_100594873
2856 Ga0307408_101712421
2857 Ga0307405_10004553
2858 Ga0307405_10023835
2859 Ga0307405_11730889
2860 Ga0307413_10009818
2861 Ga0307413_10020674
2862 Ga0307413_10458115
2863 Ga0307413_10771913
2864 Ga0307410_10011385
2865 Ga0307410_10066919
2866 Ga0307410_10109783
2867 Ga0307410_10166253
2868 Ga0307410_10181548
2869 Ga0307410_10240348
2870 Ga0307410_10352167
2871 Ga0307410_10625981
2872 Ga0307410_10641211
2873 Ga0307410_10681163
2874 Ga0307406_10013139
2875 Ga0307406_10863004
2876 Ga0307407_10000966
2877 Ga0307407_11130093
2878 Ga0307412_10008019
2879 Ga0307412_10175853
2880 Ga0307412_10464286
2881 Ga0307412_10655259
2882 Ga0307412_10717232
2883 Ga0307412_11034947
2884 Ga0307409_100023260
2885 Ga0307409_100143739
2886 Ga0307409_100256052
2887 Ga0307409_100553008
2888 Ga0307409_100672259
2889 Ga0307409_101085355
2890 Ga0307409_101235906
2891 Ga0307409_101588912
2892 Ga0307409_102302097
2893 Ga0307416_100021939
2894 Ga0307416_100144917
2895 Ga0307416_100228176
2896 Ga0307416_100266111
2897 Ga0307416_100310080
2898 Ga0307416_100720972
2899 Ga0307414_10013912
2900 Ga0307414_10064525
2901 Ga0307414_10335531
2902 Ga0307414_10519133
2903 Ga0307414_10682195
2904 Ga0307414_10772809
2905 Ga0307414_11211716
2906 Ga0307414_12168704
2907 Ga0307411_10071316
2908 Ga0307411_10137617
2909 Ga0307411_10251169
2910 Ga0307411_10757873
2911 Ga0307411_11180018
2912 Ga0307411_11810351
2913 Ga0307415_100004186
2914 Ga0307415_100719442
2915 Ga0307415_100995470
2916 Ga0307415_102187643
2917 Ga0316593_10153375
2918 Ga0316588_1067427
2919 Ga0316588_1096612
2920 Ga0316596_1053483
2921 Ga0316596_1054650
2922 Ga0373948_0001060
2923 Ga0373928_0073371
2924 Ga0373949_0017113
2925 Ga0373951_0045363
2926 Ga0373923_0012900
2927 Ga0373923_0253719
2928 Ga0373932_0019250
2929 Ga0373932_0050304
2930 Ga0373936_0275752
2931 Ga0373939_0063081
2932 Ga0373945_0042155
2933 Ga0373954_0437169
2934 Ga0373956_0085816
2935 Ga0373960_0236391
2936 Ga0373943_0089578
2937 Ga0373946_0006741
2938 Ga0373961_0014437
2939 Ga0373962_0032279
2940 Ga0373962_0078208
2941 Ga0373962_0366357
2942 Ga0316574_0007019
2943 Ga0316574_0714287
2944 Ga0373931_0095999
2945 Ga0373931_0133592
2946 Ga0373935_1374485
2947 Ga0373933_0080197
2948 Ga0373933_0515753
2949 Ga0373937_0137669
2950 Ga0373925_0000311
2951 Ga0373925_0242716
2952 Ga0373925_0497161
2953 Ga0373925_0603800
2954 Ga0395900_1078683
2955 Ga0395905_0145471
2956 Ga0242420_039736
2957 Ga0439439_0021237
2958 Ga0439439_0056618
2959 Ga0439439_0093848
2960 Ga0439453_0004947
2961 Ga0439453_0035013
2962 Ga0439453_0059523
2963 Ga0451802_0851433
2964 Ga0451855_0889241
2965 Ga0451853_2675013
2966 Ga0451853_2950042
2967 Ga0451853_3274084
2968 Ga0439433_0078076
2969 Ga0439433_0196205
2970 Ga0439443_004394
2971 Ga0439448_0232652
2972 Ga0439448_0283780
2973 Ga0439450_003067
2974 Ga0439450_195886
2975 Ga0450913_017786
2976 Ga0450919_026133
2977 Ga0450920_083156
2978 Ga0450890_089665
2979 Ga0450896_041911
2980 Ga0450910_086617
2981 Ga0439446_0054925
2982 Ga0439446_0061363
2983 Ga0439446_0136544
2984 Ga0439434_0134363
2985 Ga0439434_0136833
2986 Ga0439434_0209993
2987 Ga0439435_0027305
2988 Ga0439435_0027412
2989 Ga0439435_0047665
2990 Ga0439444_0032673
2991 Ga0439444_0047928
2992 Ga0439459_0091528
2993 Ga0439464_0019815
2994 Ga0439464_0082263
2995 Ga0439464_0126192
2996 Ga0450916_002307
2997 Ga0450918_074231
2998 Ga0451577_0013678
2999 Ga0451577_0325959
3000 Ga0451577_0969094
3001 Ga0439440_0215815
3002 Ga0453683_0107591
3003 Ga0453683_1182115
3004 Ga0453684_0000503
3005 Ga0453684_0113267
3006 Ga0453684_0132153
3007 Ga0453684_0337097
3008 Ga0451576_0012703
3009 Ga0451576_0045741
3010 Ga0451576_0145001
3011 Ga0451576_0251899
3012 Ga0451576_0313527
3013 Ga0451576_0425129
3014 Ga0451576_0502199
3015 Ga0451576_1056404
3016 Ga0451576_1133463
3017 Ga0451576_1654162
3018 Ga0495603_0042437
3019 Ga0495603_0073077
3020 Ga0495590_0149698
3021 Ga0495629_0000007
3022 Ga0495629_0754036
3023 Ga0495629_0814378
3024 Ga0495641_0463798
3025 Ga0495651_0073290
3026 Ga0495653_0071834
3027 Ga0495653_0323443
3028 Ga0495582_0100746
3029 Ga0495582_0165832
3030 Ga0495582_0277453
3031 Ga0495582_0481622
3032 Ga0495605_0390536
3033 Ga0495639_0000012
3034 Ga0495639_0396859
3035 Ga0495639_0447078
3036 Ga0495662_0074163
3037 Ga0495664_0095864
3038 Ga0495584_0014678
3039 Ga0495585_0128758
3040 Ga0495594_0015783
3041 Ga0495594_0045017
3042 Ga0495594_0073004
3043 Ga0495608_0378188
3044 Ga0495618_0181503
3045 Ga0495628_0029181
3046 Ga0495630_0036176
3047 Ga0495630_0373853
3048 Ga0495637_0113572
3049 Ga0495643_0303540
3050 Ga0495644_0113518
3051 Ga0495644_0127774
3052 Ga0495663_0072209
3053 Ga0495663_0114505
3054 Ga0495666_0000130
3055 Ga0495642_0064110
3056 Ga0495642_0271724
3057 Ga0495652_0467598
3058 Ga0495654_0235229
3059 Ga0495665_0026207
3060 Ga0495665_0377814
3061 Ga0495640_0212601
3062 Ga0495640_0280884
3063 Ga0495586_0000452
3064 Ga0495586_0084433
3065 Ga0495586_0352153
3066 Ga0495587_0011763
3067 Ga0495598_0089131
3068 Ga0495598_0266602
3069 Ga0495598_0311821
3070 Ga0495609_0032513
3071 Ga0495621_0001834
3072 Ga0495621_0033128
3073 Ga0495621_0039662
3074 Ga0495621_0094254
3075 Ga0495621_0128222
3076 Ga0495621_0543780
3077 Ga0495645_0088172
3078 Ga0495622_0004965
3079 Ga0495667_0609930
3080 Ga0495656_0012496
3081 Ga0495656_0194272
3082 Ga0495656_0366461
3083 Ga0495656_0368434
3084 Ga0495625_0889900
3085 Ga0495635_0000679
3086 Ga0495635_0256896
3087 Ga0495659_0006070
3088 Ga0495659_0013976
3089 Ga0495659_0031626
3090 Ga0495659_0045751
3091 Ga0495659_0066297
3092 Ga0495659_0085565
3093 Ga0495659_0093347
3094 Ga0495659_0185267
3095 Ga0495661_0531246
3096 Ga0495588_0061845
3097 Ga0495657_0036170
3098 Ga0495599_0176158
3099 Ga0495623_0400902
3100 Ga0495647_0051594
3101 Ga0495647_0222184
3102 Ga0495658_0014928
3103 Ga0495658_0095424
3104 Ga0495658_0352374
3105 Ga0495658_0538806
3106 Ga0495658_0907001
3107 Ga0495658_1006891
3108 Ga0495669_0005426
3109 Ga0495669_0021180
3110 Ga0495669_0024880
3111 Ga0495613_0012840
3112 Ga0495613_1022714
3113 Ga0495624_0125400
3114 Ga0495670_0080926
3115 Ga0495670_0516666
3116 Ga0495600_0101091
3117 Ga0495581_0029132
3118 Ga0495581_0260122
3119 Ga0495604_0045142
3120 Ga0495636_0008993
3121 Ga0495636_0098358
3122 Ga0495636_0145141
3123 Ga0495636_0389641
3124 Ga0495674_0166038
3125 Ga0495672_0002243
3126 Ga0495672_0255157
3127 Ga0495676_0088829
3128 Ga0495676_0334433
3129 Ga0495680_0049064
3130 Ga0495675_0346546
3131 Ga0495685_074964
3132 Ga0495684_0000698
3133 Ga0495684_0003319
3134 Ga0496102_0490156
3135 Ga0496106_0469282
3136 Ga0496108_0330485
3137 Ga0496108_0539261
3138 Ga0496110_0782904
3139 Ga0496111_0493404
3140 Ga0496113_0048566
3141 Ga0496114_0472935
3142 Ga0496114_0675390
3143 Ga0496117_0195705
3144 Ga0496125_0102918
3145 Ga0501306_084633
3146 Ga0501306_092216
3147 Ga0501306_105065
3148 Ga0501305_008421
3149 Ga0501305_114997
3150 Ga0501291_017618
3151 Ga0501299_013839
3152 Ga0501299_134125
3153 Ga0501313_053531
3154 Ga0501316_050721
3155 Ga0501320_027563
3156 Ga0501031_0892738
3157 Ga0501033_0092201
3158 Ga0501036_0270137
3159 Ga0501037_0337708
3160 Ga0501038_0232636
3161 Ga0501038_1394604
3162 Ga0501039_0028362
3163 Ga0501039_0138245
3164 Ga0501039_0346295
3165 Ga0501039_0759527
3166 Ga0501039_1326358
3167 Ga0501040_0083706
3168 Ga0501040_0190846
3169 Ga0501040_0226496
3170 Ga0501040_0388631
3171 Ga0501040_1198277
3172 Ga0501040_1381737
3173 Ga0501041_0020068
3174 Ga0501041_0076869
3175 Ga0501041_0117118
3176 Ga0501041_0169482
3177 Ga0501041_0597332
3178 Ga0501041_0822886
3179 Ga0501041_0848145
3180 Ga0501042_0004037
3181 Ga0501042_0174881
3182 Ga0501042_0487478
3183 Ga0501042_1072138
3184 Ga0501043_0610080
3185 Ga0501046_0115527
3186 Ga0501046_0737742
3187 Ga0501048_0005773
3188 Ga0501048_0089215
3189 Ga0501048_0494707
3190 Ga0501068_0353970
3191 Ga0501068_0555714
3192 Ga0501068_0801529
3193 Ga0501070_0915956
3194 Ga0501071_0269461
3195 Ga0501071_0668035
3196 Ga0501072_0032796
3197 Ga0501072_0153510
3198 Ga0501072_0264539
3199 Ga0501072_0303265
3200 Ga0501072_0945031
3201 Ga0501072_0964684
3202 Ga0501073_0276250
3203 Ga0501074_0209031
3204 Ga0501074_0210036
3205 Ga0501074_0310784
3206 Ga0501075_0062611
3207 Ga0501075_0103757
3208 Ga0501075_0387991
3209 Ga0501076_0103804
3210 Ga0501076_0155208
3211 Ga0501076_0331219
3212 Ga0501076_0589397
3213 Ga0501076_0714547
3214 Ga0501076_0855521
3215 Ga0501077_0187494
3216 Ga0501206_025981
3217 Ga0501233_249902
3218 Ga0501249_018081
3219 Ga0501249_020496
3220 Ga0501225_0085357
3221 Ga0501234_076969
3222 Ga0501079_0005100
3223 Ga0501079_0667030
3224 Ga0501079_1209837
3225 Ga0501080_0320367
3226 Ga0501080_0364717
3227 Ga0501080_0861821
3228 Ga0501080_0945016
3229 Ga0501080_1131244
3230 Ga0501081_0006494
3231 Ga0501081_0446260
3232 Ga0501081_0448335
3233 Ga0501081_0514622
3234 Ga0501081_0701762
3235 Ga0501081_0778372
3236 Ga0501081_1137096
3237 Ga0501083_0331635
3238 Ga0501083_0752517
3239 Ga0501241_034479
3240 Ga0501035_0246049
3241 Ga0501035_0341931
3242 Ga0501044_0776367
3243 Ga0501045_0020867
3244 Ga0501045_0125774
3245 Ga0501045_0138908
3246 Ga0501045_1405099
3247 Ga0501212_031095
3248 nmdc:mga03n38_605094_c1
3249 nmdc:mga03n38_90392_c1
3250 nmdc:mga00v17_78219_c1
3251 nmdc:mga0yw44_151342_c1
3252 nmdc:mga0k408_104182_c1
3253 nmdc:mga0k408_186_c1
3254 nmdc:mga0k408_36556_c1
3255 nmdc:mga0k408_97156_c1
3256 nmdc:mga06z11_166314_c1
3257 nmdc:mga06z11_185961_c1
3258 nmdc:mga06z11_2360_c1
3259 nmdc:mga06z11_382614_c1
3260 nmdc:mga04h51_27271_c1
3261 nmdc:mga04h51_4376_c1
3262 nmdc:mga07m45_108910_c2
3263 nmdc:mga07m45_11312_c1
3264 nmdc:mga05p37_111981_c1
3265 nmdc:mga05p37_12059_c1
3266 nmdc:mga05p37_1286506_c1
3267 nmdc:mga05p37_13371_c1
3268 nmdc:mga05p37_13677_c1
3269 nmdc:mga05p37_13826_c1
3270 nmdc:mga05p37_14186_c1
3271 nmdc:mga05p37_159631_c1
3272 nmdc:mga05p37_187783_c1
3273 nmdc:mga05p37_292570_c1
3274 nmdc:mga05p37_31700_c1
3275 nmdc:mga05p37_321074_c1
3276 nmdc:mga05p37_449891_c1
3277 nmdc:mga05p37_458220_c1
3278 nmdc:mga05p37_469636_c1
3279 nmdc:mga05p37_553621_c1
3280 nmdc:mga05p37_58091_c1
3281 nmdc:mga05p37_72501_c1
3282 nmdc:mga05p37_78598_c1
3283 nmdc:mga05p37_85593_c1
3284 nmdc:mga05p37_907848_c1
3285 nmdc:mga09592_120012_c1
3286 nmdc:mga09592_14369_c1
3287 nmdc:mga09592_1473045_c1
3288 nmdc:mga09592_1746_c1
3289 nmdc:mga09592_180420_c1
3290 nmdc:mga09592_186937_c1
3291 nmdc:mga09592_245186_c1
3292 nmdc:mga09592_311174_c1
3293 nmdc:mga09592_31280_c1
3294 nmdc:mga09592_401135_c1
3295 nmdc:mga09592_40518_c1
3296 nmdc:mga09592_519798_c1
3297 nmdc:mga09592_64885_c1
3298 nmdc:mga09592_90545_c1
3299 nmdc:mga09592_94812_c1
3300 nmdc:mga09592_9883_c1
3301 nmdc:mga0qj67_133506_c1
3302 nmdc:mga0qj67_1380665_c1
3303 nmdc:mga0qj67_1398_c1
3304 nmdc:mga0qj67_174387_c1
3305 nmdc:mga0qj67_272286_c1
3306 nmdc:mga0qj67_451036_c1
3307 nmdc:mga0qj67_474044_c1
3308 nmdc:mga0qj67_476354_c1
3309 nmdc:mga0qj67_536_c1
3310 nmdc:mga0qj67_54751_c1
3311 nmdc:mga0qj67_626400_c1
3312 nmdc:mga0qj67_8727_c1
3313 nmdc:mga0qj67_98600_c1
3314 nmdc:mga06r32_1394_c1
3315 nmdc:mga06r32_196081_c1
3316 nmdc:mga06r32_2058103_c1
3317 nmdc:mga06r32_232824_c1
3318 nmdc:mga06r32_31886_c1
3319 nmdc:mga06r32_4278_c1
3320 nmdc:mga06r32_75664_c1
3321 nmdc:mga06r32_93539_c1
3322 nmdc:mga08y16_11077_c1
3323 nmdc:mga08y16_1122399_c1
3324 nmdc:mga08y16_11913_c1
3325 nmdc:mga08y16_122911_c1
3326 nmdc:mga08y16_154128_c1
3327 nmdc:mga08y16_2262_c1
3328 nmdc:mga08y16_2394_c1
3329 nmdc:mga08y16_373436_c1
3330 nmdc:mga08y16_3_c1
3331 nmdc:mga08y16_44618_c1
3332 nmdc:mga08y16_7076_c1
3333 nmdc:mga08y16_842_c1
3334 nmdc:mga08y16_9481_c1
3335 nmdc:mga08y16_9590_c1
3336 nmdc:mga0n895_1150126_c1
3337 nmdc:mga0n895_11531_c1
3338 nmdc:mga0n895_129884_c1
3339 nmdc:mga0n895_149205_c1
3340 nmdc:mga0n895_163133_c1
3341 nmdc:mga0n895_253422_c1
3342 nmdc:mga0n895_27601_c1
3343 nmdc:mga0n895_33625_c1
3344 nmdc:mga0n895_455780_c1
3345 nmdc:mga0n895_50818_c1
3346 nmdc:mga0n895_57722_c1
3347 nmdc:mga0n895_78657_c1
3348 nmdc:mga0n895_81259_c1
3349 nmdc:mga0n895_875665_c1
3350 nmdc:mga0rr50_1012592_c1
3351 nmdc:mga0rr50_14044_c1
3352 nmdc:mga0rr50_1502545_c1
3353 nmdc:mga0rr50_214174_c1
3354 nmdc:mga0rr50_236618_c1
3355 nmdc:mga0rr50_330446_c1
3356 nmdc:mga0rr50_62289_c1
3357 nmdc:mga0rr50_77904_c1
3358 nmdc:mga08x19_23138_c1
3359 nmdc:mga08x19_482652_c1
3360 nmdc:mga08x19_502417_c1
3361 nmdc:mga08x19_770591_c1
3362 nmdc:mga0a205_1169544_c1
3363 nmdc:mga0a205_121148_c1
3364 nmdc:mga0a205_1277638_c1
3365 nmdc:mga0a205_1447104_c1
3366 nmdc:mga0a205_148308_c1
3367 nmdc:mga0a205_149775_c1
3368 nmdc:mga0a205_259_c1
3369 nmdc:mga0a205_27341_c1
3370 nmdc:mga0a205_284368_c1
3371 nmdc:mga0a205_3512_c1
3372 nmdc:mga0a205_530720_c1
3373 nmdc:mga0a205_71450_c1
3374 nmdc:mga0a205_828723_c1
3375 nmdc:mga0a205_84893_c1
3376 Ga0495601_0017272
3377 Ga0495601_0044413
3378 Ga0495595_0132469
3379 Ga0495619_0028241
3380 Ga0495619_0053335
3381 Ga0495619_0093220
3382 Ga0500555_107513
3383 Ga0500645_081433
3384 Ga0501084_0156511
3385 Ga0501084_0442296
3386 Ga0590071_000041
3387 Ga0590071_000580
3388 Ga0590074_000103
3389 Ga0590074_008432
3390 Ga0590074_018564
3391 Ga0590075_000191
3392 Ga0590075_000837
3393 Ga0590075_175784
3394 Ga0590077_000066
3395 Ga0590077_000903
3396 Ga0590077_035613
3397 Ga0590077_045941
3398 Ga0587070_080562
3399 Ga0587073_0162582
3400 Ga0587073_0308417
3401 Ga0587080_091636
3402 Ga0587090_067671
3403 Ga0587101_089551
3404 Ga0587101_118129
3405 Ga0587109_134399
3406 Ga0587067_119610
3407 Ga0587114_105393
3408 Ga0501082_0040635
3409 Ga0501082_0073372
3410 Ga0501082_0236383
3411 Ga0501082_0657887
3412 Ga0501082_1103586
3413 Ga0530510_0040980
3414 Ga0530510_0136503
3415 Ga0530510_1089771
3416 Ga0530510_1497373

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00380

Ribosomal_S9

Ribosomal protein S9/S16

30

150

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v48-assembly1.cif.gz_BI real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9695 6 102
8d8l-assembly1.cif.gz_I yeast mitochondrial small subunit assembly intermediate (state 3) 0.9684 5 107
5mrf-assembly1.cif.gz_II structure of the yeast mitochondrial ribosome - class c 0.9671 5 107
7pkq-assembly1.cif.gz_i small subunit of the chlamydomonas reinhardtii mitoribosome 0.9619 5 94
8d8k-assembly1.cif.gz_I yeast mitochondrial small subunit assembly intermediate (state 2) 0.9472 5 107
ID Description Score Start End Superfamily
af_P34388_249_392_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9145 4 107 3.30.230.10
af_P54024_1_136_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8701 4 108 3.30.230.10
af_Q7XAM9_269_415_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7981 5 130 3.30.230.10
af_O94150_208_336_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7969 5 130 3.30.230.10
af_Q54CK4_214_339_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7949 6 130 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A7V4Y3R4-F1-model_v4 30S ribosomal protein S9 1.002 1 98 GO:0003723
GO:0003735
GO:0006412
GO:0022627
AF-A0A7X7M6L1-F1-model_v4 30S ribosomal protein S9 0.9987 4 105 GO:0003723
GO:0003735
GO:0006412
GO:0022627
AF-X0VQS9-F1-model_v4 30S ribosomal protein S9 0.9974 2 98 GO:0003723
GO:0003735
GO:0006412
GO:0022627
AF-A0A6A5L3V0-F1-model_v4 deleted 0.9972 1 96
AF-A0A7S7FZM9-F1-model_v4 30S ribosomal protein S9 0.997 1 100 GO:0003723
GO:0003735
GO:0006412
GO:0022627

Map