F495405

General Info

Members Datasets Scaffolds Average Seq Length
1704 747 3408 210

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0109785|Ga0501031_0109785_65_769
Length 234
Sequence MALLRNRVASQRCADSKVSGRGMGNDIDRAGVAKAYGRWAPIYDLVFGKVFDQGRQSTIAVADKIGGRILDVGVGTGLSLSDYSRSTRLCGVDISEPMLRKAQERVRKLELDNVETLAVMDAKNLAFPDDFFDAVVAQYVITAVPDPEATLDDFIRVLKPGGELILVNHIGAESGLRRISELAFAPLARRLGWRPEFPWARLVNWAAKHGGVSLAERRPMPPMGHFSLIRYRKM

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
91 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
92 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
126 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
127 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
128 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
129 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
132 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
134 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
137 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
206 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
207 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
208 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
209 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
214 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
215 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
216 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
217 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
218 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
219 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
220 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
221 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
222 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
223 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
224 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
225 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
226 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
227 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
228 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
229 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
230 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
231 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
232 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
235 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
236 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
237 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
238 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
239 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
240 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
241 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
242 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
245 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
246 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
247 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
248 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
249 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
250 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
251 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
252 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
253 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
254 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
257 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
258 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
259 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
260 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
261 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
262 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
263 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
264 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
265 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
266 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
268 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
269 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
270 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
271 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
272 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
273 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
275 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
276 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
277 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
278 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
279 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
280 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
281 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
282 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
283 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
284 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
285 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
286 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
287 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
288 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
289 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
290 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
291 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
292 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
293 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
294 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
295 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
296 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
297 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
298 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
299 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
300 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
301 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
302 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
303 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
304 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
305 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
306 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
307 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
308 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
309 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
310 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
311 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
312 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
313 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
314 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
315 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
316 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
317 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
318 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
319 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
320 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
321 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
322 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
323 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
324 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
325 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
326 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
327 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
328 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
329 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
330 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
331 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
332 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
333 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
334 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
335 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
336 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
337 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
338 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
339 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
340 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
341 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
342 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
343 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
344 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
345 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
346 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
347 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
348 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
349 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
350 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
351 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
352 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
353 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
354 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
355 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
356 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
357 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
358 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
359 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
360 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
361 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
362 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
363 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
364 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
365 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
366 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
367 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
368 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
369 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
370 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
371 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
372 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
373 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
374 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
375 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
376 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
377 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
378 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
379 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
380 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
381 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
382 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
383 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
384 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
385 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
386 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
387 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
388 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
389 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
390 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
391 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
392 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
393 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
394 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
395 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
396 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
397 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
398 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
399 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
400 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
401 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
402 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
403 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
404 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
405 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
406 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
407 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
408 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
409 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
410 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
411 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
412 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
413 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
414 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
415 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
416 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
417 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
418 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
433 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
434 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
435 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
436 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
437 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
438 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
439 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
440 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
441 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
442 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
443 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
444 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
445 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
448 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
449 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
450 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
451 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
452 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
453 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
454 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
455 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
456 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
457 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
458 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
459 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
460 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
461 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
462 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
463 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
464 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
465 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
466 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
467 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
468 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
469 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
470 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
471 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
472 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
473 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
474 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
475 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
476 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
477 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
478 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
479 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
480 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
481 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
482 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
483 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
484 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
485 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
486 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
487 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
488 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
489 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
490 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
491 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
492 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
493 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
494 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
495 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
496 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
497 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
498 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
499 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
500 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
501 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
502 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
503 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
504 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
505 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
506 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
507 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
508 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
509 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
510 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
511 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
512 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
513 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
514 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
515 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
516 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
517 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
518 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
519 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
520 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
521 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
522 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
523 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
524 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
525 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
526 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
527 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
528 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
529 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
530 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
531 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
532 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
533 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
534 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
535 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
536 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
537 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
538 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
539 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
540 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
541 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
542 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
543 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
544 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
545 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
546 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
547 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
548 2643221651 Afipia sp. Root123D2 Isolate Unclassified
549 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
550 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
551 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
552 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
553 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
554 2791355199
555 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
556 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
557 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
558 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
559 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
560 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
561 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
562 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
563 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
564 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
565 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
566 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
567 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
568 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
569 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
570 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
571 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
572 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
573 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
574 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
575 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
576 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
577 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
578 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
579 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
580 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
581 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
582 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
583 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
584 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
585 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
586 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
587 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
588 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
589 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
590 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
591 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
592 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
593 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
594 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
595 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
596 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
597 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
598 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
599 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
600 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
601 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
602 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
603 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
604 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
605 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
606 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
607 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
608 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
609 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
610 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
611 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
612 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
613 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
614 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
615 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
616 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
617 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
618 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
619 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
620 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
621 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
622 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
623 2904699407
624 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
625 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
626 2906610324
627 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
628 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
629 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
630 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
631 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
632 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
633 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
634 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
635 2922368715
636 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
637 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
638 2922425934
639 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
640 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
641 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
642 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
643 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
644 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
645 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
646 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
647 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
648 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
649 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
650 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
651 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
652 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
653 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
654 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
655 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
656 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
657 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
658 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
659 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
660 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
661 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
662 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
663 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
664 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
665 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
666 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
667 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
668 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
669 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
670 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
671 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
672 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
673 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
674 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
675 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
676 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
677 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
678 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
679 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
680 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
681 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
682 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
683 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
684 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
685 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
686 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
687 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
688 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
689 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
690 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
691 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
692 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
693 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
694 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
695 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
696 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
697 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
698 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
699 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
700 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
701 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
702 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
703 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
704 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
705 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
706 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
707 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
708 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
709 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
710 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
711 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
712 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
713 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
714 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
715 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
716 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
717 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
718 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
719 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
720 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
721 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
722 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
723 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
724 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
725 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
726 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
727 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
728 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
729 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
730 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
731 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
732 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
733 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
734 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
735 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
736 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
737 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
738 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
739 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
740 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
741 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
742 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
743 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
744 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
745 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
746 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
747 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.82
Metatranscriptomes 0.06
Isolates 13.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.27
Nodule 10.86
Rhizoplane 5.69
Rhizosphere 61.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0109785 3300049568 Bacteria 1801
2 JGI24740J21852_10014866 3300001979 Bacteria 2858
3 JGI24739J22299_10062404 3300001989 Bacteria 1175
4 JGI24737J22298_10010976 3300001990 Bacteria 2975
5 JGI25406J46586_10000042 3300003203 Bacteria 56211
6 JGI25406J46586_10001667 3300003203 Bacteria 10494
7 JGI25153J46596_10003624 3300003215 Bacteria 8573
8 JGI25153J46596_10003958 3300003215 Bacteria 8110
9 JGI25153J46596_10004459 3300003215 Bacteria 7547
10 JGI25153J46596_10005398 3300003215 Bacteria 6714
11 JGI25153J46596_10020255 3300003215 Bacteria 2520
12 JGI25153J46596_10091220 3300003215 Bacteria 736
13 JGI25160J50197_1001455 3300003354 Bacteria 11797
14 JGI25160J50197_1012378 3300003354 Bacteria 2964
15 JGI25160J50197_1020115 3300003354 Bacteria 2025
16 JGI25404J52841_10008161 3300003659 Bacteria 2225
17 JGI25404J52841_10012359 3300003659 Bacteria 1848
18 Ga0055531_10012265 3300003794 Bacteria 4047
19 Ga0055543_1014579 3300004625 Bacteria 1530
20 Ga0055543_1031128 3300004625 Bacteria 931
21 Ga0065165_1003252 3300005262 Bacteria 11764
22 Ga0065165_1045488 3300005262 Bacteria 1278
23 Ga0070658_10269128 3300005327 Bacteria 1449
24 Ga0070658_10290974 3300005327 Bacteria 1392
25 Ga0070658_10724403 3300005327 Bacteria 864
26 Ga0070676_10110009 3300005328 Bacteria 1714
27 Ga0070676_10281542 3300005328 Bacteria 1121
28 Ga0070683_100027061 3300005329 Bacteria 5169
29 Ga0070683_100138895 3300005329 Bacteria 2302
30 Ga0070683_100231044 3300005329 Bacteria 1758
31 Ga0070683_100232105 3300005329 Bacteria 1754
32 Ga0070683_100552737 3300005329 Bacteria 1101
33 Ga0070670_100311659 3300005331 Bacteria 1378
34 Ga0068869_100169996 3300005334 Bacteria 1702
35 Ga0068869_100497135 3300005334 Bacteria 1018
36 Ga0070666_10483489 3300005335 Bacteria 897
37 Ga0070680_100064005 3300005336 Bacteria 3014
38 Ga0070680_100271460 3300005336 Bacteria 1436
39 Ga0070680_100385533 3300005336 Bacteria 1194
40 Ga0070682_100651278 3300005337 Bacteria 839
41 Ga0068868_100101422 3300005338 Bacteria 2329
42 Ga0070660_100078251 3300005339 Bacteria 2593
43 Ga0070660_100270633 3300005339 Bacteria 1388
44 Ga0070689_100854221 3300005340 Bacteria 803
45 Ga0070691_10055625 3300005341 Bacteria 1896
46 Ga0070661_100240955 3300005344 Bacteria 1393
47 Ga0070668_100143978 3300005347 Bacteria 1923
48 Ga0070668_100183723 3300005347 Bacteria 1709
49 Ga0070668_100270021 3300005347 Bacteria 1417
50 Ga0070675_100191849 3300005354 Bacteria 1771
51 Ga0070671_100570463 3300005355 Bacteria 977
52 Ga0070688_100206954 3300005365 Bacteria 1376
53 Ga0070688_100377636 3300005365 Bacteria 1044
54 Ga0070659_100119271 3300005366 Bacteria 2135
55 Ga0070667_100112801 3300005367 Bacteria 2358
56 Ga0070667_100166124 3300005367 Bacteria 1947
57 Ga0070667_100299974 3300005367 Bacteria 1446
58 Ga0070703_10120268 3300005406 Bacteria 952
59 Ga0070709_10005705 3300005434 Bacteria 6751
60 Ga0070709_10010069 3300005434 Bacteria 5225
61 Ga0070709_10019609 3300005434 Bacteria 3912
62 Ga0070709_10068994 3300005434 Bacteria 2275
63 Ga0070709_10170714 3300005434 Bacteria 1519
64 Ga0070714_100037560 3300005435 Bacteria 4070
65 Ga0070714_100046348 3300005435 Bacteria 3688
66 Ga0070714_100057181 3300005435 Bacteria 3337
67 Ga0070714_100134760 3300005435 Bacteria 2211
68 Ga0070714_100196604 3300005435 Bacteria 1843
69 Ga0070714_100202282 3300005435 Bacteria 1817
70 Ga0070714_100272495 3300005435 Bacteria 1570
71 Ga0070714_100293469 3300005435 Bacteria 1514
72 Ga0070714_100417929 3300005435 Bacteria 1270
73 Ga0070714_100863884 3300005435 Bacteria 878
74 Ga0070713_100004677 3300005436 Bacteria 9240
75 Ga0070713_100005417 3300005436 Bacteria 8716
76 Ga0070713_100058128 3300005436 Bacteria 3224
77 Ga0070713_100073758 3300005436 Bacteria 2890
78 Ga0070713_100085786 3300005436 Bacteria 2698
79 Ga0070713_100340016 3300005436 Bacteria 1390
80 Ga0070710_10002398 3300005437 Bacteria 8871
81 Ga0070710_10010404 3300005437 Bacteria 4570
82 Ga0070710_10466156 3300005437 Bacteria 859
83 Ga0070711_100004055 3300005439 Bacteria 8612
84 Ga0070711_100022948 3300005439 Bacteria 4051
85 Ga0070711_100029370 3300005439 Bacteria 3627
86 Ga0070711_100253007 3300005439 Bacteria 1383
87 Ga0070700_100058073 3300005441 Bacteria 2429
88 Ga0070694_100497595 3300005444 Bacteria 969
89 Ga0070708_100094717 3300005445 Bacteria 2724
90 Ga0070663_100061894 3300005455 Bacteria 2697
91 Ga0070663_100110883 3300005455 Bacteria 2061
92 Ga0070663_100124997 3300005455 Bacteria 1948
93 Ga0070663_100131703 3300005455 Bacteria 1900
94 Ga0070663_100199904 3300005455 Bacteria 1559
95 Ga0070663_100201024 3300005455 Bacteria 1555
96 Ga0070678_100004745 3300005456 Bacteria 7749
97 Ga0070678_100049918 3300005456 Bacteria 3022
98 Ga0070678_100058533 3300005456 Bacteria 2828
99 Ga0070678_100326168 3300005456 Bacteria 1312
100 Ga0070662_100354046 3300005457 Bacteria 1203
101 Ga0070662_100509484 3300005457 Bacteria 1004
102 Ga0070681_10106354 3300005458 Bacteria 2747
103 Ga0070681_10154946 3300005458 Bacteria 2216
104 Ga0070681_10174097 3300005458 Bacteria 2074
105 Ga0070681_10191774 3300005458 Bacteria 1963
106 Ga0070681_10291231 3300005458 Bacteria 1543
107 Ga0068867_100223826 3300005459 Bacteria 1517
108 Ga0068867_100426455 3300005459 Bacteria 1125
109 Ga0070707_100950178 3300005468 Bacteria 824
110 Ga0070698_100117254 3300005471 Bacteria 2625
111 Ga0070698_100465334 3300005471 Bacteria 1200
112 Ga0070699_100194289 3300005518 Bacteria 1803
113 Ga0070679_100009107 3300005530 Bacteria 9367
114 Ga0070679_100018046 3300005530 Bacteria 6839
115 Ga0070679_100061391 3300005530 Bacteria 3746
116 Ga0070684_100002381 3300005535 Bacteria 13855
117 Ga0070684_100019269 3300005535 Bacteria 5641
118 Ga0070697_100000384 3300005536 Bacteria 34537
119 Ga0068853_100008031 3300005539 Bacteria 8464
120 Ga0068853_100043449 3300005539 Bacteria 3844
121 Ga0068853_100131164 3300005539 Bacteria 2243
122 Ga0068853_100160177 3300005539 Bacteria 2030
123 Ga0068853_100230163 3300005539 Bacteria 1695
124 Ga0068853_100294048 3300005539 Bacteria 1500
125 Ga0070672_100059107 3300005543 Bacteria 3015
126 Ga0070672_100169209 3300005543 Bacteria 1816
127 Ga0070672_100210649 3300005543 Bacteria 1628
128 Ga0070672_101194447 3300005543 Bacteria 677
129 Ga0070693_100188144 3300005547 Bacteria 1334
130 Ga0070665_100008983 3300005548 Bacteria 10124
131 Ga0070665_100009227 3300005548 Bacteria 9995
132 Ga0070665_100029464 3300005548 Bacteria 5525
133 Ga0070665_100032495 3300005548 Bacteria 5252
134 Ga0070665_100120727 3300005548 Bacteria 2622
135 Ga0070665_100136332 3300005548 Bacteria 2457
136 Ga0070665_100205831 3300005548 Bacteria 1968
137 Ga0070665_100273272 3300005548 Bacteria 1692
138 Ga0068855_100005308 3300005563 Bacteria 15738
139 Ga0068855_100006278 3300005563 Bacteria 14485
140 Ga0068855_100050315 3300005563 Bacteria 4911
141 Ga0068855_100124785 3300005563 Bacteria 2944
142 Ga0068855_100256893 3300005563 Bacteria 1948
143 Ga0068855_100561714 3300005563 Bacteria 1234
144 Ga0068855_100581282 3300005563 Bacteria 1210
145 Ga0070664_100177934 3300005564 Bacteria 1889
146 Ga0070664_100255596 3300005564 Bacteria 1576
147 Ga0068857_100014818 3300005577 Bacteria 6800
148 Ga0068857_100053478 3300005577 Bacteria 3582
149 Ga0068857_100062088 3300005577 Bacteria 3321
150 Ga0068857_100170413 3300005577 Bacteria 1978
151 Ga0068857_100216970 3300005577 Bacteria 1747
152 Ga0068854_100024638 3300005578 Bacteria 4122
153 Ga0068854_100123948 3300005578 Bacteria 1965
154 Ga0068854_100328821 3300005578 Bacteria 1245
155 Ga0068854_100462700 3300005578 Bacteria 1061
156 Ga0068856_100002141 3300005614 Bacteria 20471
157 Ga0068856_100085937 3300005614 Bacteria 3125
158 Ga0068856_100122345 3300005614 Bacteria 2604
159 Ga0068856_100125076 3300005614 Bacteria 2574
160 Ga0068856_100199610 3300005614 Bacteria 2015
161 Ga0068856_100371752 3300005614 Bacteria 1448
162 Ga0068852_100290760 3300005616 Bacteria 1578
163 Ga0068852_100739384 3300005616 Bacteria 995
164 Ga0068852_100863893 3300005616 Bacteria 921
165 Ga0068859_100142745 3300005617 Bacteria 2468
166 Ga0068859_100201571 3300005617 Bacteria 2074
167 Ga0068859_100268483 3300005617 Bacteria 1798
168 Ga0068859_100687638 3300005617 Bacteria 1114
169 Ga0068864_100101958 3300005618 Bacteria 2546
170 Ga0068861_100027676 3300005719 Bacteria 4132
171 Ga0068851_10001857 3300005834 Bacteria 9268
172 Ga0068870_10243328 3300005840 Bacteria 1112
173 Ga0068863_100082299 3300005841 Bacteria 3050
174 Ga0068863_100087604 3300005841 Bacteria 2950
175 Ga0068863_100174377 3300005841 Bacteria 2063
176 Ga0068858_100006904 3300005842 Bacteria 11036
177 Ga0068858_100011239 3300005842 Bacteria 8459
178 Ga0068858_100053134 3300005842 Bacteria 3748
179 Ga0068858_100130519 3300005842 Bacteria 2356
180 Ga0068858_100528846 3300005842 Bacteria 1141
181 Ga0068858_100873429 3300005842 Bacteria 879
182 Ga0068860_100001883 3300005843 Bacteria 22289
183 Ga0068860_100028726 3300005843 Bacteria 5353
184 Ga0068860_100142004 3300005843 Bacteria 2308
185 Ga0068860_100570854 3300005843 Bacteria 1135
186 Ga0068860_100574963 3300005843 Bacteria 1130
187 Ga0068862_100074257 3300005844 Bacteria 2939
188 Ga0068862_100103057 3300005844 Bacteria 2498
189 Ga0068862_100513237 3300005844 Bacteria 1139
190 Ga0068862_100922915 3300005844 Bacteria 859
191 Ga0068862_101038629 3300005844 Bacteria 812
192 Ga0081455_10006143 3300005937 Bacteria 12966
193 Ga0081455_10034784 3300005937 Bacteria 4511
194 Ga0081455_10236759 3300005937 Bacteria 1344
195 Ga0081538_10034120 3300005981 Bacteria 3370
196 Ga0081540_1002324 3300005983 Bacteria 15586
197 Ga0081540_1004136 3300005983 Bacteria 11192
198 Ga0081540_1004563 3300005983 Bacteria 10497
199 Ga0081540_1004863 3300005983 Bacteria 10124
200 Ga0081540_1006598 3300005983 Bacteria 8422
201 Ga0081540_1013141 3300005983 Bacteria 5403
202 Ga0081540_1031304 3300005983 Bacteria 2928
203 Ga0081540_1039534 3300005983 Bacteria 2472
204 Ga0081539_10000099 3300005985 Bacteria 201018
205 Ga0081539_10001705 3300005985 Bacteria 35436
206 Ga0081539_10199589 3300005985 Bacteria 925
207 Ga0081539_10226934 3300005985 Bacteria 846
208 Ga0081539_10231448 3300005985 Bacteria 834
209 Ga0070717_10000884 3300006028 Bacteria 19823
210 Ga0070717_10014958 3300006028 Bacteria 5976
211 Ga0070717_10891292 3300006028 Bacteria 810
212 Ga0075365_10010380 3300006038 Bacteria 5420
213 Ga0075365_10020780 3300006038 Bacteria 4078
214 Ga0075365_10021853 3300006038 Bacteria 3997
215 Ga0075365_10107629 3300006038 Bacteria 1914
216 Ga0075365_10155709 3300006038 Bacteria 1590
217 Ga0075365_10164297 3300006038 Bacteria 1548
218 Ga0075365_10269534 3300006038 Bacteria 1197
219 Ga0075365_10373371 3300006038 Bacteria 1006
220 Ga0075368_10027704 3300006042 Bacteria 2187
221 Ga0075368_10044846 3300006042 Bacteria 1746
222 Ga0075368_10052860 3300006042 Bacteria 1616
223 Ga0075363_100076653 3300006048 Bacteria 1823
224 Ga0075363_100107756 3300006048 Bacteria 1546
225 Ga0075363_100127931 3300006048 Bacteria 1423
226 Ga0075363_100206646 3300006048 Bacteria 1123
227 Ga0075363_100254574 3300006048 Bacteria 1012
228 Ga0075364_10006886 3300006051 Bacteria 6710
229 Ga0075364_10034616 3300006051 Bacteria 3260
230 Ga0070715_10000981 3300006163 Bacteria 7973
231 Ga0070716_100013712 3300006173 Bacteria 4136
232 Ga0070716_100022257 3300006173 Bacteria 3347
233 Ga0070716_100075243 3300006173 Bacteria 1997
234 Ga0070712_100015975 3300006175 Bacteria 4841
235 Ga0070712_100051147 3300006175 Bacteria 2878
236 Ga0070712_100323610 3300006175 Bacteria 1254
237 Ga0070712_100367303 3300006175 Bacteria 1182
238 Ga0070712_100609691 3300006175 Bacteria 925
239 Ga0075367_10058549 3300006178 Bacteria 2293
240 Ga0075367_10068670 3300006178 Bacteria 2126
241 Ga0075367_10152099 3300006178 Bacteria 1436
242 Ga0075369_10070615 3300006186 Bacteria 1536
243 Ga0075369_10170053 3300006186 Bacteria 1000
244 Ga0075366_10034226 3300006195 Bacteria 2992
245 Ga0075366_10440476 3300006195 Bacteria 803
246 Ga0075370_10023753 3300006353 Bacteria 3380
247 Ga0075370_10027637 3300006353 Bacteria 3149
248 Ga0075370_10070899 3300006353 Bacteria 1993
249 Ga0075370_10180316 3300006353 Bacteria 1243
250 Ga0075428_100973603 3300006844 Bacteria 898
251 Ga0075434_100091893 3300006871 Bacteria 3037
252 Ga0075434_100139408 3300006871 Bacteria 2444
253 Ga0075434_101054065 3300006871 Bacteria 827
254 Ga0068865_100107511 3300006881 Bacteria 2052
255 Ga0068865_100203413 3300006881 Bacteria 1538
256 Ga0068865_100398507 3300006881 Bacteria 1127
257 Ga0097620_100142741 3300006931 Bacteria 2468
258 Ga0097620_100201574 3300006931 Bacteria 2074
259 Ga0097620_100268470 3300006931 Bacteria 1798
260 Ga0097620_100687750 3300006931 Bacteria 1114
261 Ga0099825_1029936 3300006941 Bacteria 2467
262 Ga0099824_1007272 3300006942 Bacteria 14768
263 Ga0099824_1025823 3300006942 Bacteria 3144
264 Ga0099823_1053108 3300006944 Bacteria 2389
265 Ga0075435_100208200 3300007076 Bacteria 1658
266 Ga0099794_10007534 3300007265 Bacteria 4477
267 Ga0099794_10022139 3300007265 Bacteria 2895
268 Ga0099795_10056429 3300007788 Bacteria 1445
269 Ga0105251_10307119 3300009011 Bacteria 720
270 Ga0105240_10003625 3300009093 Bacteria 23906
271 Ga0105240_10050592 3300009093 Bacteria 5237
272 Ga0105240_10144227 3300009093 Bacteria 2843
273 Ga0105240_10366710 3300009093 Bacteria 1630
274 Ga0105240_10516600 3300009093 Bacteria 1326
275 Ga0105240_10794077 3300009093 Bacteria 1026
276 Ga0105240_11473144 3300009093 Bacteria 714
277 Ga0111539_10124690 3300009094 Bacteria 3018
278 Ga0111539_11525139 3300009094 Bacteria 775
279 Ga0105245_10082095 3300009098 Bacteria 2948
280 Ga0105245_10100337 3300009098 Bacteria 2678
281 Ga0105245_10391376 3300009098 Bacteria 1387
282 Ga0105245_10421320 3300009098 Bacteria 1338
283 Ga0105245_10647120 3300009098 Bacteria 1087
284 Ga0105247_10157856 3300009101 Bacteria 1499
285 Ga0114129_11043253 3300009147 Bacteria 1027
286 Ga0105243_10038231 3300009148 Bacteria 3737
287 Ga0105243_10091595 3300009148 Bacteria 2504
288 Ga0105243_10569401 3300009148 Bacteria 1085
289 Ga0105243_10783742 3300009148 Bacteria 938
290 Ga0105241_10009272 3300009174 Bacteria 7238
291 Ga0105241_10090159 3300009174 Bacteria 2417
292 Ga0105241_10211991 3300009174 Bacteria 1623
293 Ga0105242_10350202 3300009176 Bacteria 1364
294 Ga0105242_10539767 3300009176 Bacteria 1116
295 Ga0105242_11424160 3300009176 Bacteria 721
296 Ga0105248_10370733 3300009177 Bacteria 1612
297 Ga0105248_10509363 3300009177 Bacteria 1357
298 Ga0105237_10003462 3300009545 Bacteria 18731
299 Ga0105237_10042625 3300009545 Bacteria 4575
300 Ga0105237_10045814 3300009545 Bacteria 4400
301 Ga0105237_10050449 3300009545 Bacteria 4181
302 Ga0105237_10072304 3300009545 Bacteria 3443
303 Ga0105237_10124677 3300009545 Bacteria 2570
304 Ga0105237_10172003 3300009545 Bacteria 2166
305 Ga0105237_10201580 3300009545 Bacteria 1990
306 Ga0105237_10264373 3300009545 Bacteria 1723
307 Ga0105237_10301265 3300009545 Bacteria 1606
308 Ga0105237_10452715 3300009545 Bacteria 1290
309 Ga0105237_10457440 3300009545 Bacteria 1282
310 Ga0105238_10001064 3300009551 Bacteria 27700
311 Ga0105238_10137768 3300009551 Bacteria 2418
312 Ga0105238_10309576 3300009551 Bacteria 1564
313 Ga0105238_10584823 3300009551 Bacteria 1123
314 Ga0105238_10920252 3300009551 Bacteria 893
315 Ga0105238_11142676 3300009551 Bacteria 802
316 Ga0105249_10152529 3300009553 Bacteria 2226
317 Ga0099796_10120195 3300010159 Bacteria 1009
318 Ga0099796_10161464 3300010159 Bacteria 888
319 Ga0105239_10000803 3300010375 Bacteria 44420
320 Ga0105239_10111666 3300010375 Bacteria 3030
321 Ga0105239_10384597 3300010375 Bacteria 1587
322 Ga0105239_10445585 3300010375 Bacteria 1468
323 Ga0105246_10224084 3300011119 Bacteria 1476
324 Ga0105246_10376963 3300011119 Bacteria 1171
325 Ga0157370_10013095 3300013104 Bacteria 8561
326 Ga0157370_10076076 3300013104 Bacteria 3163
327 Ga0157370_10083255 3300013104 Bacteria 3008
328 Ga0157370_10271608 3300013104 Bacteria 1566
329 Ga0157370_10525986 3300013104 Bacteria 1085
330 Ga0157369_10007934 3300013105 Bacteria 12206
331 Ga0157369_10029605 3300013105 Bacteria 6049
332 Ga0157369_10057734 3300013105 Bacteria 4186
333 Ga0157369_10157648 3300013105 Bacteria 2397
334 Ga0157369_10469589 3300013105 Bacteria 1302
335 Ga0157369_10496482 3300013105 Bacteria 1263
336 Ga0157369_10727424 3300013105 Bacteria 1021
337 Ga0157374_10201543 3300013296 Bacteria 1949
338 Ga0157378_10030034 3300013297 Bacteria 4801
339 Ga0157378_10567482 3300013297 Bacteria 1142
340 Ga0163162_10074838 3300013306 Bacteria 3446
341 Ga0157372_10018081 3300013307 Bacteria 7577
342 Ga0157372_10641591 3300013307 Bacteria 1237
343 Ga0157375_10035212 3300013308 Bacteria 4777
344 Ga0157375_10225225 3300013308 Bacteria 2034
345 Ga0157375_10293727 3300013308 Bacteria 1788
346 Ga0157375_10775583 3300013308 Bacteria 1109
347 Ga0163163_10011193 3300014325 Bacteria 8126
348 Ga0163163_10160241 3300014325 Bacteria 2295
349 Ga0157380_10128687 3300014326 Bacteria 2157
350 Ga0182008_10278514 3300014497 Bacteria 870
351 Ga0182008_10295830 3300014497 Bacteria 846
352 Ga0157377_10028713 3300014745 Bacteria 2996
353 Ga0157377_10518676 3300014745 Bacteria 836
354 Ga0157377_10716721 3300014745 Bacteria 728
355 Ga0157379_10090668 3300014968 Bacteria 2742
356 Ga0157379_10112770 3300014968 Bacteria 2444
357 Ga0157379_10211047 3300014968 Bacteria 1758
358 Ga0157376_10076201 3300014969 Bacteria 2865
359 Ga0214544_1000005 3300021320 Bacteria 387675
360 Ga0214544_1030440 3300021320 Bacteria 1877
361 Ga0214542_1000004 3300021321 Bacteria 415597
362 Ga0214542_1032430 3300021321 Bacteria 1848
363 Ga0214542_1033369 3300021321 Bacteria 1740
364 Ga0214545_1000005 3300021324 Bacteria 415590
365 Ga0214545_1028880 3300021324 Bacteria 2583
366 Ga0214543_1000030 3300021327 Bacteria 210137
367 Ga0213873_10023567 3300021358 Bacteria 1468
368 Ga0213876_10005771 3300021384 Bacteria 6779
369 Ga0213876_10051827 3300021384 Bacteria 2169
370 Ga0213871_10015751 3300021441 Bacteria 1812
371 Ga0209563_104596 3300025230 Bacteria 2617
372 Ga0207425_1029117 3300025245 Bacteria 1115
373 Ga0209677_100180 3300025253 Bacteria 53251
374 Ga0209677_105813 3300025253 Bacteria 3106
375 Ga0209148_1000801 3300025254 Bacteria 23021
376 Ga0209148_1020749 3300025254 Bacteria 1077
377 Ga0209233_1001773 3300025261 Bacteria 8322
378 Ga0209233_1019150 3300025261 Bacteria 1825
379 Ga0209233_1019779 3300025261 Bacteria 1781
380 Ga0209455_1013794 3300025272 Bacteria 1860
381 Ga0209455_1018576 3300025272 Bacteria 1425
382 Ga0209673_1028696 3300025273 Bacteria 1785
383 Ga0209564_1001232 3300025295 Bacteria 28872
384 Ga0209758_1000102 3300025297 Bacteria 224851
385 Ga0209758_1000631 3300025297 Bacteria 53996
386 Ga0209758_1000703 3300025297 Bacteria 49647
387 Ga0209758_1000761 3300025297 Bacteria 46617
388 Ga0209758_1001792 3300025297 Bacteria 23713
389 Ga0209758_1002441 3300025297 Bacteria 18971
390 Ga0209758_1055416 3300025297 Bacteria 1346
391 Ga0209256_1016058 3300025299 Bacteria 2577
392 Ga0209256_1044827 3300025299 Bacteria 1102
393 Ga0207426_1000354 3300025302 Bacteria 83734
394 Ga0207426_1003127 3300025302 Bacteria 9434
395 Ga0209257_1003566 3300025304 Bacteria 13196
396 Ga0209257_1072583 3300025304 Bacteria 903
397 Ga0207697_10070067 3300025315 Bacteria 1468
398 Ga0207656_10094099 3300025321 Bacteria 1364
399 Ga0207682_10054713 3300025893 Bacteria 1659
400 Ga0207692_10021622 3300025898 Bacteria 2947
401 Ga0207692_10028244 3300025898 Bacteria 2651
402 Ga0207692_10590426 3300025898 Bacteria 713
403 Ga0207642_10329358 3300025899 Bacteria 894
404 Ga0207688_10206315 3300025901 Bacteria 1180
405 Ga0207680_10162186 3300025903 Bacteria 1500
406 Ga0207647_10018549 3300025904 Bacteria 4702
407 Ga0207699_10001383 3300025906 Bacteria 11543
408 Ga0207699_10017637 3300025906 Bacteria 3764
409 Ga0207699_10028712 3300025906 Bacteria 3095
410 Ga0207699_10054224 3300025906 Bacteria 2381
411 Ga0207699_10113627 3300025906 Bacteria 1740
412 Ga0207699_10413491 3300025906 Bacteria 962
413 Ga0207645_10148193 3300025907 Bacteria 1531
414 Ga0207643_10391875 3300025908 Bacteria 877
415 Ga0207705_10039045 3300025909 Bacteria 3402
416 Ga0207705_10091269 3300025909 Bacteria 2231
417 Ga0207705_10165761 3300025909 Bacteria 1661
418 Ga0207684_10233443 3300025910 Bacteria 1587
419 Ga0207654_10001104 3300025911 Bacteria 14608
420 Ga0207654_10011477 3300025911 Bacteria 4522
421 Ga0207654_10155179 3300025911 Bacteria 1474
422 Ga0207654_10288678 3300025911 Bacteria 1112
423 Ga0207707_10005313 3300025912 Bacteria 11255
424 Ga0207707_10011326 3300025912 Bacteria 7764
425 Ga0207707_10154891 3300025912 Bacteria 2004
426 Ga0207707_10203938 3300025912 Bacteria 1724
427 Ga0207707_10372090 3300025912 Bacteria 1229
428 Ga0207695_10000006 3300025913 Bacteria 1135309
429 Ga0207695_10003805 3300025913 Bacteria 20923
430 Ga0207695_10104719 3300025913 Bacteria 2817
431 Ga0207695_10561481 3300025913 Bacteria 1023
432 Ga0207695_10739888 3300025913 Bacteria 864
433 Ga0207671_10005375 3300025914 Bacteria 11833
434 Ga0207671_10036148 3300025914 Bacteria 3662
435 Ga0207671_10096861 3300025914 Bacteria 2230
436 Ga0207671_10129560 3300025914 Bacteria 1935
437 Ga0207671_10175234 3300025914 Bacteria 1667
438 Ga0207671_10458153 3300025914 Bacteria 1016
439 Ga0207671_10515255 3300025914 Bacteria 954
440 Ga0207671_10744592 3300025914 Bacteria 778
441 Ga0207693_10012138 3300025915 Bacteria 6961
442 Ga0207693_10021423 3300025915 Bacteria 5136
443 Ga0207693_10037531 3300025915 Bacteria 3819
444 Ga0207693_10156630 3300025915 Bacteria 1792
445 Ga0207693_10177459 3300025915 Bacteria 1676
446 Ga0207663_10000457 3300025916 Bacteria 17764
447 Ga0207663_10022469 3300025916 Bacteria 3605
448 Ga0207663_10125596 3300025916 Bacteria 1764
449 Ga0207663_10256602 3300025916 Bacteria 1289
450 Ga0207660_10007858 3300025917 Bacteria 6903
451 Ga0207660_10009400 3300025917 Bacteria 6327
452 Ga0207660_10025528 3300025917 Bacteria 4011
453 Ga0207660_10162970 3300025917 Bacteria 1722
454 Ga0207662_10060766 3300025918 Bacteria 2267
455 Ga0207657_10002620 3300025919 Bacteria 19429
456 Ga0207657_10201178 3300025919 Bacteria 1602
457 Ga0207657_10729981 3300025919 Bacteria 768
458 Ga0207649_10104448 3300025920 Bacteria 1881
459 Ga0207649_10728059 3300025920 Bacteria 771
460 Ga0207652_10023832 3300025921 Bacteria 5074
461 Ga0207652_10031328 3300025921 Bacteria 4466
462 Ga0207652_10052312 3300025921 Bacteria 3504
463 Ga0207646_10452087 3300025922 Bacteria 1159
464 Ga0207681_10115128 3300025923 Bacteria 1963
465 Ga0207681_10804120 3300025923 Bacteria 785
466 Ga0207694_10000273 3300025924 Bacteria 49024
467 Ga0207694_10287115 3300025924 Bacteria 1352
468 Ga0207694_10606884 3300025924 Bacteria 920
469 Ga0207650_10122673 3300025925 Bacteria 2025
470 Ga0207650_10294479 3300025925 Bacteria 1324
471 Ga0207659_10159984 3300025926 Bacteria 1767
472 Ga0207687_10069286 3300025927 Bacteria 2515
473 Ga0207687_10355900 3300025927 Bacteria 1194
474 Ga0207687_10386868 3300025927 Bacteria 1147
475 Ga0207700_10010929 3300025928 Bacteria 5762
476 Ga0207700_10023057 3300025928 Bacteria 4283
477 Ga0207700_10054679 3300025928 Bacteria 2998
478 Ga0207700_10161634 3300025928 Bacteria 1860
479 Ga0207700_10372342 3300025928 Bacteria 1247
480 Ga0207700_10380261 3300025928 Bacteria 1235
481 Ga0207700_10882728 3300025928 Bacteria 800
482 Ga0207700_11045318 3300025928 Bacteria 730
483 Ga0207664_10024427 3300025929 Bacteria 4542
484 Ga0207664_10049207 3300025929 Bacteria 3318
485 Ga0207664_10064666 3300025929 Bacteria 2927
486 Ga0207664_10172067 3300025929 Bacteria 1854
487 Ga0207664_10181056 3300025929 Bacteria 1809
488 Ga0207664_10411184 3300025929 Bacteria 1204
489 Ga0207664_10485259 3300025929 Bacteria 1106
490 Ga0207664_10551290 3300025929 Bacteria 1034
491 Ga0207664_10981246 3300025929 Bacteria 757
492 Ga0207644_10377075 3300025931 Bacteria 1156
493 Ga0207690_10336410 3300025932 Bacteria 1190
494 Ga0207690_10583981 3300025932 Bacteria 911
495 Ga0207706_10116359 3300025933 Bacteria 2351
496 Ga0207706_10231929 3300025933 Bacteria 1615
497 Ga0207706_10268969 3300025933 Bacteria 1487
498 Ga0207709_10070825 3300025935 Bacteria 2212
499 Ga0207709_10582526 3300025935 Bacteria 884
500 Ga0207670_10208517 3300025936 Bacteria 1489
501 Ga0207670_10290114 3300025936 Bacteria 1278
502 Ga0207670_10738510 3300025936 Bacteria 817
503 Ga0207669_10150018 3300025937 Bacteria 1631
504 Ga0207669_10213607 3300025937 Bacteria 1410
505 Ga0207704_10067161 3300025938 Bacteria 2254
506 Ga0207704_10391085 3300025938 Bacteria 1094
507 Ga0207704_10651791 3300025938 Bacteria 867
508 Ga0207665_10000127 3300025939 Bacteria 50413
509 Ga0207665_10009558 3300025939 Bacteria 6369
510 Ga0207665_10015452 3300025939 Bacteria 5011
511 Ga0207691_10397250 3300025940 Bacteria 1176
512 Ga0207711_11047908 3300025941 Bacteria 756
513 Ga0207661_10013783 3300025944 Bacteria 5906
514 Ga0207661_10021726 3300025944 Bacteria 4814
515 Ga0207661_10171311 3300025944 Bacteria 1890
516 Ga0207661_10324103 3300025944 Bacteria 1385
517 Ga0207661_10765705 3300025944 Bacteria 889
518 Ga0207679_10282626 3300025945 Bacteria 1424
519 Ga0207667_10005930 3300025949 Bacteria 14876
520 Ga0207667_10095234 3300025949 Bacteria 3074
521 Ga0207667_10155541 3300025949 Bacteria 2353
522 Ga0207667_10181792 3300025949 Bacteria 2159
523 Ga0207667_10243490 3300025949 Bacteria 1840
524 Ga0207667_10355690 3300025949 Bacteria 1493
525 Ga0207667_10481357 3300025949 Bacteria 1260
526 Ga0207667_10508646 3300025949 Bacteria 1221
527 Ga0207712_10585344 3300025961 Bacteria 964
528 Ga0207668_10013352 3300025972 Bacteria 5054
529 Ga0207668_10140455 3300025972 Bacteria 1856
530 Ga0207668_10357438 3300025972 Bacteria 1223
531 Ga0207668_10414015 3300025972 Bacteria 1142
532 Ga0207640_10105929 3300025981 Bacteria 1982
533 Ga0207640_11050843 3300025981 Bacteria 718
534 Ga0207658_10014650 3300025986 Bacteria 5371
535 Ga0207677_10088985 3300026023 Bacteria 2240
536 Ga0207677_10278711 3300026023 Bacteria 1371
537 Ga0207703_10084544 3300026035 Bacteria 2653
538 Ga0207703_10095065 3300026035 Bacteria 2513
539 Ga0207703_10457491 3300026035 Bacteria 1193
540 Ga0207703_10806071 3300026035 Bacteria 896
541 Ga0207639_10038757 3300026041 Bacteria 3547
542 Ga0207639_10069559 3300026041 Bacteria 2747
543 Ga0207639_10178257 3300026041 Bacteria 1805
544 Ga0207639_10185177 3300026041 Bacteria 1774
545 Ga0207639_10359501 3300026041 Bacteria 1302
546 Ga0207678_10016165 3300026067 Bacteria 6552
547 Ga0207678_10018540 3300026067 Bacteria 6111
548 Ga0207678_10022726 3300026067 Bacteria 5492
549 Ga0207678_10093897 3300026067 Bacteria 2563
550 Ga0207678_10146729 3300026067 Bacteria 2014
551 Ga0207678_10209849 3300026067 Bacteria 1666
552 Ga0207678_10225178 3300026067 Bacteria 1605
553 Ga0207678_10234829 3300026067 Bacteria 1570
554 Ga0207678_10502819 3300026067 Bacteria 1057
555 Ga0207702_10000003 3300026078 Bacteria 434196
556 Ga0207702_10000325 3300026078 Bacteria 54690
557 Ga0207702_10057553 3300026078 Bacteria 3304
558 Ga0207702_10147332 3300026078 Bacteria 2138
559 Ga0207702_10284541 3300026078 Bacteria 1564
560 Ga0207702_10374371 3300026078 Bacteria 1368
561 Ga0207641_10102577 3300026088 Bacteria 2523
562 Ga0207641_10199393 3300026088 Bacteria 1844
563 Ga0207641_10358382 3300026088 Bacteria 1392
564 Ga0207648_10389276 3300026089 Bacteria 1261
565 Ga0207676_10141774 3300026095 Bacteria 2058
566 Ga0207676_10400559 3300026095 Bacteria 1282
567 Ga0207674_10017609 3300026116 Bacteria 7793
568 Ga0207674_10017929 3300026116 Bacteria 7716
569 Ga0207674_10030154 3300026116 Bacteria 5705
570 Ga0207674_10108612 3300026116 Bacteria 2751
571 Ga0207674_10166376 3300026116 Bacteria 2159
572 Ga0207674_10175414 3300026116 Bacteria 2096
573 Ga0207674_10666689 3300026116 Bacteria 1004
574 Ga0207675_100072306 3300026118 Bacteria 3226
575 Ga0207675_100113589 3300026118 Bacteria 2557
576 Ga0207675_100232992 3300026118 Bacteria 1777
577 Ga0207683_10061897 3300026121 Bacteria 3295
578 Ga0207683_10148831 3300026121 Bacteria 2112
579 Ga0207683_10152190 3300026121 Bacteria 2088
580 Ga0207683_11016254 3300026121 Bacteria 769
581 Ga0207698_10051678 3300026142 Bacteria 3144
582 Ga0207698_10536012 3300026142 Bacteria 1145
583 Ga0209389_1000924 3300027296 Bacteria 19203
584 Ga0209389_1000951 3300027296 Bacteria 19062
585 Ga0209589_1000005 3300027357 Bacteria 530958
586 Ga0209589_1003240 3300027357 Bacteria 28538
587 Ga0209489_100005 3300027361 Bacteria 530958
588 Ga0209489_102828 3300027361 Bacteria 34702
589 Ga0209489_115384 3300027361 Bacteria 4720
590 Ga0209700_100006 3300027363 Bacteria 530958
591 Ga0209700_100483 3300027363 Bacteria 74857
592 Ga0209588_1001041 3300027671 Bacteria 7136
593 Ga0268266_10001580 3300028379 Bacteria 26592
594 Ga0268266_10004157 3300028379 Bacteria 13958
595 Ga0268266_10012768 3300028379 Bacteria 7258
596 Ga0268266_10034039 3300028379 Bacteria 4331
597 Ga0268266_10043998 3300028379 Bacteria 3817
598 Ga0268266_10249225 3300028379 Bacteria 1642
599 Ga0268266_10637240 3300028379 Bacteria 1025
600 Ga0268266_10678661 3300028379 Bacteria 992
601 Ga0268266_10866761 3300028379 Bacteria 873
602 Ga0268265_10218323 3300028380 Bacteria 1666
603 Ga0268265_10359470 3300028380 Bacteria 1332
604 Ga0268265_11123285 3300028380 Bacteria 781
605 Ga0268265_11270556 3300028380 Bacteria 735
606 Ga0268264_10000174 3300028381 Bacteria 137254
607 Ga0268264_10154530 3300028381 Bacteria 2061
608 Ga0268264_10250828 3300028381 Bacteria 1644
609 Ga0268264_10406720 3300028381 Bacteria 1309
610 Ga0265337_1022171 3300028556 Bacteria 1970
611 Ga0265322_10086893 3300028654 Bacteria 888
612 Ga0265336_10002309 3300028666 Bacteria 7954
613 Ga0307517_10000124 3300028786 Bacteria 115570
614 Ga0307515_10036628 3300028794 Bacteria 7928
615 Ga0307515_10581716 3300028794 Bacteria 730
616 Ga0265338_10002710 3300028800 Bacteria 25984
617 Ga0265338_10225100 3300028800 Bacteria 1399
618 Ga0265324_10008015 3300029957 Bacteria 4232
619 Ga0307511_10057673 3300030521 Bacteria 3014
620 Ga0265330_10005554 3300031235 Bacteria 6284
621 Ga0265330_10071648 3300031235 Bacteria 1499
622 Ga0265330_10082084 3300031235 Bacteria 1388
623 Ga0265332_10029066 3300031238 Bacteria 2417
624 Ga0265332_10037876 3300031238 Bacteria 2091
625 Ga0265332_10241633 3300031238 Bacteria 747
626 Ga0265328_10031734 3300031239 Bacteria 1963
627 Ga0265325_10137153 3300031241 Bacteria 1166
628 Ga0265340_10000891 3300031247 Bacteria 16923
629 Ga0265340_10014481 3300031247 Bacteria 4117
630 Ga0265339_10008471 3300031249 Bacteria 6544
631 Ga0265339_10032933 3300031249 Bacteria 2922
632 Ga0265316_10086587 3300031344 Bacteria 2395
633 Ga0265316_10418583 3300031344 Bacteria 963
634 Ga0307513_10110997 3300031456 Bacteria 2736
635 Ga0307513_10287426 3300031456 Bacteria 1418
636 Ga0307509_10140310 3300031507 Bacteria 2353
637 Ga0307509_10226763 3300031507 Bacteria 1675
638 Ga0307408_100312511 3300031548 Bacteria 1321
639 Ga0307408_100504084 3300031548 Bacteria 1060
640 Ga0265313_10076154 3300031595 Bacteria 1534
641 Ga0307508_10072848 3300031616 Bacteria 3010
642 Ga0307508_10191813 3300031616 Bacteria 1644
643 Ga0307508_10195726 3300031616 Bacteria 1622
644 Ga0265314_10001980 3300031711 Bacteria 21759
645 Ga0265314_10056351 3300031711 Bacteria 2706
646 Ga0265314_10075066 3300031711 Bacteria 2250
647 Ga0265342_10014362 3300031712 Bacteria 5259
648 Ga0265342_10097360 3300031712 Bacteria 1680
649 Ga0265342_10119726 3300031712 Bacteria 1483
650 Ga0316578_10036456 3300031728 Bacteria 2830
651 Ga0307516_10000457 3300031730 Bacteria 54103
652 Ga0307516_10020328 3300031730 Bacteria 6859
653 Ga0307516_10036865 3300031730 Bacteria 4891
654 Ga0307516_10215446 3300031730 Bacteria 1632
655 Ga0307405_10239112 3300031731 Bacteria 1344
656 Ga0307405_10582021 3300031731 Bacteria 911
657 Ga0307413_10094071 3300031824 Bacteria 1961
658 Ga0307410_10515160 3300031852 Bacteria 986
659 Ga0307406_10106324 3300031901 Bacteria 1922
660 Ga0307412_10148574 3300031911 Bacteria 1726
661 Ga0307412_10345907 3300031911 Bacteria 1192
662 Ga0307412_10416580 3300031911 Bacteria 1098
663 Ga0307409_100840123 3300031995 Bacteria 928
664 Ga0307416_100468374 3300032002 Bacteria 1317
665 Ga0307411_10344227 3300032005 Bacteria 1213
666 Ga0316583_10117265 3300032133 Bacteria 928
667 Ga0307507_10049280 3300033179 Bacteria 4084
668 Ga0307510_10004801 3300033180 Bacteria 15994
669 Ga0307510_10017344 3300033180 Bacteria 8494
670 Ga0307510_10024151 3300033180 Bacteria 7029
671 Ga0307510_10041115 3300033180 Bacteria 5062
672 Ga0307510_10101487 3300033180 Bacteria 2665
673 Ga0315911_1000041 3300033442 Bacteria 50391
674 Ga0316215_1001284 3300033544 Bacteria 2424
675 Ga0373959_0072081 3300034820 Bacteria 783
676 Ga0373934_0074619 3300035086 Bacteria 1359
677 Ga0373944_0052997 3300035089 Bacteria 1283
678 Ga0373949_0036411 3300035090 Bacteria 1194
679 Ga0373923_0020170 3300035111 Bacteria 2586
680 Ga0373923_0025394 3300035111 Bacteria 2348
681 Ga0373936_0006369 3300035113 Bacteria 4447
682 Ga0373936_0013694 3300035113 Bacteria 3094
683 Ga0373936_0046144 3300035113 Bacteria 1756
684 Ga0373953_0000483 3300035117 Bacteria 11042
685 Ga0373954_0000152 3300035118 Bacteria 24549
686 Ga0373954_0002572 3300035118 Bacteria 7625
687 Ga0373954_0027857 3300035118 Bacteria 2595
688 Ga0373954_0237926 3300035118 Bacteria 896
689 Ga0373956_0043185 3300035119 Bacteria 2006
690 Ga0373957_0006488 3300035120 Bacteria 3688
691 Ga0373957_0048025 3300035120 Bacteria 1625
692 Ga0373943_0004910 3300035170 Bacteria 6043
693 Ga0373943_0075584 3300035170 Bacteria 1716
694 Ga0373946_0006110 3300035171 Bacteria 4361
695 Ga0373955_0000721 3300035172 Bacteria 14158
696 Ga0373955_0285689 3300035172 Bacteria 993
697 Ga0373942_0173649 3300035207 Bacteria 703
698 Ga0316574_0010592 3300035398 Bacteria 5215
699 Ga0373924_0167416 3300035410 Bacteria 965
700 Ga0373935_0002202 3300035692 Bacteria 11074
701 Ga0373935_0051609 3300035692 Bacteria 2612
702 Ga0373935_0085752 3300035692 Bacteria 2054
703 Ga0373935_0122358 3300035692 Bacteria 1740
704 Ga0373935_0206506 3300035692 Bacteria 1360
705 Ga0373927_0001742 3300035695 Bacteria 16248
706 Ga0373927_0005149 3300035695 Bacteria 9045
707 Ga0373927_0023426 3300035695 Bacteria 4043
708 Ga0373933_0000348 3300035724 Bacteria 29489
709 Ga0373933_0004671 3300035724 Bacteria 7502
710 Ga0373947_0012585 3300035725 Bacteria 4850
711 Ga0373947_0063579 3300035725 Bacteria 2248
712 Ga0373947_0144655 3300035725 Bacteria 1527
713 Ga0373937_0059759 3300036401 Bacteria 3503
714 Ga0373937_0079504 3300036401 Bacteria 3030
715 Ga0373937_0170595 3300036401 Bacteria 2041
716 Ga0373937_0381055 3300036401 Bacteria 1337
717 Ga0373937_0557781 3300036401 Bacteria 1088
718 Ga0372808_012610 3300036459 Bacteria 1201
719 Ga0316584_0015310 3300036712 Bacteria 5483
720 Ga0373925_0016402 3300037068 Bacteria 5366
721 Ga0373925_0271167 3300037068 Bacteria 1365
722 Ga0373925_0910845 3300037068 Bacteria 724
723 Ga0395899_0045984 3300037312 Bacteria 3251
724 Ga0395899_0182906 3300037312 Bacteria 1470
725 Ga0395900_0146874 3300037418 Bacteria 2411
726 Ga0395900_0224268 3300037418 Bacteria 1893
727 Ga0395900_0327796 3300037418 Bacteria 1510
728 Ga0395900_0333605 3300037418 Bacteria 1494
729 Ga0395900_0344296 3300037418 Bacteria 1465
730 Ga0395900_0839362 3300037418 Bacteria 845
731 Ga0395898_0009973 3300037466 Bacteria 9949
732 Ga0395898_0043826 3300037466 Bacteria 4408
733 Ga0395898_0058881 3300037466 Bacteria 3739
734 Ga0395898_0518929 3300037466 Bacteria 1133
735 Ga0395905_0079594 3300037471 Bacteria 3072
736 Ga0395905_0098751 3300037471 Bacteria 2742
737 Ga0395905_0168012 3300037471 Bacteria 2061
738 Ga0395901_0036728 3300038443 Bacteria 5064
739 Ga0395901_0230420 3300038443 Bacteria 1934
740 Ga0395901_0296402 3300038443 Bacteria 1677
741 Ga0395901_0496746 3300038443 Bacteria 1242
742 Ga0395901_0882950 3300038443 Bacteria 877
743 Ga0436365_0472724 3300039437 Bacteria 822
744 Ga0436365_0694949 3300039437 Bacteria 8262
745 Ga0436365_0838471 3300039437 Bacteria 2463
746 Ga0436365_1683641 3300039437 Bacteria 2186
747 Ga0436365_1911415 3300039437 Bacteria 829
748 Ga0436360_0605391 3300039438 Bacteria 14680
749 Ga0436361_0018023 3300039447 Bacteria 1730
750 Ga0436361_0576498 3300039447 Bacteria 3174
751 Ga0436361_1036455 3300039447 Bacteria 1128
752 Ga0436363_0060836 3300039450 Bacteria 1132
753 Ga0436363_0165204 3300039450 Bacteria 3230
754 Ga0436363_0194287 3300039450 Bacteria 4449
755 Ga0436362_0418961 3300039453 Bacteria 5346
756 Ga0436362_0974814 3300039453 Bacteria 1491
757 Ga0436362_1114012 3300039453 Bacteria 996
758 Ga0436362_1195541 3300039453 Bacteria 700
759 Ga0451791_0175252 3300041451 Bacteria 1146
760 Ga0451793_1106130 3300041452 Bacteria 1060
761 Ga0451793_1469486 3300041452 Bacteria 1094
762 Ga0451802_0621294 3300041460 Bacteria 1332
763 Ga0439445_0109374 3300042004 Bacteria 788
764 Ga0450894_037402 3300042131 Bacteria 691
765 Ga0439440_0091747 3300042993 Bacteria 816
766 Ga0466969_0195415 3300044656 Bacteria 924
767 Ga0466972_0006422 3300044658 Bacteria 5905
768 Ga0466972_0011224 3300044658 Bacteria 4496
769 Ga0466972_0292348 3300044658 Bacteria 761
770 Ga0466965_0112501 3300044683 Bacteria 1400
771 Ga0466966_0001733 3300044684 Bacteria 14105
772 Ga0466966_0103448 3300044684 Bacteria 1760
773 Ga0466966_0589695 3300044684 Bacteria 669
774 Ga0466961_0000009 3300044693 Bacteria 139001
775 Ga0466961_0210915 3300044693 Bacteria 1199
776 Ga0466963_0029623 3300044694 Bacteria 3525
777 Ga0466963_0041407 3300044694 Bacteria 3021
778 Ga0466968_0041819 3300044735 Bacteria 1936
779 Ga0466968_0051956 3300044735 Bacteria 1752
780 Ga0466968_0176754 3300044735 Bacteria 991
781 Ga0466970_0225572 3300044765 Bacteria 1046
782 Ga0466970_0225722 3300044765 Bacteria 1046
783 Ga0466970_0411950 3300044765 Bacteria 772
784 Ga0466970_0431591 3300044765 Bacteria 754
785 Ga0466957_0167912 3300044842 Bacteria 1428
786 Ga0466957_0473827 3300044842 Bacteria 865
787 Ga0466960_0068614 3300044901 Bacteria 1759
788 Ga0466960_0207382 3300044901 Bacteria 1073
789 Ga0466960_0364477 3300044901 Bacteria 827
790 Ga0466959_0003063 3300045049 Bacteria 10820
791 Ga0466959_0013181 3300045049 Bacteria 5989
792 Ga0466959_0093544 3300045049 Bacteria 2157
793 Ga0466967_0041953 3300045976 Bacteria 3950
794 Ga0466967_0048933 3300045976 Bacteria 3695
795 Ga0466967_0088096 3300045976 Bacteria 2816
796 Ga0466967_0382777 3300045976 Bacteria 1366
797 Ga0466967_0980112 3300045976 Bacteria 841
798 Ga0495617_038545 3300046452 Bacteria 1598
799 Ga0495617_044045 3300046452 Bacteria 1490
800 Ga0495592_0000784 3300046454 Bacteria 22015
801 Ga0495592_0013597 3300046454 Bacteria 6192
802 Ga0495592_0050838 3300046454 Bacteria 3079
803 Ga0495592_0463846 3300046454 Bacteria 792
804 Ga0495603_0002122 3300046455 Bacteria 11662
805 Ga0495603_0006942 3300046455 Bacteria 6792
806 Ga0495603_0019891 3300046455 Bacteria 4066
807 Ga0495603_0037990 3300046455 Bacteria 2889
808 Ga0495603_0132281 3300046455 Bacteria 1452
809 Ga0495603_0169109 3300046455 Bacteria 1266
810 Ga0495603_0362620 3300046455 Bacteria 831
811 Ga0495629_0002089 3300046459 Bacteria 15494
812 Ga0495629_0004413 3300046459 Bacteria 10539
813 Ga0495629_0009291 3300046459 Bacteria 7193
814 Ga0495629_0346538 3300046459 Bacteria 1014
815 Ga0495629_0373522 3300046459 Bacteria 971
816 Ga0495629_0404528 3300046459 Bacteria 927
817 Ga0495629_0512386 3300046459 Bacteria 808
818 Ga0495638_0012347 3300046460 Bacteria 5857
819 Ga0495638_0082490 3300046460 Bacteria 1950
820 Ga0495641_0033338 3300046461 Bacteria 2445
821 Ga0495651_0002043 3300046462 Bacteria 15601
822 Ga0495651_0008079 3300046462 Bacteria 8069
823 Ga0495651_0141888 3300046462 Bacteria 1741
824 Ga0495651_0172894 3300046462 Bacteria 1536
825 Ga0495651_0202893 3300046462 Bacteria 1386
826 Ga0495651_0309672 3300046462 Bacteria 1056
827 Ga0495653_0010673 3300046463 Bacteria 7521
828 Ga0495653_0040516 3300046463 Bacteria 3640
829 Ga0495653_0041285 3300046463 Bacteria 3601
830 Ga0495653_0110670 3300046463 Bacteria 1974
831 Ga0495650_0055441 3300046471 Bacteria 1613
832 Ga0495580_0016592 3300046472 Bacteria 5523
833 Ga0495580_0165569 3300046472 Bacteria 1529
834 Ga0495582_0000331 3300046473 Bacteria 25765
835 Ga0495605_0123052 3300046474 Bacteria 1175
836 Ga0495639_0000147 3300046475 Bacteria 36171
837 Ga0495639_0100913 3300046475 Bacteria 1362
838 Ga0495662_0252973 3300046476 Bacteria 868
839 Ga0495662_0267445 3300046476 Bacteria 841
840 Ga0495664_0011748 3300046477 Bacteria 4944
841 Ga0495664_0039262 3300046477 Bacteria 2797
842 Ga0495664_0061377 3300046477 Bacteria 2238
843 Ga0495664_0080416 3300046477 Bacteria 1953
844 Ga0495664_0383961 3300046477 Bacteria 844
845 Ga0495584_0052285 3300046491 Bacteria 2056
846 Ga0495585_0060847 3300046492 Bacteria 2077
847 Ga0495594_0000113 3300046499 Bacteria 38231
848 Ga0495594_0270989 3300046499 Bacteria 967
849 Ga0495594_0409542 3300046499 Bacteria 771
850 Ga0495596_0016851 3300046500 Bacteria 3032
851 Ga0495583_0058686 3300046506 Bacteria 1727
852 Ga0495583_0071311 3300046506 Bacteria 1526
853 Ga0495606_0001165 3300046507 Bacteria 37175
854 Ga0495606_0055718 3300046507 Bacteria 2556
855 Ga0495608_0029134 3300046511 Bacteria 3748
856 Ga0495608_0191309 3300046511 Bacteria 1292
857 Ga0495610_0147420 3300046512 Bacteria 1007
858 Ga0495610_0205231 3300046512 Bacteria 804
859 Ga0495616_0065200 3300046513 Bacteria 1775
860 Ga0495616_0097979 3300046513 Bacteria 1379
861 Ga0495618_0003202 3300046514 Bacteria 10254
862 Ga0495628_0001092 3300046516 Bacteria 24748
863 Ga0495628_0055224 3300046516 Bacteria 3129
864 Ga0495628_0200683 3300046516 Bacteria 1503
865 Ga0495628_0423637 3300046516 Bacteria 970
866 Ga0495630_0010615 3300046517 Bacteria 6651
867 Ga0495630_0332641 3300046517 Bacteria 1162
868 Ga0495630_0499307 3300046517 Bacteria 933
869 Ga0495631_0033340 3300046518 Bacteria 2314
870 Ga0495631_0069634 3300046518 Bacteria 1521
871 Ga0495631_0091644 3300046518 Bacteria 1308
872 Ga0495631_0146816 3300046518 Bacteria 1012
873 Ga0495632_0209701 3300046519 Bacteria 884
874 Ga0495643_0053073 3300046522 Bacteria 2174
875 Ga0495643_0176355 3300046522 Bacteria 1041
876 Ga0495648_0000378 3300046524 Bacteria 48799
877 Ga0495648_0000776 3300046524 Bacteria 34006
878 Ga0495663_0045194 3300046525 Bacteria 1350
879 Ga0495666_0008723 3300046526 Bacteria 5078
880 Ga0495666_0230980 3300046526 Bacteria 846
881 Ga0495642_0181598 3300046528 Bacteria 916
882 Ga0495652_0014813 3300046529 Bacteria 6990
883 Ga0495652_0068865 3300046529 Bacteria 2963
884 Ga0495652_0082065 3300046529 Bacteria 2658
885 Ga0495652_0307290 3300046529 Bacteria 1150
886 Ga0495665_0092777 3300046531 Bacteria 1587
887 Ga0495640_0003705 3300046533 Bacteria 12278
888 Ga0495640_0012355 3300046533 Bacteria 6527
889 Ga0495640_0058844 3300046533 Bacteria 2619
890 Ga0495640_0086096 3300046533 Bacteria 2081
891 Ga0495640_0101679 3300046533 Bacteria 1886
892 Ga0495640_0484919 3300046533 Bacteria 753
893 Ga0495586_0096941 3300046535 Bacteria 1634
894 Ga0495587_0012965 3300046536 Bacteria 5240
895 Ga0495587_0121871 3300046536 Bacteria 1493
896 Ga0495598_0049035 3300046537 Bacteria 1264
897 Ga0495609_0020594 3300046538 Bacteria 3047
898 Ga0495621_0078346 3300046539 Bacteria 1228
899 Ga0495597_0154128 3300046542 Bacteria 941
900 Ga0495597_0162603 3300046542 Bacteria 910
901 Ga0495645_0006161 3300046543 Bacteria 8305
902 Ga0495645_0008674 3300046543 Bacteria 7101
903 Ga0495645_0027745 3300046543 Bacteria 4113
904 Ga0495645_0425029 3300046543 Bacteria 842
905 Ga0495622_0010529 3300046557 Bacteria 4270
906 Ga0495622_0023366 3300046557 Bacteria 2881
907 Ga0495622_0035738 3300046557 Bacteria 2316
908 Ga0495633_0058245 3300046558 Bacteria 1813
909 Ga0495633_0114930 3300046558 Bacteria 1247
910 Ga0495633_0190576 3300046558 Bacteria 943
911 Ga0495667_0000697 3300046559 Bacteria 21512
912 Ga0495667_0015284 3300046559 Bacteria 5184
913 Ga0495667_0044711 3300046559 Bacteria 2932
914 Ga0495667_0069130 3300046559 Bacteria 2305
915 Ga0495667_0104381 3300046559 Bacteria 1832
916 Ga0495656_0006145 3300046615 Bacteria 4195
917 Ga0495656_0099144 3300046615 Bacteria 1344
918 Ga0495668_0098885 3300046616 Bacteria 1596
919 Ga0495668_0136935 3300046616 Bacteria 1340
920 Ga0495668_0146190 3300046616 Bacteria 1294
921 Ga0495634_0023917 3300046642 Bacteria 4291
922 Ga0495634_0025373 3300046642 Bacteria 4148
923 Ga0495634_0052872 3300046642 Bacteria 2722
924 Ga0495634_0094506 3300046642 Bacteria 1937
925 Ga0495634_0306612 3300046642 Bacteria 959
926 Ga0495611_0030002 3300046648 Bacteria 2388
927 Ga0495625_0238953 3300046660 Bacteria 1183
928 Ga0495625_0364585 3300046660 Bacteria 910
929 Ga0495635_0000358 3300046663 Bacteria 29005
930 Ga0495635_0000491 3300046663 Bacteria 24925
931 Ga0495635_0205998 3300046663 Bacteria 1333
932 Ga0495635_0306901 3300046663 Bacteria 1063
933 Ga0495659_0059441 3300046664 Bacteria 1408
934 Ga0495661_0253887 3300046665 Bacteria 896
935 Ga0495588_0090749 3300046674 Bacteria 1600
936 Ga0495588_0178007 3300046674 Bacteria 1124
937 Ga0495657_0006263 3300046675 Bacteria 9325
938 Ga0495657_0033718 3300046675 Bacteria 3562
939 Ga0495657_0131208 3300046675 Bacteria 1569
940 Ga0495657_0194812 3300046675 Bacteria 1237
941 Ga0495599_0017171 3300046678 Bacteria 4497
942 Ga0495599_0144290 3300046678 Bacteria 1476
943 Ga0495623_0005004 3300046679 Bacteria 8695
944 Ga0495623_0006372 3300046679 Bacteria 7673
945 Ga0495623_0221525 3300046679 Bacteria 1077
946 Ga0495646_0008340 3300046680 Bacteria 6590
947 Ga0495646_0020670 3300046680 Bacteria 4165
948 Ga0495646_0118464 3300046680 Bacteria 1500
949 Ga0495646_0233557 3300046680 Bacteria 990
950 Ga0495647_0000705 3300046681 Bacteria 9979
951 Ga0495658_0002450 3300046683 Bacteria 9344
952 Ga0495669_0029433 3300046684 Bacteria 2408
953 Ga0495669_0030081 3300046684 Bacteria 2383
954 Ga0495669_0188547 3300046684 Bacteria 984
955 Ga0495669_0298050 3300046684 Bacteria 777
956 Ga0495613_0094685 3300046689 Bacteria 2161
957 Ga0495613_0139273 3300046689 Bacteria 1734
958 Ga0495613_0194751 3300046689 Bacteria 1431
959 Ga0495624_0003403 3300046690 Bacteria 11803
960 Ga0495624_0297235 3300046690 Bacteria 974
961 Ga0495624_0332322 3300046690 Bacteria 915
962 Ga0495670_0061889 3300046691 Bacteria 1882
963 Ga0495670_0099903 3300046691 Bacteria 1493
964 Ga0495671_0087042 3300046692 Bacteria 1530
965 Ga0495649_0322127 3300046694 Bacteria 784
966 Ga0495600_0007576 3300046809 Bacteria 6647
967 Ga0495600_0007900 3300046809 Bacteria 6519
968 Ga0495600_0014138 3300046809 Bacteria 5027
969 Ga0495600_0255328 3300046809 Bacteria 1114
970 Ga0495600_0268886 3300046809 Bacteria 1082
971 Ga0495600_0387963 3300046809 Bacteria 870
972 Ga0495581_0160458 3300047315 Bacteria 1314
973 Ga0495581_0169525 3300047315 Bacteria 1276
974 Ga0495581_0327151 3300047315 Bacteria 895
975 Ga0495604_0001200 3300047317 Bacteria 21400
976 Ga0495604_0022394 3300047317 Bacteria 5045
977 Ga0495636_0056609 3300047318 Bacteria 1651
978 Ga0495674_0001226 3300047319 Bacteria 24884
979 Ga0495674_0001231 3300047319 Bacteria 24836
980 Ga0495674_0033843 3300047319 Bacteria 4625
981 Ga0495674_0063283 3300047319 Bacteria 3218
982 Ga0495674_0512520 3300047319 Bacteria 958
983 Ga0495672_0000571 3300047320 Bacteria 41596
984 Ga0495672_0139516 3300047320 Bacteria 1267
985 Ga0495672_0204927 3300047320 Bacteria 984
986 Ga0495672_0270544 3300047320 Bacteria 816
987 Ga0495676_0186919 3300047321 Bacteria 1447
988 Ga0495676_0220355 3300047321 Bacteria 1308
989 Ga0495680_0001591 3300047322 Bacteria 24246
990 Ga0495680_0005953 3300047322 Bacteria 11405
991 Ga0495680_0238106 3300047322 Bacteria 1294
992 Ga0495683_0083987 3300047323 Bacteria 1550
993 Ga0495683_0253907 3300047323 Bacteria 770
994 Ga0495687_061617 3300047443 Bacteria 1542
995 Ga0495687_110765 3300047443 Bacteria 1010
996 Ga0495675_0002604 3300047444 Bacteria 10812
997 Ga0495675_0014401 3300047444 Bacteria 4997
998 Ga0495685_050343 3300047447 Bacteria 1414
999 Ga0495673_0004400 3300047469 Bacteria 8832
1000 Ga0495673_0103814 3300047469 Bacteria 1145
1001 Ga0495681_0166435 3300047470 Bacteria 915
1002 Ga0495681_0233991 3300047470 Bacteria 732
1003 Ga0495684_0000897 3300047471 Bacteria 24092
1004 Ga0495684_0113156 3300047471 Bacteria 2046
1005 Ga0495684_0270226 3300047471 Bacteria 1230
1006 Ga0495686_0054893 3300047472 Bacteria 2493
1007 Ga0495686_0084124 3300047472 Bacteria 1939
1008 Ga0495686_0283812 3300047472 Bacteria 919
1009 Ga0495593_0002080 3300047673 Bacteria 11960
1010 Ga0495593_0002499 3300047673 Bacteria 11060
1011 Ga0495593_0155042 3300047673 Bacteria 1158
1012 Ga0495593_0227767 3300047673 Bacteria 935
1013 Ga0495602_0000392 3300048088 Bacteria 40828
1014 Ga0495602_0012486 3300048088 Bacteria 8728
1015 Ga0495602_0147428 3300048088 Bacteria 1854
1016 Ga0495626_0095919 3300048091 Bacteria 1298
1017 Ga0495626_0124934 3300048091 Bacteria 1103
1018 Ga0496100_0018019 3300048903 Bacteria 4181
1019 Ga0496100_0117230 3300048903 Bacteria 1859
1020 Ga0496100_0152155 3300048903 Bacteria 1651
1021 Ga0496100_0869611 3300048903 Bacteria 707
1022 Ga0496101_0203527 3300048904 Bacteria 1531
1023 Ga0496101_0259375 3300048904 Bacteria 1355
1024 Ga0496102_0088198 3300048905 Bacteria 2867
1025 Ga0496102_0120647 3300048905 Bacteria 2448
1026 Ga0496102_0143930 3300048905 Bacteria 2236
1027 Ga0496102_0146704 3300048905 Bacteria 2215
1028 Ga0496102_0188546 3300048905 Bacteria 1943
1029 Ga0496102_0306964 3300048905 Bacteria 1495
1030 Ga0496102_0334916 3300048905 Bacteria 1425
1031 Ga0496103_0066119 3300048906 Bacteria 2256
1032 Ga0496103_0282495 3300048906 Bacteria 1067
1033 Ga0496104_0004695 3300048907 Bacteria 11899
1034 Ga0496104_0014830 3300048907 Bacteria 7043
1035 Ga0496104_0131260 3300048907 Bacteria 2406
1036 Ga0496104_0178064 3300048907 Bacteria 2036
1037 Ga0496104_0521360 3300048907 Bacteria 1099
1038 Ga0496105_0041160 3300048908 Bacteria 3808
1039 Ga0496105_0087843 3300048908 Bacteria 2568
1040 Ga0496105_0288219 3300048908 Bacteria 1322
1041 Ga0496105_0561925 3300048908 Bacteria 889
1042 Ga0496106_0001396 3300048909 Bacteria 18100
1043 Ga0496106_0007524 3300048909 Bacteria 8055
1044 Ga0496106_0010594 3300048909 Bacteria 6810
1045 Ga0496106_0013602 3300048909 Bacteria 6008
1046 Ga0496106_0019605 3300048909 Bacteria 5017
1047 Ga0496106_0047429 3300048909 Bacteria 3233
1048 Ga0496106_0203955 3300048909 Bacteria 1574
1049 Ga0496106_0356166 3300048909 Bacteria 1176
1050 Ga0496106_0478172 3300048909 Bacteria 1001
1051 Ga0496107_0002660 3300048910 Bacteria 11701
1052 Ga0496107_0054255 3300048910 Bacteria 2892
1053 Ga0496107_0202486 3300048910 Bacteria 1475
1054 Ga0496107_0256096 3300048910 Bacteria 1302
1055 Ga0496108_0002981 3300048911 Bacteria 13605
1056 Ga0496108_0042560 3300048911 Bacteria 3792
1057 Ga0496108_0055486 3300048911 Bacteria 3327
1058 Ga0496108_0120991 3300048911 Bacteria 2245
1059 Ga0496108_0131707 3300048911 Bacteria 2149
1060 Ga0496108_0244352 3300048911 Bacteria 1561
1061 Ga0496108_0326356 3300048911 Bacteria 1338
1062 Ga0496108_0455741 3300048911 Bacteria 1117
1063 Ga0496109_0000680 3300048912 Bacteria 28264
1064 Ga0496109_0015312 3300048912 Bacteria 6680
1065 Ga0496109_0064596 3300048912 Bacteria 3349
1066 Ga0496109_0072998 3300048912 Bacteria 3153
1067 Ga0496109_0099641 3300048912 Bacteria 2695
1068 Ga0496109_0308605 3300048912 Bacteria 1492
1069 Ga0496109_0337662 3300048912 Bacteria 1423
1070 Ga0496109_0567663 3300048912 Bacteria 1070
1071 Ga0496110_0011018 3300048913 Bacteria 7379
1072 Ga0496110_0035574 3300048913 Bacteria 4321
1073 Ga0496110_0206475 3300048913 Bacteria 1785
1074 Ga0496111_0026885 3300048914 Bacteria 4066
1075 Ga0496111_0030432 3300048914 Bacteria 3838
1076 Ga0496111_0038904 3300048914 Bacteria 3408
1077 Ga0496111_0193417 3300048914 Bacteria 1512
1078 Ga0496111_0218506 3300048914 Bacteria 1416
1079 Ga0496112_0000092 3300048915 Bacteria 58800
1080 Ga0496112_0012339 3300048915 Bacteria 7850
1081 Ga0496112_0012489 3300048915 Bacteria 7805
1082 Ga0496112_0029751 3300048915 Bacteria 5284
1083 Ga0496112_0048156 3300048915 Bacteria 4180
1084 Ga0496112_0089828 3300048915 Bacteria 3040
1085 Ga0496112_0211298 3300048915 Bacteria 1897
1086 Ga0496112_0340943 3300048915 Bacteria 1442
1087 Ga0496112_0383866 3300048915 Bacteria 1346
1088 Ga0496113_0031665 3300048916 Bacteria 3840
1089 Ga0496113_0032428 3300048916 Bacteria 3797
1090 Ga0496113_0081632 3300048916 Bacteria 2478
1091 Ga0496113_0084790 3300048916 Bacteria 2433
1092 Ga0496113_0140703 3300048916 Bacteria 1898
1093 Ga0496113_0273297 3300048916 Bacteria 1351
1094 Ga0496113_0473859 3300048916 Bacteria 1006
1095 Ga0496114_0061159 3300048917 Bacteria 3149
1096 Ga0496114_0196222 3300048917 Bacteria 1767
1097 Ga0496114_0271091 3300048917 Bacteria 1495
1098 Ga0496114_0304370 3300048917 Bacteria 1408
1099 Ga0496114_0578896 3300048917 Bacteria 991
1100 Ga0496115_0002197 3300048918 Bacteria 13964
1101 Ga0496115_0021622 3300048918 Bacteria 4972
1102 Ga0496115_0026754 3300048918 Bacteria 4506
1103 Ga0496115_0059260 3300048918 Bacteria 3083
1104 Ga0496115_0099283 3300048918 Bacteria 2385
1105 Ga0496115_0171019 3300048918 Bacteria 1797
1106 Ga0496115_0174534 3300048918 Bacteria 1777
1107 Ga0496115_0201925 3300048918 Bacteria 1642
1108 Ga0496115_0273669 3300048918 Bacteria 1387
1109 Ga0496116_0004921 3300048919 Bacteria 12589
1110 Ga0496116_0084957 3300048919 Bacteria 1947
1111 Ga0496117_0038158 3300048920 Bacteria 3568
1112 Ga0496117_0067871 3300048920 Bacteria 2410
1113 Ga0496117_0109453 3300048920 Bacteria 1725
1114 Ga0496117_0133701 3300048920 Bacteria 1498
1115 Ga0496117_0366414 3300048920 Bacteria 738
1116 Ga0496118_0013106 3300048921 Bacteria 7877
1117 Ga0496118_0023964 3300048921 Bacteria 5283
1118 Ga0496118_0177977 3300048921 Bacteria 1289
1119 Ga0496118_0198522 3300048921 Bacteria 1191
1120 Ga0496119_0012182 3300048922 Bacteria 7016
1121 Ga0496119_0018807 3300048922 Bacteria 5120
1122 Ga0496119_0026413 3300048922 Bacteria 4027
1123 Ga0496119_0197846 3300048922 Bacteria 1042
1124 Ga0496120_0081147 3300048923 Bacteria 1756
1125 Ga0496120_0089965 3300048923 Bacteria 1642
1126 Ga0496120_0149529 3300048923 Bacteria 1175
1127 Ga0496121_0001057 3300048924 Bacteria 48772
1128 Ga0496121_0002390 3300048924 Bacteria 28777
1129 Ga0496121_0005210 3300048924 Bacteria 16843
1130 Ga0496121_0007663 3300048924 Bacteria 12964
1131 Ga0496121_0009900 3300048924 Bacteria 10854
1132 Ga0496121_0027990 3300048924 Bacteria 5259
1133 Ga0496121_0033930 3300048924 Bacteria 4605
1134 Ga0496121_0062971 3300048924 Bacteria 3035
1135 Ga0496121_0067770 3300048924 Bacteria 2891
1136 Ga0496121_0103444 3300048924 Bacteria 2191
1137 Ga0496121_0153540 3300048924 Bacteria 1691
1138 Ga0496121_0155324 3300048924 Bacteria 1679
1139 Ga0496121_0157772 3300048924 Bacteria 1663
1140 Ga0496121_0162864 3300048924 Bacteria 1629
1141 Ga0496121_0175878 3300048924 Bacteria 1549
1142 Ga0496121_0205528 3300048924 Bacteria 1399
1143 Ga0496121_0224413 3300048924 Bacteria 1321
1144 Ga0496121_0358432 3300048924 Bacteria 969
1145 Ga0496122_0116850 3300048925 Bacteria 1733
1146 Ga0496122_0180775 3300048925 Bacteria 1258
1147 Ga0496123_0202642 3300048926 Bacteria 1015
1148 Ga0496123_0293152 3300048926 Bacteria 780
1149 Ga0496124_0063109 3300048927 Bacteria 3097
1150 Ga0496124_0126216 3300048927 Bacteria 2038
1151 Ga0496124_0138905 3300048927 Bacteria 1920
1152 Ga0496124_0156141 3300048927 Bacteria 1784
1153 Ga0496124_0222828 3300048927 Bacteria 1417
1154 Ga0496124_0310814 3300048927 Bacteria 1133
1155 Ga0496125_0000237 3300048928 Bacteria 113322
1156 Ga0496125_0004959 3300048928 Bacteria 15051
1157 Ga0496125_0007927 3300048928 Bacteria 11213
1158 Ga0496125_0067041 3300048928 Bacteria 2831
1159 Ga0496125_0106267 3300048928 Bacteria 2049
1160 Ga0496125_0122572 3300048928 Bacteria 1850
1161 Ga0496125_0306968 3300048928 Bacteria 969
1162 Ga0496126_0001827 3300048929 Bacteria 31077
1163 Ga0496126_0007564 3300048929 Bacteria 11879
1164 Ga0496126_0009154 3300048929 Bacteria 10570
1165 Ga0496126_0011078 3300048929 Bacteria 9371
1166 Ga0496126_0012721 3300048929 Bacteria 8607
1167 Ga0496126_0020967 3300048929 Bacteria 6396
1168 Ga0496126_0046372 3300048929 Bacteria 3986
1169 Ga0496126_0054701 3300048929 Bacteria 3613
1170 Ga0496126_0056206 3300048929 Bacteria 3558
1171 Ga0496126_0078367 3300048929 Bacteria 2928
1172 Ga0496126_0083738 3300048929 Bacteria 2814
1173 Ga0496126_0085832 3300048929 Bacteria 2774
1174 Ga0496126_0144235 3300048929 Bacteria 2047
1175 Ga0496126_0168557 3300048929 Bacteria 1867
1176 Ga0496126_0230604 3300048929 Bacteria 1551
1177 Ga0496126_0253975 3300048929 Bacteria 1464
1178 Ga0496126_0261833 3300048929 Bacteria 1438
1179 Ga0496126_0372119 3300048929 Bacteria 1165
1180 Ga0496126_0482964 3300048929 Bacteria 992
1181 Ga0496126_0503732 3300048929 Bacteria 967
1182 Ga0496126_0805188 3300048929 Bacteria 720
1183 Ga0495678_147606 3300049459 Bacteria 763
1184 Ga0495682_0036048 3300049460 Bacteria 1821
1185 Ga0495682_0042883 3300049460 Bacteria 1657
1186 Ga0501031_0006062 3300049568 Bacteria 7895
1187 Ga0501031_0013983 3300049568 Bacteria 5226
1188 Ga0501031_0020408 3300049568 Bacteria 4318
1189 Ga0501032_0001501 3300049569 Bacteria 18648
1190 Ga0501032_0124903 3300049569 Bacteria 1700
1191 Ga0501032_0359983 3300049569 Bacteria 937
1192 Ga0501033_0000394 3300049570 Bacteria 42043
1193 Ga0501033_0000639 3300049570 Bacteria 32342
1194 Ga0501033_0016652 3300049570 Bacteria 5560
1195 Ga0501033_0090615 3300049570 Bacteria 2237
1196 Ga0501033_0100323 3300049570 Bacteria 2113
1197 Ga0501034_0000157 3300049571 Bacteria 128661
1198 Ga0501034_0068248 3300049571 Bacteria 3566
1199 Ga0501034_0123784 3300049571 Bacteria 2571
1200 Ga0501034_0173679 3300049571 Bacteria 2121
1201 Ga0501034_0270338 3300049571 Bacteria 1641
1202 Ga0501034_0311051 3300049571 Bacteria 1510
1203 Ga0501034_0495753 3300049571 Bacteria 1135
1204 Ga0501036_0000440 3300049572 Bacteria 29582
1205 Ga0501036_0032056 3300049572 Bacteria 4439
1206 Ga0501036_0058423 3300049572 Bacteria 3267
1207 Ga0501036_0089001 3300049572 Bacteria 2608
1208 Ga0501036_0197573 3300049572 Bacteria 1692
1209 Ga0501036_0208537 3300049572 Bacteria 1642
1210 Ga0501036_0242185 3300049572 Bacteria 1512
1211 Ga0501036_0521308 3300049572 Bacteria 988
1212 Ga0501036_0810480 3300049572 Bacteria 771
1213 Ga0501037_0000969 3300049573 Bacteria 21316
1214 Ga0501037_0001723 3300049573 Bacteria 15886
1215 Ga0501037_0049834 3300049573 Bacteria 3066
1216 Ga0501037_0057203 3300049573 Bacteria 2847
1217 Ga0501037_0234287 3300049573 Bacteria 1288
1218 Ga0501038_0000473 3300049574 Bacteria 35337
1219 Ga0501038_0010530 3300049574 Bacteria 8458
1220 Ga0501038_0034189 3300049574 Bacteria 4472
1221 Ga0501038_0037503 3300049574 Bacteria 4249
1222 Ga0501038_0096218 3300049574 Bacteria 2472
1223 Ga0501038_0112741 3300049574 Bacteria 2251
1224 Ga0501038_0143120 3300049574 Bacteria 1954
1225 Ga0501038_0238474 3300049574 Bacteria 1444
1226 Ga0501038_0643035 3300049574 Bacteria 799
1227 Ga0501039_0002012 3300049575 Bacteria 15036
1228 Ga0501039_0006007 3300049575 Bacteria 9208
1229 Ga0501039_0109240 3300049575 Bacteria 2162
1230 Ga0501039_0123997 3300049575 Bacteria 2025
1231 Ga0501040_0244174 3300049576 Bacteria 1280
1232 Ga0501040_0256419 3300049576 Bacteria 1248
1233 Ga0501041_0069312 3300049577 Bacteria 2163
1234 Ga0501042_0065242 3300049578 Bacteria 2602
1235 Ga0501042_0080850 3300049578 Bacteria 2328
1236 Ga0501043_0002014 3300049579 Bacteria 17357
1237 Ga0501043_0003168 3300049579 Bacteria 13612
1238 Ga0501043_0016557 3300049579 Bacteria 5779
1239 Ga0501043_0051045 3300049579 Bacteria 3251
1240 Ga0501043_0071243 3300049579 Bacteria 2730
1241 Ga0501043_0110503 3300049579 Bacteria 2158
1242 Ga0501043_0121514 3300049579 Bacteria 2048
1243 Ga0501043_0151668 3300049579 Bacteria 1813
1244 Ga0501043_0153968 3300049579 Bacteria 1798
1245 Ga0501043_0398883 3300049579 Bacteria 1040
1246 Ga0501046_0026559 3300049580 Bacteria 4728
1247 Ga0501046_0043974 3300049580 Bacteria 3554
1248 Ga0501046_0054587 3300049580 Bacteria 3142
1249 Ga0501046_0062722 3300049580 Bacteria 2903
1250 Ga0501046_0122020 3300049580 Bacteria 1982
1251 Ga0501047_0000419 3300049581 Bacteria 47535
1252 Ga0501047_0052635 3300049581 Bacteria 3935
1253 Ga0501047_0274357 3300049581 Bacteria 1532
1254 Ga0501047_0375785 3300049581 Bacteria 1256
1255 Ga0501047_0388877 3300049581 Bacteria 1228
1256 Ga0501047_0502243 3300049581 Bacteria 1039
1257 Ga0501048_0000057 3300049582 Bacteria 56138
1258 Ga0501048_0099098 3300049582 Bacteria 2056
1259 Ga0501048_0556373 3300049582 Bacteria 823
1260 Ga0501067_0000507 3300049583 Bacteria 21269
1261 Ga0501067_0023557 3300049583 Bacteria 3412
1262 Ga0501067_0154639 3300049583 Bacteria 1278
1263 Ga0501067_0176722 3300049583 Bacteria 1189
1264 Ga0501067_0195646 3300049583 Bacteria 1126
1265 Ga0501067_0389095 3300049583 Bacteria 777
1266 Ga0501068_0004195 3300049584 Bacteria 7818
1267 Ga0501068_0066490 3300049584 Bacteria 2196
1268 Ga0501068_0071854 3300049584 Bacteria 2112
1269 Ga0501069_0006517 3300049585 Bacteria 6102
1270 Ga0501069_0218198 3300049585 Bacteria 1108
1271 Ga0501070_0029682 3300049586 Bacteria 4582
1272 Ga0501070_0061196 3300049586 Bacteria 3119
1273 Ga0501070_0115060 3300049586 Bacteria 2222
1274 Ga0501070_0204862 3300049586 Bacteria 1620
1275 Ga0501070_0719349 3300049586 Bacteria 789
1276 Ga0501071_0056300 3300049587 Bacteria 2840
1277 Ga0501071_0083928 3300049587 Bacteria 2334
1278 Ga0501071_0166824 3300049587 Bacteria 1648
1279 Ga0501071_0281672 3300049587 Bacteria 1258
1280 Ga0501071_0641394 3300049587 Bacteria 817
1281 Ga0501072_0053425 3300049588 Bacteria 3181
1282 Ga0501072_0313805 3300049588 Bacteria 1246
1283 Ga0501073_0000027 3300049589 Bacteria 121860
1284 Ga0501073_0017325 3300049589 Bacteria 5217
1285 Ga0501073_0090860 3300049589 Bacteria 2122
1286 Ga0501073_0169705 3300049589 Bacteria 1510
1287 Ga0501073_0171015 3300049589 Bacteria 1504
1288 Ga0501073_0698533 3300049589 Bacteria 700
1289 Ga0501074_0000081 3300049590 Bacteria 46487
1290 Ga0501074_0374537 3300049590 Bacteria 1010
1291 Ga0501076_0078412 3300049592 Bacteria 2651
1292 Ga0501077_0077707 3300049593 Bacteria 2103
1293 Ga0501079_0068811 3300049741 Bacteria 2733
1294 Ga0501079_0080208 3300049741 Bacteria 2523
1295 Ga0501079_0082616 3300049741 Bacteria 2484
1296 Ga0501080_0000313 3300049742 Bacteria 37111
1297 Ga0501080_0025448 3300049742 Bacteria 5493
1298 Ga0501080_0316932 3300049742 Bacteria 1412
1299 Ga0501083_0062728 3300049744 Bacteria 2479
1300 Ga0501035_0000145 3300049822 Bacteria 86013
1301 Ga0501035_0002494 3300049822 Bacteria 17985
1302 Ga0501035_0043031 3300049822 Bacteria 4071
1303 Ga0501035_0045019 3300049822 Bacteria 3971
1304 Ga0501035_0145887 3300049822 Bacteria 2055
1305 Ga0501035_0159854 3300049822 Bacteria 1951
1306 Ga0501035_0169311 3300049822 Bacteria 1888
1307 Ga0501035_0175867 3300049822 Bacteria 1846
1308 Ga0501035_0521166 3300049822 Bacteria 976
1309 Ga0501035_0535663 3300049822 Bacteria 960
1310 Ga0501044_0002483 3300049823 Bacteria 21039
1311 Ga0501044_0016900 3300049823 Bacteria 7826
1312 Ga0501044_0017556 3300049823 Bacteria 7677
1313 Ga0501044_0028759 3300049823 Bacteria 5864
1314 Ga0501044_0037365 3300049823 Bacteria 5076
1315 Ga0501044_0047612 3300049823 Bacteria 4434
1316 Ga0501044_0070464 3300049823 Bacteria 3556
1317 Ga0501044_0086992 3300049823 Bacteria 3156
1318 Ga0501044_0316040 3300049823 Bacteria 1487
1319 Ga0501044_0715447 3300049823 Bacteria 886
1320 Ga0501045_0032630 3300049824 Bacteria 3774
1321 Ga0501045_0065645 3300049824 Bacteria 2664
1322 Ga0501045_0287662 3300049824 Bacteria 1223
1323 nmdc:mga03683_84769_c1 3300050489 Bacteria 1373
1324 nmdc:mga03n38_130777_c1 3300050490 Bacteria 1244
1325 nmdc:mga03n38_174286_c1 3300050490 Bacteria 1098
1326 nmdc:mga03n38_84922_c1 3300050490 Bacteria 1495
1327 nmdc:mga00v17_106208_c1 3300050491 Bacteria 1777
1328 nmdc:mga00v17_17072_c1 3300050491 Bacteria 4099
1329 nmdc:mga00v17_339804_c1 3300050491 Bacteria 976
1330 nmdc:mga00v17_535846_c1 3300050491 Bacteria 757
1331 nmdc:mga0yw44_131148_c1 3300050492 Bacteria 1623
1332 nmdc:mga0yw44_188824_c1 3300050492 Bacteria 1358
1333 nmdc:mga0yw44_50814_c1 3300050492 Bacteria 2508
1334 nmdc:mga0yw44_65741_c1 3300050492 Bacteria 2236
1335 nmdc:mga0yw44_76420_c1 3300050492 Bacteria 2090
1336 nmdc:mga0yw44_83502_c1 3300050492 Bacteria 2007
1337 nmdc:mga0k408_39324_c1 3300050493 Bacteria 2717
1338 nmdc:mga06z11_102090_c1 3300050494 Bacteria 1575
1339 nmdc:mga06z11_142812_c1 3300050494 Bacteria 1355
1340 nmdc:mga06z11_231002_c1 3300050494 Bacteria 1084
1341 nmdc:mga06z11_276815_c1 3300050494 Bacteria 993
1342 nmdc:mga06z11_30175_c1 3300050494 Bacteria 2621
1343 nmdc:mga06z11_4552_c1 3300050494 Bacteria 5463
1344 nmdc:mga06z11_51386_c1 3300050494 Bacteria 2110
1345 nmdc:mga04h51_27619_c1 3300050495 Bacteria 1764
1346 nmdc:mga07m45_102463_c1 3300050496 Bacteria 1644
1347 nmdc:mga07m45_26107_c1 3300050496 Bacteria 3208
1348 nmdc:mga07m45_43386_c1 3300050496 Bacteria 2521
1349 nmdc:mga07m45_76241_c1 3300050496 Bacteria 1912
1350 nmdc:mga05p37_787746_c1 3300050507 Bacteria 1042
1351 nmdc:mga0n895_92008_c1 3300050512 Bacteria 3036
1352 nmdc:mga0rr50_144537_c1 3300050513 Bacteria 1916
1353 nmdc:mga0a205_175450_c1 3300050515 Bacteria 2038
1354 nmdc:mga0sz30_23579_c1 3300050516 Bacteria 1397
1355 nmdc:mga0sz30_41151_c1 3300050516 Bacteria 1943
1356 nmdc:mga0sz30_89970_c1 3300050516 Bacteria 1335
1357 Ga0495601_0062758 3300053077 Bacteria 2360
1358 Ga0495612_0022880 3300053078 Bacteria 2505
1359 Ga0500610_0232167 3300053079 Bacteria 865
1360 Ga0500635_0002242 3300053080 Bacteria 4759
1361 Ga0500635_0002742 3300053080 Bacteria 4373
1362 Ga0500635_0048704 3300053080 Bacteria 1444
1363 Ga0500635_0096552 3300053080 Bacteria 1082
1364 Ga0495655_0043650 3300053083 Bacteria 1157
1365 Ga0495595_0015715 3300053084 Bacteria 3230
1366 Ga0495619_0000858 3300053085 Bacteria 19930
1367 Ga0495619_0157808 3300053085 Bacteria 1566
1368 Ga0500578_0088881 3300053086 Bacteria 1962
1369 Ga0500643_000016 3300053087 Bacteria 309502
1370 Ga0500643_069541 3300053087 Bacteria 978
1371 Ga0500647_0065379 3300053091 Bacteria 1749
1372 Ga0500583_0274754 3300053092 Bacteria 828
1373 Ga0500651_0026230 3300053093 Bacteria 3660
1374 Ga0500651_0061210 3300053093 Bacteria 2352
1375 Ga0500566_0000394 3300053094 Bacteria 24254
1376 Ga0500566_0000751 3300053094 Bacteria 18265
1377 Ga0500566_0015160 3300053094 Bacteria 4523
1378 Ga0500566_0030466 3300053094 Bacteria 3146
1379 Ga0500640_001550 3300053095 Bacteria 7061
1380 Ga0500641_0130716 3300053096 Bacteria 1083
1381 Ga0500650_0021151 3300053098 Bacteria 2862
1382 Ga0500554_010908 3300053102 Bacteria 2233
1383 Ga0500554_018859 3300053102 Bacteria 1870
1384 Ga0500555_005870 3300053103 Bacteria 3483
1385 Ga0500556_0000238 3300053104 Bacteria 44627
1386 Ga0500556_0002504 3300053104 Bacteria 5851
1387 Ga0500557_000018 3300053105 Bacteria 95477
1388 Ga0500557_029595 3300053105 Bacteria 1648
1389 Ga0500562_020364 3300053108 Bacteria 1722
1390 Ga0500569_002333 3300053109 Bacteria 3725
1391 Ga0500569_045967 3300053109 Bacteria 1299
1392 Ga0500569_072778 3300053109 Bacteria 1084
1393 Ga0500572_000156 3300053111 Bacteria 23706
1394 Ga0500572_002564 3300053111 Bacteria 4333
1395 Ga0500592_002853 3300053116 Bacteria 2779
1396 Ga0500594_0035745 3300053118 Bacteria 1334
1397 Ga0500595_001005 3300053119 Bacteria 15840
1398 Ga0500595_007607 3300053119 Bacteria 4485
1399 Ga0500595_010518 3300053119 Bacteria 3672
1400 Ga0500595_011210 3300053119 Bacteria 3521
1401 Ga0500595_012247 3300053119 Bacteria 3323
1402 Ga0500595_017583 3300053119 Bacteria 2636
1403 Ga0500595_024242 3300053119 Bacteria 2120
1404 Ga0500608_022516 3300053122 Bacteria 2922
1405 Ga0500608_044580 3300053122 Bacteria 2129
1406 Ga0500608_102162 3300053122 Bacteria 1327
1407 Ga0500608_136341 3300053122 Bacteria 1094
1408 Ga0500614_001247 3300053123 Bacteria 6179
1409 Ga0500614_024310 3300053123 Bacteria 1430
1410 Ga0500618_003296 3300053125 Bacteria 5605
1411 Ga0500642_0000069 3300053130 Bacteria 55916
1412 Ga0500642_0000092 3300053130 Bacteria 45651
1413 Ga0500642_0130915 3300053130 Bacteria 1175
1414 Ga0500652_000258 3300053131 Bacteria 19823
1415 Ga0500652_035989 3300053131 Bacteria 1969
1416 Ga0500658_0135180 3300053134 Bacteria 1102
1417 Ga0500559_0000377 3300053136 Bacteria 32813
1418 Ga0500559_0000492 3300053136 Bacteria 27669
1419 Ga0500559_0000657 3300053136 Bacteria 23232
1420 Ga0500559_0001182 3300053136 Bacteria 15606
1421 Ga0500559_0027168 3300053136 Bacteria 2441
1422 Ga0500559_0117128 3300053136 Bacteria 1237
1423 Ga0500568_0005790 3300053139 Bacteria 6313
1424 Ga0500568_0037767 3300053139 Bacteria 1957
1425 Ga0500568_0056219 3300053139 Bacteria 1534
1426 Ga0500573_0081236 3300053140 Bacteria 1841
1427 Ga0500577_0000068 3300053142 Bacteria 23514
1428 Ga0500577_0037067 3300053142 Bacteria 1750
1429 Ga0500577_0114735 3300053142 Bacteria 1115
1430 Ga0500577_0167508 3300053142 Bacteria 938
1431 Ga0500586_002258 3300053145 Bacteria 4292
1432 Ga0500589_154640 3300053147 Bacteria 929
1433 Ga0500590_025525 3300053148 Bacteria 3069
1434 Ga0500590_101169 3300053148 Bacteria 1384
1435 Ga0500590_120217 3300053148 Bacteria 1232
1436 Ga0500603_000254 3300053150 Bacteria 14076
1437 Ga0500603_001083 3300053150 Bacteria 6405
1438 Ga0500603_064876 3300053150 Bacteria 1029
1439 Ga0500604_0006587 3300053151 Bacteria 3072
1440 Ga0500604_0022060 3300053151 Bacteria 1805
1441 Ga0500616_0000197 3300053153 Bacteria 98372
1442 Ga0500619_102485 3300053154 Bacteria 971
1443 Ga0500622_0000966 3300053156 Bacteria 24386
1444 Ga0500622_0104018 3300053156 Bacteria 1394
1445 Ga0500627_0014629 3300053158 Bacteria 3011
1446 Ga0500627_0065476 3300053158 Bacteria 1603
1447 Ga0500630_000834 3300053159 Bacteria 14264
1448 Ga0500638_007204 3300053162 Bacteria 4630
1449 Ga0500638_090931 3300053162 Bacteria 1436
1450 Ga0500638_176455 3300053162 Bacteria 926
1451 Ga0500639_001931 3300053163 Bacteria 10361
1452 Ga0500639_008061 3300053163 Bacteria 5484
1453 Ga0500636_0000223 3300053177 Bacteria 30889
1454 Ga0500636_0021262 3300053177 Bacteria 3841
1455 Ga0500636_0081672 3300053177 Bacteria 1861
1456 Ga0500636_0112613 3300053177 Bacteria 1536
1457 Ga0500636_0214640 3300053177 Bacteria 1007
1458 Ga0500637_0000090 3300053178 Bacteria 32448
1459 Ga0500637_0029621 3300053178 Bacteria 3037
1460 Ga0500637_0218248 3300053178 Bacteria 1079
1461 Ga0500637_0316676 3300053178 Bacteria 844
1462 Ga0500570_108629 3300053724 Bacteria 1135
1463 Ga0500645_019942 3300053730 Bacteria 2081
1464 Ga0500552_001014 3300053733 Bacteria 2654
1465 Ga0500596_000920 3300053735 Bacteria 5882
1466 Ga0500596_001030 3300053735 Bacteria 5600
1467 Ga0500599_003555 3300053736 Bacteria 1905
1468 Ga0500601_000084 3300053737 Bacteria 19268
1469 Ga0500601_004047 3300053737 Bacteria 1591
1470 Ga0500601_009318 3300053737 Bacteria 1094
1471 Ga0501084_0072304 3300054114 Bacteria 2888
1472 Ga0500661_000273 3300055283 Bacteria 9361
1473 Ga0500661_016039 3300055283 Bacteria 1342
1474 Ga0501082_0002728 3300060353 Bacteria 15429
1475 Ga0501082_0024361 3300060353 Bacteria 5217
1476 Ga0501082_0176163 3300060353 Bacteria 1860
1477 2507511340 2507262055 Bacteria 8048963
1478 2508545138 2508501009 Bacteria 7784016
1479 2508693978 2508501042 Bacteria 8719808
1480 2509146674 2508501128 Bacteria 8613869
1481 2511401080 2511231028 Bacteria 8046582
1482 2513624176 2513237092 Bacteria 8341956
1483 2513641146 2513237094 Bacteria 8789602
1484 2513648599 2513237095 Bacteria 8976980
1485 2513656049 2513237096 Bacteria 8722461
1486 2513675241 2513237098 Bacteria 9902361
1487 2513696397 2513237101 Bacteria 7952346
1488 2513704334 2513237102 Bacteria 7703324
1489 2513717862 2513237104 Bacteria 10034502
1490 2513862853 2513237137 Bacteria 9558895
1491 2513874921 2513237139 Bacteria 8737671
1492 2513887668 2513237141 Bacteria 8496279
1493 2513920943 2513237145 Bacteria 8979722
1494 2514010356 2513237161 Bacteria 8871253
1495 2515625076 2515154112 Bacteria 8294334
1496 2517101078 2517093001 Bacteria 9002274
1497 2517895870 2517572143 Bacteria 9484767
1498 2524439979 2524023205 Bacteria 8918781
1499 2524469158 2524023210 Bacteria 9029266
1500 2524534748 2524023228 Bacteria 10118060
1501 2528856808 2528768022 Bacteria 10457665
1502 2603857512 2602042107 Bacteria 6226103
1503 2617348510 2617270735 Bacteria 9163226
1504 2617375063 2617270741 Bacteria 8201522
1505 2644287255 2643221651 Bacteria 4798932
1506 2671122670 2667528175 Bacteria 7532676
1507 2723842903 2721755755 Bacteria 8322773
1508 2728749602 2728368998 Bacteria 8720350
1509 2793061707 2791355196 Bacteria 7323613
1510 2793069696 2791355197 Bacteria 8420563
1511 2793080209
1512 2805916491 2802429603 Bacteria 8777136
1513 2818243481 2816332527 Bacteria 8933356
1514 2824604328 2824600985 Bacteria 8488197
1515 2824614199 2824609381 Bacteria 8672835
1516 2824619574 2824617872 Bacteria 8814715
1517 2824629010 2824626560 Bacteria 8813858
1518 2824635677 2824635225 Bacteria 8785348
1519 2824652971 2824644064 Bacteria 8743947
1520 2824656458 2824653114 Bacteria 8493680
1521 2824671267 2824661429 Bacteria 9877870
1522 2824679573 2824671348 Bacteria 8369588
1523 2824687818 2824679649 Bacteria 8248951
1524 2824696219 2824687955 Bacteria 8360029
1525 2824704509 2824696289 Bacteria 8335049
1526 2824714515 2824704595 Bacteria 9667483
1527 2824723758 2824714736 Bacteria 8717648
1528 2824732823 2824723954 Bacteria 8758240
1529 2824740862 2824732956 Bacteria 7810675
1530 2824753768 2824746037 Bacteria 7911610
1531 2824754144 2824753945 Bacteria 9787441
1532 2824771651 2824763712 Bacteria 9792355
1533 2824780550 2824773399 Bacteria 8360218
1534 2838129009 2838122688 Bacteria 8803140
1535 2841948286 2841941048 Bacteria 8688029
1536 2841957218 2841949485 Bacteria 8680857
1537 2841961491 2841957949 Bacteria 8652217
1538 2841970138 2841966195 Bacteria 8673214
1539 2841977217 2841974524 Bacteria 8931498
1540 2841985651 2841983080 Bacteria 8395090
1541 2842042388 2842038055 Bacteria 8002051
1542 2842050431 2842045827 Bacteria 8006841
1543 2844316582 2844315083 Bacteria 8138177
1544 2847939117 2847930680 Bacteria 9342022
1545 2847943938 2847939898 Bacteria 8606328
1546 2849081835 2849076700 Bacteria 7039503
1547 2857512594 2857509624 Bacteria 7472071
1548 2857526899 2857524615 Bacteria 6615449
1549 2874594559 2874590934 Bacteria 8299676
1550 2874606435 2874604998 Bacteria 7834745
1551 2874613913 2874612657 Bacteria 8252029
1552 2874625554 2874620515 Bacteria 8290088
1553 2874633762 2874628541 Bacteria 8630250
1554 2874649607 2874645413 Bacteria 8214782
1555 2876773691 2876771140 Bacteria 8287509
1556 2876817886 2876808645 Bacteria 8824342
1557 2876820682 2876818435 Bacteria 8274608
1558 2879076884 2879074833 Bacteria 8279565
1559 2879084589 2879083081 Bacteria 8587928
1560 2879101151 2879099564 Bacteria 10442239
1561 2879113693 2879110137 Bacteria 8907982
1562 2879130328 2879127579 Bacteria 8294491
1563 2879146844 2879142872 Bacteria 8267021
1564 2881367364 2881364244 Bacteria 7710352
1565 2881668742 2881665667 Bacteria 8175609
1566 2885366568 2885366525 Bacteria 8326213
1567 2885381579 2885374607 Bacteria 8927485
1568 2885387486 2885383462 Bacteria 9473874
1569 2885413503 2885409591 Bacteria 9235467
1570 2888386864 2888378607 Bacteria 9652610
1571 2888389587 2888388044 Bacteria 7304136
1572 2888421508 2888419890 Bacteria 7857137
1573 2889033780 2889033259 Bacteria 9099371
1574 2893070056 2893066018 Bacteria 6158120
1575 2903731352 2903727486 Bacteria 8281579
1576 2903756034 2903748898 Bacteria 9972761
1577 2903770364 2903768456 Bacteria 9749579
1578 2904673500 2904666416 Bacteria 8226587
1579 2904693353 2904690495 Bacteria 9412302
1580 2904707006
1581 2904719475 2904711408 Bacteria 9771557
1582 2906603818 2906602504 Bacteria 8295279
1583 2906615661
1584 2906635031 2906626472 Bacteria 8826946
1585 2906646090 2906643746 Bacteria 8722424
1586 2906665098 2906660503 Bacteria 8595048
1587 2908745523 2908739725 Bacteria 8628932
1588 2908759430 2908756301 Bacteria 8864324
1589 2908777549 2908775508 Bacteria 8092255
1590 2919078016 2919073203 Bacteria 6531949
1591 2922367181 2922361189 Bacteria 7436256
1592 2922377018
1593 2922390085 2922386360 Bacteria 7017218
1594 2922398174 2922393267 Bacteria 8285685
1595 2922432348
1596 2929619154 2929615660 Bacteria 9193770
1597 2929628351 2929624759 Bacteria 9339455
1598 2932791278 2932784394 Bacteria 9704911
1599 2932795705 2932794094 Bacteria 7915132
1600 2932801944 2932801729 Bacteria 7987968
1601 2932817694 2932809354 Bacteria 9135765
1602 2932826978 2932818245 Bacteria 9955613
1603 2932833153 2932828146 Bacteria 9745859
1604 2933581076 2933577622 Bacteria 9116884
1605 2935612331 2935608549 Bacteria 8203142
1606 2935620570 2935616580 Bacteria 9032984
1607 2935630821 2935630451 Bacteria 8169952
1608 2935639657 2935638405 Bacteria 10015038
1609 2935650173 2935648319 Bacteria 8801166
1610 2935658320 2935656913 Bacteria 8965014
1611 2935667505 2935665750 Bacteria 9571747
1612 2935682930 2935675223 Bacteria 9928132
1613 2935687597 2935684952 Bacteria 9590419
1614 2935696432 2935694250 Bacteria 9291695
1615 2935705245 2935703347 Bacteria 10242284
1616 2935719057 2935713505 Bacteria 9608509
1617 2935728709 2935722832 Bacteria 9608746
1618 2935736695 2935732158 Bacteria 9706831
1619 2935746303 2935741537 Bacteria 9707219
1620 2935753563 2935750917 Bacteria 9590372
1621 2935767755 2935760218 Bacteria 9817913
1622 2935770513 2935769743 Bacteria 7878163
1623 2935782466 2935777560 Bacteria 8077691
1624 2935786434 2935785616 Bacteria 7962367
1625 2935794489 2935793552 Bacteria 8012592
1626 2935806991 2935801545 Bacteria 9301974
1627 2935814091 2935810662 Bacteria 9401221
1628 2935823819 2935819856 Bacteria 8261050
1629 2935829140 2935827899 Bacteria 10038562
1630 2935845326 2935837841 Bacteria 9454360
1631 2935854457 2935847175 Bacteria 8228321
1632 2935858378 2935855204 Bacteria 9035059
1633 2935872314 2935864058 Bacteria 9784707
1634 2935877339 2935873716 Bacteria 9632195
1635 2935886131 2935883170 Bacteria 7964738
1636 2935913452 2935908558 Bacteria 8568796
1637 2935923348 2935916978 Bacteria 9113783
1638 2935931231 2935926038 Bacteria 8601059
1639 2935935513 2935934488 Bacteria 8602579
1640 2935947079 2935942939 Bacteria 8599779
1641 2935953826 2935951376 Bacteria 8602333
1642 2935961534 2935959822 Bacteria 7869783
1643 2935968852 2935967501 Bacteria 8603075
1644 2935982484 2935975950 Bacteria 8347125
1645 2935985952 2935984226 Bacteria 8302647
1646 2935995042 2935992306 Bacteria 9802711
1647 2936006135 2936002035 Bacteria 9362176
1648 2936013268 2936011229 Bacteria 8801034
1649 2936021645 2936019824 Bacteria 8804134
1650 2936030561 2936028420 Bacteria 8965941
1651 2936039646 2936037263 Bacteria 9446081
1652 2936047839 2936046547 Bacteria 8903709
1653 2936057841 2936055302 Bacteria 8785755
1654 2940559476 2940556831 Bacteria 9590747
1655 2941507473 2941507105 Bacteria 8166816
1656 2941515900 2941515067 Bacteria 8166720
1657 2941523392 2941523033 Bacteria 8169134
1658 2941537043 2941531003 Bacteria 7653939
1659 2941545703 2941538514 Bacteria 9402094
1660 3005476690 3005474847 Bacteria 9259049
1661 3005488280 3005483717 Bacteria 7877331
1662 3005511224 3005506211 Bacteria 6943378
1663 3005592088 3005587118 Bacteria 7794411
1664 3005596203 3005594810 Bacteria 8716512
1665 3005712139 3005710791 Bacteria 7622528
1666 8006934789 8006933436 Bacteria 10410654
1667 8006966708 8006964411 Bacteria 8966052
1668 8006974757 8006973647 Bacteria 10679141
1669 8006989619 8006984368 Bacteria 9651211
1670 8006998010 8006994254 Bacteria 8309700
1671 8016516885 8016511872 Bacteria 9921665
1672 8016524478 8016522445 Bacteria 8156687
1673 8016538038 8016530956 Bacteria 8155261
1674 8016542311 8016539877 Bacteria 8155419
1675 8016550968 8016548790 Bacteria 8155074
1676 8016567698 8016566248 Bacteria 8158151
1677 8016580392 8016575299 Bacteria 8154085
1678 8016588771 8016583857 Bacteria 10421953
1679 8016597316 8016595262 Bacteria 8149947
1680 8016604941 8016603502 Bacteria 8731218
1681 8016620067 8016613128 Bacteria 8794220
1682 8016624292 8016622563 Bacteria 7999408
1683 8016637703 8016630954 Bacteria 9217207
1684 8017059686 8017057580 Bacteria 10023680
1685 8019537705 8019530166 Bacteria 8155624
1686 8019539336 8019538911 Bacteria 7872763
1687 8019551309 8019547302 Bacteria 7996444
1688 8019563864 8019555841 Bacteria 9642137
1689 8019573935 8019565922 Bacteria 9639779
1690 8019604480 8019597564 Bacteria 10041141
1691 8019614056 8019608314 Bacteria 10042931
1692 8019624589 8019619141 Bacteria 9218857
1693 8019637444 8019629233 Bacteria 8687553
1694 8019642165 8019638758 Bacteria 9062356
1695 8019650355 8019648815 Bacteria 10014479
1696 8019665381 8019659431 Bacteria 8577854
1697 8019674926 8019668869 Bacteria 8791617
1698 8019681169 8019678201 Bacteria 8863603
1699 8019694533 8019687851 Bacteria 8712826
1700 8055749588 8055742211 Bacteria 9226248
1701 8056675045 8056673599 Bacteria 7871253
1702 8056681881 8056681323 Bacteria 8472857
1703 8056696280 8056689827 Bacteria 6712655
1704 8056973784 8056967851 Bacteria 9038162
1705 Ga0501031_0109785
1706 JGI24740J21852_10014866
1707 JGI24739J22299_10062404
1708 JGI24737J22298_10010976
1709 JGI25406J46586_10000042
1710 JGI25406J46586_10001667
1711 JGI25153J46596_10003624
1712 JGI25153J46596_10003958
1713 JGI25153J46596_10004459
1714 JGI25153J46596_10005398
1715 JGI25153J46596_10020255
1716 JGI25153J46596_10091220
1717 JGI25160J50197_1001455
1718 JGI25160J50197_1012378
1719 JGI25160J50197_1020115
1720 JGI25404J52841_10008161
1721 JGI25404J52841_10012359
1722 Ga0055531_10012265
1723 Ga0055543_1014579
1724 Ga0055543_1031128
1725 Ga0065165_1003252
1726 Ga0065165_1045488
1727 Ga0070658_10269128
1728 Ga0070658_10290974
1729 Ga0070658_10724403
1730 Ga0070676_10110009
1731 Ga0070676_10281542
1732 Ga0070683_100027061
1733 Ga0070683_100138895
1734 Ga0070683_100231044
1735 Ga0070683_100232105
1736 Ga0070683_100552737
1737 Ga0070670_100311659
1738 Ga0068869_100169996
1739 Ga0068869_100497135
1740 Ga0070666_10483489
1741 Ga0070680_100064005
1742 Ga0070680_100271460
1743 Ga0070680_100385533
1744 Ga0070682_100651278
1745 Ga0068868_100101422
1746 Ga0070660_100078251
1747 Ga0070660_100270633
1748 Ga0070689_100854221
1749 Ga0070691_10055625
1750 Ga0070661_100240955
1751 Ga0070668_100143978
1752 Ga0070668_100183723
1753 Ga0070668_100270021
1754 Ga0070675_100191849
1755 Ga0070671_100570463
1756 Ga0070688_100206954
1757 Ga0070688_100377636
1758 Ga0070659_100119271
1759 Ga0070667_100112801
1760 Ga0070667_100166124
1761 Ga0070667_100299974
1762 Ga0070703_10120268
1763 Ga0070709_10005705
1764 Ga0070709_10010069
1765 Ga0070709_10019609
1766 Ga0070709_10068994
1767 Ga0070709_10170714
1768 Ga0070714_100037560
1769 Ga0070714_100046348
1770 Ga0070714_100057181
1771 Ga0070714_100134760
1772 Ga0070714_100196604
1773 Ga0070714_100202282
1774 Ga0070714_100272495
1775 Ga0070714_100293469
1776 Ga0070714_100417929
1777 Ga0070714_100863884
1778 Ga0070713_100004677
1779 Ga0070713_100005417
1780 Ga0070713_100058128
1781 Ga0070713_100073758
1782 Ga0070713_100085786
1783 Ga0070713_100340016
1784 Ga0070710_10002398
1785 Ga0070710_10010404
1786 Ga0070710_10466156
1787 Ga0070711_100004055
1788 Ga0070711_100022948
1789 Ga0070711_100029370
1790 Ga0070711_100253007
1791 Ga0070700_100058073
1792 Ga0070694_100497595
1793 Ga0070708_100094717
1794 Ga0070663_100061894
1795 Ga0070663_100110883
1796 Ga0070663_100124997
1797 Ga0070663_100131703
1798 Ga0070663_100199904
1799 Ga0070663_100201024
1800 Ga0070678_100004745
1801 Ga0070678_100049918
1802 Ga0070678_100058533
1803 Ga0070678_100326168
1804 Ga0070662_100354046
1805 Ga0070662_100509484
1806 Ga0070681_10106354
1807 Ga0070681_10154946
1808 Ga0070681_10174097
1809 Ga0070681_10191774
1810 Ga0070681_10291231
1811 Ga0068867_100223826
1812 Ga0068867_100426455
1813 Ga0070707_100950178
1814 Ga0070698_100117254
1815 Ga0070698_100465334
1816 Ga0070699_100194289
1817 Ga0070679_100009107
1818 Ga0070679_100018046
1819 Ga0070679_100061391
1820 Ga0070684_100002381
1821 Ga0070684_100019269
1822 Ga0070697_100000384
1823 Ga0068853_100008031
1824 Ga0068853_100043449
1825 Ga0068853_100131164
1826 Ga0068853_100160177
1827 Ga0068853_100230163
1828 Ga0068853_100294048
1829 Ga0070672_100059107
1830 Ga0070672_100169209
1831 Ga0070672_100210649
1832 Ga0070672_101194447
1833 Ga0070693_100188144
1834 Ga0070665_100008983
1835 Ga0070665_100009227
1836 Ga0070665_100029464
1837 Ga0070665_100032495
1838 Ga0070665_100120727
1839 Ga0070665_100136332
1840 Ga0070665_100205831
1841 Ga0070665_100273272
1842 Ga0068855_100005308
1843 Ga0068855_100006278
1844 Ga0068855_100050315
1845 Ga0068855_100124785
1846 Ga0068855_100256893
1847 Ga0068855_100561714
1848 Ga0068855_100581282
1849 Ga0070664_100177934
1850 Ga0070664_100255596
1851 Ga0068857_100014818
1852 Ga0068857_100053478
1853 Ga0068857_100062088
1854 Ga0068857_100170413
1855 Ga0068857_100216970
1856 Ga0068854_100024638
1857 Ga0068854_100123948
1858 Ga0068854_100328821
1859 Ga0068854_100462700
1860 Ga0068856_100002141
1861 Ga0068856_100085937
1862 Ga0068856_100122345
1863 Ga0068856_100125076
1864 Ga0068856_100199610
1865 Ga0068856_100371752
1866 Ga0068852_100290760
1867 Ga0068852_100739384
1868 Ga0068852_100863893
1869 Ga0068859_100142745
1870 Ga0068859_100201571
1871 Ga0068859_100268483
1872 Ga0068859_100687638
1873 Ga0068864_100101958
1874 Ga0068861_100027676
1875 Ga0068851_10001857
1876 Ga0068870_10243328
1877 Ga0068863_100082299
1878 Ga0068863_100087604
1879 Ga0068863_100174377
1880 Ga0068858_100006904
1881 Ga0068858_100011239
1882 Ga0068858_100053134
1883 Ga0068858_100130519
1884 Ga0068858_100528846
1885 Ga0068858_100873429
1886 Ga0068860_100001883
1887 Ga0068860_100028726
1888 Ga0068860_100142004
1889 Ga0068860_100570854
1890 Ga0068860_100574963
1891 Ga0068862_100074257
1892 Ga0068862_100103057
1893 Ga0068862_100513237
1894 Ga0068862_100922915
1895 Ga0068862_101038629
1896 Ga0081455_10006143
1897 Ga0081455_10034784
1898 Ga0081455_10236759
1899 Ga0081538_10034120
1900 Ga0081540_1002324
1901 Ga0081540_1004136
1902 Ga0081540_1004563
1903 Ga0081540_1004863
1904 Ga0081540_1006598
1905 Ga0081540_1013141
1906 Ga0081540_1031304
1907 Ga0081540_1039534
1908 Ga0081539_10000099
1909 Ga0081539_10001705
1910 Ga0081539_10199589
1911 Ga0081539_10226934
1912 Ga0081539_10231448
1913 Ga0070717_10000884
1914 Ga0070717_10014958
1915 Ga0070717_10891292
1916 Ga0075365_10010380
1917 Ga0075365_10020780
1918 Ga0075365_10021853
1919 Ga0075365_10107629
1920 Ga0075365_10155709
1921 Ga0075365_10164297
1922 Ga0075365_10269534
1923 Ga0075365_10373371
1924 Ga0075368_10027704
1925 Ga0075368_10044846
1926 Ga0075368_10052860
1927 Ga0075363_100076653
1928 Ga0075363_100107756
1929 Ga0075363_100127931
1930 Ga0075363_100206646
1931 Ga0075363_100254574
1932 Ga0075364_10006886
1933 Ga0075364_10034616
1934 Ga0070715_10000981
1935 Ga0070716_100013712
1936 Ga0070716_100022257
1937 Ga0070716_100075243
1938 Ga0070712_100015975
1939 Ga0070712_100051147
1940 Ga0070712_100323610
1941 Ga0070712_100367303
1942 Ga0070712_100609691
1943 Ga0075367_10058549
1944 Ga0075367_10068670
1945 Ga0075367_10152099
1946 Ga0075369_10070615
1947 Ga0075369_10170053
1948 Ga0075366_10034226
1949 Ga0075366_10440476
1950 Ga0075370_10023753
1951 Ga0075370_10027637
1952 Ga0075370_10070899
1953 Ga0075370_10180316
1954 Ga0075428_100973603
1955 Ga0075434_100091893
1956 Ga0075434_100139408
1957 Ga0075434_101054065
1958 Ga0068865_100107511
1959 Ga0068865_100203413
1960 Ga0068865_100398507
1961 Ga0097620_100142741
1962 Ga0097620_100201574
1963 Ga0097620_100268470
1964 Ga0097620_100687750
1965 Ga0099825_1029936
1966 Ga0099824_1007272
1967 Ga0099824_1025823
1968 Ga0099823_1053108
1969 Ga0075435_100208200
1970 Ga0099794_10007534
1971 Ga0099794_10022139
1972 Ga0099795_10056429
1973 Ga0105251_10307119
1974 Ga0105240_10003625
1975 Ga0105240_10050592
1976 Ga0105240_10144227
1977 Ga0105240_10366710
1978 Ga0105240_10516600
1979 Ga0105240_10794077
1980 Ga0105240_11473144
1981 Ga0111539_10124690
1982 Ga0111539_11525139
1983 Ga0105245_10082095
1984 Ga0105245_10100337
1985 Ga0105245_10391376
1986 Ga0105245_10421320
1987 Ga0105245_10647120
1988 Ga0105247_10157856
1989 Ga0114129_11043253
1990 Ga0105243_10038231
1991 Ga0105243_10091595
1992 Ga0105243_10569401
1993 Ga0105243_10783742
1994 Ga0105241_10009272
1995 Ga0105241_10090159
1996 Ga0105241_10211991
1997 Ga0105242_10350202
1998 Ga0105242_10539767
1999 Ga0105242_11424160
2000 Ga0105248_10370733
2001 Ga0105248_10509363
2002 Ga0105237_10003462
2003 Ga0105237_10042625
2004 Ga0105237_10045814
2005 Ga0105237_10050449
2006 Ga0105237_10072304
2007 Ga0105237_10124677
2008 Ga0105237_10172003
2009 Ga0105237_10201580
2010 Ga0105237_10264373
2011 Ga0105237_10301265
2012 Ga0105237_10452715
2013 Ga0105237_10457440
2014 Ga0105238_10001064
2015 Ga0105238_10137768
2016 Ga0105238_10309576
2017 Ga0105238_10584823
2018 Ga0105238_10920252
2019 Ga0105238_11142676
2020 Ga0105249_10152529
2021 Ga0099796_10120195
2022 Ga0099796_10161464
2023 Ga0105239_10000803
2024 Ga0105239_10111666
2025 Ga0105239_10384597
2026 Ga0105239_10445585
2027 Ga0105246_10224084
2028 Ga0105246_10376963
2029 Ga0157370_10013095
2030 Ga0157370_10076076
2031 Ga0157370_10083255
2032 Ga0157370_10271608
2033 Ga0157370_10525986
2034 Ga0157369_10007934
2035 Ga0157369_10029605
2036 Ga0157369_10057734
2037 Ga0157369_10157648
2038 Ga0157369_10469589
2039 Ga0157369_10496482
2040 Ga0157369_10727424
2041 Ga0157374_10201543
2042 Ga0157378_10030034
2043 Ga0157378_10567482
2044 Ga0163162_10074838
2045 Ga0157372_10018081
2046 Ga0157372_10641591
2047 Ga0157375_10035212
2048 Ga0157375_10225225
2049 Ga0157375_10293727
2050 Ga0157375_10775583
2051 Ga0163163_10011193
2052 Ga0163163_10160241
2053 Ga0157380_10128687
2054 Ga0182008_10278514
2055 Ga0182008_10295830
2056 Ga0157377_10028713
2057 Ga0157377_10518676
2058 Ga0157377_10716721
2059 Ga0157379_10090668
2060 Ga0157379_10112770
2061 Ga0157379_10211047
2062 Ga0157376_10076201
2063 Ga0214544_1000005
2064 Ga0214544_1030440
2065 Ga0214542_1000004
2066 Ga0214542_1032430
2067 Ga0214542_1033369
2068 Ga0214545_1000005
2069 Ga0214545_1028880
2070 Ga0214543_1000030
2071 Ga0213873_10023567
2072 Ga0213876_10005771
2073 Ga0213876_10051827
2074 Ga0213871_10015751
2075 Ga0209563_104596
2076 Ga0207425_1029117
2077 Ga0209677_100180
2078 Ga0209677_105813
2079 Ga0209148_1000801
2080 Ga0209148_1020749
2081 Ga0209233_1001773
2082 Ga0209233_1019150
2083 Ga0209233_1019779
2084 Ga0209455_1013794
2085 Ga0209455_1018576
2086 Ga0209673_1028696
2087 Ga0209564_1001232
2088 Ga0209758_1000102
2089 Ga0209758_1000631
2090 Ga0209758_1000703
2091 Ga0209758_1000761
2092 Ga0209758_1001792
2093 Ga0209758_1002441
2094 Ga0209758_1055416
2095 Ga0209256_1016058
2096 Ga0209256_1044827
2097 Ga0207426_1000354
2098 Ga0207426_1003127
2099 Ga0209257_1003566
2100 Ga0209257_1072583
2101 Ga0207697_10070067
2102 Ga0207656_10094099
2103 Ga0207682_10054713
2104 Ga0207692_10021622
2105 Ga0207692_10028244
2106 Ga0207692_10590426
2107 Ga0207642_10329358
2108 Ga0207688_10206315
2109 Ga0207680_10162186
2110 Ga0207647_10018549
2111 Ga0207699_10001383
2112 Ga0207699_10017637
2113 Ga0207699_10028712
2114 Ga0207699_10054224
2115 Ga0207699_10113627
2116 Ga0207699_10413491
2117 Ga0207645_10148193
2118 Ga0207643_10391875
2119 Ga0207705_10039045
2120 Ga0207705_10091269
2121 Ga0207705_10165761
2122 Ga0207684_10233443
2123 Ga0207654_10001104
2124 Ga0207654_10011477
2125 Ga0207654_10155179
2126 Ga0207654_10288678
2127 Ga0207707_10005313
2128 Ga0207707_10011326
2129 Ga0207707_10154891
2130 Ga0207707_10203938
2131 Ga0207707_10372090
2132 Ga0207695_10000006
2133 Ga0207695_10003805
2134 Ga0207695_10104719
2135 Ga0207695_10561481
2136 Ga0207695_10739888
2137 Ga0207671_10005375
2138 Ga0207671_10036148
2139 Ga0207671_10096861
2140 Ga0207671_10129560
2141 Ga0207671_10175234
2142 Ga0207671_10458153
2143 Ga0207671_10515255
2144 Ga0207671_10744592
2145 Ga0207693_10012138
2146 Ga0207693_10021423
2147 Ga0207693_10037531
2148 Ga0207693_10156630
2149 Ga0207693_10177459
2150 Ga0207663_10000457
2151 Ga0207663_10022469
2152 Ga0207663_10125596
2153 Ga0207663_10256602
2154 Ga0207660_10007858
2155 Ga0207660_10009400
2156 Ga0207660_10025528
2157 Ga0207660_10162970
2158 Ga0207662_10060766
2159 Ga0207657_10002620
2160 Ga0207657_10201178
2161 Ga0207657_10729981
2162 Ga0207649_10104448
2163 Ga0207649_10728059
2164 Ga0207652_10023832
2165 Ga0207652_10031328
2166 Ga0207652_10052312
2167 Ga0207646_10452087
2168 Ga0207681_10115128
2169 Ga0207681_10804120
2170 Ga0207694_10000273
2171 Ga0207694_10287115
2172 Ga0207694_10606884
2173 Ga0207650_10122673
2174 Ga0207650_10294479
2175 Ga0207659_10159984
2176 Ga0207687_10069286
2177 Ga0207687_10355900
2178 Ga0207687_10386868
2179 Ga0207700_10010929
2180 Ga0207700_10023057
2181 Ga0207700_10054679
2182 Ga0207700_10161634
2183 Ga0207700_10372342
2184 Ga0207700_10380261
2185 Ga0207700_10882728
2186 Ga0207700_11045318
2187 Ga0207664_10024427
2188 Ga0207664_10049207
2189 Ga0207664_10064666
2190 Ga0207664_10172067
2191 Ga0207664_10181056
2192 Ga0207664_10411184
2193 Ga0207664_10485259
2194 Ga0207664_10551290
2195 Ga0207664_10981246
2196 Ga0207644_10377075
2197 Ga0207690_10336410
2198 Ga0207690_10583981
2199 Ga0207706_10116359
2200 Ga0207706_10231929
2201 Ga0207706_10268969
2202 Ga0207709_10070825
2203 Ga0207709_10582526
2204 Ga0207670_10208517
2205 Ga0207670_10290114
2206 Ga0207670_10738510
2207 Ga0207669_10150018
2208 Ga0207669_10213607
2209 Ga0207704_10067161
2210 Ga0207704_10391085
2211 Ga0207704_10651791
2212 Ga0207665_10000127
2213 Ga0207665_10009558
2214 Ga0207665_10015452
2215 Ga0207691_10397250
2216 Ga0207711_11047908
2217 Ga0207661_10013783
2218 Ga0207661_10021726
2219 Ga0207661_10171311
2220 Ga0207661_10324103
2221 Ga0207661_10765705
2222 Ga0207679_10282626
2223 Ga0207667_10005930
2224 Ga0207667_10095234
2225 Ga0207667_10155541
2226 Ga0207667_10181792
2227 Ga0207667_10243490
2228 Ga0207667_10355690
2229 Ga0207667_10481357
2230 Ga0207667_10508646
2231 Ga0207712_10585344
2232 Ga0207668_10013352
2233 Ga0207668_10140455
2234 Ga0207668_10357438
2235 Ga0207668_10414015
2236 Ga0207640_10105929
2237 Ga0207640_11050843
2238 Ga0207658_10014650
2239 Ga0207677_10088985
2240 Ga0207677_10278711
2241 Ga0207703_10084544
2242 Ga0207703_10095065
2243 Ga0207703_10457491
2244 Ga0207703_10806071
2245 Ga0207639_10038757
2246 Ga0207639_10069559
2247 Ga0207639_10178257
2248 Ga0207639_10185177
2249 Ga0207639_10359501
2250 Ga0207678_10016165
2251 Ga0207678_10018540
2252 Ga0207678_10022726
2253 Ga0207678_10093897
2254 Ga0207678_10146729
2255 Ga0207678_10209849
2256 Ga0207678_10225178
2257 Ga0207678_10234829
2258 Ga0207678_10502819
2259 Ga0207702_10000003
2260 Ga0207702_10000325
2261 Ga0207702_10057553
2262 Ga0207702_10147332
2263 Ga0207702_10284541
2264 Ga0207702_10374371
2265 Ga0207641_10102577
2266 Ga0207641_10199393
2267 Ga0207641_10358382
2268 Ga0207648_10389276
2269 Ga0207676_10141774
2270 Ga0207676_10400559
2271 Ga0207674_10017609
2272 Ga0207674_10017929
2273 Ga0207674_10030154
2274 Ga0207674_10108612
2275 Ga0207674_10166376
2276 Ga0207674_10175414
2277 Ga0207674_10666689
2278 Ga0207675_100072306
2279 Ga0207675_100113589
2280 Ga0207675_100232992
2281 Ga0207683_10061897
2282 Ga0207683_10148831
2283 Ga0207683_10152190
2284 Ga0207683_11016254
2285 Ga0207698_10051678
2286 Ga0207698_10536012
2287 Ga0209389_1000924
2288 Ga0209389_1000951
2289 Ga0209589_1000005
2290 Ga0209589_1003240
2291 Ga0209489_100005
2292 Ga0209489_102828
2293 Ga0209489_115384
2294 Ga0209700_100006
2295 Ga0209700_100483
2296 Ga0209588_1001041
2297 Ga0268266_10001580
2298 Ga0268266_10004157
2299 Ga0268266_10012768
2300 Ga0268266_10034039
2301 Ga0268266_10043998
2302 Ga0268266_10249225
2303 Ga0268266_10637240
2304 Ga0268266_10678661
2305 Ga0268266_10866761
2306 Ga0268265_10218323
2307 Ga0268265_10359470
2308 Ga0268265_11123285
2309 Ga0268265_11270556
2310 Ga0268264_10000174
2311 Ga0268264_10154530
2312 Ga0268264_10250828
2313 Ga0268264_10406720
2314 Ga0265337_1022171
2315 Ga0265322_10086893
2316 Ga0265336_10002309
2317 Ga0307517_10000124
2318 Ga0307515_10036628
2319 Ga0307515_10581716
2320 Ga0265338_10002710
2321 Ga0265338_10225100
2322 Ga0265324_10008015
2323 Ga0307511_10057673
2324 Ga0265330_10005554
2325 Ga0265330_10071648
2326 Ga0265330_10082084
2327 Ga0265332_10029066
2328 Ga0265332_10037876
2329 Ga0265332_10241633
2330 Ga0265328_10031734
2331 Ga0265325_10137153
2332 Ga0265340_10000891
2333 Ga0265340_10014481
2334 Ga0265339_10008471
2335 Ga0265339_10032933
2336 Ga0265316_10086587
2337 Ga0265316_10418583
2338 Ga0307513_10110997
2339 Ga0307513_10287426
2340 Ga0307509_10140310
2341 Ga0307509_10226763
2342 Ga0307408_100312511
2343 Ga0307408_100504084
2344 Ga0265313_10076154
2345 Ga0307508_10072848
2346 Ga0307508_10191813
2347 Ga0307508_10195726
2348 Ga0265314_10001980
2349 Ga0265314_10056351
2350 Ga0265314_10075066
2351 Ga0265342_10014362
2352 Ga0265342_10097360
2353 Ga0265342_10119726
2354 Ga0316578_10036456
2355 Ga0307516_10000457
2356 Ga0307516_10020328
2357 Ga0307516_10036865
2358 Ga0307516_10215446
2359 Ga0307405_10239112
2360 Ga0307405_10582021
2361 Ga0307413_10094071
2362 Ga0307410_10515160
2363 Ga0307406_10106324
2364 Ga0307412_10148574
2365 Ga0307412_10345907
2366 Ga0307412_10416580
2367 Ga0307409_100840123
2368 Ga0307416_100468374
2369 Ga0307411_10344227
2370 Ga0316583_10117265
2371 Ga0307507_10049280
2372 Ga0307510_10004801
2373 Ga0307510_10017344
2374 Ga0307510_10024151
2375 Ga0307510_10041115
2376 Ga0307510_10101487
2377 Ga0315911_1000041
2378 Ga0316215_1001284
2379 Ga0373959_0072081
2380 Ga0373934_0074619
2381 Ga0373944_0052997
2382 Ga0373949_0036411
2383 Ga0373923_0020170
2384 Ga0373923_0025394
2385 Ga0373936_0006369
2386 Ga0373936_0013694
2387 Ga0373936_0046144
2388 Ga0373953_0000483
2389 Ga0373954_0000152
2390 Ga0373954_0002572
2391 Ga0373954_0027857
2392 Ga0373954_0237926
2393 Ga0373956_0043185
2394 Ga0373957_0006488
2395 Ga0373957_0048025
2396 Ga0373943_0004910
2397 Ga0373943_0075584
2398 Ga0373946_0006110
2399 Ga0373955_0000721
2400 Ga0373955_0285689
2401 Ga0373942_0173649
2402 Ga0316574_0010592
2403 Ga0373924_0167416
2404 Ga0373935_0002202
2405 Ga0373935_0051609
2406 Ga0373935_0085752
2407 Ga0373935_0122358
2408 Ga0373935_0206506
2409 Ga0373927_0001742
2410 Ga0373927_0005149
2411 Ga0373927_0023426
2412 Ga0373933_0000348
2413 Ga0373933_0004671
2414 Ga0373947_0012585
2415 Ga0373947_0063579
2416 Ga0373947_0144655
2417 Ga0373937_0059759
2418 Ga0373937_0079504
2419 Ga0373937_0170595
2420 Ga0373937_0381055
2421 Ga0373937_0557781
2422 Ga0372808_012610
2423 Ga0316584_0015310
2424 Ga0373925_0016402
2425 Ga0373925_0271167
2426 Ga0373925_0910845
2427 Ga0395899_0045984
2428 Ga0395899_0182906
2429 Ga0395900_0146874
2430 Ga0395900_0224268
2431 Ga0395900_0327796
2432 Ga0395900_0333605
2433 Ga0395900_0344296
2434 Ga0395900_0839362
2435 Ga0395898_0009973
2436 Ga0395898_0043826
2437 Ga0395898_0058881
2438 Ga0395898_0518929
2439 Ga0395905_0079594
2440 Ga0395905_0098751
2441 Ga0395905_0168012
2442 Ga0395901_0036728
2443 Ga0395901_0230420
2444 Ga0395901_0296402
2445 Ga0395901_0496746
2446 Ga0395901_0882950
2447 Ga0436365_0472724
2448 Ga0436365_0694949
2449 Ga0436365_0838471
2450 Ga0436365_1683641
2451 Ga0436365_1911415
2452 Ga0436360_0605391
2453 Ga0436361_0018023
2454 Ga0436361_0576498
2455 Ga0436361_1036455
2456 Ga0436363_0060836
2457 Ga0436363_0165204
2458 Ga0436363_0194287
2459 Ga0436362_0418961
2460 Ga0436362_0974814
2461 Ga0436362_1114012
2462 Ga0436362_1195541
2463 Ga0451791_0175252
2464 Ga0451793_1106130
2465 Ga0451793_1469486
2466 Ga0451802_0621294
2467 Ga0439445_0109374
2468 Ga0450894_037402
2469 Ga0439440_0091747
2470 Ga0466969_0195415
2471 Ga0466972_0006422
2472 Ga0466972_0011224
2473 Ga0466972_0292348
2474 Ga0466965_0112501
2475 Ga0466966_0001733
2476 Ga0466966_0103448
2477 Ga0466966_0589695
2478 Ga0466961_0000009
2479 Ga0466961_0210915
2480 Ga0466963_0029623
2481 Ga0466963_0041407
2482 Ga0466968_0041819
2483 Ga0466968_0051956
2484 Ga0466968_0176754
2485 Ga0466970_0225572
2486 Ga0466970_0225722
2487 Ga0466970_0411950
2488 Ga0466970_0431591
2489 Ga0466957_0167912
2490 Ga0466957_0473827
2491 Ga0466960_0068614
2492 Ga0466960_0207382
2493 Ga0466960_0364477
2494 Ga0466959_0003063
2495 Ga0466959_0013181
2496 Ga0466959_0093544
2497 Ga0466967_0041953
2498 Ga0466967_0048933
2499 Ga0466967_0088096
2500 Ga0466967_0382777
2501 Ga0466967_0980112
2502 Ga0495617_038545
2503 Ga0495617_044045
2504 Ga0495592_0000784
2505 Ga0495592_0013597
2506 Ga0495592_0050838
2507 Ga0495592_0463846
2508 Ga0495603_0002122
2509 Ga0495603_0006942
2510 Ga0495603_0019891
2511 Ga0495603_0037990
2512 Ga0495603_0132281
2513 Ga0495603_0169109
2514 Ga0495603_0362620
2515 Ga0495629_0002089
2516 Ga0495629_0004413
2517 Ga0495629_0009291
2518 Ga0495629_0346538
2519 Ga0495629_0373522
2520 Ga0495629_0404528
2521 Ga0495629_0512386
2522 Ga0495638_0012347
2523 Ga0495638_0082490
2524 Ga0495641_0033338
2525 Ga0495651_0002043
2526 Ga0495651_0008079
2527 Ga0495651_0141888
2528 Ga0495651_0172894
2529 Ga0495651_0202893
2530 Ga0495651_0309672
2531 Ga0495653_0010673
2532 Ga0495653_0040516
2533 Ga0495653_0041285
2534 Ga0495653_0110670
2535 Ga0495650_0055441
2536 Ga0495580_0016592
2537 Ga0495580_0165569
2538 Ga0495582_0000331
2539 Ga0495605_0123052
2540 Ga0495639_0000147
2541 Ga0495639_0100913
2542 Ga0495662_0252973
2543 Ga0495662_0267445
2544 Ga0495664_0011748
2545 Ga0495664_0039262
2546 Ga0495664_0061377
2547 Ga0495664_0080416
2548 Ga0495664_0383961
2549 Ga0495584_0052285
2550 Ga0495585_0060847
2551 Ga0495594_0000113
2552 Ga0495594_0270989
2553 Ga0495594_0409542
2554 Ga0495596_0016851
2555 Ga0495583_0058686
2556 Ga0495583_0071311
2557 Ga0495606_0001165
2558 Ga0495606_0055718
2559 Ga0495608_0029134
2560 Ga0495608_0191309
2561 Ga0495610_0147420
2562 Ga0495610_0205231
2563 Ga0495616_0065200
2564 Ga0495616_0097979
2565 Ga0495618_0003202
2566 Ga0495628_0001092
2567 Ga0495628_0055224
2568 Ga0495628_0200683
2569 Ga0495628_0423637
2570 Ga0495630_0010615
2571 Ga0495630_0332641
2572 Ga0495630_0499307
2573 Ga0495631_0033340
2574 Ga0495631_0069634
2575 Ga0495631_0091644
2576 Ga0495631_0146816
2577 Ga0495632_0209701
2578 Ga0495643_0053073
2579 Ga0495643_0176355
2580 Ga0495648_0000378
2581 Ga0495648_0000776
2582 Ga0495663_0045194
2583 Ga0495666_0008723
2584 Ga0495666_0230980
2585 Ga0495642_0181598
2586 Ga0495652_0014813
2587 Ga0495652_0068865
2588 Ga0495652_0082065
2589 Ga0495652_0307290
2590 Ga0495665_0092777
2591 Ga0495640_0003705
2592 Ga0495640_0012355
2593 Ga0495640_0058844
2594 Ga0495640_0086096
2595 Ga0495640_0101679
2596 Ga0495640_0484919
2597 Ga0495586_0096941
2598 Ga0495587_0012965
2599 Ga0495587_0121871
2600 Ga0495598_0049035
2601 Ga0495609_0020594
2602 Ga0495621_0078346
2603 Ga0495597_0154128
2604 Ga0495597_0162603
2605 Ga0495645_0006161
2606 Ga0495645_0008674
2607 Ga0495645_0027745
2608 Ga0495645_0425029
2609 Ga0495622_0010529
2610 Ga0495622_0023366
2611 Ga0495622_0035738
2612 Ga0495633_0058245
2613 Ga0495633_0114930
2614 Ga0495633_0190576
2615 Ga0495667_0000697
2616 Ga0495667_0015284
2617 Ga0495667_0044711
2618 Ga0495667_0069130
2619 Ga0495667_0104381
2620 Ga0495656_0006145
2621 Ga0495656_0099144
2622 Ga0495668_0098885
2623 Ga0495668_0136935
2624 Ga0495668_0146190
2625 Ga0495634_0023917
2626 Ga0495634_0025373
2627 Ga0495634_0052872
2628 Ga0495634_0094506
2629 Ga0495634_0306612
2630 Ga0495611_0030002
2631 Ga0495625_0238953
2632 Ga0495625_0364585
2633 Ga0495635_0000358
2634 Ga0495635_0000491
2635 Ga0495635_0205998
2636 Ga0495635_0306901
2637 Ga0495659_0059441
2638 Ga0495661_0253887
2639 Ga0495588_0090749
2640 Ga0495588_0178007
2641 Ga0495657_0006263
2642 Ga0495657_0033718
2643 Ga0495657_0131208
2644 Ga0495657_0194812
2645 Ga0495599_0017171
2646 Ga0495599_0144290
2647 Ga0495623_0005004
2648 Ga0495623_0006372
2649 Ga0495623_0221525
2650 Ga0495646_0008340
2651 Ga0495646_0020670
2652 Ga0495646_0118464
2653 Ga0495646_0233557
2654 Ga0495647_0000705
2655 Ga0495658_0002450
2656 Ga0495669_0029433
2657 Ga0495669_0030081
2658 Ga0495669_0188547
2659 Ga0495669_0298050
2660 Ga0495613_0094685
2661 Ga0495613_0139273
2662 Ga0495613_0194751
2663 Ga0495624_0003403
2664 Ga0495624_0297235
2665 Ga0495624_0332322
2666 Ga0495670_0061889
2667 Ga0495670_0099903
2668 Ga0495671_0087042
2669 Ga0495649_0322127
2670 Ga0495600_0007576
2671 Ga0495600_0007900
2672 Ga0495600_0014138
2673 Ga0495600_0255328
2674 Ga0495600_0268886
2675 Ga0495600_0387963
2676 Ga0495581_0160458
2677 Ga0495581_0169525
2678 Ga0495581_0327151
2679 Ga0495604_0001200
2680 Ga0495604_0022394
2681 Ga0495636_0056609
2682 Ga0495674_0001226
2683 Ga0495674_0001231
2684 Ga0495674_0033843
2685 Ga0495674_0063283
2686 Ga0495674_0512520
2687 Ga0495672_0000571
2688 Ga0495672_0139516
2689 Ga0495672_0204927
2690 Ga0495672_0270544
2691 Ga0495676_0186919
2692 Ga0495676_0220355
2693 Ga0495680_0001591
2694 Ga0495680_0005953
2695 Ga0495680_0238106
2696 Ga0495683_0083987
2697 Ga0495683_0253907
2698 Ga0495687_061617
2699 Ga0495687_110765
2700 Ga0495675_0002604
2701 Ga0495675_0014401
2702 Ga0495685_050343
2703 Ga0495673_0004400
2704 Ga0495673_0103814
2705 Ga0495681_0166435
2706 Ga0495681_0233991
2707 Ga0495684_0000897
2708 Ga0495684_0113156
2709 Ga0495684_0270226
2710 Ga0495686_0054893
2711 Ga0495686_0084124
2712 Ga0495686_0283812
2713 Ga0495593_0002080
2714 Ga0495593_0002499
2715 Ga0495593_0155042
2716 Ga0495593_0227767
2717 Ga0495602_0000392
2718 Ga0495602_0012486
2719 Ga0495602_0147428
2720 Ga0495626_0095919
2721 Ga0495626_0124934
2722 Ga0496100_0018019
2723 Ga0496100_0117230
2724 Ga0496100_0152155
2725 Ga0496100_0869611
2726 Ga0496101_0203527
2727 Ga0496101_0259375
2728 Ga0496102_0088198
2729 Ga0496102_0120647
2730 Ga0496102_0143930
2731 Ga0496102_0146704
2732 Ga0496102_0188546
2733 Ga0496102_0306964
2734 Ga0496102_0334916
2735 Ga0496103_0066119
2736 Ga0496103_0282495
2737 Ga0496104_0004695
2738 Ga0496104_0014830
2739 Ga0496104_0131260
2740 Ga0496104_0178064
2741 Ga0496104_0521360
2742 Ga0496105_0041160
2743 Ga0496105_0087843
2744 Ga0496105_0288219
2745 Ga0496105_0561925
2746 Ga0496106_0001396
2747 Ga0496106_0007524
2748 Ga0496106_0010594
2749 Ga0496106_0013602
2750 Ga0496106_0019605
2751 Ga0496106_0047429
2752 Ga0496106_0203955
2753 Ga0496106_0356166
2754 Ga0496106_0478172
2755 Ga0496107_0002660
2756 Ga0496107_0054255
2757 Ga0496107_0202486
2758 Ga0496107_0256096
2759 Ga0496108_0002981
2760 Ga0496108_0042560
2761 Ga0496108_0055486
2762 Ga0496108_0120991
2763 Ga0496108_0131707
2764 Ga0496108_0244352
2765 Ga0496108_0326356
2766 Ga0496108_0455741
2767 Ga0496109_0000680
2768 Ga0496109_0015312
2769 Ga0496109_0064596
2770 Ga0496109_0072998
2771 Ga0496109_0099641
2772 Ga0496109_0308605
2773 Ga0496109_0337662
2774 Ga0496109_0567663
2775 Ga0496110_0011018
2776 Ga0496110_0035574
2777 Ga0496110_0206475
2778 Ga0496111_0026885
2779 Ga0496111_0030432
2780 Ga0496111_0038904
2781 Ga0496111_0193417
2782 Ga0496111_0218506
2783 Ga0496112_0000092
2784 Ga0496112_0012339
2785 Ga0496112_0012489
2786 Ga0496112_0029751
2787 Ga0496112_0048156
2788 Ga0496112_0089828
2789 Ga0496112_0211298
2790 Ga0496112_0340943
2791 Ga0496112_0383866
2792 Ga0496113_0031665
2793 Ga0496113_0032428
2794 Ga0496113_0081632
2795 Ga0496113_0084790
2796 Ga0496113_0140703
2797 Ga0496113_0273297
2798 Ga0496113_0473859
2799 Ga0496114_0061159
2800 Ga0496114_0196222
2801 Ga0496114_0271091
2802 Ga0496114_0304370
2803 Ga0496114_0578896
2804 Ga0496115_0002197
2805 Ga0496115_0021622
2806 Ga0496115_0026754
2807 Ga0496115_0059260
2808 Ga0496115_0099283
2809 Ga0496115_0171019
2810 Ga0496115_0174534
2811 Ga0496115_0201925
2812 Ga0496115_0273669
2813 Ga0496116_0004921
2814 Ga0496116_0084957
2815 Ga0496117_0038158
2816 Ga0496117_0067871
2817 Ga0496117_0109453
2818 Ga0496117_0133701
2819 Ga0496117_0366414
2820 Ga0496118_0013106
2821 Ga0496118_0023964
2822 Ga0496118_0177977
2823 Ga0496118_0198522
2824 Ga0496119_0012182
2825 Ga0496119_0018807
2826 Ga0496119_0026413
2827 Ga0496119_0197846
2828 Ga0496120_0081147
2829 Ga0496120_0089965
2830 Ga0496120_0149529
2831 Ga0496121_0001057
2832 Ga0496121_0002390
2833 Ga0496121_0005210
2834 Ga0496121_0007663
2835 Ga0496121_0009900
2836 Ga0496121_0027990
2837 Ga0496121_0033930
2838 Ga0496121_0062971
2839 Ga0496121_0067770
2840 Ga0496121_0103444
2841 Ga0496121_0153540
2842 Ga0496121_0155324
2843 Ga0496121_0157772
2844 Ga0496121_0162864
2845 Ga0496121_0175878
2846 Ga0496121_0205528
2847 Ga0496121_0224413
2848 Ga0496121_0358432
2849 Ga0496122_0116850
2850 Ga0496122_0180775
2851 Ga0496123_0202642
2852 Ga0496123_0293152
2853 Ga0496124_0063109
2854 Ga0496124_0126216
2855 Ga0496124_0138905
2856 Ga0496124_0156141
2857 Ga0496124_0222828
2858 Ga0496124_0310814
2859 Ga0496125_0000237
2860 Ga0496125_0004959
2861 Ga0496125_0007927
2862 Ga0496125_0067041
2863 Ga0496125_0106267
2864 Ga0496125_0122572
2865 Ga0496125_0306968
2866 Ga0496126_0001827
2867 Ga0496126_0007564
2868 Ga0496126_0009154
2869 Ga0496126_0011078
2870 Ga0496126_0012721
2871 Ga0496126_0020967
2872 Ga0496126_0046372
2873 Ga0496126_0054701
2874 Ga0496126_0056206
2875 Ga0496126_0078367
2876 Ga0496126_0083738
2877 Ga0496126_0085832
2878 Ga0496126_0144235
2879 Ga0496126_0168557
2880 Ga0496126_0230604
2881 Ga0496126_0253975
2882 Ga0496126_0261833
2883 Ga0496126_0372119
2884 Ga0496126_0482964
2885 Ga0496126_0503732
2886 Ga0496126_0805188
2887 Ga0495678_147606
2888 Ga0495682_0036048
2889 Ga0495682_0042883
2890 Ga0501031_0006062
2891 Ga0501031_0013983
2892 Ga0501031_0020408
2893 Ga0501032_0001501
2894 Ga0501032_0124903
2895 Ga0501032_0359983
2896 Ga0501033_0000394
2897 Ga0501033_0000639
2898 Ga0501033_0016652
2899 Ga0501033_0090615
2900 Ga0501033_0100323
2901 Ga0501034_0000157
2902 Ga0501034_0068248
2903 Ga0501034_0123784
2904 Ga0501034_0173679
2905 Ga0501034_0270338
2906 Ga0501034_0311051
2907 Ga0501034_0495753
2908 Ga0501036_0000440
2909 Ga0501036_0032056
2910 Ga0501036_0058423
2911 Ga0501036_0089001
2912 Ga0501036_0197573
2913 Ga0501036_0208537
2914 Ga0501036_0242185
2915 Ga0501036_0521308
2916 Ga0501036_0810480
2917 Ga0501037_0000969
2918 Ga0501037_0001723
2919 Ga0501037_0049834
2920 Ga0501037_0057203
2921 Ga0501037_0234287
2922 Ga0501038_0000473
2923 Ga0501038_0010530
2924 Ga0501038_0034189
2925 Ga0501038_0037503
2926 Ga0501038_0096218
2927 Ga0501038_0112741
2928 Ga0501038_0143120
2929 Ga0501038_0238474
2930 Ga0501038_0643035
2931 Ga0501039_0002012
2932 Ga0501039_0006007
2933 Ga0501039_0109240
2934 Ga0501039_0123997
2935 Ga0501040_0244174
2936 Ga0501040_0256419
2937 Ga0501041_0069312
2938 Ga0501042_0065242
2939 Ga0501042_0080850
2940 Ga0501043_0002014
2941 Ga0501043_0003168
2942 Ga0501043_0016557
2943 Ga0501043_0051045
2944 Ga0501043_0071243
2945 Ga0501043_0110503
2946 Ga0501043_0121514
2947 Ga0501043_0151668
2948 Ga0501043_0153968
2949 Ga0501043_0398883
2950 Ga0501046_0026559
2951 Ga0501046_0043974
2952 Ga0501046_0054587
2953 Ga0501046_0062722
2954 Ga0501046_0122020
2955 Ga0501047_0000419
2956 Ga0501047_0052635
2957 Ga0501047_0274357
2958 Ga0501047_0375785
2959 Ga0501047_0388877
2960 Ga0501047_0502243
2961 Ga0501048_0000057
2962 Ga0501048_0099098
2963 Ga0501048_0556373
2964 Ga0501067_0000507
2965 Ga0501067_0023557
2966 Ga0501067_0154639
2967 Ga0501067_0176722
2968 Ga0501067_0195646
2969 Ga0501067_0389095
2970 Ga0501068_0004195
2971 Ga0501068_0066490
2972 Ga0501068_0071854
2973 Ga0501069_0006517
2974 Ga0501069_0218198
2975 Ga0501070_0029682
2976 Ga0501070_0061196
2977 Ga0501070_0115060
2978 Ga0501070_0204862
2979 Ga0501070_0719349
2980 Ga0501071_0056300
2981 Ga0501071_0083928
2982 Ga0501071_0166824
2983 Ga0501071_0281672
2984 Ga0501071_0641394
2985 Ga0501072_0053425
2986 Ga0501072_0313805
2987 Ga0501073_0000027
2988 Ga0501073_0017325
2989 Ga0501073_0090860
2990 Ga0501073_0169705
2991 Ga0501073_0171015
2992 Ga0501073_0698533
2993 Ga0501074_0000081
2994 Ga0501074_0374537
2995 Ga0501076_0078412
2996 Ga0501077_0077707
2997 Ga0501079_0068811
2998 Ga0501079_0080208
2999 Ga0501079_0082616
3000 Ga0501080_0000313
3001 Ga0501080_0025448
3002 Ga0501080_0316932
3003 Ga0501083_0062728
3004 Ga0501035_0000145
3005 Ga0501035_0002494
3006 Ga0501035_0043031
3007 Ga0501035_0045019
3008 Ga0501035_0145887
3009 Ga0501035_0159854
3010 Ga0501035_0169311
3011 Ga0501035_0175867
3012 Ga0501035_0521166
3013 Ga0501035_0535663
3014 Ga0501044_0002483
3015 Ga0501044_0016900
3016 Ga0501044_0017556
3017 Ga0501044_0028759
3018 Ga0501044_0037365
3019 Ga0501044_0047612
3020 Ga0501044_0070464
3021 Ga0501044_0086992
3022 Ga0501044_0316040
3023 Ga0501044_0715447
3024 Ga0501045_0032630
3025 Ga0501045_0065645
3026 Ga0501045_0287662
3027 nmdc:mga03683_84769_c1
3028 nmdc:mga03n38_130777_c1
3029 nmdc:mga03n38_174286_c1
3030 nmdc:mga03n38_84922_c1
3031 nmdc:mga00v17_106208_c1
3032 nmdc:mga00v17_17072_c1
3033 nmdc:mga00v17_339804_c1
3034 nmdc:mga00v17_535846_c1
3035 nmdc:mga0yw44_131148_c1
3036 nmdc:mga0yw44_188824_c1
3037 nmdc:mga0yw44_50814_c1
3038 nmdc:mga0yw44_65741_c1
3039 nmdc:mga0yw44_76420_c1
3040 nmdc:mga0yw44_83502_c1
3041 nmdc:mga0k408_39324_c1
3042 nmdc:mga06z11_102090_c1
3043 nmdc:mga06z11_142812_c1
3044 nmdc:mga06z11_231002_c1
3045 nmdc:mga06z11_276815_c1
3046 nmdc:mga06z11_30175_c1
3047 nmdc:mga06z11_4552_c1
3048 nmdc:mga06z11_51386_c1
3049 nmdc:mga04h51_27619_c1
3050 nmdc:mga07m45_102463_c1
3051 nmdc:mga07m45_26107_c1
3052 nmdc:mga07m45_43386_c1
3053 nmdc:mga07m45_76241_c1
3054 nmdc:mga05p37_787746_c1
3055 nmdc:mga0n895_92008_c1
3056 nmdc:mga0rr50_144537_c1
3057 nmdc:mga0a205_175450_c1
3058 nmdc:mga0sz30_23579_c1
3059 nmdc:mga0sz30_41151_c1
3060 nmdc:mga0sz30_89970_c1
3061 Ga0495601_0062758
3062 Ga0495612_0022880
3063 Ga0500610_0232167
3064 Ga0500635_0002242
3065 Ga0500635_0002742
3066 Ga0500635_0048704
3067 Ga0500635_0096552
3068 Ga0495655_0043650
3069 Ga0495595_0015715
3070 Ga0495619_0000858
3071 Ga0495619_0157808
3072 Ga0500578_0088881
3073 Ga0500643_000016
3074 Ga0500643_069541
3075 Ga0500647_0065379
3076 Ga0500583_0274754
3077 Ga0500651_0026230
3078 Ga0500651_0061210
3079 Ga0500566_0000394
3080 Ga0500566_0000751
3081 Ga0500566_0015160
3082 Ga0500566_0030466
3083 Ga0500640_001550
3084 Ga0500641_0130716
3085 Ga0500650_0021151
3086 Ga0500554_010908
3087 Ga0500554_018859
3088 Ga0500555_005870
3089 Ga0500556_0000238
3090 Ga0500556_0002504
3091 Ga0500557_000018
3092 Ga0500557_029595
3093 Ga0500562_020364
3094 Ga0500569_002333
3095 Ga0500569_045967
3096 Ga0500569_072778
3097 Ga0500572_000156
3098 Ga0500572_002564
3099 Ga0500592_002853
3100 Ga0500594_0035745
3101 Ga0500595_001005
3102 Ga0500595_007607
3103 Ga0500595_010518
3104 Ga0500595_011210
3105 Ga0500595_012247
3106 Ga0500595_017583
3107 Ga0500595_024242
3108 Ga0500608_022516
3109 Ga0500608_044580
3110 Ga0500608_102162
3111 Ga0500608_136341
3112 Ga0500614_001247
3113 Ga0500614_024310
3114 Ga0500618_003296
3115 Ga0500642_0000069
3116 Ga0500642_0000092
3117 Ga0500642_0130915
3118 Ga0500652_000258
3119 Ga0500652_035989
3120 Ga0500658_0135180
3121 Ga0500559_0000377
3122 Ga0500559_0000492
3123 Ga0500559_0000657
3124 Ga0500559_0001182
3125 Ga0500559_0027168
3126 Ga0500559_0117128
3127 Ga0500568_0005790
3128 Ga0500568_0037767
3129 Ga0500568_0056219
3130 Ga0500573_0081236
3131 Ga0500577_0000068
3132 Ga0500577_0037067
3133 Ga0500577_0114735
3134 Ga0500577_0167508
3135 Ga0500586_002258
3136 Ga0500589_154640
3137 Ga0500590_025525
3138 Ga0500590_101169
3139 Ga0500590_120217
3140 Ga0500603_000254
3141 Ga0500603_001083
3142 Ga0500603_064876
3143 Ga0500604_0006587
3144 Ga0500604_0022060
3145 Ga0500616_0000197
3146 Ga0500619_102485
3147 Ga0500622_0000966
3148 Ga0500622_0104018
3149 Ga0500627_0014629
3150 Ga0500627_0065476
3151 Ga0500630_000834
3152 Ga0500638_007204
3153 Ga0500638_090931
3154 Ga0500638_176455
3155 Ga0500639_001931
3156 Ga0500639_008061
3157 Ga0500636_0000223
3158 Ga0500636_0021262
3159 Ga0500636_0081672
3160 Ga0500636_0112613
3161 Ga0500636_0214640
3162 Ga0500637_0000090
3163 Ga0500637_0029621
3164 Ga0500637_0218248
3165 Ga0500637_0316676
3166 Ga0500570_108629
3167 Ga0500645_019942
3168 Ga0500552_001014
3169 Ga0500596_000920
3170 Ga0500596_001030
3171 Ga0500599_003555
3172 Ga0500601_000084
3173 Ga0500601_004047
3174 Ga0500601_009318
3175 Ga0501084_0072304
3176 Ga0500661_000273
3177 Ga0500661_016039
3178 Ga0501082_0002728
3179 Ga0501082_0024361
3180 Ga0501082_0176163
3181 2507511340
3182 2508545138
3183 2508693978
3184 2509146674
3185 2511401080
3186 2513624176
3187 2513641146
3188 2513648599
3189 2513656049
3190 2513675241
3191 2513696397
3192 2513704334
3193 2513717862
3194 2513862853
3195 2513874921
3196 2513887668
3197 2513920943
3198 2514010356
3199 2515625076
3200 2517101078
3201 2517895870
3202 2524439979
3203 2524469158
3204 2524534748
3205 2528856808
3206 2603857512
3207 2617348510
3208 2617375063
3209 2644287255
3210 2671122670
3211 2723842903
3212 2728749602
3213 2793061707
3214 2793069696
3215 2793080209
3216 2805916491
3217 2818243481
3218 2824604328
3219 2824614199
3220 2824619574
3221 2824629010
3222 2824635677
3223 2824652971
3224 2824656458
3225 2824671267
3226 2824679573
3227 2824687818
3228 2824696219
3229 2824704509
3230 2824714515
3231 2824723758
3232 2824732823
3233 2824740862
3234 2824753768
3235 2824754144
3236 2824771651
3237 2824780550
3238 2838129009
3239 2841948286
3240 2841957218
3241 2841961491
3242 2841970138
3243 2841977217
3244 2841985651
3245 2842042388
3246 2842050431
3247 2844316582
3248 2847939117
3249 2847943938
3250 2849081835
3251 2857512594
3252 2857526899
3253 2874594559
3254 2874606435
3255 2874613913
3256 2874625554
3257 2874633762
3258 2874649607
3259 2876773691
3260 2876817886
3261 2876820682
3262 2879076884
3263 2879084589
3264 2879101151
3265 2879113693
3266 2879130328
3267 2879146844
3268 2881367364
3269 2881668742
3270 2885366568
3271 2885381579
3272 2885387486
3273 2885413503
3274 2888386864
3275 2888389587
3276 2888421508
3277 2889033780
3278 2893070056
3279 2903731352
3280 2903756034
3281 2903770364
3282 2904673500
3283 2904693353
3284 2904707006
3285 2904719475
3286 2906603818
3287 2906615661
3288 2906635031
3289 2906646090
3290 2906665098
3291 2908745523
3292 2908759430
3293 2908777549
3294 2919078016
3295 2922367181
3296 2922377018
3297 2922390085
3298 2922398174
3299 2922432348
3300 2929619154
3301 2929628351
3302 2932791278
3303 2932795705
3304 2932801944
3305 2932817694
3306 2932826978
3307 2932833153
3308 2933581076
3309 2935612331
3310 2935620570
3311 2935630821
3312 2935639657
3313 2935650173
3314 2935658320
3315 2935667505
3316 2935682930
3317 2935687597
3318 2935696432
3319 2935705245
3320 2935719057
3321 2935728709
3322 2935736695
3323 2935746303
3324 2935753563
3325 2935767755
3326 2935770513
3327 2935782466
3328 2935786434
3329 2935794489
3330 2935806991
3331 2935814091
3332 2935823819
3333 2935829140
3334 2935845326
3335 2935854457
3336 2935858378
3337 2935872314
3338 2935877339
3339 2935886131
3340 2935913452
3341 2935923348
3342 2935931231
3343 2935935513
3344 2935947079
3345 2935953826
3346 2935961534
3347 2935968852
3348 2935982484
3349 2935985952
3350 2935995042
3351 2936006135
3352 2936013268
3353 2936021645
3354 2936030561
3355 2936039646
3356 2936047839
3357 2936057841
3358 2940559476
3359 2941507473
3360 2941515900
3361 2941523392
3362 2941537043
3363 2941545703
3364 3005476690
3365 3005488280
3366 3005511224
3367 3005592088
3368 3005596203
3369 3005712139
3370 8006934789
3371 8006966708
3372 8006974757
3373 8006989619
3374 8006998010
3375 8016516885
3376 8016524478
3377 8016538038
3378 8016542311
3379 8016550968
3380 8016567698
3381 8016580392
3382 8016588771
3383 8016597316
3384 8016604941
3385 8016620067
3386 8016624292
3387 8016637703
3388 8017059686
3389 8019537705
3390 8019539336
3391 8019551309
3392 8019563864
3393 8019573935
3394 8019604480
3395 8019614056
3396 8019624589
3397 8019637444
3398 8019642165
3399 8019650355
3400 8019665381
3401 8019674926
3402 8019681169
3403 8019694533
3404 8055749588
3405 8056675045
3406 8056681881
3407 8056696280
3408 8056973784

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

70

166

0.95

PF13649

Methyltransf_25

Methyltransferase domain

69

162

0.93

PF08242

Methyltransf_12

Methyltransferase domain

70

164

0.9

PF13847

Methyltransf_31

Methyltransferase domain

63

192

0.89

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

30

178

0.86

PF13489

Methyltransf_23

Methyltransferase domain

46

211

0.79

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

60

182

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wzn-assembly1.cif.gz_A crystal structure of the sam-dependent methyltransferase from pyrococcus horikoshii ot3 0.8227 11 144
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.815 12 211
1xxl-assembly2.cif.gz_B the crystal structure of ycgj protein from bacillus subitilis at 2.1 a resolution 0.8121 32 210
1vl5-assembly4.cif.gz_D crystal structure of a putative methyltransferase (bh2331) from bacillus halodurans c-125 at 1.95 a resolution 0.7972 34 210
6f5z-assembly1.cif.gz_B complex between the haloferax volcanii trm112 methyltransferase activator and the hvo_0019 putative methyltransferase 0.796 9 210
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.868 44 95 3.40.50.150
af_F1R3E3_35_208_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8603 32 141 3.40.50.150
af_Q7YWR7_1_204_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8491 26 208 3.40.50.150
af_Q4E3J0_145_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8335 46 93 3.40.50.150
af_Q4DS78_179_367_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8284 29 211 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7V8AIV5-F1-model_v4 Putative N-methyltransferase 0.9231 7 211 GO:0008757
GO:0032259
AF-A0A3C1YWK4-F1-model_v4 SAM-dependent methyltransferase 0.9143 5 123 GO:0008168
GO:0032259
AF-A0A533ZLT2-F1-model_v4 Methyltransferase domain-containing protein 0.9106 1 209 GO:0008757
GO:0032259
AF-A0A7Y7M866-F1-model_v4 Class I SAM-dependent methyltransferase 0.9068 5 211 GO:0008757
GO:0032259
AF-A0A3D5Y937-F1-model_v4 SAM-dependent methyltransferase 0.9045 7 143 GO:0008757
GO:0032259

Map