F495405
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1704 | 747 | 3408 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300049568|Ga0501031_0109785|Ga0501031_0109785_65_769 |
| Length | 234 |
| Sequence | MALLRNRVASQRCADSKVSGRGMGNDIDRAGVAKAYGRWAPIYDLVFGKVFDQGRQSTIAVADKIGGRILDVGVGTGLSLSDYSRSTRLCGVDISEPMLRKAQERVRKLELDNVETLAVMDAKNLAFPDDFFDAVVAQYVITAVPDPEATLDDFIRVLKPGGELILVNHIGAESGLRRISELAFAPLARRLGWRPEFPWARLVNWAAKHGGVSLAERRPMPPMGHFSLIRYRKM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 91 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 92 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 95 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 96 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 126 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 127 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 128 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 129 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 130 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 131 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 132 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 206 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 207 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 208 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 209 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 214 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 217 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 218 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 221 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 224 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 225 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 226 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 229 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 230 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 231 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 233 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 236 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 237 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 239 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 240 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 241 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 243 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 244 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 245 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 246 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 247 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 248 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 249 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 250 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 256 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 258 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 260 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 265 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 266 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 268 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 269 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 270 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 272 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 273 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 275 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 276 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 277 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 278 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 279 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 280 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 281 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 282 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 283 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 284 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 287 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 288 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 289 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 290 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 291 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 292 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 293 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 294 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 295 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 296 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 297 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 298 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 299 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 300 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 301 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 302 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 391 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 392 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 393 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 394 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 395 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 396 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 397 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 398 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 400 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 401 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 402 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 403 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 404 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 405 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 406 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 407 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 408 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 409 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 410 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 411 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 412 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 413 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 414 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 415 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 416 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 449 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 450 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 451 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 452 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 453 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 454 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 455 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 456 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 461 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 464 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 465 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 469 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 470 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 471 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 472 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 473 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 474 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 475 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 476 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 477 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 478 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 479 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 480 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 481 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 482 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 483 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 484 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 485 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 486 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 487 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 488 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 489 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 490 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 491 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 492 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 493 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 494 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 495 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 496 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 497 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 498 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 499 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 500 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 501 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 502 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 503 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 504 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 505 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 506 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 507 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 508 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 509 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 510 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 511 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 512 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 513 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 514 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 515 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 516 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 517 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 518 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 519 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 520 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 521 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 522 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 523 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 524 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 525 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 526 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 527 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 528 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 529 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 530 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 531 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 532 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 533 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 534 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 535 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 536 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 537 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 538 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 539 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 540 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 541 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 542 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 543 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 544 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 545 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 546 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 547 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 548 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 549 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 550 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 551 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 552 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 553 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 554 | 2791355199 | |||
| 555 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 556 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 557 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 558 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 559 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 560 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 561 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 562 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 563 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 564 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 565 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 566 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 567 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 568 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 569 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 570 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 571 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 572 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 573 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 574 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 575 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 576 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 577 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 578 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 579 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 580 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 581 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 582 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 583 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 584 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 585 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 586 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 587 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 588 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 589 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 590 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 591 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 592 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 593 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 594 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 595 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 596 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 597 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 598 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 599 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 600 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 601 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 602 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 603 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 604 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 605 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 606 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 607 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 608 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 609 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 610 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 611 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 612 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 613 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 614 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 615 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 616 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 617 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 618 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 619 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 620 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 621 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 622 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 623 | 2904699407 | |||
| 624 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 625 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 626 | 2906610324 | |||
| 627 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 628 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 629 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 630 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 631 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 632 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 633 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 634 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 635 | 2922368715 | |||
| 636 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 637 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 638 | 2922425934 | |||
| 639 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 640 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 641 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 642 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 643 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 644 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 645 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 646 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 647 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 648 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 649 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 650 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 651 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 652 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 653 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 654 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 655 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 656 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 657 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 658 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 659 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 660 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 661 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 662 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 663 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 664 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 665 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 666 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 667 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 668 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 669 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 670 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 671 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 672 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 673 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 674 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 675 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 676 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 677 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 678 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 679 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 680 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 681 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 682 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 683 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 684 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 685 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 686 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 687 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 688 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 689 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 690 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 691 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 692 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 693 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 694 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 695 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 696 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 697 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 698 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 699 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 700 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 701 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 702 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 703 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 704 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 705 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 706 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 707 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 708 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 709 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 710 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 711 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 712 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 713 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 714 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 715 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 716 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 717 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 718 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 719 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 720 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 721 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 722 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 723 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 724 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 725 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 726 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 727 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 728 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 729 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 730 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 731 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 732 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 733 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 734 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 735 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 736 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 737 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 738 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 739 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 740 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 741 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 742 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 743 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 744 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 745 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 746 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 747 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.82 |
| Metatranscriptomes | 0.06 |
| Isolates | 13.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.27 |
| Nodule | 10.86 |
| Rhizoplane | 5.69 |
| Rhizosphere | 61.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501031_0109785 | 3300049568 | Bacteria | 1801 |
| 2 | JGI24740J21852_10014866 | 3300001979 | Bacteria | 2858 |
| 3 | JGI24739J22299_10062404 | 3300001989 | Bacteria | 1175 |
| 4 | JGI24737J22298_10010976 | 3300001990 | Bacteria | 2975 |
| 5 | JGI25406J46586_10000042 | 3300003203 | Bacteria | 56211 |
| 6 | JGI25406J46586_10001667 | 3300003203 | Bacteria | 10494 |
| 7 | JGI25153J46596_10003624 | 3300003215 | Bacteria | 8573 |
| 8 | JGI25153J46596_10003958 | 3300003215 | Bacteria | 8110 |
| 9 | JGI25153J46596_10004459 | 3300003215 | Bacteria | 7547 |
| 10 | JGI25153J46596_10005398 | 3300003215 | Bacteria | 6714 |
| 11 | JGI25153J46596_10020255 | 3300003215 | Bacteria | 2520 |
| 12 | JGI25153J46596_10091220 | 3300003215 | Bacteria | 736 |
| 13 | JGI25160J50197_1001455 | 3300003354 | Bacteria | 11797 |
| 14 | JGI25160J50197_1012378 | 3300003354 | Bacteria | 2964 |
| 15 | JGI25160J50197_1020115 | 3300003354 | Bacteria | 2025 |
| 16 | JGI25404J52841_10008161 | 3300003659 | Bacteria | 2225 |
| 17 | JGI25404J52841_10012359 | 3300003659 | Bacteria | 1848 |
| 18 | Ga0055531_10012265 | 3300003794 | Bacteria | 4047 |
| 19 | Ga0055543_1014579 | 3300004625 | Bacteria | 1530 |
| 20 | Ga0055543_1031128 | 3300004625 | Bacteria | 931 |
| 21 | Ga0065165_1003252 | 3300005262 | Bacteria | 11764 |
| 22 | Ga0065165_1045488 | 3300005262 | Bacteria | 1278 |
| 23 | Ga0070658_10269128 | 3300005327 | Bacteria | 1449 |
| 24 | Ga0070658_10290974 | 3300005327 | Bacteria | 1392 |
| 25 | Ga0070658_10724403 | 3300005327 | Bacteria | 864 |
| 26 | Ga0070676_10110009 | 3300005328 | Bacteria | 1714 |
| 27 | Ga0070676_10281542 | 3300005328 | Bacteria | 1121 |
| 28 | Ga0070683_100027061 | 3300005329 | Bacteria | 5169 |
| 29 | Ga0070683_100138895 | 3300005329 | Bacteria | 2302 |
| 30 | Ga0070683_100231044 | 3300005329 | Bacteria | 1758 |
| 31 | Ga0070683_100232105 | 3300005329 | Bacteria | 1754 |
| 32 | Ga0070683_100552737 | 3300005329 | Bacteria | 1101 |
| 33 | Ga0070670_100311659 | 3300005331 | Bacteria | 1378 |
| 34 | Ga0068869_100169996 | 3300005334 | Bacteria | 1702 |
| 35 | Ga0068869_100497135 | 3300005334 | Bacteria | 1018 |
| 36 | Ga0070666_10483489 | 3300005335 | Bacteria | 897 |
| 37 | Ga0070680_100064005 | 3300005336 | Bacteria | 3014 |
| 38 | Ga0070680_100271460 | 3300005336 | Bacteria | 1436 |
| 39 | Ga0070680_100385533 | 3300005336 | Bacteria | 1194 |
| 40 | Ga0070682_100651278 | 3300005337 | Bacteria | 839 |
| 41 | Ga0068868_100101422 | 3300005338 | Bacteria | 2329 |
| 42 | Ga0070660_100078251 | 3300005339 | Bacteria | 2593 |
| 43 | Ga0070660_100270633 | 3300005339 | Bacteria | 1388 |
| 44 | Ga0070689_100854221 | 3300005340 | Bacteria | 803 |
| 45 | Ga0070691_10055625 | 3300005341 | Bacteria | 1896 |
| 46 | Ga0070661_100240955 | 3300005344 | Bacteria | 1393 |
| 47 | Ga0070668_100143978 | 3300005347 | Bacteria | 1923 |
| 48 | Ga0070668_100183723 | 3300005347 | Bacteria | 1709 |
| 49 | Ga0070668_100270021 | 3300005347 | Bacteria | 1417 |
| 50 | Ga0070675_100191849 | 3300005354 | Bacteria | 1771 |
| 51 | Ga0070671_100570463 | 3300005355 | Bacteria | 977 |
| 52 | Ga0070688_100206954 | 3300005365 | Bacteria | 1376 |
| 53 | Ga0070688_100377636 | 3300005365 | Bacteria | 1044 |
| 54 | Ga0070659_100119271 | 3300005366 | Bacteria | 2135 |
| 55 | Ga0070667_100112801 | 3300005367 | Bacteria | 2358 |
| 56 | Ga0070667_100166124 | 3300005367 | Bacteria | 1947 |
| 57 | Ga0070667_100299974 | 3300005367 | Bacteria | 1446 |
| 58 | Ga0070703_10120268 | 3300005406 | Bacteria | 952 |
| 59 | Ga0070709_10005705 | 3300005434 | Bacteria | 6751 |
| 60 | Ga0070709_10010069 | 3300005434 | Bacteria | 5225 |
| 61 | Ga0070709_10019609 | 3300005434 | Bacteria | 3912 |
| 62 | Ga0070709_10068994 | 3300005434 | Bacteria | 2275 |
| 63 | Ga0070709_10170714 | 3300005434 | Bacteria | 1519 |
| 64 | Ga0070714_100037560 | 3300005435 | Bacteria | 4070 |
| 65 | Ga0070714_100046348 | 3300005435 | Bacteria | 3688 |
| 66 | Ga0070714_100057181 | 3300005435 | Bacteria | 3337 |
| 67 | Ga0070714_100134760 | 3300005435 | Bacteria | 2211 |
| 68 | Ga0070714_100196604 | 3300005435 | Bacteria | 1843 |
| 69 | Ga0070714_100202282 | 3300005435 | Bacteria | 1817 |
| 70 | Ga0070714_100272495 | 3300005435 | Bacteria | 1570 |
| 71 | Ga0070714_100293469 | 3300005435 | Bacteria | 1514 |
| 72 | Ga0070714_100417929 | 3300005435 | Bacteria | 1270 |
| 73 | Ga0070714_100863884 | 3300005435 | Bacteria | 878 |
| 74 | Ga0070713_100004677 | 3300005436 | Bacteria | 9240 |
| 75 | Ga0070713_100005417 | 3300005436 | Bacteria | 8716 |
| 76 | Ga0070713_100058128 | 3300005436 | Bacteria | 3224 |
| 77 | Ga0070713_100073758 | 3300005436 | Bacteria | 2890 |
| 78 | Ga0070713_100085786 | 3300005436 | Bacteria | 2698 |
| 79 | Ga0070713_100340016 | 3300005436 | Bacteria | 1390 |
| 80 | Ga0070710_10002398 | 3300005437 | Bacteria | 8871 |
| 81 | Ga0070710_10010404 | 3300005437 | Bacteria | 4570 |
| 82 | Ga0070710_10466156 | 3300005437 | Bacteria | 859 |
| 83 | Ga0070711_100004055 | 3300005439 | Bacteria | 8612 |
| 84 | Ga0070711_100022948 | 3300005439 | Bacteria | 4051 |
| 85 | Ga0070711_100029370 | 3300005439 | Bacteria | 3627 |
| 86 | Ga0070711_100253007 | 3300005439 | Bacteria | 1383 |
| 87 | Ga0070700_100058073 | 3300005441 | Bacteria | 2429 |
| 88 | Ga0070694_100497595 | 3300005444 | Bacteria | 969 |
| 89 | Ga0070708_100094717 | 3300005445 | Bacteria | 2724 |
| 90 | Ga0070663_100061894 | 3300005455 | Bacteria | 2697 |
| 91 | Ga0070663_100110883 | 3300005455 | Bacteria | 2061 |
| 92 | Ga0070663_100124997 | 3300005455 | Bacteria | 1948 |
| 93 | Ga0070663_100131703 | 3300005455 | Bacteria | 1900 |
| 94 | Ga0070663_100199904 | 3300005455 | Bacteria | 1559 |
| 95 | Ga0070663_100201024 | 3300005455 | Bacteria | 1555 |
| 96 | Ga0070678_100004745 | 3300005456 | Bacteria | 7749 |
| 97 | Ga0070678_100049918 | 3300005456 | Bacteria | 3022 |
| 98 | Ga0070678_100058533 | 3300005456 | Bacteria | 2828 |
| 99 | Ga0070678_100326168 | 3300005456 | Bacteria | 1312 |
| 100 | Ga0070662_100354046 | 3300005457 | Bacteria | 1203 |
| 101 | Ga0070662_100509484 | 3300005457 | Bacteria | 1004 |
| 102 | Ga0070681_10106354 | 3300005458 | Bacteria | 2747 |
| 103 | Ga0070681_10154946 | 3300005458 | Bacteria | 2216 |
| 104 | Ga0070681_10174097 | 3300005458 | Bacteria | 2074 |
| 105 | Ga0070681_10191774 | 3300005458 | Bacteria | 1963 |
| 106 | Ga0070681_10291231 | 3300005458 | Bacteria | 1543 |
| 107 | Ga0068867_100223826 | 3300005459 | Bacteria | 1517 |
| 108 | Ga0068867_100426455 | 3300005459 | Bacteria | 1125 |
| 109 | Ga0070707_100950178 | 3300005468 | Bacteria | 824 |
| 110 | Ga0070698_100117254 | 3300005471 | Bacteria | 2625 |
| 111 | Ga0070698_100465334 | 3300005471 | Bacteria | 1200 |
| 112 | Ga0070699_100194289 | 3300005518 | Bacteria | 1803 |
| 113 | Ga0070679_100009107 | 3300005530 | Bacteria | 9367 |
| 114 | Ga0070679_100018046 | 3300005530 | Bacteria | 6839 |
| 115 | Ga0070679_100061391 | 3300005530 | Bacteria | 3746 |
| 116 | Ga0070684_100002381 | 3300005535 | Bacteria | 13855 |
| 117 | Ga0070684_100019269 | 3300005535 | Bacteria | 5641 |
| 118 | Ga0070697_100000384 | 3300005536 | Bacteria | 34537 |
| 119 | Ga0068853_100008031 | 3300005539 | Bacteria | 8464 |
| 120 | Ga0068853_100043449 | 3300005539 | Bacteria | 3844 |
| 121 | Ga0068853_100131164 | 3300005539 | Bacteria | 2243 |
| 122 | Ga0068853_100160177 | 3300005539 | Bacteria | 2030 |
| 123 | Ga0068853_100230163 | 3300005539 | Bacteria | 1695 |
| 124 | Ga0068853_100294048 | 3300005539 | Bacteria | 1500 |
| 125 | Ga0070672_100059107 | 3300005543 | Bacteria | 3015 |
| 126 | Ga0070672_100169209 | 3300005543 | Bacteria | 1816 |
| 127 | Ga0070672_100210649 | 3300005543 | Bacteria | 1628 |
| 128 | Ga0070672_101194447 | 3300005543 | Bacteria | 677 |
| 129 | Ga0070693_100188144 | 3300005547 | Bacteria | 1334 |
| 130 | Ga0070665_100008983 | 3300005548 | Bacteria | 10124 |
| 131 | Ga0070665_100009227 | 3300005548 | Bacteria | 9995 |
| 132 | Ga0070665_100029464 | 3300005548 | Bacteria | 5525 |
| 133 | Ga0070665_100032495 | 3300005548 | Bacteria | 5252 |
| 134 | Ga0070665_100120727 | 3300005548 | Bacteria | 2622 |
| 135 | Ga0070665_100136332 | 3300005548 | Bacteria | 2457 |
| 136 | Ga0070665_100205831 | 3300005548 | Bacteria | 1968 |
| 137 | Ga0070665_100273272 | 3300005548 | Bacteria | 1692 |
| 138 | Ga0068855_100005308 | 3300005563 | Bacteria | 15738 |
| 139 | Ga0068855_100006278 | 3300005563 | Bacteria | 14485 |
| 140 | Ga0068855_100050315 | 3300005563 | Bacteria | 4911 |
| 141 | Ga0068855_100124785 | 3300005563 | Bacteria | 2944 |
| 142 | Ga0068855_100256893 | 3300005563 | Bacteria | 1948 |
| 143 | Ga0068855_100561714 | 3300005563 | Bacteria | 1234 |
| 144 | Ga0068855_100581282 | 3300005563 | Bacteria | 1210 |
| 145 | Ga0070664_100177934 | 3300005564 | Bacteria | 1889 |
| 146 | Ga0070664_100255596 | 3300005564 | Bacteria | 1576 |
| 147 | Ga0068857_100014818 | 3300005577 | Bacteria | 6800 |
| 148 | Ga0068857_100053478 | 3300005577 | Bacteria | 3582 |
| 149 | Ga0068857_100062088 | 3300005577 | Bacteria | 3321 |
| 150 | Ga0068857_100170413 | 3300005577 | Bacteria | 1978 |
| 151 | Ga0068857_100216970 | 3300005577 | Bacteria | 1747 |
| 152 | Ga0068854_100024638 | 3300005578 | Bacteria | 4122 |
| 153 | Ga0068854_100123948 | 3300005578 | Bacteria | 1965 |
| 154 | Ga0068854_100328821 | 3300005578 | Bacteria | 1245 |
| 155 | Ga0068854_100462700 | 3300005578 | Bacteria | 1061 |
| 156 | Ga0068856_100002141 | 3300005614 | Bacteria | 20471 |
| 157 | Ga0068856_100085937 | 3300005614 | Bacteria | 3125 |
| 158 | Ga0068856_100122345 | 3300005614 | Bacteria | 2604 |
| 159 | Ga0068856_100125076 | 3300005614 | Bacteria | 2574 |
| 160 | Ga0068856_100199610 | 3300005614 | Bacteria | 2015 |
| 161 | Ga0068856_100371752 | 3300005614 | Bacteria | 1448 |
| 162 | Ga0068852_100290760 | 3300005616 | Bacteria | 1578 |
| 163 | Ga0068852_100739384 | 3300005616 | Bacteria | 995 |
| 164 | Ga0068852_100863893 | 3300005616 | Bacteria | 921 |
| 165 | Ga0068859_100142745 | 3300005617 | Bacteria | 2468 |
| 166 | Ga0068859_100201571 | 3300005617 | Bacteria | 2074 |
| 167 | Ga0068859_100268483 | 3300005617 | Bacteria | 1798 |
| 168 | Ga0068859_100687638 | 3300005617 | Bacteria | 1114 |
| 169 | Ga0068864_100101958 | 3300005618 | Bacteria | 2546 |
| 170 | Ga0068861_100027676 | 3300005719 | Bacteria | 4132 |
| 171 | Ga0068851_10001857 | 3300005834 | Bacteria | 9268 |
| 172 | Ga0068870_10243328 | 3300005840 | Bacteria | 1112 |
| 173 | Ga0068863_100082299 | 3300005841 | Bacteria | 3050 |
| 174 | Ga0068863_100087604 | 3300005841 | Bacteria | 2950 |
| 175 | Ga0068863_100174377 | 3300005841 | Bacteria | 2063 |
| 176 | Ga0068858_100006904 | 3300005842 | Bacteria | 11036 |
| 177 | Ga0068858_100011239 | 3300005842 | Bacteria | 8459 |
| 178 | Ga0068858_100053134 | 3300005842 | Bacteria | 3748 |
| 179 | Ga0068858_100130519 | 3300005842 | Bacteria | 2356 |
| 180 | Ga0068858_100528846 | 3300005842 | Bacteria | 1141 |
| 181 | Ga0068858_100873429 | 3300005842 | Bacteria | 879 |
| 182 | Ga0068860_100001883 | 3300005843 | Bacteria | 22289 |
| 183 | Ga0068860_100028726 | 3300005843 | Bacteria | 5353 |
| 184 | Ga0068860_100142004 | 3300005843 | Bacteria | 2308 |
| 185 | Ga0068860_100570854 | 3300005843 | Bacteria | 1135 |
| 186 | Ga0068860_100574963 | 3300005843 | Bacteria | 1130 |
| 187 | Ga0068862_100074257 | 3300005844 | Bacteria | 2939 |
| 188 | Ga0068862_100103057 | 3300005844 | Bacteria | 2498 |
| 189 | Ga0068862_100513237 | 3300005844 | Bacteria | 1139 |
| 190 | Ga0068862_100922915 | 3300005844 | Bacteria | 859 |
| 191 | Ga0068862_101038629 | 3300005844 | Bacteria | 812 |
| 192 | Ga0081455_10006143 | 3300005937 | Bacteria | 12966 |
| 193 | Ga0081455_10034784 | 3300005937 | Bacteria | 4511 |
| 194 | Ga0081455_10236759 | 3300005937 | Bacteria | 1344 |
| 195 | Ga0081538_10034120 | 3300005981 | Bacteria | 3370 |
| 196 | Ga0081540_1002324 | 3300005983 | Bacteria | 15586 |
| 197 | Ga0081540_1004136 | 3300005983 | Bacteria | 11192 |
| 198 | Ga0081540_1004563 | 3300005983 | Bacteria | 10497 |
| 199 | Ga0081540_1004863 | 3300005983 | Bacteria | 10124 |
| 200 | Ga0081540_1006598 | 3300005983 | Bacteria | 8422 |
| 201 | Ga0081540_1013141 | 3300005983 | Bacteria | 5403 |
| 202 | Ga0081540_1031304 | 3300005983 | Bacteria | 2928 |
| 203 | Ga0081540_1039534 | 3300005983 | Bacteria | 2472 |
| 204 | Ga0081539_10000099 | 3300005985 | Bacteria | 201018 |
| 205 | Ga0081539_10001705 | 3300005985 | Bacteria | 35436 |
| 206 | Ga0081539_10199589 | 3300005985 | Bacteria | 925 |
| 207 | Ga0081539_10226934 | 3300005985 | Bacteria | 846 |
| 208 | Ga0081539_10231448 | 3300005985 | Bacteria | 834 |
| 209 | Ga0070717_10000884 | 3300006028 | Bacteria | 19823 |
| 210 | Ga0070717_10014958 | 3300006028 | Bacteria | 5976 |
| 211 | Ga0070717_10891292 | 3300006028 | Bacteria | 810 |
| 212 | Ga0075365_10010380 | 3300006038 | Bacteria | 5420 |
| 213 | Ga0075365_10020780 | 3300006038 | Bacteria | 4078 |
| 214 | Ga0075365_10021853 | 3300006038 | Bacteria | 3997 |
| 215 | Ga0075365_10107629 | 3300006038 | Bacteria | 1914 |
| 216 | Ga0075365_10155709 | 3300006038 | Bacteria | 1590 |
| 217 | Ga0075365_10164297 | 3300006038 | Bacteria | 1548 |
| 218 | Ga0075365_10269534 | 3300006038 | Bacteria | 1197 |
| 219 | Ga0075365_10373371 | 3300006038 | Bacteria | 1006 |
| 220 | Ga0075368_10027704 | 3300006042 | Bacteria | 2187 |
| 221 | Ga0075368_10044846 | 3300006042 | Bacteria | 1746 |
| 222 | Ga0075368_10052860 | 3300006042 | Bacteria | 1616 |
| 223 | Ga0075363_100076653 | 3300006048 | Bacteria | 1823 |
| 224 | Ga0075363_100107756 | 3300006048 | Bacteria | 1546 |
| 225 | Ga0075363_100127931 | 3300006048 | Bacteria | 1423 |
| 226 | Ga0075363_100206646 | 3300006048 | Bacteria | 1123 |
| 227 | Ga0075363_100254574 | 3300006048 | Bacteria | 1012 |
| 228 | Ga0075364_10006886 | 3300006051 | Bacteria | 6710 |
| 229 | Ga0075364_10034616 | 3300006051 | Bacteria | 3260 |
| 230 | Ga0070715_10000981 | 3300006163 | Bacteria | 7973 |
| 231 | Ga0070716_100013712 | 3300006173 | Bacteria | 4136 |
| 232 | Ga0070716_100022257 | 3300006173 | Bacteria | 3347 |
| 233 | Ga0070716_100075243 | 3300006173 | Bacteria | 1997 |
| 234 | Ga0070712_100015975 | 3300006175 | Bacteria | 4841 |
| 235 | Ga0070712_100051147 | 3300006175 | Bacteria | 2878 |
| 236 | Ga0070712_100323610 | 3300006175 | Bacteria | 1254 |
| 237 | Ga0070712_100367303 | 3300006175 | Bacteria | 1182 |
| 238 | Ga0070712_100609691 | 3300006175 | Bacteria | 925 |
| 239 | Ga0075367_10058549 | 3300006178 | Bacteria | 2293 |
| 240 | Ga0075367_10068670 | 3300006178 | Bacteria | 2126 |
| 241 | Ga0075367_10152099 | 3300006178 | Bacteria | 1436 |
| 242 | Ga0075369_10070615 | 3300006186 | Bacteria | 1536 |
| 243 | Ga0075369_10170053 | 3300006186 | Bacteria | 1000 |
| 244 | Ga0075366_10034226 | 3300006195 | Bacteria | 2992 |
| 245 | Ga0075366_10440476 | 3300006195 | Bacteria | 803 |
| 246 | Ga0075370_10023753 | 3300006353 | Bacteria | 3380 |
| 247 | Ga0075370_10027637 | 3300006353 | Bacteria | 3149 |
| 248 | Ga0075370_10070899 | 3300006353 | Bacteria | 1993 |
| 249 | Ga0075370_10180316 | 3300006353 | Bacteria | 1243 |
| 250 | Ga0075428_100973603 | 3300006844 | Bacteria | 898 |
| 251 | Ga0075434_100091893 | 3300006871 | Bacteria | 3037 |
| 252 | Ga0075434_100139408 | 3300006871 | Bacteria | 2444 |
| 253 | Ga0075434_101054065 | 3300006871 | Bacteria | 827 |
| 254 | Ga0068865_100107511 | 3300006881 | Bacteria | 2052 |
| 255 | Ga0068865_100203413 | 3300006881 | Bacteria | 1538 |
| 256 | Ga0068865_100398507 | 3300006881 | Bacteria | 1127 |
| 257 | Ga0097620_100142741 | 3300006931 | Bacteria | 2468 |
| 258 | Ga0097620_100201574 | 3300006931 | Bacteria | 2074 |
| 259 | Ga0097620_100268470 | 3300006931 | Bacteria | 1798 |
| 260 | Ga0097620_100687750 | 3300006931 | Bacteria | 1114 |
| 261 | Ga0099825_1029936 | 3300006941 | Bacteria | 2467 |
| 262 | Ga0099824_1007272 | 3300006942 | Bacteria | 14768 |
| 263 | Ga0099824_1025823 | 3300006942 | Bacteria | 3144 |
| 264 | Ga0099823_1053108 | 3300006944 | Bacteria | 2389 |
| 265 | Ga0075435_100208200 | 3300007076 | Bacteria | 1658 |
| 266 | Ga0099794_10007534 | 3300007265 | Bacteria | 4477 |
| 267 | Ga0099794_10022139 | 3300007265 | Bacteria | 2895 |
| 268 | Ga0099795_10056429 | 3300007788 | Bacteria | 1445 |
| 269 | Ga0105251_10307119 | 3300009011 | Bacteria | 720 |
| 270 | Ga0105240_10003625 | 3300009093 | Bacteria | 23906 |
| 271 | Ga0105240_10050592 | 3300009093 | Bacteria | 5237 |
| 272 | Ga0105240_10144227 | 3300009093 | Bacteria | 2843 |
| 273 | Ga0105240_10366710 | 3300009093 | Bacteria | 1630 |
| 274 | Ga0105240_10516600 | 3300009093 | Bacteria | 1326 |
| 275 | Ga0105240_10794077 | 3300009093 | Bacteria | 1026 |
| 276 | Ga0105240_11473144 | 3300009093 | Bacteria | 714 |
| 277 | Ga0111539_10124690 | 3300009094 | Bacteria | 3018 |
| 278 | Ga0111539_11525139 | 3300009094 | Bacteria | 775 |
| 279 | Ga0105245_10082095 | 3300009098 | Bacteria | 2948 |
| 280 | Ga0105245_10100337 | 3300009098 | Bacteria | 2678 |
| 281 | Ga0105245_10391376 | 3300009098 | Bacteria | 1387 |
| 282 | Ga0105245_10421320 | 3300009098 | Bacteria | 1338 |
| 283 | Ga0105245_10647120 | 3300009098 | Bacteria | 1087 |
| 284 | Ga0105247_10157856 | 3300009101 | Bacteria | 1499 |
| 285 | Ga0114129_11043253 | 3300009147 | Bacteria | 1027 |
| 286 | Ga0105243_10038231 | 3300009148 | Bacteria | 3737 |
| 287 | Ga0105243_10091595 | 3300009148 | Bacteria | 2504 |
| 288 | Ga0105243_10569401 | 3300009148 | Bacteria | 1085 |
| 289 | Ga0105243_10783742 | 3300009148 | Bacteria | 938 |
| 290 | Ga0105241_10009272 | 3300009174 | Bacteria | 7238 |
| 291 | Ga0105241_10090159 | 3300009174 | Bacteria | 2417 |
| 292 | Ga0105241_10211991 | 3300009174 | Bacteria | 1623 |
| 293 | Ga0105242_10350202 | 3300009176 | Bacteria | 1364 |
| 294 | Ga0105242_10539767 | 3300009176 | Bacteria | 1116 |
| 295 | Ga0105242_11424160 | 3300009176 | Bacteria | 721 |
| 296 | Ga0105248_10370733 | 3300009177 | Bacteria | 1612 |
| 297 | Ga0105248_10509363 | 3300009177 | Bacteria | 1357 |
| 298 | Ga0105237_10003462 | 3300009545 | Bacteria | 18731 |
| 299 | Ga0105237_10042625 | 3300009545 | Bacteria | 4575 |
| 300 | Ga0105237_10045814 | 3300009545 | Bacteria | 4400 |
| 301 | Ga0105237_10050449 | 3300009545 | Bacteria | 4181 |
| 302 | Ga0105237_10072304 | 3300009545 | Bacteria | 3443 |
| 303 | Ga0105237_10124677 | 3300009545 | Bacteria | 2570 |
| 304 | Ga0105237_10172003 | 3300009545 | Bacteria | 2166 |
| 305 | Ga0105237_10201580 | 3300009545 | Bacteria | 1990 |
| 306 | Ga0105237_10264373 | 3300009545 | Bacteria | 1723 |
| 307 | Ga0105237_10301265 | 3300009545 | Bacteria | 1606 |
| 308 | Ga0105237_10452715 | 3300009545 | Bacteria | 1290 |
| 309 | Ga0105237_10457440 | 3300009545 | Bacteria | 1282 |
| 310 | Ga0105238_10001064 | 3300009551 | Bacteria | 27700 |
| 311 | Ga0105238_10137768 | 3300009551 | Bacteria | 2418 |
| 312 | Ga0105238_10309576 | 3300009551 | Bacteria | 1564 |
| 313 | Ga0105238_10584823 | 3300009551 | Bacteria | 1123 |
| 314 | Ga0105238_10920252 | 3300009551 | Bacteria | 893 |
| 315 | Ga0105238_11142676 | 3300009551 | Bacteria | 802 |
| 316 | Ga0105249_10152529 | 3300009553 | Bacteria | 2226 |
| 317 | Ga0099796_10120195 | 3300010159 | Bacteria | 1009 |
| 318 | Ga0099796_10161464 | 3300010159 | Bacteria | 888 |
| 319 | Ga0105239_10000803 | 3300010375 | Bacteria | 44420 |
| 320 | Ga0105239_10111666 | 3300010375 | Bacteria | 3030 |
| 321 | Ga0105239_10384597 | 3300010375 | Bacteria | 1587 |
| 322 | Ga0105239_10445585 | 3300010375 | Bacteria | 1468 |
| 323 | Ga0105246_10224084 | 3300011119 | Bacteria | 1476 |
| 324 | Ga0105246_10376963 | 3300011119 | Bacteria | 1171 |
| 325 | Ga0157370_10013095 | 3300013104 | Bacteria | 8561 |
| 326 | Ga0157370_10076076 | 3300013104 | Bacteria | 3163 |
| 327 | Ga0157370_10083255 | 3300013104 | Bacteria | 3008 |
| 328 | Ga0157370_10271608 | 3300013104 | Bacteria | 1566 |
| 329 | Ga0157370_10525986 | 3300013104 | Bacteria | 1085 |
| 330 | Ga0157369_10007934 | 3300013105 | Bacteria | 12206 |
| 331 | Ga0157369_10029605 | 3300013105 | Bacteria | 6049 |
| 332 | Ga0157369_10057734 | 3300013105 | Bacteria | 4186 |
| 333 | Ga0157369_10157648 | 3300013105 | Bacteria | 2397 |
| 334 | Ga0157369_10469589 | 3300013105 | Bacteria | 1302 |
| 335 | Ga0157369_10496482 | 3300013105 | Bacteria | 1263 |
| 336 | Ga0157369_10727424 | 3300013105 | Bacteria | 1021 |
| 337 | Ga0157374_10201543 | 3300013296 | Bacteria | 1949 |
| 338 | Ga0157378_10030034 | 3300013297 | Bacteria | 4801 |
| 339 | Ga0157378_10567482 | 3300013297 | Bacteria | 1142 |
| 340 | Ga0163162_10074838 | 3300013306 | Bacteria | 3446 |
| 341 | Ga0157372_10018081 | 3300013307 | Bacteria | 7577 |
| 342 | Ga0157372_10641591 | 3300013307 | Bacteria | 1237 |
| 343 | Ga0157375_10035212 | 3300013308 | Bacteria | 4777 |
| 344 | Ga0157375_10225225 | 3300013308 | Bacteria | 2034 |
| 345 | Ga0157375_10293727 | 3300013308 | Bacteria | 1788 |
| 346 | Ga0157375_10775583 | 3300013308 | Bacteria | 1109 |
| 347 | Ga0163163_10011193 | 3300014325 | Bacteria | 8126 |
| 348 | Ga0163163_10160241 | 3300014325 | Bacteria | 2295 |
| 349 | Ga0157380_10128687 | 3300014326 | Bacteria | 2157 |
| 350 | Ga0182008_10278514 | 3300014497 | Bacteria | 870 |
| 351 | Ga0182008_10295830 | 3300014497 | Bacteria | 846 |
| 352 | Ga0157377_10028713 | 3300014745 | Bacteria | 2996 |
| 353 | Ga0157377_10518676 | 3300014745 | Bacteria | 836 |
| 354 | Ga0157377_10716721 | 3300014745 | Bacteria | 728 |
| 355 | Ga0157379_10090668 | 3300014968 | Bacteria | 2742 |
| 356 | Ga0157379_10112770 | 3300014968 | Bacteria | 2444 |
| 357 | Ga0157379_10211047 | 3300014968 | Bacteria | 1758 |
| 358 | Ga0157376_10076201 | 3300014969 | Bacteria | 2865 |
| 359 | Ga0214544_1000005 | 3300021320 | Bacteria | 387675 |
| 360 | Ga0214544_1030440 | 3300021320 | Bacteria | 1877 |
| 361 | Ga0214542_1000004 | 3300021321 | Bacteria | 415597 |
| 362 | Ga0214542_1032430 | 3300021321 | Bacteria | 1848 |
| 363 | Ga0214542_1033369 | 3300021321 | Bacteria | 1740 |
| 364 | Ga0214545_1000005 | 3300021324 | Bacteria | 415590 |
| 365 | Ga0214545_1028880 | 3300021324 | Bacteria | 2583 |
| 366 | Ga0214543_1000030 | 3300021327 | Bacteria | 210137 |
| 367 | Ga0213873_10023567 | 3300021358 | Bacteria | 1468 |
| 368 | Ga0213876_10005771 | 3300021384 | Bacteria | 6779 |
| 369 | Ga0213876_10051827 | 3300021384 | Bacteria | 2169 |
| 370 | Ga0213871_10015751 | 3300021441 | Bacteria | 1812 |
| 371 | Ga0209563_104596 | 3300025230 | Bacteria | 2617 |
| 372 | Ga0207425_1029117 | 3300025245 | Bacteria | 1115 |
| 373 | Ga0209677_100180 | 3300025253 | Bacteria | 53251 |
| 374 | Ga0209677_105813 | 3300025253 | Bacteria | 3106 |
| 375 | Ga0209148_1000801 | 3300025254 | Bacteria | 23021 |
| 376 | Ga0209148_1020749 | 3300025254 | Bacteria | 1077 |
| 377 | Ga0209233_1001773 | 3300025261 | Bacteria | 8322 |
| 378 | Ga0209233_1019150 | 3300025261 | Bacteria | 1825 |
| 379 | Ga0209233_1019779 | 3300025261 | Bacteria | 1781 |
| 380 | Ga0209455_1013794 | 3300025272 | Bacteria | 1860 |
| 381 | Ga0209455_1018576 | 3300025272 | Bacteria | 1425 |
| 382 | Ga0209673_1028696 | 3300025273 | Bacteria | 1785 |
| 383 | Ga0209564_1001232 | 3300025295 | Bacteria | 28872 |
| 384 | Ga0209758_1000102 | 3300025297 | Bacteria | 224851 |
| 385 | Ga0209758_1000631 | 3300025297 | Bacteria | 53996 |
| 386 | Ga0209758_1000703 | 3300025297 | Bacteria | 49647 |
| 387 | Ga0209758_1000761 | 3300025297 | Bacteria | 46617 |
| 388 | Ga0209758_1001792 | 3300025297 | Bacteria | 23713 |
| 389 | Ga0209758_1002441 | 3300025297 | Bacteria | 18971 |
| 390 | Ga0209758_1055416 | 3300025297 | Bacteria | 1346 |
| 391 | Ga0209256_1016058 | 3300025299 | Bacteria | 2577 |
| 392 | Ga0209256_1044827 | 3300025299 | Bacteria | 1102 |
| 393 | Ga0207426_1000354 | 3300025302 | Bacteria | 83734 |
| 394 | Ga0207426_1003127 | 3300025302 | Bacteria | 9434 |
| 395 | Ga0209257_1003566 | 3300025304 | Bacteria | 13196 |
| 396 | Ga0209257_1072583 | 3300025304 | Bacteria | 903 |
| 397 | Ga0207697_10070067 | 3300025315 | Bacteria | 1468 |
| 398 | Ga0207656_10094099 | 3300025321 | Bacteria | 1364 |
| 399 | Ga0207682_10054713 | 3300025893 | Bacteria | 1659 |
| 400 | Ga0207692_10021622 | 3300025898 | Bacteria | 2947 |
| 401 | Ga0207692_10028244 | 3300025898 | Bacteria | 2651 |
| 402 | Ga0207692_10590426 | 3300025898 | Bacteria | 713 |
| 403 | Ga0207642_10329358 | 3300025899 | Bacteria | 894 |
| 404 | Ga0207688_10206315 | 3300025901 | Bacteria | 1180 |
| 405 | Ga0207680_10162186 | 3300025903 | Bacteria | 1500 |
| 406 | Ga0207647_10018549 | 3300025904 | Bacteria | 4702 |
| 407 | Ga0207699_10001383 | 3300025906 | Bacteria | 11543 |
| 408 | Ga0207699_10017637 | 3300025906 | Bacteria | 3764 |
| 409 | Ga0207699_10028712 | 3300025906 | Bacteria | 3095 |
| 410 | Ga0207699_10054224 | 3300025906 | Bacteria | 2381 |
| 411 | Ga0207699_10113627 | 3300025906 | Bacteria | 1740 |
| 412 | Ga0207699_10413491 | 3300025906 | Bacteria | 962 |
| 413 | Ga0207645_10148193 | 3300025907 | Bacteria | 1531 |
| 414 | Ga0207643_10391875 | 3300025908 | Bacteria | 877 |
| 415 | Ga0207705_10039045 | 3300025909 | Bacteria | 3402 |
| 416 | Ga0207705_10091269 | 3300025909 | Bacteria | 2231 |
| 417 | Ga0207705_10165761 | 3300025909 | Bacteria | 1661 |
| 418 | Ga0207684_10233443 | 3300025910 | Bacteria | 1587 |
| 419 | Ga0207654_10001104 | 3300025911 | Bacteria | 14608 |
| 420 | Ga0207654_10011477 | 3300025911 | Bacteria | 4522 |
| 421 | Ga0207654_10155179 | 3300025911 | Bacteria | 1474 |
| 422 | Ga0207654_10288678 | 3300025911 | Bacteria | 1112 |
| 423 | Ga0207707_10005313 | 3300025912 | Bacteria | 11255 |
| 424 | Ga0207707_10011326 | 3300025912 | Bacteria | 7764 |
| 425 | Ga0207707_10154891 | 3300025912 | Bacteria | 2004 |
| 426 | Ga0207707_10203938 | 3300025912 | Bacteria | 1724 |
| 427 | Ga0207707_10372090 | 3300025912 | Bacteria | 1229 |
| 428 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 429 | Ga0207695_10003805 | 3300025913 | Bacteria | 20923 |
| 430 | Ga0207695_10104719 | 3300025913 | Bacteria | 2817 |
| 431 | Ga0207695_10561481 | 3300025913 | Bacteria | 1023 |
| 432 | Ga0207695_10739888 | 3300025913 | Bacteria | 864 |
| 433 | Ga0207671_10005375 | 3300025914 | Bacteria | 11833 |
| 434 | Ga0207671_10036148 | 3300025914 | Bacteria | 3662 |
| 435 | Ga0207671_10096861 | 3300025914 | Bacteria | 2230 |
| 436 | Ga0207671_10129560 | 3300025914 | Bacteria | 1935 |
| 437 | Ga0207671_10175234 | 3300025914 | Bacteria | 1667 |
| 438 | Ga0207671_10458153 | 3300025914 | Bacteria | 1016 |
| 439 | Ga0207671_10515255 | 3300025914 | Bacteria | 954 |
| 440 | Ga0207671_10744592 | 3300025914 | Bacteria | 778 |
| 441 | Ga0207693_10012138 | 3300025915 | Bacteria | 6961 |
| 442 | Ga0207693_10021423 | 3300025915 | Bacteria | 5136 |
| 443 | Ga0207693_10037531 | 3300025915 | Bacteria | 3819 |
| 444 | Ga0207693_10156630 | 3300025915 | Bacteria | 1792 |
| 445 | Ga0207693_10177459 | 3300025915 | Bacteria | 1676 |
| 446 | Ga0207663_10000457 | 3300025916 | Bacteria | 17764 |
| 447 | Ga0207663_10022469 | 3300025916 | Bacteria | 3605 |
| 448 | Ga0207663_10125596 | 3300025916 | Bacteria | 1764 |
| 449 | Ga0207663_10256602 | 3300025916 | Bacteria | 1289 |
| 450 | Ga0207660_10007858 | 3300025917 | Bacteria | 6903 |
| 451 | Ga0207660_10009400 | 3300025917 | Bacteria | 6327 |
| 452 | Ga0207660_10025528 | 3300025917 | Bacteria | 4011 |
| 453 | Ga0207660_10162970 | 3300025917 | Bacteria | 1722 |
| 454 | Ga0207662_10060766 | 3300025918 | Bacteria | 2267 |
| 455 | Ga0207657_10002620 | 3300025919 | Bacteria | 19429 |
| 456 | Ga0207657_10201178 | 3300025919 | Bacteria | 1602 |
| 457 | Ga0207657_10729981 | 3300025919 | Bacteria | 768 |
| 458 | Ga0207649_10104448 | 3300025920 | Bacteria | 1881 |
| 459 | Ga0207649_10728059 | 3300025920 | Bacteria | 771 |
| 460 | Ga0207652_10023832 | 3300025921 | Bacteria | 5074 |
| 461 | Ga0207652_10031328 | 3300025921 | Bacteria | 4466 |
| 462 | Ga0207652_10052312 | 3300025921 | Bacteria | 3504 |
| 463 | Ga0207646_10452087 | 3300025922 | Bacteria | 1159 |
| 464 | Ga0207681_10115128 | 3300025923 | Bacteria | 1963 |
| 465 | Ga0207681_10804120 | 3300025923 | Bacteria | 785 |
| 466 | Ga0207694_10000273 | 3300025924 | Bacteria | 49024 |
| 467 | Ga0207694_10287115 | 3300025924 | Bacteria | 1352 |
| 468 | Ga0207694_10606884 | 3300025924 | Bacteria | 920 |
| 469 | Ga0207650_10122673 | 3300025925 | Bacteria | 2025 |
| 470 | Ga0207650_10294479 | 3300025925 | Bacteria | 1324 |
| 471 | Ga0207659_10159984 | 3300025926 | Bacteria | 1767 |
| 472 | Ga0207687_10069286 | 3300025927 | Bacteria | 2515 |
| 473 | Ga0207687_10355900 | 3300025927 | Bacteria | 1194 |
| 474 | Ga0207687_10386868 | 3300025927 | Bacteria | 1147 |
| 475 | Ga0207700_10010929 | 3300025928 | Bacteria | 5762 |
| 476 | Ga0207700_10023057 | 3300025928 | Bacteria | 4283 |
| 477 | Ga0207700_10054679 | 3300025928 | Bacteria | 2998 |
| 478 | Ga0207700_10161634 | 3300025928 | Bacteria | 1860 |
| 479 | Ga0207700_10372342 | 3300025928 | Bacteria | 1247 |
| 480 | Ga0207700_10380261 | 3300025928 | Bacteria | 1235 |
| 481 | Ga0207700_10882728 | 3300025928 | Bacteria | 800 |
| 482 | Ga0207700_11045318 | 3300025928 | Bacteria | 730 |
| 483 | Ga0207664_10024427 | 3300025929 | Bacteria | 4542 |
| 484 | Ga0207664_10049207 | 3300025929 | Bacteria | 3318 |
| 485 | Ga0207664_10064666 | 3300025929 | Bacteria | 2927 |
| 486 | Ga0207664_10172067 | 3300025929 | Bacteria | 1854 |
| 487 | Ga0207664_10181056 | 3300025929 | Bacteria | 1809 |
| 488 | Ga0207664_10411184 | 3300025929 | Bacteria | 1204 |
| 489 | Ga0207664_10485259 | 3300025929 | Bacteria | 1106 |
| 490 | Ga0207664_10551290 | 3300025929 | Bacteria | 1034 |
| 491 | Ga0207664_10981246 | 3300025929 | Bacteria | 757 |
| 492 | Ga0207644_10377075 | 3300025931 | Bacteria | 1156 |
| 493 | Ga0207690_10336410 | 3300025932 | Bacteria | 1190 |
| 494 | Ga0207690_10583981 | 3300025932 | Bacteria | 911 |
| 495 | Ga0207706_10116359 | 3300025933 | Bacteria | 2351 |
| 496 | Ga0207706_10231929 | 3300025933 | Bacteria | 1615 |
| 497 | Ga0207706_10268969 | 3300025933 | Bacteria | 1487 |
| 498 | Ga0207709_10070825 | 3300025935 | Bacteria | 2212 |
| 499 | Ga0207709_10582526 | 3300025935 | Bacteria | 884 |
| 500 | Ga0207670_10208517 | 3300025936 | Bacteria | 1489 |
| 501 | Ga0207670_10290114 | 3300025936 | Bacteria | 1278 |
| 502 | Ga0207670_10738510 | 3300025936 | Bacteria | 817 |
| 503 | Ga0207669_10150018 | 3300025937 | Bacteria | 1631 |
| 504 | Ga0207669_10213607 | 3300025937 | Bacteria | 1410 |
| 505 | Ga0207704_10067161 | 3300025938 | Bacteria | 2254 |
| 506 | Ga0207704_10391085 | 3300025938 | Bacteria | 1094 |
| 507 | Ga0207704_10651791 | 3300025938 | Bacteria | 867 |
| 508 | Ga0207665_10000127 | 3300025939 | Bacteria | 50413 |
| 509 | Ga0207665_10009558 | 3300025939 | Bacteria | 6369 |
| 510 | Ga0207665_10015452 | 3300025939 | Bacteria | 5011 |
| 511 | Ga0207691_10397250 | 3300025940 | Bacteria | 1176 |
| 512 | Ga0207711_11047908 | 3300025941 | Bacteria | 756 |
| 513 | Ga0207661_10013783 | 3300025944 | Bacteria | 5906 |
| 514 | Ga0207661_10021726 | 3300025944 | Bacteria | 4814 |
| 515 | Ga0207661_10171311 | 3300025944 | Bacteria | 1890 |
| 516 | Ga0207661_10324103 | 3300025944 | Bacteria | 1385 |
| 517 | Ga0207661_10765705 | 3300025944 | Bacteria | 889 |
| 518 | Ga0207679_10282626 | 3300025945 | Bacteria | 1424 |
| 519 | Ga0207667_10005930 | 3300025949 | Bacteria | 14876 |
| 520 | Ga0207667_10095234 | 3300025949 | Bacteria | 3074 |
| 521 | Ga0207667_10155541 | 3300025949 | Bacteria | 2353 |
| 522 | Ga0207667_10181792 | 3300025949 | Bacteria | 2159 |
| 523 | Ga0207667_10243490 | 3300025949 | Bacteria | 1840 |
| 524 | Ga0207667_10355690 | 3300025949 | Bacteria | 1493 |
| 525 | Ga0207667_10481357 | 3300025949 | Bacteria | 1260 |
| 526 | Ga0207667_10508646 | 3300025949 | Bacteria | 1221 |
| 527 | Ga0207712_10585344 | 3300025961 | Bacteria | 964 |
| 528 | Ga0207668_10013352 | 3300025972 | Bacteria | 5054 |
| 529 | Ga0207668_10140455 | 3300025972 | Bacteria | 1856 |
| 530 | Ga0207668_10357438 | 3300025972 | Bacteria | 1223 |
| 531 | Ga0207668_10414015 | 3300025972 | Bacteria | 1142 |
| 532 | Ga0207640_10105929 | 3300025981 | Bacteria | 1982 |
| 533 | Ga0207640_11050843 | 3300025981 | Bacteria | 718 |
| 534 | Ga0207658_10014650 | 3300025986 | Bacteria | 5371 |
| 535 | Ga0207677_10088985 | 3300026023 | Bacteria | 2240 |
| 536 | Ga0207677_10278711 | 3300026023 | Bacteria | 1371 |
| 537 | Ga0207703_10084544 | 3300026035 | Bacteria | 2653 |
| 538 | Ga0207703_10095065 | 3300026035 | Bacteria | 2513 |
| 539 | Ga0207703_10457491 | 3300026035 | Bacteria | 1193 |
| 540 | Ga0207703_10806071 | 3300026035 | Bacteria | 896 |
| 541 | Ga0207639_10038757 | 3300026041 | Bacteria | 3547 |
| 542 | Ga0207639_10069559 | 3300026041 | Bacteria | 2747 |
| 543 | Ga0207639_10178257 | 3300026041 | Bacteria | 1805 |
| 544 | Ga0207639_10185177 | 3300026041 | Bacteria | 1774 |
| 545 | Ga0207639_10359501 | 3300026041 | Bacteria | 1302 |
| 546 | Ga0207678_10016165 | 3300026067 | Bacteria | 6552 |
| 547 | Ga0207678_10018540 | 3300026067 | Bacteria | 6111 |
| 548 | Ga0207678_10022726 | 3300026067 | Bacteria | 5492 |
| 549 | Ga0207678_10093897 | 3300026067 | Bacteria | 2563 |
| 550 | Ga0207678_10146729 | 3300026067 | Bacteria | 2014 |
| 551 | Ga0207678_10209849 | 3300026067 | Bacteria | 1666 |
| 552 | Ga0207678_10225178 | 3300026067 | Bacteria | 1605 |
| 553 | Ga0207678_10234829 | 3300026067 | Bacteria | 1570 |
| 554 | Ga0207678_10502819 | 3300026067 | Bacteria | 1057 |
| 555 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 556 | Ga0207702_10000325 | 3300026078 | Bacteria | 54690 |
| 557 | Ga0207702_10057553 | 3300026078 | Bacteria | 3304 |
| 558 | Ga0207702_10147332 | 3300026078 | Bacteria | 2138 |
| 559 | Ga0207702_10284541 | 3300026078 | Bacteria | 1564 |
| 560 | Ga0207702_10374371 | 3300026078 | Bacteria | 1368 |
| 561 | Ga0207641_10102577 | 3300026088 | Bacteria | 2523 |
| 562 | Ga0207641_10199393 | 3300026088 | Bacteria | 1844 |
| 563 | Ga0207641_10358382 | 3300026088 | Bacteria | 1392 |
| 564 | Ga0207648_10389276 | 3300026089 | Bacteria | 1261 |
| 565 | Ga0207676_10141774 | 3300026095 | Bacteria | 2058 |
| 566 | Ga0207676_10400559 | 3300026095 | Bacteria | 1282 |
| 567 | Ga0207674_10017609 | 3300026116 | Bacteria | 7793 |
| 568 | Ga0207674_10017929 | 3300026116 | Bacteria | 7716 |
| 569 | Ga0207674_10030154 | 3300026116 | Bacteria | 5705 |
| 570 | Ga0207674_10108612 | 3300026116 | Bacteria | 2751 |
| 571 | Ga0207674_10166376 | 3300026116 | Bacteria | 2159 |
| 572 | Ga0207674_10175414 | 3300026116 | Bacteria | 2096 |
| 573 | Ga0207674_10666689 | 3300026116 | Bacteria | 1004 |
| 574 | Ga0207675_100072306 | 3300026118 | Bacteria | 3226 |
| 575 | Ga0207675_100113589 | 3300026118 | Bacteria | 2557 |
| 576 | Ga0207675_100232992 | 3300026118 | Bacteria | 1777 |
| 577 | Ga0207683_10061897 | 3300026121 | Bacteria | 3295 |
| 578 | Ga0207683_10148831 | 3300026121 | Bacteria | 2112 |
| 579 | Ga0207683_10152190 | 3300026121 | Bacteria | 2088 |
| 580 | Ga0207683_11016254 | 3300026121 | Bacteria | 769 |
| 581 | Ga0207698_10051678 | 3300026142 | Bacteria | 3144 |
| 582 | Ga0207698_10536012 | 3300026142 | Bacteria | 1145 |
| 583 | Ga0209389_1000924 | 3300027296 | Bacteria | 19203 |
| 584 | Ga0209389_1000951 | 3300027296 | Bacteria | 19062 |
| 585 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 586 | Ga0209589_1003240 | 3300027357 | Bacteria | 28538 |
| 587 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 588 | Ga0209489_102828 | 3300027361 | Bacteria | 34702 |
| 589 | Ga0209489_115384 | 3300027361 | Bacteria | 4720 |
| 590 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 591 | Ga0209700_100483 | 3300027363 | Bacteria | 74857 |
| 592 | Ga0209588_1001041 | 3300027671 | Bacteria | 7136 |
| 593 | Ga0268266_10001580 | 3300028379 | Bacteria | 26592 |
| 594 | Ga0268266_10004157 | 3300028379 | Bacteria | 13958 |
| 595 | Ga0268266_10012768 | 3300028379 | Bacteria | 7258 |
| 596 | Ga0268266_10034039 | 3300028379 | Bacteria | 4331 |
| 597 | Ga0268266_10043998 | 3300028379 | Bacteria | 3817 |
| 598 | Ga0268266_10249225 | 3300028379 | Bacteria | 1642 |
| 599 | Ga0268266_10637240 | 3300028379 | Bacteria | 1025 |
| 600 | Ga0268266_10678661 | 3300028379 | Bacteria | 992 |
| 601 | Ga0268266_10866761 | 3300028379 | Bacteria | 873 |
| 602 | Ga0268265_10218323 | 3300028380 | Bacteria | 1666 |
| 603 | Ga0268265_10359470 | 3300028380 | Bacteria | 1332 |
| 604 | Ga0268265_11123285 | 3300028380 | Bacteria | 781 |
| 605 | Ga0268265_11270556 | 3300028380 | Bacteria | 735 |
| 606 | Ga0268264_10000174 | 3300028381 | Bacteria | 137254 |
| 607 | Ga0268264_10154530 | 3300028381 | Bacteria | 2061 |
| 608 | Ga0268264_10250828 | 3300028381 | Bacteria | 1644 |
| 609 | Ga0268264_10406720 | 3300028381 | Bacteria | 1309 |
| 610 | Ga0265337_1022171 | 3300028556 | Bacteria | 1970 |
| 611 | Ga0265322_10086893 | 3300028654 | Bacteria | 888 |
| 612 | Ga0265336_10002309 | 3300028666 | Bacteria | 7954 |
| 613 | Ga0307517_10000124 | 3300028786 | Bacteria | 115570 |
| 614 | Ga0307515_10036628 | 3300028794 | Bacteria | 7928 |
| 615 | Ga0307515_10581716 | 3300028794 | Bacteria | 730 |
| 616 | Ga0265338_10002710 | 3300028800 | Bacteria | 25984 |
| 617 | Ga0265338_10225100 | 3300028800 | Bacteria | 1399 |
| 618 | Ga0265324_10008015 | 3300029957 | Bacteria | 4232 |
| 619 | Ga0307511_10057673 | 3300030521 | Bacteria | 3014 |
| 620 | Ga0265330_10005554 | 3300031235 | Bacteria | 6284 |
| 621 | Ga0265330_10071648 | 3300031235 | Bacteria | 1499 |
| 622 | Ga0265330_10082084 | 3300031235 | Bacteria | 1388 |
| 623 | Ga0265332_10029066 | 3300031238 | Bacteria | 2417 |
| 624 | Ga0265332_10037876 | 3300031238 | Bacteria | 2091 |
| 625 | Ga0265332_10241633 | 3300031238 | Bacteria | 747 |
| 626 | Ga0265328_10031734 | 3300031239 | Bacteria | 1963 |
| 627 | Ga0265325_10137153 | 3300031241 | Bacteria | 1166 |
| 628 | Ga0265340_10000891 | 3300031247 | Bacteria | 16923 |
| 629 | Ga0265340_10014481 | 3300031247 | Bacteria | 4117 |
| 630 | Ga0265339_10008471 | 3300031249 | Bacteria | 6544 |
| 631 | Ga0265339_10032933 | 3300031249 | Bacteria | 2922 |
| 632 | Ga0265316_10086587 | 3300031344 | Bacteria | 2395 |
| 633 | Ga0265316_10418583 | 3300031344 | Bacteria | 963 |
| 634 | Ga0307513_10110997 | 3300031456 | Bacteria | 2736 |
| 635 | Ga0307513_10287426 | 3300031456 | Bacteria | 1418 |
| 636 | Ga0307509_10140310 | 3300031507 | Bacteria | 2353 |
| 637 | Ga0307509_10226763 | 3300031507 | Bacteria | 1675 |
| 638 | Ga0307408_100312511 | 3300031548 | Bacteria | 1321 |
| 639 | Ga0307408_100504084 | 3300031548 | Bacteria | 1060 |
| 640 | Ga0265313_10076154 | 3300031595 | Bacteria | 1534 |
| 641 | Ga0307508_10072848 | 3300031616 | Bacteria | 3010 |
| 642 | Ga0307508_10191813 | 3300031616 | Bacteria | 1644 |
| 643 | Ga0307508_10195726 | 3300031616 | Bacteria | 1622 |
| 644 | Ga0265314_10001980 | 3300031711 | Bacteria | 21759 |
| 645 | Ga0265314_10056351 | 3300031711 | Bacteria | 2706 |
| 646 | Ga0265314_10075066 | 3300031711 | Bacteria | 2250 |
| 647 | Ga0265342_10014362 | 3300031712 | Bacteria | 5259 |
| 648 | Ga0265342_10097360 | 3300031712 | Bacteria | 1680 |
| 649 | Ga0265342_10119726 | 3300031712 | Bacteria | 1483 |
| 650 | Ga0316578_10036456 | 3300031728 | Bacteria | 2830 |
| 651 | Ga0307516_10000457 | 3300031730 | Bacteria | 54103 |
| 652 | Ga0307516_10020328 | 3300031730 | Bacteria | 6859 |
| 653 | Ga0307516_10036865 | 3300031730 | Bacteria | 4891 |
| 654 | Ga0307516_10215446 | 3300031730 | Bacteria | 1632 |
| 655 | Ga0307405_10239112 | 3300031731 | Bacteria | 1344 |
| 656 | Ga0307405_10582021 | 3300031731 | Bacteria | 911 |
| 657 | Ga0307413_10094071 | 3300031824 | Bacteria | 1961 |
| 658 | Ga0307410_10515160 | 3300031852 | Bacteria | 986 |
| 659 | Ga0307406_10106324 | 3300031901 | Bacteria | 1922 |
| 660 | Ga0307412_10148574 | 3300031911 | Bacteria | 1726 |
| 661 | Ga0307412_10345907 | 3300031911 | Bacteria | 1192 |
| 662 | Ga0307412_10416580 | 3300031911 | Bacteria | 1098 |
| 663 | Ga0307409_100840123 | 3300031995 | Bacteria | 928 |
| 664 | Ga0307416_100468374 | 3300032002 | Bacteria | 1317 |
| 665 | Ga0307411_10344227 | 3300032005 | Bacteria | 1213 |
| 666 | Ga0316583_10117265 | 3300032133 | Bacteria | 928 |
| 667 | Ga0307507_10049280 | 3300033179 | Bacteria | 4084 |
| 668 | Ga0307510_10004801 | 3300033180 | Bacteria | 15994 |
| 669 | Ga0307510_10017344 | 3300033180 | Bacteria | 8494 |
| 670 | Ga0307510_10024151 | 3300033180 | Bacteria | 7029 |
| 671 | Ga0307510_10041115 | 3300033180 | Bacteria | 5062 |
| 672 | Ga0307510_10101487 | 3300033180 | Bacteria | 2665 |
| 673 | Ga0315911_1000041 | 3300033442 | Bacteria | 50391 |
| 674 | Ga0316215_1001284 | 3300033544 | Bacteria | 2424 |
| 675 | Ga0373959_0072081 | 3300034820 | Bacteria | 783 |
| 676 | Ga0373934_0074619 | 3300035086 | Bacteria | 1359 |
| 677 | Ga0373944_0052997 | 3300035089 | Bacteria | 1283 |
| 678 | Ga0373949_0036411 | 3300035090 | Bacteria | 1194 |
| 679 | Ga0373923_0020170 | 3300035111 | Bacteria | 2586 |
| 680 | Ga0373923_0025394 | 3300035111 | Bacteria | 2348 |
| 681 | Ga0373936_0006369 | 3300035113 | Bacteria | 4447 |
| 682 | Ga0373936_0013694 | 3300035113 | Bacteria | 3094 |
| 683 | Ga0373936_0046144 | 3300035113 | Bacteria | 1756 |
| 684 | Ga0373953_0000483 | 3300035117 | Bacteria | 11042 |
| 685 | Ga0373954_0000152 | 3300035118 | Bacteria | 24549 |
| 686 | Ga0373954_0002572 | 3300035118 | Bacteria | 7625 |
| 687 | Ga0373954_0027857 | 3300035118 | Bacteria | 2595 |
| 688 | Ga0373954_0237926 | 3300035118 | Bacteria | 896 |
| 689 | Ga0373956_0043185 | 3300035119 | Bacteria | 2006 |
| 690 | Ga0373957_0006488 | 3300035120 | Bacteria | 3688 |
| 691 | Ga0373957_0048025 | 3300035120 | Bacteria | 1625 |
| 692 | Ga0373943_0004910 | 3300035170 | Bacteria | 6043 |
| 693 | Ga0373943_0075584 | 3300035170 | Bacteria | 1716 |
| 694 | Ga0373946_0006110 | 3300035171 | Bacteria | 4361 |
| 695 | Ga0373955_0000721 | 3300035172 | Bacteria | 14158 |
| 696 | Ga0373955_0285689 | 3300035172 | Bacteria | 993 |
| 697 | Ga0373942_0173649 | 3300035207 | Bacteria | 703 |
| 698 | Ga0316574_0010592 | 3300035398 | Bacteria | 5215 |
| 699 | Ga0373924_0167416 | 3300035410 | Bacteria | 965 |
| 700 | Ga0373935_0002202 | 3300035692 | Bacteria | 11074 |
| 701 | Ga0373935_0051609 | 3300035692 | Bacteria | 2612 |
| 702 | Ga0373935_0085752 | 3300035692 | Bacteria | 2054 |
| 703 | Ga0373935_0122358 | 3300035692 | Bacteria | 1740 |
| 704 | Ga0373935_0206506 | 3300035692 | Bacteria | 1360 |
| 705 | Ga0373927_0001742 | 3300035695 | Bacteria | 16248 |
| 706 | Ga0373927_0005149 | 3300035695 | Bacteria | 9045 |
| 707 | Ga0373927_0023426 | 3300035695 | Bacteria | 4043 |
| 708 | Ga0373933_0000348 | 3300035724 | Bacteria | 29489 |
| 709 | Ga0373933_0004671 | 3300035724 | Bacteria | 7502 |
| 710 | Ga0373947_0012585 | 3300035725 | Bacteria | 4850 |
| 711 | Ga0373947_0063579 | 3300035725 | Bacteria | 2248 |
| 712 | Ga0373947_0144655 | 3300035725 | Bacteria | 1527 |
| 713 | Ga0373937_0059759 | 3300036401 | Bacteria | 3503 |
| 714 | Ga0373937_0079504 | 3300036401 | Bacteria | 3030 |
| 715 | Ga0373937_0170595 | 3300036401 | Bacteria | 2041 |
| 716 | Ga0373937_0381055 | 3300036401 | Bacteria | 1337 |
| 717 | Ga0373937_0557781 | 3300036401 | Bacteria | 1088 |
| 718 | Ga0372808_012610 | 3300036459 | Bacteria | 1201 |
| 719 | Ga0316584_0015310 | 3300036712 | Bacteria | 5483 |
| 720 | Ga0373925_0016402 | 3300037068 | Bacteria | 5366 |
| 721 | Ga0373925_0271167 | 3300037068 | Bacteria | 1365 |
| 722 | Ga0373925_0910845 | 3300037068 | Bacteria | 724 |
| 723 | Ga0395899_0045984 | 3300037312 | Bacteria | 3251 |
| 724 | Ga0395899_0182906 | 3300037312 | Bacteria | 1470 |
| 725 | Ga0395900_0146874 | 3300037418 | Bacteria | 2411 |
| 726 | Ga0395900_0224268 | 3300037418 | Bacteria | 1893 |
| 727 | Ga0395900_0327796 | 3300037418 | Bacteria | 1510 |
| 728 | Ga0395900_0333605 | 3300037418 | Bacteria | 1494 |
| 729 | Ga0395900_0344296 | 3300037418 | Bacteria | 1465 |
| 730 | Ga0395900_0839362 | 3300037418 | Bacteria | 845 |
| 731 | Ga0395898_0009973 | 3300037466 | Bacteria | 9949 |
| 732 | Ga0395898_0043826 | 3300037466 | Bacteria | 4408 |
| 733 | Ga0395898_0058881 | 3300037466 | Bacteria | 3739 |
| 734 | Ga0395898_0518929 | 3300037466 | Bacteria | 1133 |
| 735 | Ga0395905_0079594 | 3300037471 | Bacteria | 3072 |
| 736 | Ga0395905_0098751 | 3300037471 | Bacteria | 2742 |
| 737 | Ga0395905_0168012 | 3300037471 | Bacteria | 2061 |
| 738 | Ga0395901_0036728 | 3300038443 | Bacteria | 5064 |
| 739 | Ga0395901_0230420 | 3300038443 | Bacteria | 1934 |
| 740 | Ga0395901_0296402 | 3300038443 | Bacteria | 1677 |
| 741 | Ga0395901_0496746 | 3300038443 | Bacteria | 1242 |
| 742 | Ga0395901_0882950 | 3300038443 | Bacteria | 877 |
| 743 | Ga0436365_0472724 | 3300039437 | Bacteria | 822 |
| 744 | Ga0436365_0694949 | 3300039437 | Bacteria | 8262 |
| 745 | Ga0436365_0838471 | 3300039437 | Bacteria | 2463 |
| 746 | Ga0436365_1683641 | 3300039437 | Bacteria | 2186 |
| 747 | Ga0436365_1911415 | 3300039437 | Bacteria | 829 |
| 748 | Ga0436360_0605391 | 3300039438 | Bacteria | 14680 |
| 749 | Ga0436361_0018023 | 3300039447 | Bacteria | 1730 |
| 750 | Ga0436361_0576498 | 3300039447 | Bacteria | 3174 |
| 751 | Ga0436361_1036455 | 3300039447 | Bacteria | 1128 |
| 752 | Ga0436363_0060836 | 3300039450 | Bacteria | 1132 |
| 753 | Ga0436363_0165204 | 3300039450 | Bacteria | 3230 |
| 754 | Ga0436363_0194287 | 3300039450 | Bacteria | 4449 |
| 755 | Ga0436362_0418961 | 3300039453 | Bacteria | 5346 |
| 756 | Ga0436362_0974814 | 3300039453 | Bacteria | 1491 |
| 757 | Ga0436362_1114012 | 3300039453 | Bacteria | 996 |
| 758 | Ga0436362_1195541 | 3300039453 | Bacteria | 700 |
| 759 | Ga0451791_0175252 | 3300041451 | Bacteria | 1146 |
| 760 | Ga0451793_1106130 | 3300041452 | Bacteria | 1060 |
| 761 | Ga0451793_1469486 | 3300041452 | Bacteria | 1094 |
| 762 | Ga0451802_0621294 | 3300041460 | Bacteria | 1332 |
| 763 | Ga0439445_0109374 | 3300042004 | Bacteria | 788 |
| 764 | Ga0450894_037402 | 3300042131 | Bacteria | 691 |
| 765 | Ga0439440_0091747 | 3300042993 | Bacteria | 816 |
| 766 | Ga0466969_0195415 | 3300044656 | Bacteria | 924 |
| 767 | Ga0466972_0006422 | 3300044658 | Bacteria | 5905 |
| 768 | Ga0466972_0011224 | 3300044658 | Bacteria | 4496 |
| 769 | Ga0466972_0292348 | 3300044658 | Bacteria | 761 |
| 770 | Ga0466965_0112501 | 3300044683 | Bacteria | 1400 |
| 771 | Ga0466966_0001733 | 3300044684 | Bacteria | 14105 |
| 772 | Ga0466966_0103448 | 3300044684 | Bacteria | 1760 |
| 773 | Ga0466966_0589695 | 3300044684 | Bacteria | 669 |
| 774 | Ga0466961_0000009 | 3300044693 | Bacteria | 139001 |
| 775 | Ga0466961_0210915 | 3300044693 | Bacteria | 1199 |
| 776 | Ga0466963_0029623 | 3300044694 | Bacteria | 3525 |
| 777 | Ga0466963_0041407 | 3300044694 | Bacteria | 3021 |
| 778 | Ga0466968_0041819 | 3300044735 | Bacteria | 1936 |
| 779 | Ga0466968_0051956 | 3300044735 | Bacteria | 1752 |
| 780 | Ga0466968_0176754 | 3300044735 | Bacteria | 991 |
| 781 | Ga0466970_0225572 | 3300044765 | Bacteria | 1046 |
| 782 | Ga0466970_0225722 | 3300044765 | Bacteria | 1046 |
| 783 | Ga0466970_0411950 | 3300044765 | Bacteria | 772 |
| 784 | Ga0466970_0431591 | 3300044765 | Bacteria | 754 |
| 785 | Ga0466957_0167912 | 3300044842 | Bacteria | 1428 |
| 786 | Ga0466957_0473827 | 3300044842 | Bacteria | 865 |
| 787 | Ga0466960_0068614 | 3300044901 | Bacteria | 1759 |
| 788 | Ga0466960_0207382 | 3300044901 | Bacteria | 1073 |
| 789 | Ga0466960_0364477 | 3300044901 | Bacteria | 827 |
| 790 | Ga0466959_0003063 | 3300045049 | Bacteria | 10820 |
| 791 | Ga0466959_0013181 | 3300045049 | Bacteria | 5989 |
| 792 | Ga0466959_0093544 | 3300045049 | Bacteria | 2157 |
| 793 | Ga0466967_0041953 | 3300045976 | Bacteria | 3950 |
| 794 | Ga0466967_0048933 | 3300045976 | Bacteria | 3695 |
| 795 | Ga0466967_0088096 | 3300045976 | Bacteria | 2816 |
| 796 | Ga0466967_0382777 | 3300045976 | Bacteria | 1366 |
| 797 | Ga0466967_0980112 | 3300045976 | Bacteria | 841 |
| 798 | Ga0495617_038545 | 3300046452 | Bacteria | 1598 |
| 799 | Ga0495617_044045 | 3300046452 | Bacteria | 1490 |
| 800 | Ga0495592_0000784 | 3300046454 | Bacteria | 22015 |
| 801 | Ga0495592_0013597 | 3300046454 | Bacteria | 6192 |
| 802 | Ga0495592_0050838 | 3300046454 | Bacteria | 3079 |
| 803 | Ga0495592_0463846 | 3300046454 | Bacteria | 792 |
| 804 | Ga0495603_0002122 | 3300046455 | Bacteria | 11662 |
| 805 | Ga0495603_0006942 | 3300046455 | Bacteria | 6792 |
| 806 | Ga0495603_0019891 | 3300046455 | Bacteria | 4066 |
| 807 | Ga0495603_0037990 | 3300046455 | Bacteria | 2889 |
| 808 | Ga0495603_0132281 | 3300046455 | Bacteria | 1452 |
| 809 | Ga0495603_0169109 | 3300046455 | Bacteria | 1266 |
| 810 | Ga0495603_0362620 | 3300046455 | Bacteria | 831 |
| 811 | Ga0495629_0002089 | 3300046459 | Bacteria | 15494 |
| 812 | Ga0495629_0004413 | 3300046459 | Bacteria | 10539 |
| 813 | Ga0495629_0009291 | 3300046459 | Bacteria | 7193 |
| 814 | Ga0495629_0346538 | 3300046459 | Bacteria | 1014 |
| 815 | Ga0495629_0373522 | 3300046459 | Bacteria | 971 |
| 816 | Ga0495629_0404528 | 3300046459 | Bacteria | 927 |
| 817 | Ga0495629_0512386 | 3300046459 | Bacteria | 808 |
| 818 | Ga0495638_0012347 | 3300046460 | Bacteria | 5857 |
| 819 | Ga0495638_0082490 | 3300046460 | Bacteria | 1950 |
| 820 | Ga0495641_0033338 | 3300046461 | Bacteria | 2445 |
| 821 | Ga0495651_0002043 | 3300046462 | Bacteria | 15601 |
| 822 | Ga0495651_0008079 | 3300046462 | Bacteria | 8069 |
| 823 | Ga0495651_0141888 | 3300046462 | Bacteria | 1741 |
| 824 | Ga0495651_0172894 | 3300046462 | Bacteria | 1536 |
| 825 | Ga0495651_0202893 | 3300046462 | Bacteria | 1386 |
| 826 | Ga0495651_0309672 | 3300046462 | Bacteria | 1056 |
| 827 | Ga0495653_0010673 | 3300046463 | Bacteria | 7521 |
| 828 | Ga0495653_0040516 | 3300046463 | Bacteria | 3640 |
| 829 | Ga0495653_0041285 | 3300046463 | Bacteria | 3601 |
| 830 | Ga0495653_0110670 | 3300046463 | Bacteria | 1974 |
| 831 | Ga0495650_0055441 | 3300046471 | Bacteria | 1613 |
| 832 | Ga0495580_0016592 | 3300046472 | Bacteria | 5523 |
| 833 | Ga0495580_0165569 | 3300046472 | Bacteria | 1529 |
| 834 | Ga0495582_0000331 | 3300046473 | Bacteria | 25765 |
| 835 | Ga0495605_0123052 | 3300046474 | Bacteria | 1175 |
| 836 | Ga0495639_0000147 | 3300046475 | Bacteria | 36171 |
| 837 | Ga0495639_0100913 | 3300046475 | Bacteria | 1362 |
| 838 | Ga0495662_0252973 | 3300046476 | Bacteria | 868 |
| 839 | Ga0495662_0267445 | 3300046476 | Bacteria | 841 |
| 840 | Ga0495664_0011748 | 3300046477 | Bacteria | 4944 |
| 841 | Ga0495664_0039262 | 3300046477 | Bacteria | 2797 |
| 842 | Ga0495664_0061377 | 3300046477 | Bacteria | 2238 |
| 843 | Ga0495664_0080416 | 3300046477 | Bacteria | 1953 |
| 844 | Ga0495664_0383961 | 3300046477 | Bacteria | 844 |
| 845 | Ga0495584_0052285 | 3300046491 | Bacteria | 2056 |
| 846 | Ga0495585_0060847 | 3300046492 | Bacteria | 2077 |
| 847 | Ga0495594_0000113 | 3300046499 | Bacteria | 38231 |
| 848 | Ga0495594_0270989 | 3300046499 | Bacteria | 967 |
| 849 | Ga0495594_0409542 | 3300046499 | Bacteria | 771 |
| 850 | Ga0495596_0016851 | 3300046500 | Bacteria | 3032 |
| 851 | Ga0495583_0058686 | 3300046506 | Bacteria | 1727 |
| 852 | Ga0495583_0071311 | 3300046506 | Bacteria | 1526 |
| 853 | Ga0495606_0001165 | 3300046507 | Bacteria | 37175 |
| 854 | Ga0495606_0055718 | 3300046507 | Bacteria | 2556 |
| 855 | Ga0495608_0029134 | 3300046511 | Bacteria | 3748 |
| 856 | Ga0495608_0191309 | 3300046511 | Bacteria | 1292 |
| 857 | Ga0495610_0147420 | 3300046512 | Bacteria | 1007 |
| 858 | Ga0495610_0205231 | 3300046512 | Bacteria | 804 |
| 859 | Ga0495616_0065200 | 3300046513 | Bacteria | 1775 |
| 860 | Ga0495616_0097979 | 3300046513 | Bacteria | 1379 |
| 861 | Ga0495618_0003202 | 3300046514 | Bacteria | 10254 |
| 862 | Ga0495628_0001092 | 3300046516 | Bacteria | 24748 |
| 863 | Ga0495628_0055224 | 3300046516 | Bacteria | 3129 |
| 864 | Ga0495628_0200683 | 3300046516 | Bacteria | 1503 |
| 865 | Ga0495628_0423637 | 3300046516 | Bacteria | 970 |
| 866 | Ga0495630_0010615 | 3300046517 | Bacteria | 6651 |
| 867 | Ga0495630_0332641 | 3300046517 | Bacteria | 1162 |
| 868 | Ga0495630_0499307 | 3300046517 | Bacteria | 933 |
| 869 | Ga0495631_0033340 | 3300046518 | Bacteria | 2314 |
| 870 | Ga0495631_0069634 | 3300046518 | Bacteria | 1521 |
| 871 | Ga0495631_0091644 | 3300046518 | Bacteria | 1308 |
| 872 | Ga0495631_0146816 | 3300046518 | Bacteria | 1012 |
| 873 | Ga0495632_0209701 | 3300046519 | Bacteria | 884 |
| 874 | Ga0495643_0053073 | 3300046522 | Bacteria | 2174 |
| 875 | Ga0495643_0176355 | 3300046522 | Bacteria | 1041 |
| 876 | Ga0495648_0000378 | 3300046524 | Bacteria | 48799 |
| 877 | Ga0495648_0000776 | 3300046524 | Bacteria | 34006 |
| 878 | Ga0495663_0045194 | 3300046525 | Bacteria | 1350 |
| 879 | Ga0495666_0008723 | 3300046526 | Bacteria | 5078 |
| 880 | Ga0495666_0230980 | 3300046526 | Bacteria | 846 |
| 881 | Ga0495642_0181598 | 3300046528 | Bacteria | 916 |
| 882 | Ga0495652_0014813 | 3300046529 | Bacteria | 6990 |
| 883 | Ga0495652_0068865 | 3300046529 | Bacteria | 2963 |
| 884 | Ga0495652_0082065 | 3300046529 | Bacteria | 2658 |
| 885 | Ga0495652_0307290 | 3300046529 | Bacteria | 1150 |
| 886 | Ga0495665_0092777 | 3300046531 | Bacteria | 1587 |
| 887 | Ga0495640_0003705 | 3300046533 | Bacteria | 12278 |
| 888 | Ga0495640_0012355 | 3300046533 | Bacteria | 6527 |
| 889 | Ga0495640_0058844 | 3300046533 | Bacteria | 2619 |
| 890 | Ga0495640_0086096 | 3300046533 | Bacteria | 2081 |
| 891 | Ga0495640_0101679 | 3300046533 | Bacteria | 1886 |
| 892 | Ga0495640_0484919 | 3300046533 | Bacteria | 753 |
| 893 | Ga0495586_0096941 | 3300046535 | Bacteria | 1634 |
| 894 | Ga0495587_0012965 | 3300046536 | Bacteria | 5240 |
| 895 | Ga0495587_0121871 | 3300046536 | Bacteria | 1493 |
| 896 | Ga0495598_0049035 | 3300046537 | Bacteria | 1264 |
| 897 | Ga0495609_0020594 | 3300046538 | Bacteria | 3047 |
| 898 | Ga0495621_0078346 | 3300046539 | Bacteria | 1228 |
| 899 | Ga0495597_0154128 | 3300046542 | Bacteria | 941 |
| 900 | Ga0495597_0162603 | 3300046542 | Bacteria | 910 |
| 901 | Ga0495645_0006161 | 3300046543 | Bacteria | 8305 |
| 902 | Ga0495645_0008674 | 3300046543 | Bacteria | 7101 |
| 903 | Ga0495645_0027745 | 3300046543 | Bacteria | 4113 |
| 904 | Ga0495645_0425029 | 3300046543 | Bacteria | 842 |
| 905 | Ga0495622_0010529 | 3300046557 | Bacteria | 4270 |
| 906 | Ga0495622_0023366 | 3300046557 | Bacteria | 2881 |
| 907 | Ga0495622_0035738 | 3300046557 | Bacteria | 2316 |
| 908 | Ga0495633_0058245 | 3300046558 | Bacteria | 1813 |
| 909 | Ga0495633_0114930 | 3300046558 | Bacteria | 1247 |
| 910 | Ga0495633_0190576 | 3300046558 | Bacteria | 943 |
| 911 | Ga0495667_0000697 | 3300046559 | Bacteria | 21512 |
| 912 | Ga0495667_0015284 | 3300046559 | Bacteria | 5184 |
| 913 | Ga0495667_0044711 | 3300046559 | Bacteria | 2932 |
| 914 | Ga0495667_0069130 | 3300046559 | Bacteria | 2305 |
| 915 | Ga0495667_0104381 | 3300046559 | Bacteria | 1832 |
| 916 | Ga0495656_0006145 | 3300046615 | Bacteria | 4195 |
| 917 | Ga0495656_0099144 | 3300046615 | Bacteria | 1344 |
| 918 | Ga0495668_0098885 | 3300046616 | Bacteria | 1596 |
| 919 | Ga0495668_0136935 | 3300046616 | Bacteria | 1340 |
| 920 | Ga0495668_0146190 | 3300046616 | Bacteria | 1294 |
| 921 | Ga0495634_0023917 | 3300046642 | Bacteria | 4291 |
| 922 | Ga0495634_0025373 | 3300046642 | Bacteria | 4148 |
| 923 | Ga0495634_0052872 | 3300046642 | Bacteria | 2722 |
| 924 | Ga0495634_0094506 | 3300046642 | Bacteria | 1937 |
| 925 | Ga0495634_0306612 | 3300046642 | Bacteria | 959 |
| 926 | Ga0495611_0030002 | 3300046648 | Bacteria | 2388 |
| 927 | Ga0495625_0238953 | 3300046660 | Bacteria | 1183 |
| 928 | Ga0495625_0364585 | 3300046660 | Bacteria | 910 |
| 929 | Ga0495635_0000358 | 3300046663 | Bacteria | 29005 |
| 930 | Ga0495635_0000491 | 3300046663 | Bacteria | 24925 |
| 931 | Ga0495635_0205998 | 3300046663 | Bacteria | 1333 |
| 932 | Ga0495635_0306901 | 3300046663 | Bacteria | 1063 |
| 933 | Ga0495659_0059441 | 3300046664 | Bacteria | 1408 |
| 934 | Ga0495661_0253887 | 3300046665 | Bacteria | 896 |
| 935 | Ga0495588_0090749 | 3300046674 | Bacteria | 1600 |
| 936 | Ga0495588_0178007 | 3300046674 | Bacteria | 1124 |
| 937 | Ga0495657_0006263 | 3300046675 | Bacteria | 9325 |
| 938 | Ga0495657_0033718 | 3300046675 | Bacteria | 3562 |
| 939 | Ga0495657_0131208 | 3300046675 | Bacteria | 1569 |
| 940 | Ga0495657_0194812 | 3300046675 | Bacteria | 1237 |
| 941 | Ga0495599_0017171 | 3300046678 | Bacteria | 4497 |
| 942 | Ga0495599_0144290 | 3300046678 | Bacteria | 1476 |
| 943 | Ga0495623_0005004 | 3300046679 | Bacteria | 8695 |
| 944 | Ga0495623_0006372 | 3300046679 | Bacteria | 7673 |
| 945 | Ga0495623_0221525 | 3300046679 | Bacteria | 1077 |
| 946 | Ga0495646_0008340 | 3300046680 | Bacteria | 6590 |
| 947 | Ga0495646_0020670 | 3300046680 | Bacteria | 4165 |
| 948 | Ga0495646_0118464 | 3300046680 | Bacteria | 1500 |
| 949 | Ga0495646_0233557 | 3300046680 | Bacteria | 990 |
| 950 | Ga0495647_0000705 | 3300046681 | Bacteria | 9979 |
| 951 | Ga0495658_0002450 | 3300046683 | Bacteria | 9344 |
| 952 | Ga0495669_0029433 | 3300046684 | Bacteria | 2408 |
| 953 | Ga0495669_0030081 | 3300046684 | Bacteria | 2383 |
| 954 | Ga0495669_0188547 | 3300046684 | Bacteria | 984 |
| 955 | Ga0495669_0298050 | 3300046684 | Bacteria | 777 |
| 956 | Ga0495613_0094685 | 3300046689 | Bacteria | 2161 |
| 957 | Ga0495613_0139273 | 3300046689 | Bacteria | 1734 |
| 958 | Ga0495613_0194751 | 3300046689 | Bacteria | 1431 |
| 959 | Ga0495624_0003403 | 3300046690 | Bacteria | 11803 |
| 960 | Ga0495624_0297235 | 3300046690 | Bacteria | 974 |
| 961 | Ga0495624_0332322 | 3300046690 | Bacteria | 915 |
| 962 | Ga0495670_0061889 | 3300046691 | Bacteria | 1882 |
| 963 | Ga0495670_0099903 | 3300046691 | Bacteria | 1493 |
| 964 | Ga0495671_0087042 | 3300046692 | Bacteria | 1530 |
| 965 | Ga0495649_0322127 | 3300046694 | Bacteria | 784 |
| 966 | Ga0495600_0007576 | 3300046809 | Bacteria | 6647 |
| 967 | Ga0495600_0007900 | 3300046809 | Bacteria | 6519 |
| 968 | Ga0495600_0014138 | 3300046809 | Bacteria | 5027 |
| 969 | Ga0495600_0255328 | 3300046809 | Bacteria | 1114 |
| 970 | Ga0495600_0268886 | 3300046809 | Bacteria | 1082 |
| 971 | Ga0495600_0387963 | 3300046809 | Bacteria | 870 |
| 972 | Ga0495581_0160458 | 3300047315 | Bacteria | 1314 |
| 973 | Ga0495581_0169525 | 3300047315 | Bacteria | 1276 |
| 974 | Ga0495581_0327151 | 3300047315 | Bacteria | 895 |
| 975 | Ga0495604_0001200 | 3300047317 | Bacteria | 21400 |
| 976 | Ga0495604_0022394 | 3300047317 | Bacteria | 5045 |
| 977 | Ga0495636_0056609 | 3300047318 | Bacteria | 1651 |
| 978 | Ga0495674_0001226 | 3300047319 | Bacteria | 24884 |
| 979 | Ga0495674_0001231 | 3300047319 | Bacteria | 24836 |
| 980 | Ga0495674_0033843 | 3300047319 | Bacteria | 4625 |
| 981 | Ga0495674_0063283 | 3300047319 | Bacteria | 3218 |
| 982 | Ga0495674_0512520 | 3300047319 | Bacteria | 958 |
| 983 | Ga0495672_0000571 | 3300047320 | Bacteria | 41596 |
| 984 | Ga0495672_0139516 | 3300047320 | Bacteria | 1267 |
| 985 | Ga0495672_0204927 | 3300047320 | Bacteria | 984 |
| 986 | Ga0495672_0270544 | 3300047320 | Bacteria | 816 |
| 987 | Ga0495676_0186919 | 3300047321 | Bacteria | 1447 |
| 988 | Ga0495676_0220355 | 3300047321 | Bacteria | 1308 |
| 989 | Ga0495680_0001591 | 3300047322 | Bacteria | 24246 |
| 990 | Ga0495680_0005953 | 3300047322 | Bacteria | 11405 |
| 991 | Ga0495680_0238106 | 3300047322 | Bacteria | 1294 |
| 992 | Ga0495683_0083987 | 3300047323 | Bacteria | 1550 |
| 993 | Ga0495683_0253907 | 3300047323 | Bacteria | 770 |
| 994 | Ga0495687_061617 | 3300047443 | Bacteria | 1542 |
| 995 | Ga0495687_110765 | 3300047443 | Bacteria | 1010 |
| 996 | Ga0495675_0002604 | 3300047444 | Bacteria | 10812 |
| 997 | Ga0495675_0014401 | 3300047444 | Bacteria | 4997 |
| 998 | Ga0495685_050343 | 3300047447 | Bacteria | 1414 |
| 999 | Ga0495673_0004400 | 3300047469 | Bacteria | 8832 |
| 1000 | Ga0495673_0103814 | 3300047469 | Bacteria | 1145 |
| 1001 | Ga0495681_0166435 | 3300047470 | Bacteria | 915 |
| 1002 | Ga0495681_0233991 | 3300047470 | Bacteria | 732 |
| 1003 | Ga0495684_0000897 | 3300047471 | Bacteria | 24092 |
| 1004 | Ga0495684_0113156 | 3300047471 | Bacteria | 2046 |
| 1005 | Ga0495684_0270226 | 3300047471 | Bacteria | 1230 |
| 1006 | Ga0495686_0054893 | 3300047472 | Bacteria | 2493 |
| 1007 | Ga0495686_0084124 | 3300047472 | Bacteria | 1939 |
| 1008 | Ga0495686_0283812 | 3300047472 | Bacteria | 919 |
| 1009 | Ga0495593_0002080 | 3300047673 | Bacteria | 11960 |
| 1010 | Ga0495593_0002499 | 3300047673 | Bacteria | 11060 |
| 1011 | Ga0495593_0155042 | 3300047673 | Bacteria | 1158 |
| 1012 | Ga0495593_0227767 | 3300047673 | Bacteria | 935 |
| 1013 | Ga0495602_0000392 | 3300048088 | Bacteria | 40828 |
| 1014 | Ga0495602_0012486 | 3300048088 | Bacteria | 8728 |
| 1015 | Ga0495602_0147428 | 3300048088 | Bacteria | 1854 |
| 1016 | Ga0495626_0095919 | 3300048091 | Bacteria | 1298 |
| 1017 | Ga0495626_0124934 | 3300048091 | Bacteria | 1103 |
| 1018 | Ga0496100_0018019 | 3300048903 | Bacteria | 4181 |
| 1019 | Ga0496100_0117230 | 3300048903 | Bacteria | 1859 |
| 1020 | Ga0496100_0152155 | 3300048903 | Bacteria | 1651 |
| 1021 | Ga0496100_0869611 | 3300048903 | Bacteria | 707 |
| 1022 | Ga0496101_0203527 | 3300048904 | Bacteria | 1531 |
| 1023 | Ga0496101_0259375 | 3300048904 | Bacteria | 1355 |
| 1024 | Ga0496102_0088198 | 3300048905 | Bacteria | 2867 |
| 1025 | Ga0496102_0120647 | 3300048905 | Bacteria | 2448 |
| 1026 | Ga0496102_0143930 | 3300048905 | Bacteria | 2236 |
| 1027 | Ga0496102_0146704 | 3300048905 | Bacteria | 2215 |
| 1028 | Ga0496102_0188546 | 3300048905 | Bacteria | 1943 |
| 1029 | Ga0496102_0306964 | 3300048905 | Bacteria | 1495 |
| 1030 | Ga0496102_0334916 | 3300048905 | Bacteria | 1425 |
| 1031 | Ga0496103_0066119 | 3300048906 | Bacteria | 2256 |
| 1032 | Ga0496103_0282495 | 3300048906 | Bacteria | 1067 |
| 1033 | Ga0496104_0004695 | 3300048907 | Bacteria | 11899 |
| 1034 | Ga0496104_0014830 | 3300048907 | Bacteria | 7043 |
| 1035 | Ga0496104_0131260 | 3300048907 | Bacteria | 2406 |
| 1036 | Ga0496104_0178064 | 3300048907 | Bacteria | 2036 |
| 1037 | Ga0496104_0521360 | 3300048907 | Bacteria | 1099 |
| 1038 | Ga0496105_0041160 | 3300048908 | Bacteria | 3808 |
| 1039 | Ga0496105_0087843 | 3300048908 | Bacteria | 2568 |
| 1040 | Ga0496105_0288219 | 3300048908 | Bacteria | 1322 |
| 1041 | Ga0496105_0561925 | 3300048908 | Bacteria | 889 |
| 1042 | Ga0496106_0001396 | 3300048909 | Bacteria | 18100 |
| 1043 | Ga0496106_0007524 | 3300048909 | Bacteria | 8055 |
| 1044 | Ga0496106_0010594 | 3300048909 | Bacteria | 6810 |
| 1045 | Ga0496106_0013602 | 3300048909 | Bacteria | 6008 |
| 1046 | Ga0496106_0019605 | 3300048909 | Bacteria | 5017 |
| 1047 | Ga0496106_0047429 | 3300048909 | Bacteria | 3233 |
| 1048 | Ga0496106_0203955 | 3300048909 | Bacteria | 1574 |
| 1049 | Ga0496106_0356166 | 3300048909 | Bacteria | 1176 |
| 1050 | Ga0496106_0478172 | 3300048909 | Bacteria | 1001 |
| 1051 | Ga0496107_0002660 | 3300048910 | Bacteria | 11701 |
| 1052 | Ga0496107_0054255 | 3300048910 | Bacteria | 2892 |
| 1053 | Ga0496107_0202486 | 3300048910 | Bacteria | 1475 |
| 1054 | Ga0496107_0256096 | 3300048910 | Bacteria | 1302 |
| 1055 | Ga0496108_0002981 | 3300048911 | Bacteria | 13605 |
| 1056 | Ga0496108_0042560 | 3300048911 | Bacteria | 3792 |
| 1057 | Ga0496108_0055486 | 3300048911 | Bacteria | 3327 |
| 1058 | Ga0496108_0120991 | 3300048911 | Bacteria | 2245 |
| 1059 | Ga0496108_0131707 | 3300048911 | Bacteria | 2149 |
| 1060 | Ga0496108_0244352 | 3300048911 | Bacteria | 1561 |
| 1061 | Ga0496108_0326356 | 3300048911 | Bacteria | 1338 |
| 1062 | Ga0496108_0455741 | 3300048911 | Bacteria | 1117 |
| 1063 | Ga0496109_0000680 | 3300048912 | Bacteria | 28264 |
| 1064 | Ga0496109_0015312 | 3300048912 | Bacteria | 6680 |
| 1065 | Ga0496109_0064596 | 3300048912 | Bacteria | 3349 |
| 1066 | Ga0496109_0072998 | 3300048912 | Bacteria | 3153 |
| 1067 | Ga0496109_0099641 | 3300048912 | Bacteria | 2695 |
| 1068 | Ga0496109_0308605 | 3300048912 | Bacteria | 1492 |
| 1069 | Ga0496109_0337662 | 3300048912 | Bacteria | 1423 |
| 1070 | Ga0496109_0567663 | 3300048912 | Bacteria | 1070 |
| 1071 | Ga0496110_0011018 | 3300048913 | Bacteria | 7379 |
| 1072 | Ga0496110_0035574 | 3300048913 | Bacteria | 4321 |
| 1073 | Ga0496110_0206475 | 3300048913 | Bacteria | 1785 |
| 1074 | Ga0496111_0026885 | 3300048914 | Bacteria | 4066 |
| 1075 | Ga0496111_0030432 | 3300048914 | Bacteria | 3838 |
| 1076 | Ga0496111_0038904 | 3300048914 | Bacteria | 3408 |
| 1077 | Ga0496111_0193417 | 3300048914 | Bacteria | 1512 |
| 1078 | Ga0496111_0218506 | 3300048914 | Bacteria | 1416 |
| 1079 | Ga0496112_0000092 | 3300048915 | Bacteria | 58800 |
| 1080 | Ga0496112_0012339 | 3300048915 | Bacteria | 7850 |
| 1081 | Ga0496112_0012489 | 3300048915 | Bacteria | 7805 |
| 1082 | Ga0496112_0029751 | 3300048915 | Bacteria | 5284 |
| 1083 | Ga0496112_0048156 | 3300048915 | Bacteria | 4180 |
| 1084 | Ga0496112_0089828 | 3300048915 | Bacteria | 3040 |
| 1085 | Ga0496112_0211298 | 3300048915 | Bacteria | 1897 |
| 1086 | Ga0496112_0340943 | 3300048915 | Bacteria | 1442 |
| 1087 | Ga0496112_0383866 | 3300048915 | Bacteria | 1346 |
| 1088 | Ga0496113_0031665 | 3300048916 | Bacteria | 3840 |
| 1089 | Ga0496113_0032428 | 3300048916 | Bacteria | 3797 |
| 1090 | Ga0496113_0081632 | 3300048916 | Bacteria | 2478 |
| 1091 | Ga0496113_0084790 | 3300048916 | Bacteria | 2433 |
| 1092 | Ga0496113_0140703 | 3300048916 | Bacteria | 1898 |
| 1093 | Ga0496113_0273297 | 3300048916 | Bacteria | 1351 |
| 1094 | Ga0496113_0473859 | 3300048916 | Bacteria | 1006 |
| 1095 | Ga0496114_0061159 | 3300048917 | Bacteria | 3149 |
| 1096 | Ga0496114_0196222 | 3300048917 | Bacteria | 1767 |
| 1097 | Ga0496114_0271091 | 3300048917 | Bacteria | 1495 |
| 1098 | Ga0496114_0304370 | 3300048917 | Bacteria | 1408 |
| 1099 | Ga0496114_0578896 | 3300048917 | Bacteria | 991 |
| 1100 | Ga0496115_0002197 | 3300048918 | Bacteria | 13964 |
| 1101 | Ga0496115_0021622 | 3300048918 | Bacteria | 4972 |
| 1102 | Ga0496115_0026754 | 3300048918 | Bacteria | 4506 |
| 1103 | Ga0496115_0059260 | 3300048918 | Bacteria | 3083 |
| 1104 | Ga0496115_0099283 | 3300048918 | Bacteria | 2385 |
| 1105 | Ga0496115_0171019 | 3300048918 | Bacteria | 1797 |
| 1106 | Ga0496115_0174534 | 3300048918 | Bacteria | 1777 |
| 1107 | Ga0496115_0201925 | 3300048918 | Bacteria | 1642 |
| 1108 | Ga0496115_0273669 | 3300048918 | Bacteria | 1387 |
| 1109 | Ga0496116_0004921 | 3300048919 | Bacteria | 12589 |
| 1110 | Ga0496116_0084957 | 3300048919 | Bacteria | 1947 |
| 1111 | Ga0496117_0038158 | 3300048920 | Bacteria | 3568 |
| 1112 | Ga0496117_0067871 | 3300048920 | Bacteria | 2410 |
| 1113 | Ga0496117_0109453 | 3300048920 | Bacteria | 1725 |
| 1114 | Ga0496117_0133701 | 3300048920 | Bacteria | 1498 |
| 1115 | Ga0496117_0366414 | 3300048920 | Bacteria | 738 |
| 1116 | Ga0496118_0013106 | 3300048921 | Bacteria | 7877 |
| 1117 | Ga0496118_0023964 | 3300048921 | Bacteria | 5283 |
| 1118 | Ga0496118_0177977 | 3300048921 | Bacteria | 1289 |
| 1119 | Ga0496118_0198522 | 3300048921 | Bacteria | 1191 |
| 1120 | Ga0496119_0012182 | 3300048922 | Bacteria | 7016 |
| 1121 | Ga0496119_0018807 | 3300048922 | Bacteria | 5120 |
| 1122 | Ga0496119_0026413 | 3300048922 | Bacteria | 4027 |
| 1123 | Ga0496119_0197846 | 3300048922 | Bacteria | 1042 |
| 1124 | Ga0496120_0081147 | 3300048923 | Bacteria | 1756 |
| 1125 | Ga0496120_0089965 | 3300048923 | Bacteria | 1642 |
| 1126 | Ga0496120_0149529 | 3300048923 | Bacteria | 1175 |
| 1127 | Ga0496121_0001057 | 3300048924 | Bacteria | 48772 |
| 1128 | Ga0496121_0002390 | 3300048924 | Bacteria | 28777 |
| 1129 | Ga0496121_0005210 | 3300048924 | Bacteria | 16843 |
| 1130 | Ga0496121_0007663 | 3300048924 | Bacteria | 12964 |
| 1131 | Ga0496121_0009900 | 3300048924 | Bacteria | 10854 |
| 1132 | Ga0496121_0027990 | 3300048924 | Bacteria | 5259 |
| 1133 | Ga0496121_0033930 | 3300048924 | Bacteria | 4605 |
| 1134 | Ga0496121_0062971 | 3300048924 | Bacteria | 3035 |
| 1135 | Ga0496121_0067770 | 3300048924 | Bacteria | 2891 |
| 1136 | Ga0496121_0103444 | 3300048924 | Bacteria | 2191 |
| 1137 | Ga0496121_0153540 | 3300048924 | Bacteria | 1691 |
| 1138 | Ga0496121_0155324 | 3300048924 | Bacteria | 1679 |
| 1139 | Ga0496121_0157772 | 3300048924 | Bacteria | 1663 |
| 1140 | Ga0496121_0162864 | 3300048924 | Bacteria | 1629 |
| 1141 | Ga0496121_0175878 | 3300048924 | Bacteria | 1549 |
| 1142 | Ga0496121_0205528 | 3300048924 | Bacteria | 1399 |
| 1143 | Ga0496121_0224413 | 3300048924 | Bacteria | 1321 |
| 1144 | Ga0496121_0358432 | 3300048924 | Bacteria | 969 |
| 1145 | Ga0496122_0116850 | 3300048925 | Bacteria | 1733 |
| 1146 | Ga0496122_0180775 | 3300048925 | Bacteria | 1258 |
| 1147 | Ga0496123_0202642 | 3300048926 | Bacteria | 1015 |
| 1148 | Ga0496123_0293152 | 3300048926 | Bacteria | 780 |
| 1149 | Ga0496124_0063109 | 3300048927 | Bacteria | 3097 |
| 1150 | Ga0496124_0126216 | 3300048927 | Bacteria | 2038 |
| 1151 | Ga0496124_0138905 | 3300048927 | Bacteria | 1920 |
| 1152 | Ga0496124_0156141 | 3300048927 | Bacteria | 1784 |
| 1153 | Ga0496124_0222828 | 3300048927 | Bacteria | 1417 |
| 1154 | Ga0496124_0310814 | 3300048927 | Bacteria | 1133 |
| 1155 | Ga0496125_0000237 | 3300048928 | Bacteria | 113322 |
| 1156 | Ga0496125_0004959 | 3300048928 | Bacteria | 15051 |
| 1157 | Ga0496125_0007927 | 3300048928 | Bacteria | 11213 |
| 1158 | Ga0496125_0067041 | 3300048928 | Bacteria | 2831 |
| 1159 | Ga0496125_0106267 | 3300048928 | Bacteria | 2049 |
| 1160 | Ga0496125_0122572 | 3300048928 | Bacteria | 1850 |
| 1161 | Ga0496125_0306968 | 3300048928 | Bacteria | 969 |
| 1162 | Ga0496126_0001827 | 3300048929 | Bacteria | 31077 |
| 1163 | Ga0496126_0007564 | 3300048929 | Bacteria | 11879 |
| 1164 | Ga0496126_0009154 | 3300048929 | Bacteria | 10570 |
| 1165 | Ga0496126_0011078 | 3300048929 | Bacteria | 9371 |
| 1166 | Ga0496126_0012721 | 3300048929 | Bacteria | 8607 |
| 1167 | Ga0496126_0020967 | 3300048929 | Bacteria | 6396 |
| 1168 | Ga0496126_0046372 | 3300048929 | Bacteria | 3986 |
| 1169 | Ga0496126_0054701 | 3300048929 | Bacteria | 3613 |
| 1170 | Ga0496126_0056206 | 3300048929 | Bacteria | 3558 |
| 1171 | Ga0496126_0078367 | 3300048929 | Bacteria | 2928 |
| 1172 | Ga0496126_0083738 | 3300048929 | Bacteria | 2814 |
| 1173 | Ga0496126_0085832 | 3300048929 | Bacteria | 2774 |
| 1174 | Ga0496126_0144235 | 3300048929 | Bacteria | 2047 |
| 1175 | Ga0496126_0168557 | 3300048929 | Bacteria | 1867 |
| 1176 | Ga0496126_0230604 | 3300048929 | Bacteria | 1551 |
| 1177 | Ga0496126_0253975 | 3300048929 | Bacteria | 1464 |
| 1178 | Ga0496126_0261833 | 3300048929 | Bacteria | 1438 |
| 1179 | Ga0496126_0372119 | 3300048929 | Bacteria | 1165 |
| 1180 | Ga0496126_0482964 | 3300048929 | Bacteria | 992 |
| 1181 | Ga0496126_0503732 | 3300048929 | Bacteria | 967 |
| 1182 | Ga0496126_0805188 | 3300048929 | Bacteria | 720 |
| 1183 | Ga0495678_147606 | 3300049459 | Bacteria | 763 |
| 1184 | Ga0495682_0036048 | 3300049460 | Bacteria | 1821 |
| 1185 | Ga0495682_0042883 | 3300049460 | Bacteria | 1657 |
| 1186 | Ga0501031_0006062 | 3300049568 | Bacteria | 7895 |
| 1187 | Ga0501031_0013983 | 3300049568 | Bacteria | 5226 |
| 1188 | Ga0501031_0020408 | 3300049568 | Bacteria | 4318 |
| 1189 | Ga0501032_0001501 | 3300049569 | Bacteria | 18648 |
| 1190 | Ga0501032_0124903 | 3300049569 | Bacteria | 1700 |
| 1191 | Ga0501032_0359983 | 3300049569 | Bacteria | 937 |
| 1192 | Ga0501033_0000394 | 3300049570 | Bacteria | 42043 |
| 1193 | Ga0501033_0000639 | 3300049570 | Bacteria | 32342 |
| 1194 | Ga0501033_0016652 | 3300049570 | Bacteria | 5560 |
| 1195 | Ga0501033_0090615 | 3300049570 | Bacteria | 2237 |
| 1196 | Ga0501033_0100323 | 3300049570 | Bacteria | 2113 |
| 1197 | Ga0501034_0000157 | 3300049571 | Bacteria | 128661 |
| 1198 | Ga0501034_0068248 | 3300049571 | Bacteria | 3566 |
| 1199 | Ga0501034_0123784 | 3300049571 | Bacteria | 2571 |
| 1200 | Ga0501034_0173679 | 3300049571 | Bacteria | 2121 |
| 1201 | Ga0501034_0270338 | 3300049571 | Bacteria | 1641 |
| 1202 | Ga0501034_0311051 | 3300049571 | Bacteria | 1510 |
| 1203 | Ga0501034_0495753 | 3300049571 | Bacteria | 1135 |
| 1204 | Ga0501036_0000440 | 3300049572 | Bacteria | 29582 |
| 1205 | Ga0501036_0032056 | 3300049572 | Bacteria | 4439 |
| 1206 | Ga0501036_0058423 | 3300049572 | Bacteria | 3267 |
| 1207 | Ga0501036_0089001 | 3300049572 | Bacteria | 2608 |
| 1208 | Ga0501036_0197573 | 3300049572 | Bacteria | 1692 |
| 1209 | Ga0501036_0208537 | 3300049572 | Bacteria | 1642 |
| 1210 | Ga0501036_0242185 | 3300049572 | Bacteria | 1512 |
| 1211 | Ga0501036_0521308 | 3300049572 | Bacteria | 988 |
| 1212 | Ga0501036_0810480 | 3300049572 | Bacteria | 771 |
| 1213 | Ga0501037_0000969 | 3300049573 | Bacteria | 21316 |
| 1214 | Ga0501037_0001723 | 3300049573 | Bacteria | 15886 |
| 1215 | Ga0501037_0049834 | 3300049573 | Bacteria | 3066 |
| 1216 | Ga0501037_0057203 | 3300049573 | Bacteria | 2847 |
| 1217 | Ga0501037_0234287 | 3300049573 | Bacteria | 1288 |
| 1218 | Ga0501038_0000473 | 3300049574 | Bacteria | 35337 |
| 1219 | Ga0501038_0010530 | 3300049574 | Bacteria | 8458 |
| 1220 | Ga0501038_0034189 | 3300049574 | Bacteria | 4472 |
| 1221 | Ga0501038_0037503 | 3300049574 | Bacteria | 4249 |
| 1222 | Ga0501038_0096218 | 3300049574 | Bacteria | 2472 |
| 1223 | Ga0501038_0112741 | 3300049574 | Bacteria | 2251 |
| 1224 | Ga0501038_0143120 | 3300049574 | Bacteria | 1954 |
| 1225 | Ga0501038_0238474 | 3300049574 | Bacteria | 1444 |
| 1226 | Ga0501038_0643035 | 3300049574 | Bacteria | 799 |
| 1227 | Ga0501039_0002012 | 3300049575 | Bacteria | 15036 |
| 1228 | Ga0501039_0006007 | 3300049575 | Bacteria | 9208 |
| 1229 | Ga0501039_0109240 | 3300049575 | Bacteria | 2162 |
| 1230 | Ga0501039_0123997 | 3300049575 | Bacteria | 2025 |
| 1231 | Ga0501040_0244174 | 3300049576 | Bacteria | 1280 |
| 1232 | Ga0501040_0256419 | 3300049576 | Bacteria | 1248 |
| 1233 | Ga0501041_0069312 | 3300049577 | Bacteria | 2163 |
| 1234 | Ga0501042_0065242 | 3300049578 | Bacteria | 2602 |
| 1235 | Ga0501042_0080850 | 3300049578 | Bacteria | 2328 |
| 1236 | Ga0501043_0002014 | 3300049579 | Bacteria | 17357 |
| 1237 | Ga0501043_0003168 | 3300049579 | Bacteria | 13612 |
| 1238 | Ga0501043_0016557 | 3300049579 | Bacteria | 5779 |
| 1239 | Ga0501043_0051045 | 3300049579 | Bacteria | 3251 |
| 1240 | Ga0501043_0071243 | 3300049579 | Bacteria | 2730 |
| 1241 | Ga0501043_0110503 | 3300049579 | Bacteria | 2158 |
| 1242 | Ga0501043_0121514 | 3300049579 | Bacteria | 2048 |
| 1243 | Ga0501043_0151668 | 3300049579 | Bacteria | 1813 |
| 1244 | Ga0501043_0153968 | 3300049579 | Bacteria | 1798 |
| 1245 | Ga0501043_0398883 | 3300049579 | Bacteria | 1040 |
| 1246 | Ga0501046_0026559 | 3300049580 | Bacteria | 4728 |
| 1247 | Ga0501046_0043974 | 3300049580 | Bacteria | 3554 |
| 1248 | Ga0501046_0054587 | 3300049580 | Bacteria | 3142 |
| 1249 | Ga0501046_0062722 | 3300049580 | Bacteria | 2903 |
| 1250 | Ga0501046_0122020 | 3300049580 | Bacteria | 1982 |
| 1251 | Ga0501047_0000419 | 3300049581 | Bacteria | 47535 |
| 1252 | Ga0501047_0052635 | 3300049581 | Bacteria | 3935 |
| 1253 | Ga0501047_0274357 | 3300049581 | Bacteria | 1532 |
| 1254 | Ga0501047_0375785 | 3300049581 | Bacteria | 1256 |
| 1255 | Ga0501047_0388877 | 3300049581 | Bacteria | 1228 |
| 1256 | Ga0501047_0502243 | 3300049581 | Bacteria | 1039 |
| 1257 | Ga0501048_0000057 | 3300049582 | Bacteria | 56138 |
| 1258 | Ga0501048_0099098 | 3300049582 | Bacteria | 2056 |
| 1259 | Ga0501048_0556373 | 3300049582 | Bacteria | 823 |
| 1260 | Ga0501067_0000507 | 3300049583 | Bacteria | 21269 |
| 1261 | Ga0501067_0023557 | 3300049583 | Bacteria | 3412 |
| 1262 | Ga0501067_0154639 | 3300049583 | Bacteria | 1278 |
| 1263 | Ga0501067_0176722 | 3300049583 | Bacteria | 1189 |
| 1264 | Ga0501067_0195646 | 3300049583 | Bacteria | 1126 |
| 1265 | Ga0501067_0389095 | 3300049583 | Bacteria | 777 |
| 1266 | Ga0501068_0004195 | 3300049584 | Bacteria | 7818 |
| 1267 | Ga0501068_0066490 | 3300049584 | Bacteria | 2196 |
| 1268 | Ga0501068_0071854 | 3300049584 | Bacteria | 2112 |
| 1269 | Ga0501069_0006517 | 3300049585 | Bacteria | 6102 |
| 1270 | Ga0501069_0218198 | 3300049585 | Bacteria | 1108 |
| 1271 | Ga0501070_0029682 | 3300049586 | Bacteria | 4582 |
| 1272 | Ga0501070_0061196 | 3300049586 | Bacteria | 3119 |
| 1273 | Ga0501070_0115060 | 3300049586 | Bacteria | 2222 |
| 1274 | Ga0501070_0204862 | 3300049586 | Bacteria | 1620 |
| 1275 | Ga0501070_0719349 | 3300049586 | Bacteria | 789 |
| 1276 | Ga0501071_0056300 | 3300049587 | Bacteria | 2840 |
| 1277 | Ga0501071_0083928 | 3300049587 | Bacteria | 2334 |
| 1278 | Ga0501071_0166824 | 3300049587 | Bacteria | 1648 |
| 1279 | Ga0501071_0281672 | 3300049587 | Bacteria | 1258 |
| 1280 | Ga0501071_0641394 | 3300049587 | Bacteria | 817 |
| 1281 | Ga0501072_0053425 | 3300049588 | Bacteria | 3181 |
| 1282 | Ga0501072_0313805 | 3300049588 | Bacteria | 1246 |
| 1283 | Ga0501073_0000027 | 3300049589 | Bacteria | 121860 |
| 1284 | Ga0501073_0017325 | 3300049589 | Bacteria | 5217 |
| 1285 | Ga0501073_0090860 | 3300049589 | Bacteria | 2122 |
| 1286 | Ga0501073_0169705 | 3300049589 | Bacteria | 1510 |
| 1287 | Ga0501073_0171015 | 3300049589 | Bacteria | 1504 |
| 1288 | Ga0501073_0698533 | 3300049589 | Bacteria | 700 |
| 1289 | Ga0501074_0000081 | 3300049590 | Bacteria | 46487 |
| 1290 | Ga0501074_0374537 | 3300049590 | Bacteria | 1010 |
| 1291 | Ga0501076_0078412 | 3300049592 | Bacteria | 2651 |
| 1292 | Ga0501077_0077707 | 3300049593 | Bacteria | 2103 |
| 1293 | Ga0501079_0068811 | 3300049741 | Bacteria | 2733 |
| 1294 | Ga0501079_0080208 | 3300049741 | Bacteria | 2523 |
| 1295 | Ga0501079_0082616 | 3300049741 | Bacteria | 2484 |
| 1296 | Ga0501080_0000313 | 3300049742 | Bacteria | 37111 |
| 1297 | Ga0501080_0025448 | 3300049742 | Bacteria | 5493 |
| 1298 | Ga0501080_0316932 | 3300049742 | Bacteria | 1412 |
| 1299 | Ga0501083_0062728 | 3300049744 | Bacteria | 2479 |
| 1300 | Ga0501035_0000145 | 3300049822 | Bacteria | 86013 |
| 1301 | Ga0501035_0002494 | 3300049822 | Bacteria | 17985 |
| 1302 | Ga0501035_0043031 | 3300049822 | Bacteria | 4071 |
| 1303 | Ga0501035_0045019 | 3300049822 | Bacteria | 3971 |
| 1304 | Ga0501035_0145887 | 3300049822 | Bacteria | 2055 |
| 1305 | Ga0501035_0159854 | 3300049822 | Bacteria | 1951 |
| 1306 | Ga0501035_0169311 | 3300049822 | Bacteria | 1888 |
| 1307 | Ga0501035_0175867 | 3300049822 | Bacteria | 1846 |
| 1308 | Ga0501035_0521166 | 3300049822 | Bacteria | 976 |
| 1309 | Ga0501035_0535663 | 3300049822 | Bacteria | 960 |
| 1310 | Ga0501044_0002483 | 3300049823 | Bacteria | 21039 |
| 1311 | Ga0501044_0016900 | 3300049823 | Bacteria | 7826 |
| 1312 | Ga0501044_0017556 | 3300049823 | Bacteria | 7677 |
| 1313 | Ga0501044_0028759 | 3300049823 | Bacteria | 5864 |
| 1314 | Ga0501044_0037365 | 3300049823 | Bacteria | 5076 |
| 1315 | Ga0501044_0047612 | 3300049823 | Bacteria | 4434 |
| 1316 | Ga0501044_0070464 | 3300049823 | Bacteria | 3556 |
| 1317 | Ga0501044_0086992 | 3300049823 | Bacteria | 3156 |
| 1318 | Ga0501044_0316040 | 3300049823 | Bacteria | 1487 |
| 1319 | Ga0501044_0715447 | 3300049823 | Bacteria | 886 |
| 1320 | Ga0501045_0032630 | 3300049824 | Bacteria | 3774 |
| 1321 | Ga0501045_0065645 | 3300049824 | Bacteria | 2664 |
| 1322 | Ga0501045_0287662 | 3300049824 | Bacteria | 1223 |
| 1323 | nmdc:mga03683_84769_c1 | 3300050489 | Bacteria | 1373 |
| 1324 | nmdc:mga03n38_130777_c1 | 3300050490 | Bacteria | 1244 |
| 1325 | nmdc:mga03n38_174286_c1 | 3300050490 | Bacteria | 1098 |
| 1326 | nmdc:mga03n38_84922_c1 | 3300050490 | Bacteria | 1495 |
| 1327 | nmdc:mga00v17_106208_c1 | 3300050491 | Bacteria | 1777 |
| 1328 | nmdc:mga00v17_17072_c1 | 3300050491 | Bacteria | 4099 |
| 1329 | nmdc:mga00v17_339804_c1 | 3300050491 | Bacteria | 976 |
| 1330 | nmdc:mga00v17_535846_c1 | 3300050491 | Bacteria | 757 |
| 1331 | nmdc:mga0yw44_131148_c1 | 3300050492 | Bacteria | 1623 |
| 1332 | nmdc:mga0yw44_188824_c1 | 3300050492 | Bacteria | 1358 |
| 1333 | nmdc:mga0yw44_50814_c1 | 3300050492 | Bacteria | 2508 |
| 1334 | nmdc:mga0yw44_65741_c1 | 3300050492 | Bacteria | 2236 |
| 1335 | nmdc:mga0yw44_76420_c1 | 3300050492 | Bacteria | 2090 |
| 1336 | nmdc:mga0yw44_83502_c1 | 3300050492 | Bacteria | 2007 |
| 1337 | nmdc:mga0k408_39324_c1 | 3300050493 | Bacteria | 2717 |
| 1338 | nmdc:mga06z11_102090_c1 | 3300050494 | Bacteria | 1575 |
| 1339 | nmdc:mga06z11_142812_c1 | 3300050494 | Bacteria | 1355 |
| 1340 | nmdc:mga06z11_231002_c1 | 3300050494 | Bacteria | 1084 |
| 1341 | nmdc:mga06z11_276815_c1 | 3300050494 | Bacteria | 993 |
| 1342 | nmdc:mga06z11_30175_c1 | 3300050494 | Bacteria | 2621 |
| 1343 | nmdc:mga06z11_4552_c1 | 3300050494 | Bacteria | 5463 |
| 1344 | nmdc:mga06z11_51386_c1 | 3300050494 | Bacteria | 2110 |
| 1345 | nmdc:mga04h51_27619_c1 | 3300050495 | Bacteria | 1764 |
| 1346 | nmdc:mga07m45_102463_c1 | 3300050496 | Bacteria | 1644 |
| 1347 | nmdc:mga07m45_26107_c1 | 3300050496 | Bacteria | 3208 |
| 1348 | nmdc:mga07m45_43386_c1 | 3300050496 | Bacteria | 2521 |
| 1349 | nmdc:mga07m45_76241_c1 | 3300050496 | Bacteria | 1912 |
| 1350 | nmdc:mga05p37_787746_c1 | 3300050507 | Bacteria | 1042 |
| 1351 | nmdc:mga0n895_92008_c1 | 3300050512 | Bacteria | 3036 |
| 1352 | nmdc:mga0rr50_144537_c1 | 3300050513 | Bacteria | 1916 |
| 1353 | nmdc:mga0a205_175450_c1 | 3300050515 | Bacteria | 2038 |
| 1354 | nmdc:mga0sz30_23579_c1 | 3300050516 | Bacteria | 1397 |
| 1355 | nmdc:mga0sz30_41151_c1 | 3300050516 | Bacteria | 1943 |
| 1356 | nmdc:mga0sz30_89970_c1 | 3300050516 | Bacteria | 1335 |
| 1357 | Ga0495601_0062758 | 3300053077 | Bacteria | 2360 |
| 1358 | Ga0495612_0022880 | 3300053078 | Bacteria | 2505 |
| 1359 | Ga0500610_0232167 | 3300053079 | Bacteria | 865 |
| 1360 | Ga0500635_0002242 | 3300053080 | Bacteria | 4759 |
| 1361 | Ga0500635_0002742 | 3300053080 | Bacteria | 4373 |
| 1362 | Ga0500635_0048704 | 3300053080 | Bacteria | 1444 |
| 1363 | Ga0500635_0096552 | 3300053080 | Bacteria | 1082 |
| 1364 | Ga0495655_0043650 | 3300053083 | Bacteria | 1157 |
| 1365 | Ga0495595_0015715 | 3300053084 | Bacteria | 3230 |
| 1366 | Ga0495619_0000858 | 3300053085 | Bacteria | 19930 |
| 1367 | Ga0495619_0157808 | 3300053085 | Bacteria | 1566 |
| 1368 | Ga0500578_0088881 | 3300053086 | Bacteria | 1962 |
| 1369 | Ga0500643_000016 | 3300053087 | Bacteria | 309502 |
| 1370 | Ga0500643_069541 | 3300053087 | Bacteria | 978 |
| 1371 | Ga0500647_0065379 | 3300053091 | Bacteria | 1749 |
| 1372 | Ga0500583_0274754 | 3300053092 | Bacteria | 828 |
| 1373 | Ga0500651_0026230 | 3300053093 | Bacteria | 3660 |
| 1374 | Ga0500651_0061210 | 3300053093 | Bacteria | 2352 |
| 1375 | Ga0500566_0000394 | 3300053094 | Bacteria | 24254 |
| 1376 | Ga0500566_0000751 | 3300053094 | Bacteria | 18265 |
| 1377 | Ga0500566_0015160 | 3300053094 | Bacteria | 4523 |
| 1378 | Ga0500566_0030466 | 3300053094 | Bacteria | 3146 |
| 1379 | Ga0500640_001550 | 3300053095 | Bacteria | 7061 |
| 1380 | Ga0500641_0130716 | 3300053096 | Bacteria | 1083 |
| 1381 | Ga0500650_0021151 | 3300053098 | Bacteria | 2862 |
| 1382 | Ga0500554_010908 | 3300053102 | Bacteria | 2233 |
| 1383 | Ga0500554_018859 | 3300053102 | Bacteria | 1870 |
| 1384 | Ga0500555_005870 | 3300053103 | Bacteria | 3483 |
| 1385 | Ga0500556_0000238 | 3300053104 | Bacteria | 44627 |
| 1386 | Ga0500556_0002504 | 3300053104 | Bacteria | 5851 |
| 1387 | Ga0500557_000018 | 3300053105 | Bacteria | 95477 |
| 1388 | Ga0500557_029595 | 3300053105 | Bacteria | 1648 |
| 1389 | Ga0500562_020364 | 3300053108 | Bacteria | 1722 |
| 1390 | Ga0500569_002333 | 3300053109 | Bacteria | 3725 |
| 1391 | Ga0500569_045967 | 3300053109 | Bacteria | 1299 |
| 1392 | Ga0500569_072778 | 3300053109 | Bacteria | 1084 |
| 1393 | Ga0500572_000156 | 3300053111 | Bacteria | 23706 |
| 1394 | Ga0500572_002564 | 3300053111 | Bacteria | 4333 |
| 1395 | Ga0500592_002853 | 3300053116 | Bacteria | 2779 |
| 1396 | Ga0500594_0035745 | 3300053118 | Bacteria | 1334 |
| 1397 | Ga0500595_001005 | 3300053119 | Bacteria | 15840 |
| 1398 | Ga0500595_007607 | 3300053119 | Bacteria | 4485 |
| 1399 | Ga0500595_010518 | 3300053119 | Bacteria | 3672 |
| 1400 | Ga0500595_011210 | 3300053119 | Bacteria | 3521 |
| 1401 | Ga0500595_012247 | 3300053119 | Bacteria | 3323 |
| 1402 | Ga0500595_017583 | 3300053119 | Bacteria | 2636 |
| 1403 | Ga0500595_024242 | 3300053119 | Bacteria | 2120 |
| 1404 | Ga0500608_022516 | 3300053122 | Bacteria | 2922 |
| 1405 | Ga0500608_044580 | 3300053122 | Bacteria | 2129 |
| 1406 | Ga0500608_102162 | 3300053122 | Bacteria | 1327 |
| 1407 | Ga0500608_136341 | 3300053122 | Bacteria | 1094 |
| 1408 | Ga0500614_001247 | 3300053123 | Bacteria | 6179 |
| 1409 | Ga0500614_024310 | 3300053123 | Bacteria | 1430 |
| 1410 | Ga0500618_003296 | 3300053125 | Bacteria | 5605 |
| 1411 | Ga0500642_0000069 | 3300053130 | Bacteria | 55916 |
| 1412 | Ga0500642_0000092 | 3300053130 | Bacteria | 45651 |
| 1413 | Ga0500642_0130915 | 3300053130 | Bacteria | 1175 |
| 1414 | Ga0500652_000258 | 3300053131 | Bacteria | 19823 |
| 1415 | Ga0500652_035989 | 3300053131 | Bacteria | 1969 |
| 1416 | Ga0500658_0135180 | 3300053134 | Bacteria | 1102 |
| 1417 | Ga0500559_0000377 | 3300053136 | Bacteria | 32813 |
| 1418 | Ga0500559_0000492 | 3300053136 | Bacteria | 27669 |
| 1419 | Ga0500559_0000657 | 3300053136 | Bacteria | 23232 |
| 1420 | Ga0500559_0001182 | 3300053136 | Bacteria | 15606 |
| 1421 | Ga0500559_0027168 | 3300053136 | Bacteria | 2441 |
| 1422 | Ga0500559_0117128 | 3300053136 | Bacteria | 1237 |
| 1423 | Ga0500568_0005790 | 3300053139 | Bacteria | 6313 |
| 1424 | Ga0500568_0037767 | 3300053139 | Bacteria | 1957 |
| 1425 | Ga0500568_0056219 | 3300053139 | Bacteria | 1534 |
| 1426 | Ga0500573_0081236 | 3300053140 | Bacteria | 1841 |
| 1427 | Ga0500577_0000068 | 3300053142 | Bacteria | 23514 |
| 1428 | Ga0500577_0037067 | 3300053142 | Bacteria | 1750 |
| 1429 | Ga0500577_0114735 | 3300053142 | Bacteria | 1115 |
| 1430 | Ga0500577_0167508 | 3300053142 | Bacteria | 938 |
| 1431 | Ga0500586_002258 | 3300053145 | Bacteria | 4292 |
| 1432 | Ga0500589_154640 | 3300053147 | Bacteria | 929 |
| 1433 | Ga0500590_025525 | 3300053148 | Bacteria | 3069 |
| 1434 | Ga0500590_101169 | 3300053148 | Bacteria | 1384 |
| 1435 | Ga0500590_120217 | 3300053148 | Bacteria | 1232 |
| 1436 | Ga0500603_000254 | 3300053150 | Bacteria | 14076 |
| 1437 | Ga0500603_001083 | 3300053150 | Bacteria | 6405 |
| 1438 | Ga0500603_064876 | 3300053150 | Bacteria | 1029 |
| 1439 | Ga0500604_0006587 | 3300053151 | Bacteria | 3072 |
| 1440 | Ga0500604_0022060 | 3300053151 | Bacteria | 1805 |
| 1441 | Ga0500616_0000197 | 3300053153 | Bacteria | 98372 |
| 1442 | Ga0500619_102485 | 3300053154 | Bacteria | 971 |
| 1443 | Ga0500622_0000966 | 3300053156 | Bacteria | 24386 |
| 1444 | Ga0500622_0104018 | 3300053156 | Bacteria | 1394 |
| 1445 | Ga0500627_0014629 | 3300053158 | Bacteria | 3011 |
| 1446 | Ga0500627_0065476 | 3300053158 | Bacteria | 1603 |
| 1447 | Ga0500630_000834 | 3300053159 | Bacteria | 14264 |
| 1448 | Ga0500638_007204 | 3300053162 | Bacteria | 4630 |
| 1449 | Ga0500638_090931 | 3300053162 | Bacteria | 1436 |
| 1450 | Ga0500638_176455 | 3300053162 | Bacteria | 926 |
| 1451 | Ga0500639_001931 | 3300053163 | Bacteria | 10361 |
| 1452 | Ga0500639_008061 | 3300053163 | Bacteria | 5484 |
| 1453 | Ga0500636_0000223 | 3300053177 | Bacteria | 30889 |
| 1454 | Ga0500636_0021262 | 3300053177 | Bacteria | 3841 |
| 1455 | Ga0500636_0081672 | 3300053177 | Bacteria | 1861 |
| 1456 | Ga0500636_0112613 | 3300053177 | Bacteria | 1536 |
| 1457 | Ga0500636_0214640 | 3300053177 | Bacteria | 1007 |
| 1458 | Ga0500637_0000090 | 3300053178 | Bacteria | 32448 |
| 1459 | Ga0500637_0029621 | 3300053178 | Bacteria | 3037 |
| 1460 | Ga0500637_0218248 | 3300053178 | Bacteria | 1079 |
| 1461 | Ga0500637_0316676 | 3300053178 | Bacteria | 844 |
| 1462 | Ga0500570_108629 | 3300053724 | Bacteria | 1135 |
| 1463 | Ga0500645_019942 | 3300053730 | Bacteria | 2081 |
| 1464 | Ga0500552_001014 | 3300053733 | Bacteria | 2654 |
| 1465 | Ga0500596_000920 | 3300053735 | Bacteria | 5882 |
| 1466 | Ga0500596_001030 | 3300053735 | Bacteria | 5600 |
| 1467 | Ga0500599_003555 | 3300053736 | Bacteria | 1905 |
| 1468 | Ga0500601_000084 | 3300053737 | Bacteria | 19268 |
| 1469 | Ga0500601_004047 | 3300053737 | Bacteria | 1591 |
| 1470 | Ga0500601_009318 | 3300053737 | Bacteria | 1094 |
| 1471 | Ga0501084_0072304 | 3300054114 | Bacteria | 2888 |
| 1472 | Ga0500661_000273 | 3300055283 | Bacteria | 9361 |
| 1473 | Ga0500661_016039 | 3300055283 | Bacteria | 1342 |
| 1474 | Ga0501082_0002728 | 3300060353 | Bacteria | 15429 |
| 1475 | Ga0501082_0024361 | 3300060353 | Bacteria | 5217 |
| 1476 | Ga0501082_0176163 | 3300060353 | Bacteria | 1860 |
| 1477 | 2507511340 | 2507262055 | Bacteria | 8048963 |
| 1478 | 2508545138 | 2508501009 | Bacteria | 7784016 |
| 1479 | 2508693978 | 2508501042 | Bacteria | 8719808 |
| 1480 | 2509146674 | 2508501128 | Bacteria | 8613869 |
| 1481 | 2511401080 | 2511231028 | Bacteria | 8046582 |
| 1482 | 2513624176 | 2513237092 | Bacteria | 8341956 |
| 1483 | 2513641146 | 2513237094 | Bacteria | 8789602 |
| 1484 | 2513648599 | 2513237095 | Bacteria | 8976980 |
| 1485 | 2513656049 | 2513237096 | Bacteria | 8722461 |
| 1486 | 2513675241 | 2513237098 | Bacteria | 9902361 |
| 1487 | 2513696397 | 2513237101 | Bacteria | 7952346 |
| 1488 | 2513704334 | 2513237102 | Bacteria | 7703324 |
| 1489 | 2513717862 | 2513237104 | Bacteria | 10034502 |
| 1490 | 2513862853 | 2513237137 | Bacteria | 9558895 |
| 1491 | 2513874921 | 2513237139 | Bacteria | 8737671 |
| 1492 | 2513887668 | 2513237141 | Bacteria | 8496279 |
| 1493 | 2513920943 | 2513237145 | Bacteria | 8979722 |
| 1494 | 2514010356 | 2513237161 | Bacteria | 8871253 |
| 1495 | 2515625076 | 2515154112 | Bacteria | 8294334 |
| 1496 | 2517101078 | 2517093001 | Bacteria | 9002274 |
| 1497 | 2517895870 | 2517572143 | Bacteria | 9484767 |
| 1498 | 2524439979 | 2524023205 | Bacteria | 8918781 |
| 1499 | 2524469158 | 2524023210 | Bacteria | 9029266 |
| 1500 | 2524534748 | 2524023228 | Bacteria | 10118060 |
| 1501 | 2528856808 | 2528768022 | Bacteria | 10457665 |
| 1502 | 2603857512 | 2602042107 | Bacteria | 6226103 |
| 1503 | 2617348510 | 2617270735 | Bacteria | 9163226 |
| 1504 | 2617375063 | 2617270741 | Bacteria | 8201522 |
| 1505 | 2644287255 | 2643221651 | Bacteria | 4798932 |
| 1506 | 2671122670 | 2667528175 | Bacteria | 7532676 |
| 1507 | 2723842903 | 2721755755 | Bacteria | 8322773 |
| 1508 | 2728749602 | 2728368998 | Bacteria | 8720350 |
| 1509 | 2793061707 | 2791355196 | Bacteria | 7323613 |
| 1510 | 2793069696 | 2791355197 | Bacteria | 8420563 |
| 1511 | 2793080209 | |||
| 1512 | 2805916491 | 2802429603 | Bacteria | 8777136 |
| 1513 | 2818243481 | 2816332527 | Bacteria | 8933356 |
| 1514 | 2824604328 | 2824600985 | Bacteria | 8488197 |
| 1515 | 2824614199 | 2824609381 | Bacteria | 8672835 |
| 1516 | 2824619574 | 2824617872 | Bacteria | 8814715 |
| 1517 | 2824629010 | 2824626560 | Bacteria | 8813858 |
| 1518 | 2824635677 | 2824635225 | Bacteria | 8785348 |
| 1519 | 2824652971 | 2824644064 | Bacteria | 8743947 |
| 1520 | 2824656458 | 2824653114 | Bacteria | 8493680 |
| 1521 | 2824671267 | 2824661429 | Bacteria | 9877870 |
| 1522 | 2824679573 | 2824671348 | Bacteria | 8369588 |
| 1523 | 2824687818 | 2824679649 | Bacteria | 8248951 |
| 1524 | 2824696219 | 2824687955 | Bacteria | 8360029 |
| 1525 | 2824704509 | 2824696289 | Bacteria | 8335049 |
| 1526 | 2824714515 | 2824704595 | Bacteria | 9667483 |
| 1527 | 2824723758 | 2824714736 | Bacteria | 8717648 |
| 1528 | 2824732823 | 2824723954 | Bacteria | 8758240 |
| 1529 | 2824740862 | 2824732956 | Bacteria | 7810675 |
| 1530 | 2824753768 | 2824746037 | Bacteria | 7911610 |
| 1531 | 2824754144 | 2824753945 | Bacteria | 9787441 |
| 1532 | 2824771651 | 2824763712 | Bacteria | 9792355 |
| 1533 | 2824780550 | 2824773399 | Bacteria | 8360218 |
| 1534 | 2838129009 | 2838122688 | Bacteria | 8803140 |
| 1535 | 2841948286 | 2841941048 | Bacteria | 8688029 |
| 1536 | 2841957218 | 2841949485 | Bacteria | 8680857 |
| 1537 | 2841961491 | 2841957949 | Bacteria | 8652217 |
| 1538 | 2841970138 | 2841966195 | Bacteria | 8673214 |
| 1539 | 2841977217 | 2841974524 | Bacteria | 8931498 |
| 1540 | 2841985651 | 2841983080 | Bacteria | 8395090 |
| 1541 | 2842042388 | 2842038055 | Bacteria | 8002051 |
| 1542 | 2842050431 | 2842045827 | Bacteria | 8006841 |
| 1543 | 2844316582 | 2844315083 | Bacteria | 8138177 |
| 1544 | 2847939117 | 2847930680 | Bacteria | 9342022 |
| 1545 | 2847943938 | 2847939898 | Bacteria | 8606328 |
| 1546 | 2849081835 | 2849076700 | Bacteria | 7039503 |
| 1547 | 2857512594 | 2857509624 | Bacteria | 7472071 |
| 1548 | 2857526899 | 2857524615 | Bacteria | 6615449 |
| 1549 | 2874594559 | 2874590934 | Bacteria | 8299676 |
| 1550 | 2874606435 | 2874604998 | Bacteria | 7834745 |
| 1551 | 2874613913 | 2874612657 | Bacteria | 8252029 |
| 1552 | 2874625554 | 2874620515 | Bacteria | 8290088 |
| 1553 | 2874633762 | 2874628541 | Bacteria | 8630250 |
| 1554 | 2874649607 | 2874645413 | Bacteria | 8214782 |
| 1555 | 2876773691 | 2876771140 | Bacteria | 8287509 |
| 1556 | 2876817886 | 2876808645 | Bacteria | 8824342 |
| 1557 | 2876820682 | 2876818435 | Bacteria | 8274608 |
| 1558 | 2879076884 | 2879074833 | Bacteria | 8279565 |
| 1559 | 2879084589 | 2879083081 | Bacteria | 8587928 |
| 1560 | 2879101151 | 2879099564 | Bacteria | 10442239 |
| 1561 | 2879113693 | 2879110137 | Bacteria | 8907982 |
| 1562 | 2879130328 | 2879127579 | Bacteria | 8294491 |
| 1563 | 2879146844 | 2879142872 | Bacteria | 8267021 |
| 1564 | 2881367364 | 2881364244 | Bacteria | 7710352 |
| 1565 | 2881668742 | 2881665667 | Bacteria | 8175609 |
| 1566 | 2885366568 | 2885366525 | Bacteria | 8326213 |
| 1567 | 2885381579 | 2885374607 | Bacteria | 8927485 |
| 1568 | 2885387486 | 2885383462 | Bacteria | 9473874 |
| 1569 | 2885413503 | 2885409591 | Bacteria | 9235467 |
| 1570 | 2888386864 | 2888378607 | Bacteria | 9652610 |
| 1571 | 2888389587 | 2888388044 | Bacteria | 7304136 |
| 1572 | 2888421508 | 2888419890 | Bacteria | 7857137 |
| 1573 | 2889033780 | 2889033259 | Bacteria | 9099371 |
| 1574 | 2893070056 | 2893066018 | Bacteria | 6158120 |
| 1575 | 2903731352 | 2903727486 | Bacteria | 8281579 |
| 1576 | 2903756034 | 2903748898 | Bacteria | 9972761 |
| 1577 | 2903770364 | 2903768456 | Bacteria | 9749579 |
| 1578 | 2904673500 | 2904666416 | Bacteria | 8226587 |
| 1579 | 2904693353 | 2904690495 | Bacteria | 9412302 |
| 1580 | 2904707006 | |||
| 1581 | 2904719475 | 2904711408 | Bacteria | 9771557 |
| 1582 | 2906603818 | 2906602504 | Bacteria | 8295279 |
| 1583 | 2906615661 | |||
| 1584 | 2906635031 | 2906626472 | Bacteria | 8826946 |
| 1585 | 2906646090 | 2906643746 | Bacteria | 8722424 |
| 1586 | 2906665098 | 2906660503 | Bacteria | 8595048 |
| 1587 | 2908745523 | 2908739725 | Bacteria | 8628932 |
| 1588 | 2908759430 | 2908756301 | Bacteria | 8864324 |
| 1589 | 2908777549 | 2908775508 | Bacteria | 8092255 |
| 1590 | 2919078016 | 2919073203 | Bacteria | 6531949 |
| 1591 | 2922367181 | 2922361189 | Bacteria | 7436256 |
| 1592 | 2922377018 | |||
| 1593 | 2922390085 | 2922386360 | Bacteria | 7017218 |
| 1594 | 2922398174 | 2922393267 | Bacteria | 8285685 |
| 1595 | 2922432348 | |||
| 1596 | 2929619154 | 2929615660 | Bacteria | 9193770 |
| 1597 | 2929628351 | 2929624759 | Bacteria | 9339455 |
| 1598 | 2932791278 | 2932784394 | Bacteria | 9704911 |
| 1599 | 2932795705 | 2932794094 | Bacteria | 7915132 |
| 1600 | 2932801944 | 2932801729 | Bacteria | 7987968 |
| 1601 | 2932817694 | 2932809354 | Bacteria | 9135765 |
| 1602 | 2932826978 | 2932818245 | Bacteria | 9955613 |
| 1603 | 2932833153 | 2932828146 | Bacteria | 9745859 |
| 1604 | 2933581076 | 2933577622 | Bacteria | 9116884 |
| 1605 | 2935612331 | 2935608549 | Bacteria | 8203142 |
| 1606 | 2935620570 | 2935616580 | Bacteria | 9032984 |
| 1607 | 2935630821 | 2935630451 | Bacteria | 8169952 |
| 1608 | 2935639657 | 2935638405 | Bacteria | 10015038 |
| 1609 | 2935650173 | 2935648319 | Bacteria | 8801166 |
| 1610 | 2935658320 | 2935656913 | Bacteria | 8965014 |
| 1611 | 2935667505 | 2935665750 | Bacteria | 9571747 |
| 1612 | 2935682930 | 2935675223 | Bacteria | 9928132 |
| 1613 | 2935687597 | 2935684952 | Bacteria | 9590419 |
| 1614 | 2935696432 | 2935694250 | Bacteria | 9291695 |
| 1615 | 2935705245 | 2935703347 | Bacteria | 10242284 |
| 1616 | 2935719057 | 2935713505 | Bacteria | 9608509 |
| 1617 | 2935728709 | 2935722832 | Bacteria | 9608746 |
| 1618 | 2935736695 | 2935732158 | Bacteria | 9706831 |
| 1619 | 2935746303 | 2935741537 | Bacteria | 9707219 |
| 1620 | 2935753563 | 2935750917 | Bacteria | 9590372 |
| 1621 | 2935767755 | 2935760218 | Bacteria | 9817913 |
| 1622 | 2935770513 | 2935769743 | Bacteria | 7878163 |
| 1623 | 2935782466 | 2935777560 | Bacteria | 8077691 |
| 1624 | 2935786434 | 2935785616 | Bacteria | 7962367 |
| 1625 | 2935794489 | 2935793552 | Bacteria | 8012592 |
| 1626 | 2935806991 | 2935801545 | Bacteria | 9301974 |
| 1627 | 2935814091 | 2935810662 | Bacteria | 9401221 |
| 1628 | 2935823819 | 2935819856 | Bacteria | 8261050 |
| 1629 | 2935829140 | 2935827899 | Bacteria | 10038562 |
| 1630 | 2935845326 | 2935837841 | Bacteria | 9454360 |
| 1631 | 2935854457 | 2935847175 | Bacteria | 8228321 |
| 1632 | 2935858378 | 2935855204 | Bacteria | 9035059 |
| 1633 | 2935872314 | 2935864058 | Bacteria | 9784707 |
| 1634 | 2935877339 | 2935873716 | Bacteria | 9632195 |
| 1635 | 2935886131 | 2935883170 | Bacteria | 7964738 |
| 1636 | 2935913452 | 2935908558 | Bacteria | 8568796 |
| 1637 | 2935923348 | 2935916978 | Bacteria | 9113783 |
| 1638 | 2935931231 | 2935926038 | Bacteria | 8601059 |
| 1639 | 2935935513 | 2935934488 | Bacteria | 8602579 |
| 1640 | 2935947079 | 2935942939 | Bacteria | 8599779 |
| 1641 | 2935953826 | 2935951376 | Bacteria | 8602333 |
| 1642 | 2935961534 | 2935959822 | Bacteria | 7869783 |
| 1643 | 2935968852 | 2935967501 | Bacteria | 8603075 |
| 1644 | 2935982484 | 2935975950 | Bacteria | 8347125 |
| 1645 | 2935985952 | 2935984226 | Bacteria | 8302647 |
| 1646 | 2935995042 | 2935992306 | Bacteria | 9802711 |
| 1647 | 2936006135 | 2936002035 | Bacteria | 9362176 |
| 1648 | 2936013268 | 2936011229 | Bacteria | 8801034 |
| 1649 | 2936021645 | 2936019824 | Bacteria | 8804134 |
| 1650 | 2936030561 | 2936028420 | Bacteria | 8965941 |
| 1651 | 2936039646 | 2936037263 | Bacteria | 9446081 |
| 1652 | 2936047839 | 2936046547 | Bacteria | 8903709 |
| 1653 | 2936057841 | 2936055302 | Bacteria | 8785755 |
| 1654 | 2940559476 | 2940556831 | Bacteria | 9590747 |
| 1655 | 2941507473 | 2941507105 | Bacteria | 8166816 |
| 1656 | 2941515900 | 2941515067 | Bacteria | 8166720 |
| 1657 | 2941523392 | 2941523033 | Bacteria | 8169134 |
| 1658 | 2941537043 | 2941531003 | Bacteria | 7653939 |
| 1659 | 2941545703 | 2941538514 | Bacteria | 9402094 |
| 1660 | 3005476690 | 3005474847 | Bacteria | 9259049 |
| 1661 | 3005488280 | 3005483717 | Bacteria | 7877331 |
| 1662 | 3005511224 | 3005506211 | Bacteria | 6943378 |
| 1663 | 3005592088 | 3005587118 | Bacteria | 7794411 |
| 1664 | 3005596203 | 3005594810 | Bacteria | 8716512 |
| 1665 | 3005712139 | 3005710791 | Bacteria | 7622528 |
| 1666 | 8006934789 | 8006933436 | Bacteria | 10410654 |
| 1667 | 8006966708 | 8006964411 | Bacteria | 8966052 |
| 1668 | 8006974757 | 8006973647 | Bacteria | 10679141 |
| 1669 | 8006989619 | 8006984368 | Bacteria | 9651211 |
| 1670 | 8006998010 | 8006994254 | Bacteria | 8309700 |
| 1671 | 8016516885 | 8016511872 | Bacteria | 9921665 |
| 1672 | 8016524478 | 8016522445 | Bacteria | 8156687 |
| 1673 | 8016538038 | 8016530956 | Bacteria | 8155261 |
| 1674 | 8016542311 | 8016539877 | Bacteria | 8155419 |
| 1675 | 8016550968 | 8016548790 | Bacteria | 8155074 |
| 1676 | 8016567698 | 8016566248 | Bacteria | 8158151 |
| 1677 | 8016580392 | 8016575299 | Bacteria | 8154085 |
| 1678 | 8016588771 | 8016583857 | Bacteria | 10421953 |
| 1679 | 8016597316 | 8016595262 | Bacteria | 8149947 |
| 1680 | 8016604941 | 8016603502 | Bacteria | 8731218 |
| 1681 | 8016620067 | 8016613128 | Bacteria | 8794220 |
| 1682 | 8016624292 | 8016622563 | Bacteria | 7999408 |
| 1683 | 8016637703 | 8016630954 | Bacteria | 9217207 |
| 1684 | 8017059686 | 8017057580 | Bacteria | 10023680 |
| 1685 | 8019537705 | 8019530166 | Bacteria | 8155624 |
| 1686 | 8019539336 | 8019538911 | Bacteria | 7872763 |
| 1687 | 8019551309 | 8019547302 | Bacteria | 7996444 |
| 1688 | 8019563864 | 8019555841 | Bacteria | 9642137 |
| 1689 | 8019573935 | 8019565922 | Bacteria | 9639779 |
| 1690 | 8019604480 | 8019597564 | Bacteria | 10041141 |
| 1691 | 8019614056 | 8019608314 | Bacteria | 10042931 |
| 1692 | 8019624589 | 8019619141 | Bacteria | 9218857 |
| 1693 | 8019637444 | 8019629233 | Bacteria | 8687553 |
| 1694 | 8019642165 | 8019638758 | Bacteria | 9062356 |
| 1695 | 8019650355 | 8019648815 | Bacteria | 10014479 |
| 1696 | 8019665381 | 8019659431 | Bacteria | 8577854 |
| 1697 | 8019674926 | 8019668869 | Bacteria | 8791617 |
| 1698 | 8019681169 | 8019678201 | Bacteria | 8863603 |
| 1699 | 8019694533 | 8019687851 | Bacteria | 8712826 |
| 1700 | 8055749588 | 8055742211 | Bacteria | 9226248 |
| 1701 | 8056675045 | 8056673599 | Bacteria | 7871253 |
| 1702 | 8056681881 | 8056681323 | Bacteria | 8472857 |
| 1703 | 8056696280 | 8056689827 | Bacteria | 6712655 |
| 1704 | 8056973784 | 8056967851 | Bacteria | 9038162 |
| 1705 | Ga0501031_0109785 | |||
| 1706 | JGI24740J21852_10014866 | |||
| 1707 | JGI24739J22299_10062404 | |||
| 1708 | JGI24737J22298_10010976 | |||
| 1709 | JGI25406J46586_10000042 | |||
| 1710 | JGI25406J46586_10001667 | |||
| 1711 | JGI25153J46596_10003624 | |||
| 1712 | JGI25153J46596_10003958 | |||
| 1713 | JGI25153J46596_10004459 | |||
| 1714 | JGI25153J46596_10005398 | |||
| 1715 | JGI25153J46596_10020255 | |||
| 1716 | JGI25153J46596_10091220 | |||
| 1717 | JGI25160J50197_1001455 | |||
| 1718 | JGI25160J50197_1012378 | |||
| 1719 | JGI25160J50197_1020115 | |||
| 1720 | JGI25404J52841_10008161 | |||
| 1721 | JGI25404J52841_10012359 | |||
| 1722 | Ga0055531_10012265 | |||
| 1723 | Ga0055543_1014579 | |||
| 1724 | Ga0055543_1031128 | |||
| 1725 | Ga0065165_1003252 | |||
| 1726 | Ga0065165_1045488 | |||
| 1727 | Ga0070658_10269128 | |||
| 1728 | Ga0070658_10290974 | |||
| 1729 | Ga0070658_10724403 | |||
| 1730 | Ga0070676_10110009 | |||
| 1731 | Ga0070676_10281542 | |||
| 1732 | Ga0070683_100027061 | |||
| 1733 | Ga0070683_100138895 | |||
| 1734 | Ga0070683_100231044 | |||
| 1735 | Ga0070683_100232105 | |||
| 1736 | Ga0070683_100552737 | |||
| 1737 | Ga0070670_100311659 | |||
| 1738 | Ga0068869_100169996 | |||
| 1739 | Ga0068869_100497135 | |||
| 1740 | Ga0070666_10483489 | |||
| 1741 | Ga0070680_100064005 | |||
| 1742 | Ga0070680_100271460 | |||
| 1743 | Ga0070680_100385533 | |||
| 1744 | Ga0070682_100651278 | |||
| 1745 | Ga0068868_100101422 | |||
| 1746 | Ga0070660_100078251 | |||
| 1747 | Ga0070660_100270633 | |||
| 1748 | Ga0070689_100854221 | |||
| 1749 | Ga0070691_10055625 | |||
| 1750 | Ga0070661_100240955 | |||
| 1751 | Ga0070668_100143978 | |||
| 1752 | Ga0070668_100183723 | |||
| 1753 | Ga0070668_100270021 | |||
| 1754 | Ga0070675_100191849 | |||
| 1755 | Ga0070671_100570463 | |||
| 1756 | Ga0070688_100206954 | |||
| 1757 | Ga0070688_100377636 | |||
| 1758 | Ga0070659_100119271 | |||
| 1759 | Ga0070667_100112801 | |||
| 1760 | Ga0070667_100166124 | |||
| 1761 | Ga0070667_100299974 | |||
| 1762 | Ga0070703_10120268 | |||
| 1763 | Ga0070709_10005705 | |||
| 1764 | Ga0070709_10010069 | |||
| 1765 | Ga0070709_10019609 | |||
| 1766 | Ga0070709_10068994 | |||
| 1767 | Ga0070709_10170714 | |||
| 1768 | Ga0070714_100037560 | |||
| 1769 | Ga0070714_100046348 | |||
| 1770 | Ga0070714_100057181 | |||
| 1771 | Ga0070714_100134760 | |||
| 1772 | Ga0070714_100196604 | |||
| 1773 | Ga0070714_100202282 | |||
| 1774 | Ga0070714_100272495 | |||
| 1775 | Ga0070714_100293469 | |||
| 1776 | Ga0070714_100417929 | |||
| 1777 | Ga0070714_100863884 | |||
| 1778 | Ga0070713_100004677 | |||
| 1779 | Ga0070713_100005417 | |||
| 1780 | Ga0070713_100058128 | |||
| 1781 | Ga0070713_100073758 | |||
| 1782 | Ga0070713_100085786 | |||
| 1783 | Ga0070713_100340016 | |||
| 1784 | Ga0070710_10002398 | |||
| 1785 | Ga0070710_10010404 | |||
| 1786 | Ga0070710_10466156 | |||
| 1787 | Ga0070711_100004055 | |||
| 1788 | Ga0070711_100022948 | |||
| 1789 | Ga0070711_100029370 | |||
| 1790 | Ga0070711_100253007 | |||
| 1791 | Ga0070700_100058073 | |||
| 1792 | Ga0070694_100497595 | |||
| 1793 | Ga0070708_100094717 | |||
| 1794 | Ga0070663_100061894 | |||
| 1795 | Ga0070663_100110883 | |||
| 1796 | Ga0070663_100124997 | |||
| 1797 | Ga0070663_100131703 | |||
| 1798 | Ga0070663_100199904 | |||
| 1799 | Ga0070663_100201024 | |||
| 1800 | Ga0070678_100004745 | |||
| 1801 | Ga0070678_100049918 | |||
| 1802 | Ga0070678_100058533 | |||
| 1803 | Ga0070678_100326168 | |||
| 1804 | Ga0070662_100354046 | |||
| 1805 | Ga0070662_100509484 | |||
| 1806 | Ga0070681_10106354 | |||
| 1807 | Ga0070681_10154946 | |||
| 1808 | Ga0070681_10174097 | |||
| 1809 | Ga0070681_10191774 | |||
| 1810 | Ga0070681_10291231 | |||
| 1811 | Ga0068867_100223826 | |||
| 1812 | Ga0068867_100426455 | |||
| 1813 | Ga0070707_100950178 | |||
| 1814 | Ga0070698_100117254 | |||
| 1815 | Ga0070698_100465334 | |||
| 1816 | Ga0070699_100194289 | |||
| 1817 | Ga0070679_100009107 | |||
| 1818 | Ga0070679_100018046 | |||
| 1819 | Ga0070679_100061391 | |||
| 1820 | Ga0070684_100002381 | |||
| 1821 | Ga0070684_100019269 | |||
| 1822 | Ga0070697_100000384 | |||
| 1823 | Ga0068853_100008031 | |||
| 1824 | Ga0068853_100043449 | |||
| 1825 | Ga0068853_100131164 | |||
| 1826 | Ga0068853_100160177 | |||
| 1827 | Ga0068853_100230163 | |||
| 1828 | Ga0068853_100294048 | |||
| 1829 | Ga0070672_100059107 | |||
| 1830 | Ga0070672_100169209 | |||
| 1831 | Ga0070672_100210649 | |||
| 1832 | Ga0070672_101194447 | |||
| 1833 | Ga0070693_100188144 | |||
| 1834 | Ga0070665_100008983 | |||
| 1835 | Ga0070665_100009227 | |||
| 1836 | Ga0070665_100029464 | |||
| 1837 | Ga0070665_100032495 | |||
| 1838 | Ga0070665_100120727 | |||
| 1839 | Ga0070665_100136332 | |||
| 1840 | Ga0070665_100205831 | |||
| 1841 | Ga0070665_100273272 | |||
| 1842 | Ga0068855_100005308 | |||
| 1843 | Ga0068855_100006278 | |||
| 1844 | Ga0068855_100050315 | |||
| 1845 | Ga0068855_100124785 | |||
| 1846 | Ga0068855_100256893 | |||
| 1847 | Ga0068855_100561714 | |||
| 1848 | Ga0068855_100581282 | |||
| 1849 | Ga0070664_100177934 | |||
| 1850 | Ga0070664_100255596 | |||
| 1851 | Ga0068857_100014818 | |||
| 1852 | Ga0068857_100053478 | |||
| 1853 | Ga0068857_100062088 | |||
| 1854 | Ga0068857_100170413 | |||
| 1855 | Ga0068857_100216970 | |||
| 1856 | Ga0068854_100024638 | |||
| 1857 | Ga0068854_100123948 | |||
| 1858 | Ga0068854_100328821 | |||
| 1859 | Ga0068854_100462700 | |||
| 1860 | Ga0068856_100002141 | |||
| 1861 | Ga0068856_100085937 | |||
| 1862 | Ga0068856_100122345 | |||
| 1863 | Ga0068856_100125076 | |||
| 1864 | Ga0068856_100199610 | |||
| 1865 | Ga0068856_100371752 | |||
| 1866 | Ga0068852_100290760 | |||
| 1867 | Ga0068852_100739384 | |||
| 1868 | Ga0068852_100863893 | |||
| 1869 | Ga0068859_100142745 | |||
| 1870 | Ga0068859_100201571 | |||
| 1871 | Ga0068859_100268483 | |||
| 1872 | Ga0068859_100687638 | |||
| 1873 | Ga0068864_100101958 | |||
| 1874 | Ga0068861_100027676 | |||
| 1875 | Ga0068851_10001857 | |||
| 1876 | Ga0068870_10243328 | |||
| 1877 | Ga0068863_100082299 | |||
| 1878 | Ga0068863_100087604 | |||
| 1879 | Ga0068863_100174377 | |||
| 1880 | Ga0068858_100006904 | |||
| 1881 | Ga0068858_100011239 | |||
| 1882 | Ga0068858_100053134 | |||
| 1883 | Ga0068858_100130519 | |||
| 1884 | Ga0068858_100528846 | |||
| 1885 | Ga0068858_100873429 | |||
| 1886 | Ga0068860_100001883 | |||
| 1887 | Ga0068860_100028726 | |||
| 1888 | Ga0068860_100142004 | |||
| 1889 | Ga0068860_100570854 | |||
| 1890 | Ga0068860_100574963 | |||
| 1891 | Ga0068862_100074257 | |||
| 1892 | Ga0068862_100103057 | |||
| 1893 | Ga0068862_100513237 | |||
| 1894 | Ga0068862_100922915 | |||
| 1895 | Ga0068862_101038629 | |||
| 1896 | Ga0081455_10006143 | |||
| 1897 | Ga0081455_10034784 | |||
| 1898 | Ga0081455_10236759 | |||
| 1899 | Ga0081538_10034120 | |||
| 1900 | Ga0081540_1002324 | |||
| 1901 | Ga0081540_1004136 | |||
| 1902 | Ga0081540_1004563 | |||
| 1903 | Ga0081540_1004863 | |||
| 1904 | Ga0081540_1006598 | |||
| 1905 | Ga0081540_1013141 | |||
| 1906 | Ga0081540_1031304 | |||
| 1907 | Ga0081540_1039534 | |||
| 1908 | Ga0081539_10000099 | |||
| 1909 | Ga0081539_10001705 | |||
| 1910 | Ga0081539_10199589 | |||
| 1911 | Ga0081539_10226934 | |||
| 1912 | Ga0081539_10231448 | |||
| 1913 | Ga0070717_10000884 | |||
| 1914 | Ga0070717_10014958 | |||
| 1915 | Ga0070717_10891292 | |||
| 1916 | Ga0075365_10010380 | |||
| 1917 | Ga0075365_10020780 | |||
| 1918 | Ga0075365_10021853 | |||
| 1919 | Ga0075365_10107629 | |||
| 1920 | Ga0075365_10155709 | |||
| 1921 | Ga0075365_10164297 | |||
| 1922 | Ga0075365_10269534 | |||
| 1923 | Ga0075365_10373371 | |||
| 1924 | Ga0075368_10027704 | |||
| 1925 | Ga0075368_10044846 | |||
| 1926 | Ga0075368_10052860 | |||
| 1927 | Ga0075363_100076653 | |||
| 1928 | Ga0075363_100107756 | |||
| 1929 | Ga0075363_100127931 | |||
| 1930 | Ga0075363_100206646 | |||
| 1931 | Ga0075363_100254574 | |||
| 1932 | Ga0075364_10006886 | |||
| 1933 | Ga0075364_10034616 | |||
| 1934 | Ga0070715_10000981 | |||
| 1935 | Ga0070716_100013712 | |||
| 1936 | Ga0070716_100022257 | |||
| 1937 | Ga0070716_100075243 | |||
| 1938 | Ga0070712_100015975 | |||
| 1939 | Ga0070712_100051147 | |||
| 1940 | Ga0070712_100323610 | |||
| 1941 | Ga0070712_100367303 | |||
| 1942 | Ga0070712_100609691 | |||
| 1943 | Ga0075367_10058549 | |||
| 1944 | Ga0075367_10068670 | |||
| 1945 | Ga0075367_10152099 | |||
| 1946 | Ga0075369_10070615 | |||
| 1947 | Ga0075369_10170053 | |||
| 1948 | Ga0075366_10034226 | |||
| 1949 | Ga0075366_10440476 | |||
| 1950 | Ga0075370_10023753 | |||
| 1951 | Ga0075370_10027637 | |||
| 1952 | Ga0075370_10070899 | |||
| 1953 | Ga0075370_10180316 | |||
| 1954 | Ga0075428_100973603 | |||
| 1955 | Ga0075434_100091893 | |||
| 1956 | Ga0075434_100139408 | |||
| 1957 | Ga0075434_101054065 | |||
| 1958 | Ga0068865_100107511 | |||
| 1959 | Ga0068865_100203413 | |||
| 1960 | Ga0068865_100398507 | |||
| 1961 | Ga0097620_100142741 | |||
| 1962 | Ga0097620_100201574 | |||
| 1963 | Ga0097620_100268470 | |||
| 1964 | Ga0097620_100687750 | |||
| 1965 | Ga0099825_1029936 | |||
| 1966 | Ga0099824_1007272 | |||
| 1967 | Ga0099824_1025823 | |||
| 1968 | Ga0099823_1053108 | |||
| 1969 | Ga0075435_100208200 | |||
| 1970 | Ga0099794_10007534 | |||
| 1971 | Ga0099794_10022139 | |||
| 1972 | Ga0099795_10056429 | |||
| 1973 | Ga0105251_10307119 | |||
| 1974 | Ga0105240_10003625 | |||
| 1975 | Ga0105240_10050592 | |||
| 1976 | Ga0105240_10144227 | |||
| 1977 | Ga0105240_10366710 | |||
| 1978 | Ga0105240_10516600 | |||
| 1979 | Ga0105240_10794077 | |||
| 1980 | Ga0105240_11473144 | |||
| 1981 | Ga0111539_10124690 | |||
| 1982 | Ga0111539_11525139 | |||
| 1983 | Ga0105245_10082095 | |||
| 1984 | Ga0105245_10100337 | |||
| 1985 | Ga0105245_10391376 | |||
| 1986 | Ga0105245_10421320 | |||
| 1987 | Ga0105245_10647120 | |||
| 1988 | Ga0105247_10157856 | |||
| 1989 | Ga0114129_11043253 | |||
| 1990 | Ga0105243_10038231 | |||
| 1991 | Ga0105243_10091595 | |||
| 1992 | Ga0105243_10569401 | |||
| 1993 | Ga0105243_10783742 | |||
| 1994 | Ga0105241_10009272 | |||
| 1995 | Ga0105241_10090159 | |||
| 1996 | Ga0105241_10211991 | |||
| 1997 | Ga0105242_10350202 | |||
| 1998 | Ga0105242_10539767 | |||
| 1999 | Ga0105242_11424160 | |||
| 2000 | Ga0105248_10370733 | |||
| 2001 | Ga0105248_10509363 | |||
| 2002 | Ga0105237_10003462 | |||
| 2003 | Ga0105237_10042625 | |||
| 2004 | Ga0105237_10045814 | |||
| 2005 | Ga0105237_10050449 | |||
| 2006 | Ga0105237_10072304 | |||
| 2007 | Ga0105237_10124677 | |||
| 2008 | Ga0105237_10172003 | |||
| 2009 | Ga0105237_10201580 | |||
| 2010 | Ga0105237_10264373 | |||
| 2011 | Ga0105237_10301265 | |||
| 2012 | Ga0105237_10452715 | |||
| 2013 | Ga0105237_10457440 | |||
| 2014 | Ga0105238_10001064 | |||
| 2015 | Ga0105238_10137768 | |||
| 2016 | Ga0105238_10309576 | |||
| 2017 | Ga0105238_10584823 | |||
| 2018 | Ga0105238_10920252 | |||
| 2019 | Ga0105238_11142676 | |||
| 2020 | Ga0105249_10152529 | |||
| 2021 | Ga0099796_10120195 | |||
| 2022 | Ga0099796_10161464 | |||
| 2023 | Ga0105239_10000803 | |||
| 2024 | Ga0105239_10111666 | |||
| 2025 | Ga0105239_10384597 | |||
| 2026 | Ga0105239_10445585 | |||
| 2027 | Ga0105246_10224084 | |||
| 2028 | Ga0105246_10376963 | |||
| 2029 | Ga0157370_10013095 | |||
| 2030 | Ga0157370_10076076 | |||
| 2031 | Ga0157370_10083255 | |||
| 2032 | Ga0157370_10271608 | |||
| 2033 | Ga0157370_10525986 | |||
| 2034 | Ga0157369_10007934 | |||
| 2035 | Ga0157369_10029605 | |||
| 2036 | Ga0157369_10057734 | |||
| 2037 | Ga0157369_10157648 | |||
| 2038 | Ga0157369_10469589 | |||
| 2039 | Ga0157369_10496482 | |||
| 2040 | Ga0157369_10727424 | |||
| 2041 | Ga0157374_10201543 | |||
| 2042 | Ga0157378_10030034 | |||
| 2043 | Ga0157378_10567482 | |||
| 2044 | Ga0163162_10074838 | |||
| 2045 | Ga0157372_10018081 | |||
| 2046 | Ga0157372_10641591 | |||
| 2047 | Ga0157375_10035212 | |||
| 2048 | Ga0157375_10225225 | |||
| 2049 | Ga0157375_10293727 | |||
| 2050 | Ga0157375_10775583 | |||
| 2051 | Ga0163163_10011193 | |||
| 2052 | Ga0163163_10160241 | |||
| 2053 | Ga0157380_10128687 | |||
| 2054 | Ga0182008_10278514 | |||
| 2055 | Ga0182008_10295830 | |||
| 2056 | Ga0157377_10028713 | |||
| 2057 | Ga0157377_10518676 | |||
| 2058 | Ga0157377_10716721 | |||
| 2059 | Ga0157379_10090668 | |||
| 2060 | Ga0157379_10112770 | |||
| 2061 | Ga0157379_10211047 | |||
| 2062 | Ga0157376_10076201 | |||
| 2063 | Ga0214544_1000005 | |||
| 2064 | Ga0214544_1030440 | |||
| 2065 | Ga0214542_1000004 | |||
| 2066 | Ga0214542_1032430 | |||
| 2067 | Ga0214542_1033369 | |||
| 2068 | Ga0214545_1000005 | |||
| 2069 | Ga0214545_1028880 | |||
| 2070 | Ga0214543_1000030 | |||
| 2071 | Ga0213873_10023567 | |||
| 2072 | Ga0213876_10005771 | |||
| 2073 | Ga0213876_10051827 | |||
| 2074 | Ga0213871_10015751 | |||
| 2075 | Ga0209563_104596 | |||
| 2076 | Ga0207425_1029117 | |||
| 2077 | Ga0209677_100180 | |||
| 2078 | Ga0209677_105813 | |||
| 2079 | Ga0209148_1000801 | |||
| 2080 | Ga0209148_1020749 | |||
| 2081 | Ga0209233_1001773 | |||
| 2082 | Ga0209233_1019150 | |||
| 2083 | Ga0209233_1019779 | |||
| 2084 | Ga0209455_1013794 | |||
| 2085 | Ga0209455_1018576 | |||
| 2086 | Ga0209673_1028696 | |||
| 2087 | Ga0209564_1001232 | |||
| 2088 | Ga0209758_1000102 | |||
| 2089 | Ga0209758_1000631 | |||
| 2090 | Ga0209758_1000703 | |||
| 2091 | Ga0209758_1000761 | |||
| 2092 | Ga0209758_1001792 | |||
| 2093 | Ga0209758_1002441 | |||
| 2094 | Ga0209758_1055416 | |||
| 2095 | Ga0209256_1016058 | |||
| 2096 | Ga0209256_1044827 | |||
| 2097 | Ga0207426_1000354 | |||
| 2098 | Ga0207426_1003127 | |||
| 2099 | Ga0209257_1003566 | |||
| 2100 | Ga0209257_1072583 | |||
| 2101 | Ga0207697_10070067 | |||
| 2102 | Ga0207656_10094099 | |||
| 2103 | Ga0207682_10054713 | |||
| 2104 | Ga0207692_10021622 | |||
| 2105 | Ga0207692_10028244 | |||
| 2106 | Ga0207692_10590426 | |||
| 2107 | Ga0207642_10329358 | |||
| 2108 | Ga0207688_10206315 | |||
| 2109 | Ga0207680_10162186 | |||
| 2110 | Ga0207647_10018549 | |||
| 2111 | Ga0207699_10001383 | |||
| 2112 | Ga0207699_10017637 | |||
| 2113 | Ga0207699_10028712 | |||
| 2114 | Ga0207699_10054224 | |||
| 2115 | Ga0207699_10113627 | |||
| 2116 | Ga0207699_10413491 | |||
| 2117 | Ga0207645_10148193 | |||
| 2118 | Ga0207643_10391875 | |||
| 2119 | Ga0207705_10039045 | |||
| 2120 | Ga0207705_10091269 | |||
| 2121 | Ga0207705_10165761 | |||
| 2122 | Ga0207684_10233443 | |||
| 2123 | Ga0207654_10001104 | |||
| 2124 | Ga0207654_10011477 | |||
| 2125 | Ga0207654_10155179 | |||
| 2126 | Ga0207654_10288678 | |||
| 2127 | Ga0207707_10005313 | |||
| 2128 | Ga0207707_10011326 | |||
| 2129 | Ga0207707_10154891 | |||
| 2130 | Ga0207707_10203938 | |||
| 2131 | Ga0207707_10372090 | |||
| 2132 | Ga0207695_10000006 | |||
| 2133 | Ga0207695_10003805 | |||
| 2134 | Ga0207695_10104719 | |||
| 2135 | Ga0207695_10561481 | |||
| 2136 | Ga0207695_10739888 | |||
| 2137 | Ga0207671_10005375 | |||
| 2138 | Ga0207671_10036148 | |||
| 2139 | Ga0207671_10096861 | |||
| 2140 | Ga0207671_10129560 | |||
| 2141 | Ga0207671_10175234 | |||
| 2142 | Ga0207671_10458153 | |||
| 2143 | Ga0207671_10515255 | |||
| 2144 | Ga0207671_10744592 | |||
| 2145 | Ga0207693_10012138 | |||
| 2146 | Ga0207693_10021423 | |||
| 2147 | Ga0207693_10037531 | |||
| 2148 | Ga0207693_10156630 | |||
| 2149 | Ga0207693_10177459 | |||
| 2150 | Ga0207663_10000457 | |||
| 2151 | Ga0207663_10022469 | |||
| 2152 | Ga0207663_10125596 | |||
| 2153 | Ga0207663_10256602 | |||
| 2154 | Ga0207660_10007858 | |||
| 2155 | Ga0207660_10009400 | |||
| 2156 | Ga0207660_10025528 | |||
| 2157 | Ga0207660_10162970 | |||
| 2158 | Ga0207662_10060766 | |||
| 2159 | Ga0207657_10002620 | |||
| 2160 | Ga0207657_10201178 | |||
| 2161 | Ga0207657_10729981 | |||
| 2162 | Ga0207649_10104448 | |||
| 2163 | Ga0207649_10728059 | |||
| 2164 | Ga0207652_10023832 | |||
| 2165 | Ga0207652_10031328 | |||
| 2166 | Ga0207652_10052312 | |||
| 2167 | Ga0207646_10452087 | |||
| 2168 | Ga0207681_10115128 | |||
| 2169 | Ga0207681_10804120 | |||
| 2170 | Ga0207694_10000273 | |||
| 2171 | Ga0207694_10287115 | |||
| 2172 | Ga0207694_10606884 | |||
| 2173 | Ga0207650_10122673 | |||
| 2174 | Ga0207650_10294479 | |||
| 2175 | Ga0207659_10159984 | |||
| 2176 | Ga0207687_10069286 | |||
| 2177 | Ga0207687_10355900 | |||
| 2178 | Ga0207687_10386868 | |||
| 2179 | Ga0207700_10010929 | |||
| 2180 | Ga0207700_10023057 | |||
| 2181 | Ga0207700_10054679 | |||
| 2182 | Ga0207700_10161634 | |||
| 2183 | Ga0207700_10372342 | |||
| 2184 | Ga0207700_10380261 | |||
| 2185 | Ga0207700_10882728 | |||
| 2186 | Ga0207700_11045318 | |||
| 2187 | Ga0207664_10024427 | |||
| 2188 | Ga0207664_10049207 | |||
| 2189 | Ga0207664_10064666 | |||
| 2190 | Ga0207664_10172067 | |||
| 2191 | Ga0207664_10181056 | |||
| 2192 | Ga0207664_10411184 | |||
| 2193 | Ga0207664_10485259 | |||
| 2194 | Ga0207664_10551290 | |||
| 2195 | Ga0207664_10981246 | |||
| 2196 | Ga0207644_10377075 | |||
| 2197 | Ga0207690_10336410 | |||
| 2198 | Ga0207690_10583981 | |||
| 2199 | Ga0207706_10116359 | |||
| 2200 | Ga0207706_10231929 | |||
| 2201 | Ga0207706_10268969 | |||
| 2202 | Ga0207709_10070825 | |||
| 2203 | Ga0207709_10582526 | |||
| 2204 | Ga0207670_10208517 | |||
| 2205 | Ga0207670_10290114 | |||
| 2206 | Ga0207670_10738510 | |||
| 2207 | Ga0207669_10150018 | |||
| 2208 | Ga0207669_10213607 | |||
| 2209 | Ga0207704_10067161 | |||
| 2210 | Ga0207704_10391085 | |||
| 2211 | Ga0207704_10651791 | |||
| 2212 | Ga0207665_10000127 | |||
| 2213 | Ga0207665_10009558 | |||
| 2214 | Ga0207665_10015452 | |||
| 2215 | Ga0207691_10397250 | |||
| 2216 | Ga0207711_11047908 | |||
| 2217 | Ga0207661_10013783 | |||
| 2218 | Ga0207661_10021726 | |||
| 2219 | Ga0207661_10171311 | |||
| 2220 | Ga0207661_10324103 | |||
| 2221 | Ga0207661_10765705 | |||
| 2222 | Ga0207679_10282626 | |||
| 2223 | Ga0207667_10005930 | |||
| 2224 | Ga0207667_10095234 | |||
| 2225 | Ga0207667_10155541 | |||
| 2226 | Ga0207667_10181792 | |||
| 2227 | Ga0207667_10243490 | |||
| 2228 | Ga0207667_10355690 | |||
| 2229 | Ga0207667_10481357 | |||
| 2230 | Ga0207667_10508646 | |||
| 2231 | Ga0207712_10585344 | |||
| 2232 | Ga0207668_10013352 | |||
| 2233 | Ga0207668_10140455 | |||
| 2234 | Ga0207668_10357438 | |||
| 2235 | Ga0207668_10414015 | |||
| 2236 | Ga0207640_10105929 | |||
| 2237 | Ga0207640_11050843 | |||
| 2238 | Ga0207658_10014650 | |||
| 2239 | Ga0207677_10088985 | |||
| 2240 | Ga0207677_10278711 | |||
| 2241 | Ga0207703_10084544 | |||
| 2242 | Ga0207703_10095065 | |||
| 2243 | Ga0207703_10457491 | |||
| 2244 | Ga0207703_10806071 | |||
| 2245 | Ga0207639_10038757 | |||
| 2246 | Ga0207639_10069559 | |||
| 2247 | Ga0207639_10178257 | |||
| 2248 | Ga0207639_10185177 | |||
| 2249 | Ga0207639_10359501 | |||
| 2250 | Ga0207678_10016165 | |||
| 2251 | Ga0207678_10018540 | |||
| 2252 | Ga0207678_10022726 | |||
| 2253 | Ga0207678_10093897 | |||
| 2254 | Ga0207678_10146729 | |||
| 2255 | Ga0207678_10209849 | |||
| 2256 | Ga0207678_10225178 | |||
| 2257 | Ga0207678_10234829 | |||
| 2258 | Ga0207678_10502819 | |||
| 2259 | Ga0207702_10000003 | |||
| 2260 | Ga0207702_10000325 | |||
| 2261 | Ga0207702_10057553 | |||
| 2262 | Ga0207702_10147332 | |||
| 2263 | Ga0207702_10284541 | |||
| 2264 | Ga0207702_10374371 | |||
| 2265 | Ga0207641_10102577 | |||
| 2266 | Ga0207641_10199393 | |||
| 2267 | Ga0207641_10358382 | |||
| 2268 | Ga0207648_10389276 | |||
| 2269 | Ga0207676_10141774 | |||
| 2270 | Ga0207676_10400559 | |||
| 2271 | Ga0207674_10017609 | |||
| 2272 | Ga0207674_10017929 | |||
| 2273 | Ga0207674_10030154 | |||
| 2274 | Ga0207674_10108612 | |||
| 2275 | Ga0207674_10166376 | |||
| 2276 | Ga0207674_10175414 | |||
| 2277 | Ga0207674_10666689 | |||
| 2278 | Ga0207675_100072306 | |||
| 2279 | Ga0207675_100113589 | |||
| 2280 | Ga0207675_100232992 | |||
| 2281 | Ga0207683_10061897 | |||
| 2282 | Ga0207683_10148831 | |||
| 2283 | Ga0207683_10152190 | |||
| 2284 | Ga0207683_11016254 | |||
| 2285 | Ga0207698_10051678 | |||
| 2286 | Ga0207698_10536012 | |||
| 2287 | Ga0209389_1000924 | |||
| 2288 | Ga0209389_1000951 | |||
| 2289 | Ga0209589_1000005 | |||
| 2290 | Ga0209589_1003240 | |||
| 2291 | Ga0209489_100005 | |||
| 2292 | Ga0209489_102828 | |||
| 2293 | Ga0209489_115384 | |||
| 2294 | Ga0209700_100006 | |||
| 2295 | Ga0209700_100483 | |||
| 2296 | Ga0209588_1001041 | |||
| 2297 | Ga0268266_10001580 | |||
| 2298 | Ga0268266_10004157 | |||
| 2299 | Ga0268266_10012768 | |||
| 2300 | Ga0268266_10034039 | |||
| 2301 | Ga0268266_10043998 | |||
| 2302 | Ga0268266_10249225 | |||
| 2303 | Ga0268266_10637240 | |||
| 2304 | Ga0268266_10678661 | |||
| 2305 | Ga0268266_10866761 | |||
| 2306 | Ga0268265_10218323 | |||
| 2307 | Ga0268265_10359470 | |||
| 2308 | Ga0268265_11123285 | |||
| 2309 | Ga0268265_11270556 | |||
| 2310 | Ga0268264_10000174 | |||
| 2311 | Ga0268264_10154530 | |||
| 2312 | Ga0268264_10250828 | |||
| 2313 | Ga0268264_10406720 | |||
| 2314 | Ga0265337_1022171 | |||
| 2315 | Ga0265322_10086893 | |||
| 2316 | Ga0265336_10002309 | |||
| 2317 | Ga0307517_10000124 | |||
| 2318 | Ga0307515_10036628 | |||
| 2319 | Ga0307515_10581716 | |||
| 2320 | Ga0265338_10002710 | |||
| 2321 | Ga0265338_10225100 | |||
| 2322 | Ga0265324_10008015 | |||
| 2323 | Ga0307511_10057673 | |||
| 2324 | Ga0265330_10005554 | |||
| 2325 | Ga0265330_10071648 | |||
| 2326 | Ga0265330_10082084 | |||
| 2327 | Ga0265332_10029066 | |||
| 2328 | Ga0265332_10037876 | |||
| 2329 | Ga0265332_10241633 | |||
| 2330 | Ga0265328_10031734 | |||
| 2331 | Ga0265325_10137153 | |||
| 2332 | Ga0265340_10000891 | |||
| 2333 | Ga0265340_10014481 | |||
| 2334 | Ga0265339_10008471 | |||
| 2335 | Ga0265339_10032933 | |||
| 2336 | Ga0265316_10086587 | |||
| 2337 | Ga0265316_10418583 | |||
| 2338 | Ga0307513_10110997 | |||
| 2339 | Ga0307513_10287426 | |||
| 2340 | Ga0307509_10140310 | |||
| 2341 | Ga0307509_10226763 | |||
| 2342 | Ga0307408_100312511 | |||
| 2343 | Ga0307408_100504084 | |||
| 2344 | Ga0265313_10076154 | |||
| 2345 | Ga0307508_10072848 | |||
| 2346 | Ga0307508_10191813 | |||
| 2347 | Ga0307508_10195726 | |||
| 2348 | Ga0265314_10001980 | |||
| 2349 | Ga0265314_10056351 | |||
| 2350 | Ga0265314_10075066 | |||
| 2351 | Ga0265342_10014362 | |||
| 2352 | Ga0265342_10097360 | |||
| 2353 | Ga0265342_10119726 | |||
| 2354 | Ga0316578_10036456 | |||
| 2355 | Ga0307516_10000457 | |||
| 2356 | Ga0307516_10020328 | |||
| 2357 | Ga0307516_10036865 | |||
| 2358 | Ga0307516_10215446 | |||
| 2359 | Ga0307405_10239112 | |||
| 2360 | Ga0307405_10582021 | |||
| 2361 | Ga0307413_10094071 | |||
| 2362 | Ga0307410_10515160 | |||
| 2363 | Ga0307406_10106324 | |||
| 2364 | Ga0307412_10148574 | |||
| 2365 | Ga0307412_10345907 | |||
| 2366 | Ga0307412_10416580 | |||
| 2367 | Ga0307409_100840123 | |||
| 2368 | Ga0307416_100468374 | |||
| 2369 | Ga0307411_10344227 | |||
| 2370 | Ga0316583_10117265 | |||
| 2371 | Ga0307507_10049280 | |||
| 2372 | Ga0307510_10004801 | |||
| 2373 | Ga0307510_10017344 | |||
| 2374 | Ga0307510_10024151 | |||
| 2375 | Ga0307510_10041115 | |||
| 2376 | Ga0307510_10101487 | |||
| 2377 | Ga0315911_1000041 | |||
| 2378 | Ga0316215_1001284 | |||
| 2379 | Ga0373959_0072081 | |||
| 2380 | Ga0373934_0074619 | |||
| 2381 | Ga0373944_0052997 | |||
| 2382 | Ga0373949_0036411 | |||
| 2383 | Ga0373923_0020170 | |||
| 2384 | Ga0373923_0025394 | |||
| 2385 | Ga0373936_0006369 | |||
| 2386 | Ga0373936_0013694 | |||
| 2387 | Ga0373936_0046144 | |||
| 2388 | Ga0373953_0000483 | |||
| 2389 | Ga0373954_0000152 | |||
| 2390 | Ga0373954_0002572 | |||
| 2391 | Ga0373954_0027857 | |||
| 2392 | Ga0373954_0237926 | |||
| 2393 | Ga0373956_0043185 | |||
| 2394 | Ga0373957_0006488 | |||
| 2395 | Ga0373957_0048025 | |||
| 2396 | Ga0373943_0004910 | |||
| 2397 | Ga0373943_0075584 | |||
| 2398 | Ga0373946_0006110 | |||
| 2399 | Ga0373955_0000721 | |||
| 2400 | Ga0373955_0285689 | |||
| 2401 | Ga0373942_0173649 | |||
| 2402 | Ga0316574_0010592 | |||
| 2403 | Ga0373924_0167416 | |||
| 2404 | Ga0373935_0002202 | |||
| 2405 | Ga0373935_0051609 | |||
| 2406 | Ga0373935_0085752 | |||
| 2407 | Ga0373935_0122358 | |||
| 2408 | Ga0373935_0206506 | |||
| 2409 | Ga0373927_0001742 | |||
| 2410 | Ga0373927_0005149 | |||
| 2411 | Ga0373927_0023426 | |||
| 2412 | Ga0373933_0000348 | |||
| 2413 | Ga0373933_0004671 | |||
| 2414 | Ga0373947_0012585 | |||
| 2415 | Ga0373947_0063579 | |||
| 2416 | Ga0373947_0144655 | |||
| 2417 | Ga0373937_0059759 | |||
| 2418 | Ga0373937_0079504 | |||
| 2419 | Ga0373937_0170595 | |||
| 2420 | Ga0373937_0381055 | |||
| 2421 | Ga0373937_0557781 | |||
| 2422 | Ga0372808_012610 | |||
| 2423 | Ga0316584_0015310 | |||
| 2424 | Ga0373925_0016402 | |||
| 2425 | Ga0373925_0271167 | |||
| 2426 | Ga0373925_0910845 | |||
| 2427 | Ga0395899_0045984 | |||
| 2428 | Ga0395899_0182906 | |||
| 2429 | Ga0395900_0146874 | |||
| 2430 | Ga0395900_0224268 | |||
| 2431 | Ga0395900_0327796 | |||
| 2432 | Ga0395900_0333605 | |||
| 2433 | Ga0395900_0344296 | |||
| 2434 | Ga0395900_0839362 | |||
| 2435 | Ga0395898_0009973 | |||
| 2436 | Ga0395898_0043826 | |||
| 2437 | Ga0395898_0058881 | |||
| 2438 | Ga0395898_0518929 | |||
| 2439 | Ga0395905_0079594 | |||
| 2440 | Ga0395905_0098751 | |||
| 2441 | Ga0395905_0168012 | |||
| 2442 | Ga0395901_0036728 | |||
| 2443 | Ga0395901_0230420 | |||
| 2444 | Ga0395901_0296402 | |||
| 2445 | Ga0395901_0496746 | |||
| 2446 | Ga0395901_0882950 | |||
| 2447 | Ga0436365_0472724 | |||
| 2448 | Ga0436365_0694949 | |||
| 2449 | Ga0436365_0838471 | |||
| 2450 | Ga0436365_1683641 | |||
| 2451 | Ga0436365_1911415 | |||
| 2452 | Ga0436360_0605391 | |||
| 2453 | Ga0436361_0018023 | |||
| 2454 | Ga0436361_0576498 | |||
| 2455 | Ga0436361_1036455 | |||
| 2456 | Ga0436363_0060836 | |||
| 2457 | Ga0436363_0165204 | |||
| 2458 | Ga0436363_0194287 | |||
| 2459 | Ga0436362_0418961 | |||
| 2460 | Ga0436362_0974814 | |||
| 2461 | Ga0436362_1114012 | |||
| 2462 | Ga0436362_1195541 | |||
| 2463 | Ga0451791_0175252 | |||
| 2464 | Ga0451793_1106130 | |||
| 2465 | Ga0451793_1469486 | |||
| 2466 | Ga0451802_0621294 | |||
| 2467 | Ga0439445_0109374 | |||
| 2468 | Ga0450894_037402 | |||
| 2469 | Ga0439440_0091747 | |||
| 2470 | Ga0466969_0195415 | |||
| 2471 | Ga0466972_0006422 | |||
| 2472 | Ga0466972_0011224 | |||
| 2473 | Ga0466972_0292348 | |||
| 2474 | Ga0466965_0112501 | |||
| 2475 | Ga0466966_0001733 | |||
| 2476 | Ga0466966_0103448 | |||
| 2477 | Ga0466966_0589695 | |||
| 2478 | Ga0466961_0000009 | |||
| 2479 | Ga0466961_0210915 | |||
| 2480 | Ga0466963_0029623 | |||
| 2481 | Ga0466963_0041407 | |||
| 2482 | Ga0466968_0041819 | |||
| 2483 | Ga0466968_0051956 | |||
| 2484 | Ga0466968_0176754 | |||
| 2485 | Ga0466970_0225572 | |||
| 2486 | Ga0466970_0225722 | |||
| 2487 | Ga0466970_0411950 | |||
| 2488 | Ga0466970_0431591 | |||
| 2489 | Ga0466957_0167912 | |||
| 2490 | Ga0466957_0473827 | |||
| 2491 | Ga0466960_0068614 | |||
| 2492 | Ga0466960_0207382 | |||
| 2493 | Ga0466960_0364477 | |||
| 2494 | Ga0466959_0003063 | |||
| 2495 | Ga0466959_0013181 | |||
| 2496 | Ga0466959_0093544 | |||
| 2497 | Ga0466967_0041953 | |||
| 2498 | Ga0466967_0048933 | |||
| 2499 | Ga0466967_0088096 | |||
| 2500 | Ga0466967_0382777 | |||
| 2501 | Ga0466967_0980112 | |||
| 2502 | Ga0495617_038545 | |||
| 2503 | Ga0495617_044045 | |||
| 2504 | Ga0495592_0000784 | |||
| 2505 | Ga0495592_0013597 | |||
| 2506 | Ga0495592_0050838 | |||
| 2507 | Ga0495592_0463846 | |||
| 2508 | Ga0495603_0002122 | |||
| 2509 | Ga0495603_0006942 | |||
| 2510 | Ga0495603_0019891 | |||
| 2511 | Ga0495603_0037990 | |||
| 2512 | Ga0495603_0132281 | |||
| 2513 | Ga0495603_0169109 | |||
| 2514 | Ga0495603_0362620 | |||
| 2515 | Ga0495629_0002089 | |||
| 2516 | Ga0495629_0004413 | |||
| 2517 | Ga0495629_0009291 | |||
| 2518 | Ga0495629_0346538 | |||
| 2519 | Ga0495629_0373522 | |||
| 2520 | Ga0495629_0404528 | |||
| 2521 | Ga0495629_0512386 | |||
| 2522 | Ga0495638_0012347 | |||
| 2523 | Ga0495638_0082490 | |||
| 2524 | Ga0495641_0033338 | |||
| 2525 | Ga0495651_0002043 | |||
| 2526 | Ga0495651_0008079 | |||
| 2527 | Ga0495651_0141888 | |||
| 2528 | Ga0495651_0172894 | |||
| 2529 | Ga0495651_0202893 | |||
| 2530 | Ga0495651_0309672 | |||
| 2531 | Ga0495653_0010673 | |||
| 2532 | Ga0495653_0040516 | |||
| 2533 | Ga0495653_0041285 | |||
| 2534 | Ga0495653_0110670 | |||
| 2535 | Ga0495650_0055441 | |||
| 2536 | Ga0495580_0016592 | |||
| 2537 | Ga0495580_0165569 | |||
| 2538 | Ga0495582_0000331 | |||
| 2539 | Ga0495605_0123052 | |||
| 2540 | Ga0495639_0000147 | |||
| 2541 | Ga0495639_0100913 | |||
| 2542 | Ga0495662_0252973 | |||
| 2543 | Ga0495662_0267445 | |||
| 2544 | Ga0495664_0011748 | |||
| 2545 | Ga0495664_0039262 | |||
| 2546 | Ga0495664_0061377 | |||
| 2547 | Ga0495664_0080416 | |||
| 2548 | Ga0495664_0383961 | |||
| 2549 | Ga0495584_0052285 | |||
| 2550 | Ga0495585_0060847 | |||
| 2551 | Ga0495594_0000113 | |||
| 2552 | Ga0495594_0270989 | |||
| 2553 | Ga0495594_0409542 | |||
| 2554 | Ga0495596_0016851 | |||
| 2555 | Ga0495583_0058686 | |||
| 2556 | Ga0495583_0071311 | |||
| 2557 | Ga0495606_0001165 | |||
| 2558 | Ga0495606_0055718 | |||
| 2559 | Ga0495608_0029134 | |||
| 2560 | Ga0495608_0191309 | |||
| 2561 | Ga0495610_0147420 | |||
| 2562 | Ga0495610_0205231 | |||
| 2563 | Ga0495616_0065200 | |||
| 2564 | Ga0495616_0097979 | |||
| 2565 | Ga0495618_0003202 | |||
| 2566 | Ga0495628_0001092 | |||
| 2567 | Ga0495628_0055224 | |||
| 2568 | Ga0495628_0200683 | |||
| 2569 | Ga0495628_0423637 | |||
| 2570 | Ga0495630_0010615 | |||
| 2571 | Ga0495630_0332641 | |||
| 2572 | Ga0495630_0499307 | |||
| 2573 | Ga0495631_0033340 | |||
| 2574 | Ga0495631_0069634 | |||
| 2575 | Ga0495631_0091644 | |||
| 2576 | Ga0495631_0146816 | |||
| 2577 | Ga0495632_0209701 | |||
| 2578 | Ga0495643_0053073 | |||
| 2579 | Ga0495643_0176355 | |||
| 2580 | Ga0495648_0000378 | |||
| 2581 | Ga0495648_0000776 | |||
| 2582 | Ga0495663_0045194 | |||
| 2583 | Ga0495666_0008723 | |||
| 2584 | Ga0495666_0230980 | |||
| 2585 | Ga0495642_0181598 | |||
| 2586 | Ga0495652_0014813 | |||
| 2587 | Ga0495652_0068865 | |||
| 2588 | Ga0495652_0082065 | |||
| 2589 | Ga0495652_0307290 | |||
| 2590 | Ga0495665_0092777 | |||
| 2591 | Ga0495640_0003705 | |||
| 2592 | Ga0495640_0012355 | |||
| 2593 | Ga0495640_0058844 | |||
| 2594 | Ga0495640_0086096 | |||
| 2595 | Ga0495640_0101679 | |||
| 2596 | Ga0495640_0484919 | |||
| 2597 | Ga0495586_0096941 | |||
| 2598 | Ga0495587_0012965 | |||
| 2599 | Ga0495587_0121871 | |||
| 2600 | Ga0495598_0049035 | |||
| 2601 | Ga0495609_0020594 | |||
| 2602 | Ga0495621_0078346 | |||
| 2603 | Ga0495597_0154128 | |||
| 2604 | Ga0495597_0162603 | |||
| 2605 | Ga0495645_0006161 | |||
| 2606 | Ga0495645_0008674 | |||
| 2607 | Ga0495645_0027745 | |||
| 2608 | Ga0495645_0425029 | |||
| 2609 | Ga0495622_0010529 | |||
| 2610 | Ga0495622_0023366 | |||
| 2611 | Ga0495622_0035738 | |||
| 2612 | Ga0495633_0058245 | |||
| 2613 | Ga0495633_0114930 | |||
| 2614 | Ga0495633_0190576 | |||
| 2615 | Ga0495667_0000697 | |||
| 2616 | Ga0495667_0015284 | |||
| 2617 | Ga0495667_0044711 | |||
| 2618 | Ga0495667_0069130 | |||
| 2619 | Ga0495667_0104381 | |||
| 2620 | Ga0495656_0006145 | |||
| 2621 | Ga0495656_0099144 | |||
| 2622 | Ga0495668_0098885 | |||
| 2623 | Ga0495668_0136935 | |||
| 2624 | Ga0495668_0146190 | |||
| 2625 | Ga0495634_0023917 | |||
| 2626 | Ga0495634_0025373 | |||
| 2627 | Ga0495634_0052872 | |||
| 2628 | Ga0495634_0094506 | |||
| 2629 | Ga0495634_0306612 | |||
| 2630 | Ga0495611_0030002 | |||
| 2631 | Ga0495625_0238953 | |||
| 2632 | Ga0495625_0364585 | |||
| 2633 | Ga0495635_0000358 | |||
| 2634 | Ga0495635_0000491 | |||
| 2635 | Ga0495635_0205998 | |||
| 2636 | Ga0495635_0306901 | |||
| 2637 | Ga0495659_0059441 | |||
| 2638 | Ga0495661_0253887 | |||
| 2639 | Ga0495588_0090749 | |||
| 2640 | Ga0495588_0178007 | |||
| 2641 | Ga0495657_0006263 | |||
| 2642 | Ga0495657_0033718 | |||
| 2643 | Ga0495657_0131208 | |||
| 2644 | Ga0495657_0194812 | |||
| 2645 | Ga0495599_0017171 | |||
| 2646 | Ga0495599_0144290 | |||
| 2647 | Ga0495623_0005004 | |||
| 2648 | Ga0495623_0006372 | |||
| 2649 | Ga0495623_0221525 | |||
| 2650 | Ga0495646_0008340 | |||
| 2651 | Ga0495646_0020670 | |||
| 2652 | Ga0495646_0118464 | |||
| 2653 | Ga0495646_0233557 | |||
| 2654 | Ga0495647_0000705 | |||
| 2655 | Ga0495658_0002450 | |||
| 2656 | Ga0495669_0029433 | |||
| 2657 | Ga0495669_0030081 | |||
| 2658 | Ga0495669_0188547 | |||
| 2659 | Ga0495669_0298050 | |||
| 2660 | Ga0495613_0094685 | |||
| 2661 | Ga0495613_0139273 | |||
| 2662 | Ga0495613_0194751 | |||
| 2663 | Ga0495624_0003403 | |||
| 2664 | Ga0495624_0297235 | |||
| 2665 | Ga0495624_0332322 | |||
| 2666 | Ga0495670_0061889 | |||
| 2667 | Ga0495670_0099903 | |||
| 2668 | Ga0495671_0087042 | |||
| 2669 | Ga0495649_0322127 | |||
| 2670 | Ga0495600_0007576 | |||
| 2671 | Ga0495600_0007900 | |||
| 2672 | Ga0495600_0014138 | |||
| 2673 | Ga0495600_0255328 | |||
| 2674 | Ga0495600_0268886 | |||
| 2675 | Ga0495600_0387963 | |||
| 2676 | Ga0495581_0160458 | |||
| 2677 | Ga0495581_0169525 | |||
| 2678 | Ga0495581_0327151 | |||
| 2679 | Ga0495604_0001200 | |||
| 2680 | Ga0495604_0022394 | |||
| 2681 | Ga0495636_0056609 | |||
| 2682 | Ga0495674_0001226 | |||
| 2683 | Ga0495674_0001231 | |||
| 2684 | Ga0495674_0033843 | |||
| 2685 | Ga0495674_0063283 | |||
| 2686 | Ga0495674_0512520 | |||
| 2687 | Ga0495672_0000571 | |||
| 2688 | Ga0495672_0139516 | |||
| 2689 | Ga0495672_0204927 | |||
| 2690 | Ga0495672_0270544 | |||
| 2691 | Ga0495676_0186919 | |||
| 2692 | Ga0495676_0220355 | |||
| 2693 | Ga0495680_0001591 | |||
| 2694 | Ga0495680_0005953 | |||
| 2695 | Ga0495680_0238106 | |||
| 2696 | Ga0495683_0083987 | |||
| 2697 | Ga0495683_0253907 | |||
| 2698 | Ga0495687_061617 | |||
| 2699 | Ga0495687_110765 | |||
| 2700 | Ga0495675_0002604 | |||
| 2701 | Ga0495675_0014401 | |||
| 2702 | Ga0495685_050343 | |||
| 2703 | Ga0495673_0004400 | |||
| 2704 | Ga0495673_0103814 | |||
| 2705 | Ga0495681_0166435 | |||
| 2706 | Ga0495681_0233991 | |||
| 2707 | Ga0495684_0000897 | |||
| 2708 | Ga0495684_0113156 | |||
| 2709 | Ga0495684_0270226 | |||
| 2710 | Ga0495686_0054893 | |||
| 2711 | Ga0495686_0084124 | |||
| 2712 | Ga0495686_0283812 | |||
| 2713 | Ga0495593_0002080 | |||
| 2714 | Ga0495593_0002499 | |||
| 2715 | Ga0495593_0155042 | |||
| 2716 | Ga0495593_0227767 | |||
| 2717 | Ga0495602_0000392 | |||
| 2718 | Ga0495602_0012486 | |||
| 2719 | Ga0495602_0147428 | |||
| 2720 | Ga0495626_0095919 | |||
| 2721 | Ga0495626_0124934 | |||
| 2722 | Ga0496100_0018019 | |||
| 2723 | Ga0496100_0117230 | |||
| 2724 | Ga0496100_0152155 | |||
| 2725 | Ga0496100_0869611 | |||
| 2726 | Ga0496101_0203527 | |||
| 2727 | Ga0496101_0259375 | |||
| 2728 | Ga0496102_0088198 | |||
| 2729 | Ga0496102_0120647 | |||
| 2730 | Ga0496102_0143930 | |||
| 2731 | Ga0496102_0146704 | |||
| 2732 | Ga0496102_0188546 | |||
| 2733 | Ga0496102_0306964 | |||
| 2734 | Ga0496102_0334916 | |||
| 2735 | Ga0496103_0066119 | |||
| 2736 | Ga0496103_0282495 | |||
| 2737 | Ga0496104_0004695 | |||
| 2738 | Ga0496104_0014830 | |||
| 2739 | Ga0496104_0131260 | |||
| 2740 | Ga0496104_0178064 | |||
| 2741 | Ga0496104_0521360 | |||
| 2742 | Ga0496105_0041160 | |||
| 2743 | Ga0496105_0087843 | |||
| 2744 | Ga0496105_0288219 | |||
| 2745 | Ga0496105_0561925 | |||
| 2746 | Ga0496106_0001396 | |||
| 2747 | Ga0496106_0007524 | |||
| 2748 | Ga0496106_0010594 | |||
| 2749 | Ga0496106_0013602 | |||
| 2750 | Ga0496106_0019605 | |||
| 2751 | Ga0496106_0047429 | |||
| 2752 | Ga0496106_0203955 | |||
| 2753 | Ga0496106_0356166 | |||
| 2754 | Ga0496106_0478172 | |||
| 2755 | Ga0496107_0002660 | |||
| 2756 | Ga0496107_0054255 | |||
| 2757 | Ga0496107_0202486 | |||
| 2758 | Ga0496107_0256096 | |||
| 2759 | Ga0496108_0002981 | |||
| 2760 | Ga0496108_0042560 | |||
| 2761 | Ga0496108_0055486 | |||
| 2762 | Ga0496108_0120991 | |||
| 2763 | Ga0496108_0131707 | |||
| 2764 | Ga0496108_0244352 | |||
| 2765 | Ga0496108_0326356 | |||
| 2766 | Ga0496108_0455741 | |||
| 2767 | Ga0496109_0000680 | |||
| 2768 | Ga0496109_0015312 | |||
| 2769 | Ga0496109_0064596 | |||
| 2770 | Ga0496109_0072998 | |||
| 2771 | Ga0496109_0099641 | |||
| 2772 | Ga0496109_0308605 | |||
| 2773 | Ga0496109_0337662 | |||
| 2774 | Ga0496109_0567663 | |||
| 2775 | Ga0496110_0011018 | |||
| 2776 | Ga0496110_0035574 | |||
| 2777 | Ga0496110_0206475 | |||
| 2778 | Ga0496111_0026885 | |||
| 2779 | Ga0496111_0030432 | |||
| 2780 | Ga0496111_0038904 | |||
| 2781 | Ga0496111_0193417 | |||
| 2782 | Ga0496111_0218506 | |||
| 2783 | Ga0496112_0000092 | |||
| 2784 | Ga0496112_0012339 | |||
| 2785 | Ga0496112_0012489 | |||
| 2786 | Ga0496112_0029751 | |||
| 2787 | Ga0496112_0048156 | |||
| 2788 | Ga0496112_0089828 | |||
| 2789 | Ga0496112_0211298 | |||
| 2790 | Ga0496112_0340943 | |||
| 2791 | Ga0496112_0383866 | |||
| 2792 | Ga0496113_0031665 | |||
| 2793 | Ga0496113_0032428 | |||
| 2794 | Ga0496113_0081632 | |||
| 2795 | Ga0496113_0084790 | |||
| 2796 | Ga0496113_0140703 | |||
| 2797 | Ga0496113_0273297 | |||
| 2798 | Ga0496113_0473859 | |||
| 2799 | Ga0496114_0061159 | |||
| 2800 | Ga0496114_0196222 | |||
| 2801 | Ga0496114_0271091 | |||
| 2802 | Ga0496114_0304370 | |||
| 2803 | Ga0496114_0578896 | |||
| 2804 | Ga0496115_0002197 | |||
| 2805 | Ga0496115_0021622 | |||
| 2806 | Ga0496115_0026754 | |||
| 2807 | Ga0496115_0059260 | |||
| 2808 | Ga0496115_0099283 | |||
| 2809 | Ga0496115_0171019 | |||
| 2810 | Ga0496115_0174534 | |||
| 2811 | Ga0496115_0201925 | |||
| 2812 | Ga0496115_0273669 | |||
| 2813 | Ga0496116_0004921 | |||
| 2814 | Ga0496116_0084957 | |||
| 2815 | Ga0496117_0038158 | |||
| 2816 | Ga0496117_0067871 | |||
| 2817 | Ga0496117_0109453 | |||
| 2818 | Ga0496117_0133701 | |||
| 2819 | Ga0496117_0366414 | |||
| 2820 | Ga0496118_0013106 | |||
| 2821 | Ga0496118_0023964 | |||
| 2822 | Ga0496118_0177977 | |||
| 2823 | Ga0496118_0198522 | |||
| 2824 | Ga0496119_0012182 | |||
| 2825 | Ga0496119_0018807 | |||
| 2826 | Ga0496119_0026413 | |||
| 2827 | Ga0496119_0197846 | |||
| 2828 | Ga0496120_0081147 | |||
| 2829 | Ga0496120_0089965 | |||
| 2830 | Ga0496120_0149529 | |||
| 2831 | Ga0496121_0001057 | |||
| 2832 | Ga0496121_0002390 | |||
| 2833 | Ga0496121_0005210 | |||
| 2834 | Ga0496121_0007663 | |||
| 2835 | Ga0496121_0009900 | |||
| 2836 | Ga0496121_0027990 | |||
| 2837 | Ga0496121_0033930 | |||
| 2838 | Ga0496121_0062971 | |||
| 2839 | Ga0496121_0067770 | |||
| 2840 | Ga0496121_0103444 | |||
| 2841 | Ga0496121_0153540 | |||
| 2842 | Ga0496121_0155324 | |||
| 2843 | Ga0496121_0157772 | |||
| 2844 | Ga0496121_0162864 | |||
| 2845 | Ga0496121_0175878 | |||
| 2846 | Ga0496121_0205528 | |||
| 2847 | Ga0496121_0224413 | |||
| 2848 | Ga0496121_0358432 | |||
| 2849 | Ga0496122_0116850 | |||
| 2850 | Ga0496122_0180775 | |||
| 2851 | Ga0496123_0202642 | |||
| 2852 | Ga0496123_0293152 | |||
| 2853 | Ga0496124_0063109 | |||
| 2854 | Ga0496124_0126216 | |||
| 2855 | Ga0496124_0138905 | |||
| 2856 | Ga0496124_0156141 | |||
| 2857 | Ga0496124_0222828 | |||
| 2858 | Ga0496124_0310814 | |||
| 2859 | Ga0496125_0000237 | |||
| 2860 | Ga0496125_0004959 | |||
| 2861 | Ga0496125_0007927 | |||
| 2862 | Ga0496125_0067041 | |||
| 2863 | Ga0496125_0106267 | |||
| 2864 | Ga0496125_0122572 | |||
| 2865 | Ga0496125_0306968 | |||
| 2866 | Ga0496126_0001827 | |||
| 2867 | Ga0496126_0007564 | |||
| 2868 | Ga0496126_0009154 | |||
| 2869 | Ga0496126_0011078 | |||
| 2870 | Ga0496126_0012721 | |||
| 2871 | Ga0496126_0020967 | |||
| 2872 | Ga0496126_0046372 | |||
| 2873 | Ga0496126_0054701 | |||
| 2874 | Ga0496126_0056206 | |||
| 2875 | Ga0496126_0078367 | |||
| 2876 | Ga0496126_0083738 | |||
| 2877 | Ga0496126_0085832 | |||
| 2878 | Ga0496126_0144235 | |||
| 2879 | Ga0496126_0168557 | |||
| 2880 | Ga0496126_0230604 | |||
| 2881 | Ga0496126_0253975 | |||
| 2882 | Ga0496126_0261833 | |||
| 2883 | Ga0496126_0372119 | |||
| 2884 | Ga0496126_0482964 | |||
| 2885 | Ga0496126_0503732 | |||
| 2886 | Ga0496126_0805188 | |||
| 2887 | Ga0495678_147606 | |||
| 2888 | Ga0495682_0036048 | |||
| 2889 | Ga0495682_0042883 | |||
| 2890 | Ga0501031_0006062 | |||
| 2891 | Ga0501031_0013983 | |||
| 2892 | Ga0501031_0020408 | |||
| 2893 | Ga0501032_0001501 | |||
| 2894 | Ga0501032_0124903 | |||
| 2895 | Ga0501032_0359983 | |||
| 2896 | Ga0501033_0000394 | |||
| 2897 | Ga0501033_0000639 | |||
| 2898 | Ga0501033_0016652 | |||
| 2899 | Ga0501033_0090615 | |||
| 2900 | Ga0501033_0100323 | |||
| 2901 | Ga0501034_0000157 | |||
| 2902 | Ga0501034_0068248 | |||
| 2903 | Ga0501034_0123784 | |||
| 2904 | Ga0501034_0173679 | |||
| 2905 | Ga0501034_0270338 | |||
| 2906 | Ga0501034_0311051 | |||
| 2907 | Ga0501034_0495753 | |||
| 2908 | Ga0501036_0000440 | |||
| 2909 | Ga0501036_0032056 | |||
| 2910 | Ga0501036_0058423 | |||
| 2911 | Ga0501036_0089001 | |||
| 2912 | Ga0501036_0197573 | |||
| 2913 | Ga0501036_0208537 | |||
| 2914 | Ga0501036_0242185 | |||
| 2915 | Ga0501036_0521308 | |||
| 2916 | Ga0501036_0810480 | |||
| 2917 | Ga0501037_0000969 | |||
| 2918 | Ga0501037_0001723 | |||
| 2919 | Ga0501037_0049834 | |||
| 2920 | Ga0501037_0057203 | |||
| 2921 | Ga0501037_0234287 | |||
| 2922 | Ga0501038_0000473 | |||
| 2923 | Ga0501038_0010530 | |||
| 2924 | Ga0501038_0034189 | |||
| 2925 | Ga0501038_0037503 | |||
| 2926 | Ga0501038_0096218 | |||
| 2927 | Ga0501038_0112741 | |||
| 2928 | Ga0501038_0143120 | |||
| 2929 | Ga0501038_0238474 | |||
| 2930 | Ga0501038_0643035 | |||
| 2931 | Ga0501039_0002012 | |||
| 2932 | Ga0501039_0006007 | |||
| 2933 | Ga0501039_0109240 | |||
| 2934 | Ga0501039_0123997 | |||
| 2935 | Ga0501040_0244174 | |||
| 2936 | Ga0501040_0256419 | |||
| 2937 | Ga0501041_0069312 | |||
| 2938 | Ga0501042_0065242 | |||
| 2939 | Ga0501042_0080850 | |||
| 2940 | Ga0501043_0002014 | |||
| 2941 | Ga0501043_0003168 | |||
| 2942 | Ga0501043_0016557 | |||
| 2943 | Ga0501043_0051045 | |||
| 2944 | Ga0501043_0071243 | |||
| 2945 | Ga0501043_0110503 | |||
| 2946 | Ga0501043_0121514 | |||
| 2947 | Ga0501043_0151668 | |||
| 2948 | Ga0501043_0153968 | |||
| 2949 | Ga0501043_0398883 | |||
| 2950 | Ga0501046_0026559 | |||
| 2951 | Ga0501046_0043974 | |||
| 2952 | Ga0501046_0054587 | |||
| 2953 | Ga0501046_0062722 | |||
| 2954 | Ga0501046_0122020 | |||
| 2955 | Ga0501047_0000419 | |||
| 2956 | Ga0501047_0052635 | |||
| 2957 | Ga0501047_0274357 | |||
| 2958 | Ga0501047_0375785 | |||
| 2959 | Ga0501047_0388877 | |||
| 2960 | Ga0501047_0502243 | |||
| 2961 | Ga0501048_0000057 | |||
| 2962 | Ga0501048_0099098 | |||
| 2963 | Ga0501048_0556373 | |||
| 2964 | Ga0501067_0000507 | |||
| 2965 | Ga0501067_0023557 | |||
| 2966 | Ga0501067_0154639 | |||
| 2967 | Ga0501067_0176722 | |||
| 2968 | Ga0501067_0195646 | |||
| 2969 | Ga0501067_0389095 | |||
| 2970 | Ga0501068_0004195 | |||
| 2971 | Ga0501068_0066490 | |||
| 2972 | Ga0501068_0071854 | |||
| 2973 | Ga0501069_0006517 | |||
| 2974 | Ga0501069_0218198 | |||
| 2975 | Ga0501070_0029682 | |||
| 2976 | Ga0501070_0061196 | |||
| 2977 | Ga0501070_0115060 | |||
| 2978 | Ga0501070_0204862 | |||
| 2979 | Ga0501070_0719349 | |||
| 2980 | Ga0501071_0056300 | |||
| 2981 | Ga0501071_0083928 | |||
| 2982 | Ga0501071_0166824 | |||
| 2983 | Ga0501071_0281672 | |||
| 2984 | Ga0501071_0641394 | |||
| 2985 | Ga0501072_0053425 | |||
| 2986 | Ga0501072_0313805 | |||
| 2987 | Ga0501073_0000027 | |||
| 2988 | Ga0501073_0017325 | |||
| 2989 | Ga0501073_0090860 | |||
| 2990 | Ga0501073_0169705 | |||
| 2991 | Ga0501073_0171015 | |||
| 2992 | Ga0501073_0698533 | |||
| 2993 | Ga0501074_0000081 | |||
| 2994 | Ga0501074_0374537 | |||
| 2995 | Ga0501076_0078412 | |||
| 2996 | Ga0501077_0077707 | |||
| 2997 | Ga0501079_0068811 | |||
| 2998 | Ga0501079_0080208 | |||
| 2999 | Ga0501079_0082616 | |||
| 3000 | Ga0501080_0000313 | |||
| 3001 | Ga0501080_0025448 | |||
| 3002 | Ga0501080_0316932 | |||
| 3003 | Ga0501083_0062728 | |||
| 3004 | Ga0501035_0000145 | |||
| 3005 | Ga0501035_0002494 | |||
| 3006 | Ga0501035_0043031 | |||
| 3007 | Ga0501035_0045019 | |||
| 3008 | Ga0501035_0145887 | |||
| 3009 | Ga0501035_0159854 | |||
| 3010 | Ga0501035_0169311 | |||
| 3011 | Ga0501035_0175867 | |||
| 3012 | Ga0501035_0521166 | |||
| 3013 | Ga0501035_0535663 | |||
| 3014 | Ga0501044_0002483 | |||
| 3015 | Ga0501044_0016900 | |||
| 3016 | Ga0501044_0017556 | |||
| 3017 | Ga0501044_0028759 | |||
| 3018 | Ga0501044_0037365 | |||
| 3019 | Ga0501044_0047612 | |||
| 3020 | Ga0501044_0070464 | |||
| 3021 | Ga0501044_0086992 | |||
| 3022 | Ga0501044_0316040 | |||
| 3023 | Ga0501044_0715447 | |||
| 3024 | Ga0501045_0032630 | |||
| 3025 | Ga0501045_0065645 | |||
| 3026 | Ga0501045_0287662 | |||
| 3027 | nmdc:mga03683_84769_c1 | |||
| 3028 | nmdc:mga03n38_130777_c1 | |||
| 3029 | nmdc:mga03n38_174286_c1 | |||
| 3030 | nmdc:mga03n38_84922_c1 | |||
| 3031 | nmdc:mga00v17_106208_c1 | |||
| 3032 | nmdc:mga00v17_17072_c1 | |||
| 3033 | nmdc:mga00v17_339804_c1 | |||
| 3034 | nmdc:mga00v17_535846_c1 | |||
| 3035 | nmdc:mga0yw44_131148_c1 | |||
| 3036 | nmdc:mga0yw44_188824_c1 | |||
| 3037 | nmdc:mga0yw44_50814_c1 | |||
| 3038 | nmdc:mga0yw44_65741_c1 | |||
| 3039 | nmdc:mga0yw44_76420_c1 | |||
| 3040 | nmdc:mga0yw44_83502_c1 | |||
| 3041 | nmdc:mga0k408_39324_c1 | |||
| 3042 | nmdc:mga06z11_102090_c1 | |||
| 3043 | nmdc:mga06z11_142812_c1 | |||
| 3044 | nmdc:mga06z11_231002_c1 | |||
| 3045 | nmdc:mga06z11_276815_c1 | |||
| 3046 | nmdc:mga06z11_30175_c1 | |||
| 3047 | nmdc:mga06z11_4552_c1 | |||
| 3048 | nmdc:mga06z11_51386_c1 | |||
| 3049 | nmdc:mga04h51_27619_c1 | |||
| 3050 | nmdc:mga07m45_102463_c1 | |||
| 3051 | nmdc:mga07m45_26107_c1 | |||
| 3052 | nmdc:mga07m45_43386_c1 | |||
| 3053 | nmdc:mga07m45_76241_c1 | |||
| 3054 | nmdc:mga05p37_787746_c1 | |||
| 3055 | nmdc:mga0n895_92008_c1 | |||
| 3056 | nmdc:mga0rr50_144537_c1 | |||
| 3057 | nmdc:mga0a205_175450_c1 | |||
| 3058 | nmdc:mga0sz30_23579_c1 | |||
| 3059 | nmdc:mga0sz30_41151_c1 | |||
| 3060 | nmdc:mga0sz30_89970_c1 | |||
| 3061 | Ga0495601_0062758 | |||
| 3062 | Ga0495612_0022880 | |||
| 3063 | Ga0500610_0232167 | |||
| 3064 | Ga0500635_0002242 | |||
| 3065 | Ga0500635_0002742 | |||
| 3066 | Ga0500635_0048704 | |||
| 3067 | Ga0500635_0096552 | |||
| 3068 | Ga0495655_0043650 | |||
| 3069 | Ga0495595_0015715 | |||
| 3070 | Ga0495619_0000858 | |||
| 3071 | Ga0495619_0157808 | |||
| 3072 | Ga0500578_0088881 | |||
| 3073 | Ga0500643_000016 | |||
| 3074 | Ga0500643_069541 | |||
| 3075 | Ga0500647_0065379 | |||
| 3076 | Ga0500583_0274754 | |||
| 3077 | Ga0500651_0026230 | |||
| 3078 | Ga0500651_0061210 | |||
| 3079 | Ga0500566_0000394 | |||
| 3080 | Ga0500566_0000751 | |||
| 3081 | Ga0500566_0015160 | |||
| 3082 | Ga0500566_0030466 | |||
| 3083 | Ga0500640_001550 | |||
| 3084 | Ga0500641_0130716 | |||
| 3085 | Ga0500650_0021151 | |||
| 3086 | Ga0500554_010908 | |||
| 3087 | Ga0500554_018859 | |||
| 3088 | Ga0500555_005870 | |||
| 3089 | Ga0500556_0000238 | |||
| 3090 | Ga0500556_0002504 | |||
| 3091 | Ga0500557_000018 | |||
| 3092 | Ga0500557_029595 | |||
| 3093 | Ga0500562_020364 | |||
| 3094 | Ga0500569_002333 | |||
| 3095 | Ga0500569_045967 | |||
| 3096 | Ga0500569_072778 | |||
| 3097 | Ga0500572_000156 | |||
| 3098 | Ga0500572_002564 | |||
| 3099 | Ga0500592_002853 | |||
| 3100 | Ga0500594_0035745 | |||
| 3101 | Ga0500595_001005 | |||
| 3102 | Ga0500595_007607 | |||
| 3103 | Ga0500595_010518 | |||
| 3104 | Ga0500595_011210 | |||
| 3105 | Ga0500595_012247 | |||
| 3106 | Ga0500595_017583 | |||
| 3107 | Ga0500595_024242 | |||
| 3108 | Ga0500608_022516 | |||
| 3109 | Ga0500608_044580 | |||
| 3110 | Ga0500608_102162 | |||
| 3111 | Ga0500608_136341 | |||
| 3112 | Ga0500614_001247 | |||
| 3113 | Ga0500614_024310 | |||
| 3114 | Ga0500618_003296 | |||
| 3115 | Ga0500642_0000069 | |||
| 3116 | Ga0500642_0000092 | |||
| 3117 | Ga0500642_0130915 | |||
| 3118 | Ga0500652_000258 | |||
| 3119 | Ga0500652_035989 | |||
| 3120 | Ga0500658_0135180 | |||
| 3121 | Ga0500559_0000377 | |||
| 3122 | Ga0500559_0000492 | |||
| 3123 | Ga0500559_0000657 | |||
| 3124 | Ga0500559_0001182 | |||
| 3125 | Ga0500559_0027168 | |||
| 3126 | Ga0500559_0117128 | |||
| 3127 | Ga0500568_0005790 | |||
| 3128 | Ga0500568_0037767 | |||
| 3129 | Ga0500568_0056219 | |||
| 3130 | Ga0500573_0081236 | |||
| 3131 | Ga0500577_0000068 | |||
| 3132 | Ga0500577_0037067 | |||
| 3133 | Ga0500577_0114735 | |||
| 3134 | Ga0500577_0167508 | |||
| 3135 | Ga0500586_002258 | |||
| 3136 | Ga0500589_154640 | |||
| 3137 | Ga0500590_025525 | |||
| 3138 | Ga0500590_101169 | |||
| 3139 | Ga0500590_120217 | |||
| 3140 | Ga0500603_000254 | |||
| 3141 | Ga0500603_001083 | |||
| 3142 | Ga0500603_064876 | |||
| 3143 | Ga0500604_0006587 | |||
| 3144 | Ga0500604_0022060 | |||
| 3145 | Ga0500616_0000197 | |||
| 3146 | Ga0500619_102485 | |||
| 3147 | Ga0500622_0000966 | |||
| 3148 | Ga0500622_0104018 | |||
| 3149 | Ga0500627_0014629 | |||
| 3150 | Ga0500627_0065476 | |||
| 3151 | Ga0500630_000834 | |||
| 3152 | Ga0500638_007204 | |||
| 3153 | Ga0500638_090931 | |||
| 3154 | Ga0500638_176455 | |||
| 3155 | Ga0500639_001931 | |||
| 3156 | Ga0500639_008061 | |||
| 3157 | Ga0500636_0000223 | |||
| 3158 | Ga0500636_0021262 | |||
| 3159 | Ga0500636_0081672 | |||
| 3160 | Ga0500636_0112613 | |||
| 3161 | Ga0500636_0214640 | |||
| 3162 | Ga0500637_0000090 | |||
| 3163 | Ga0500637_0029621 | |||
| 3164 | Ga0500637_0218248 | |||
| 3165 | Ga0500637_0316676 | |||
| 3166 | Ga0500570_108629 | |||
| 3167 | Ga0500645_019942 | |||
| 3168 | Ga0500552_001014 | |||
| 3169 | Ga0500596_000920 | |||
| 3170 | Ga0500596_001030 | |||
| 3171 | Ga0500599_003555 | |||
| 3172 | Ga0500601_000084 | |||
| 3173 | Ga0500601_004047 | |||
| 3174 | Ga0500601_009318 | |||
| 3175 | Ga0501084_0072304 | |||
| 3176 | Ga0500661_000273 | |||
| 3177 | Ga0500661_016039 | |||
| 3178 | Ga0501082_0002728 | |||
| 3179 | Ga0501082_0024361 | |||
| 3180 | Ga0501082_0176163 | |||
| 3181 | 2507511340 | |||
| 3182 | 2508545138 | |||
| 3183 | 2508693978 | |||
| 3184 | 2509146674 | |||
| 3185 | 2511401080 | |||
| 3186 | 2513624176 | |||
| 3187 | 2513641146 | |||
| 3188 | 2513648599 | |||
| 3189 | 2513656049 | |||
| 3190 | 2513675241 | |||
| 3191 | 2513696397 | |||
| 3192 | 2513704334 | |||
| 3193 | 2513717862 | |||
| 3194 | 2513862853 | |||
| 3195 | 2513874921 | |||
| 3196 | 2513887668 | |||
| 3197 | 2513920943 | |||
| 3198 | 2514010356 | |||
| 3199 | 2515625076 | |||
| 3200 | 2517101078 | |||
| 3201 | 2517895870 | |||
| 3202 | 2524439979 | |||
| 3203 | 2524469158 | |||
| 3204 | 2524534748 | |||
| 3205 | 2528856808 | |||
| 3206 | 2603857512 | |||
| 3207 | 2617348510 | |||
| 3208 | 2617375063 | |||
| 3209 | 2644287255 | |||
| 3210 | 2671122670 | |||
| 3211 | 2723842903 | |||
| 3212 | 2728749602 | |||
| 3213 | 2793061707 | |||
| 3214 | 2793069696 | |||
| 3215 | 2793080209 | |||
| 3216 | 2805916491 | |||
| 3217 | 2818243481 | |||
| 3218 | 2824604328 | |||
| 3219 | 2824614199 | |||
| 3220 | 2824619574 | |||
| 3221 | 2824629010 | |||
| 3222 | 2824635677 | |||
| 3223 | 2824652971 | |||
| 3224 | 2824656458 | |||
| 3225 | 2824671267 | |||
| 3226 | 2824679573 | |||
| 3227 | 2824687818 | |||
| 3228 | 2824696219 | |||
| 3229 | 2824704509 | |||
| 3230 | 2824714515 | |||
| 3231 | 2824723758 | |||
| 3232 | 2824732823 | |||
| 3233 | 2824740862 | |||
| 3234 | 2824753768 | |||
| 3235 | 2824754144 | |||
| 3236 | 2824771651 | |||
| 3237 | 2824780550 | |||
| 3238 | 2838129009 | |||
| 3239 | 2841948286 | |||
| 3240 | 2841957218 | |||
| 3241 | 2841961491 | |||
| 3242 | 2841970138 | |||
| 3243 | 2841977217 | |||
| 3244 | 2841985651 | |||
| 3245 | 2842042388 | |||
| 3246 | 2842050431 | |||
| 3247 | 2844316582 | |||
| 3248 | 2847939117 | |||
| 3249 | 2847943938 | |||
| 3250 | 2849081835 | |||
| 3251 | 2857512594 | |||
| 3252 | 2857526899 | |||
| 3253 | 2874594559 | |||
| 3254 | 2874606435 | |||
| 3255 | 2874613913 | |||
| 3256 | 2874625554 | |||
| 3257 | 2874633762 | |||
| 3258 | 2874649607 | |||
| 3259 | 2876773691 | |||
| 3260 | 2876817886 | |||
| 3261 | 2876820682 | |||
| 3262 | 2879076884 | |||
| 3263 | 2879084589 | |||
| 3264 | 2879101151 | |||
| 3265 | 2879113693 | |||
| 3266 | 2879130328 | |||
| 3267 | 2879146844 | |||
| 3268 | 2881367364 | |||
| 3269 | 2881668742 | |||
| 3270 | 2885366568 | |||
| 3271 | 2885381579 | |||
| 3272 | 2885387486 | |||
| 3273 | 2885413503 | |||
| 3274 | 2888386864 | |||
| 3275 | 2888389587 | |||
| 3276 | 2888421508 | |||
| 3277 | 2889033780 | |||
| 3278 | 2893070056 | |||
| 3279 | 2903731352 | |||
| 3280 | 2903756034 | |||
| 3281 | 2903770364 | |||
| 3282 | 2904673500 | |||
| 3283 | 2904693353 | |||
| 3284 | 2904707006 | |||
| 3285 | 2904719475 | |||
| 3286 | 2906603818 | |||
| 3287 | 2906615661 | |||
| 3288 | 2906635031 | |||
| 3289 | 2906646090 | |||
| 3290 | 2906665098 | |||
| 3291 | 2908745523 | |||
| 3292 | 2908759430 | |||
| 3293 | 2908777549 | |||
| 3294 | 2919078016 | |||
| 3295 | 2922367181 | |||
| 3296 | 2922377018 | |||
| 3297 | 2922390085 | |||
| 3298 | 2922398174 | |||
| 3299 | 2922432348 | |||
| 3300 | 2929619154 | |||
| 3301 | 2929628351 | |||
| 3302 | 2932791278 | |||
| 3303 | 2932795705 | |||
| 3304 | 2932801944 | |||
| 3305 | 2932817694 | |||
| 3306 | 2932826978 | |||
| 3307 | 2932833153 | |||
| 3308 | 2933581076 | |||
| 3309 | 2935612331 | |||
| 3310 | 2935620570 | |||
| 3311 | 2935630821 | |||
| 3312 | 2935639657 | |||
| 3313 | 2935650173 | |||
| 3314 | 2935658320 | |||
| 3315 | 2935667505 | |||
| 3316 | 2935682930 | |||
| 3317 | 2935687597 | |||
| 3318 | 2935696432 | |||
| 3319 | 2935705245 | |||
| 3320 | 2935719057 | |||
| 3321 | 2935728709 | |||
| 3322 | 2935736695 | |||
| 3323 | 2935746303 | |||
| 3324 | 2935753563 | |||
| 3325 | 2935767755 | |||
| 3326 | 2935770513 | |||
| 3327 | 2935782466 | |||
| 3328 | 2935786434 | |||
| 3329 | 2935794489 | |||
| 3330 | 2935806991 | |||
| 3331 | 2935814091 | |||
| 3332 | 2935823819 | |||
| 3333 | 2935829140 | |||
| 3334 | 2935845326 | |||
| 3335 | 2935854457 | |||
| 3336 | 2935858378 | |||
| 3337 | 2935872314 | |||
| 3338 | 2935877339 | |||
| 3339 | 2935886131 | |||
| 3340 | 2935913452 | |||
| 3341 | 2935923348 | |||
| 3342 | 2935931231 | |||
| 3343 | 2935935513 | |||
| 3344 | 2935947079 | |||
| 3345 | 2935953826 | |||
| 3346 | 2935961534 | |||
| 3347 | 2935968852 | |||
| 3348 | 2935982484 | |||
| 3349 | 2935985952 | |||
| 3350 | 2935995042 | |||
| 3351 | 2936006135 | |||
| 3352 | 2936013268 | |||
| 3353 | 2936021645 | |||
| 3354 | 2936030561 | |||
| 3355 | 2936039646 | |||
| 3356 | 2936047839 | |||
| 3357 | 2936057841 | |||
| 3358 | 2940559476 | |||
| 3359 | 2941507473 | |||
| 3360 | 2941515900 | |||
| 3361 | 2941523392 | |||
| 3362 | 2941537043 | |||
| 3363 | 2941545703 | |||
| 3364 | 3005476690 | |||
| 3365 | 3005488280 | |||
| 3366 | 3005511224 | |||
| 3367 | 3005592088 | |||
| 3368 | 3005596203 | |||
| 3369 | 3005712139 | |||
| 3370 | 8006934789 | |||
| 3371 | 8006966708 | |||
| 3372 | 8006974757 | |||
| 3373 | 8006989619 | |||
| 3374 | 8006998010 | |||
| 3375 | 8016516885 | |||
| 3376 | 8016524478 | |||
| 3377 | 8016538038 | |||
| 3378 | 8016542311 | |||
| 3379 | 8016550968 | |||
| 3380 | 8016567698 | |||
| 3381 | 8016580392 | |||
| 3382 | 8016588771 | |||
| 3383 | 8016597316 | |||
| 3384 | 8016604941 | |||
| 3385 | 8016620067 | |||
| 3386 | 8016624292 | |||
| 3387 | 8016637703 | |||
| 3388 | 8017059686 | |||
| 3389 | 8019537705 | |||
| 3390 | 8019539336 | |||
| 3391 | 8019551309 | |||
| 3392 | 8019563864 | |||
| 3393 | 8019573935 | |||
| 3394 | 8019604480 | |||
| 3395 | 8019614056 | |||
| 3396 | 8019624589 | |||
| 3397 | 8019637444 | |||
| 3398 | 8019642165 | |||
| 3399 | 8019650355 | |||
| 3400 | 8019665381 | |||
| 3401 | 8019674926 | |||
| 3402 | 8019681169 | |||
| 3403 | 8019694533 | |||
| 3404 | 8055749588 | |||
| 3405 | 8056675045 | |||
| 3406 | 8056681881 | |||
| 3407 | 8056696280 | |||
| 3408 | 8056973784 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wzn-assembly1.cif.gz_A | crystal structure of the sam-dependent methyltransferase from pyrococcus horikoshii ot3 | 0.8227 | 11 | 144 |
| 4obx-assembly1.cif.gz_B | crystal structure of yeast coq5 in the apo form | 0.815 | 12 | 211 |
| 1xxl-assembly2.cif.gz_B | the crystal structure of ycgj protein from bacillus subitilis at 2.1 a resolution | 0.8121 | 32 | 210 |
| 1vl5-assembly4.cif.gz_D | crystal structure of a putative methyltransferase (bh2331) from bacillus halodurans c-125 at 1.95 a resolution | 0.7972 | 34 | 210 |
| 6f5z-assembly1.cif.gz_B | complex between the haloferax volcanii trm112 methyltransferase activator and the hvo_0019 putative methyltransferase | 0.796 | 9 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6EFY7_537_616_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.868 | 44 | 95 | 3.40.50.150 |
| af_F1R3E3_35_208_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8603 | 32 | 141 | 3.40.50.150 |
| af_Q7YWR7_1_204_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8491 | 26 | 208 | 3.40.50.150 |
| af_Q4E3J0_145_404_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8335 | 46 | 93 | 3.40.50.150 |
| af_Q4DS78_179_367_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8284 | 29 | 211 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V8AIV5-F1-model_v4 | Putative N-methyltransferase | 0.9231 | 7 | 211 |
GO:0008757
GO:0032259 |
| AF-A0A3C1YWK4-F1-model_v4 | SAM-dependent methyltransferase | 0.9143 | 5 | 123 |
GO:0008168
GO:0032259 |
| AF-A0A533ZLT2-F1-model_v4 | Methyltransferase domain-containing protein | 0.9106 | 1 | 209 |
GO:0008757
GO:0032259 |
| AF-A0A7Y7M866-F1-model_v4 | Class I SAM-dependent methyltransferase | 0.9068 | 5 | 211 |
GO:0008757
GO:0032259 |
| AF-A0A3D5Y937-F1-model_v4 | SAM-dependent methyltransferase | 0.9045 | 7 | 143 |
GO:0008757
GO:0032259 |