F495394
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1701 | 571 | 3402 | 136 |
Family's Representative Sequence
| Representative Sequence | 3300017792|Ga0163161_10034921|Ga0163161_100349215 |
| Length | 147 |
| Sequence | MIQGIQVVGLYVRDQDEALAFYVEQLGFRVHTDVANGAYRWLTVQHPDQPSFQLGLFTPGPPVLDAATAQAVRAIVAKGAMPPLVLAVDDCRAAYDRMLARGVEFTQEPVDRYGTVDAGFRDPSGNGWKMIEARRDALGARSQRRSQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 92 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 93 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 94 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 95 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 96 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 99 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 102 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 103 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 104 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 105 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 106 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 110 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 143 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 144 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 148 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 150 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 151 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 229 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 232 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 236 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 237 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 239 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 241 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 243 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 244 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 245 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 246 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 247 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 248 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 249 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 251 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 252 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 253 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 254 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 255 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 256 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 257 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 258 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 259 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 260 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 261 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 262 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 263 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 264 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 265 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 266 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 268 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 272 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 273 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 274 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 275 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 278 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 279 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 280 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 281 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 282 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 283 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 284 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 285 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 289 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 290 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 291 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 292 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 293 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 294 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 295 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 296 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 297 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 298 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 299 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 300 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 301 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 302 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 303 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 304 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 305 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 306 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 307 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 308 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 309 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 310 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 311 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 312 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 313 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 314 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 315 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 316 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 317 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 318 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 319 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 320 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 321 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 322 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 323 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 324 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 325 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 326 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 327 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 328 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 329 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 330 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 331 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 332 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 333 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 334 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 335 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 336 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 424 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 425 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 426 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 427 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 428 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 429 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 430 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 431 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 432 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 433 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 434 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 435 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 436 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 437 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 438 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 439 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 440 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 441 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 442 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 443 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 444 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 445 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 446 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 447 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 448 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 449 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 450 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 476 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 477 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 478 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 479 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 480 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 483 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 485 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 486 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 488 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 489 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 490 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 491 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 492 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 493 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 494 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 495 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 496 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 497 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 498 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 499 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 500 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 501 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 502 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 503 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 504 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 505 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 506 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 507 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 508 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 509 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 510 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 511 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 512 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 513 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 514 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 515 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 516 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 517 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 518 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 519 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 520 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 521 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 522 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 523 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 524 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 525 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 526 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 527 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 528 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 529 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 530 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 531 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 532 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 533 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 534 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 535 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 536 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 537 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 538 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 539 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 540 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 541 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 542 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 543 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 544 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 545 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 546 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 547 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 548 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 549 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 550 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 551 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 552 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 553 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 554 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 555 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 556 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 557 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 558 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 559 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 560 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 561 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 562 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 563 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 564 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 565 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 566 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 567 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 568 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 569 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 570 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 571 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.88 |
| Metatranscriptomes | 0.24 |
| Isolates | 2.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.29 |
| Nodule | 1.06 |
| Rhizoplane | 6.47 |
| Rhizosphere | 77.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163161_10034921 | 3300017792 | Bacteria | 3597 |
| 2 | JGI24739J22299_10003364 | 3300001989 | Bacteria | 6102 |
| 3 | JGI24739J22299_10023427 | 3300001989 | Bacteria | 2183 |
| 4 | JGI24739J22299_10084174 | 3300001989 | Bacteria | 974 |
| 5 | JGI24739J22299_10182118 | 3300001989 | Bacteria | 618 |
| 6 | JGI24737J22298_10024487 | 3300001990 | Bacteria | 1911 |
| 7 | JGI24737J22298_10035457 | 3300001990 | Bacteria | 1544 |
| 8 | JGI24735J21928_10000218 | 3300002067 | Bacteria | 20136 |
| 9 | JGI24735J21928_10019288 | 3300002067 | Bacteria | 2096 |
| 10 | JGI24735J21928_10084510 | 3300002067 | Bacteria | 909 |
| 11 | JGI24738J21930_10001339 | 3300002075 | Bacteria | 6845 |
| 12 | JGI25151J46595_10002650 | 3300003187 | Bacteria | 10524 |
| 13 | JGI25153J46596_10002559 | 3300003215 | Bacteria | 10429 |
| 14 | JGI25153J46596_10004432 | 3300003215 | Bacteria | 7574 |
| 15 | rootH2_10017111 | 3300003320 | Bacteria | 8496 |
| 16 | rootL2_10017630 | 3300003322 | Bacteria | 6871 |
| 17 | rootL2_10063704 | 3300003322 | Bacteria | 4615 |
| 18 | rootH1_10057484 | 3300003323 | Bacteria | 1079 |
| 19 | rootH1_10106569 | 3300003323 | Bacteria | 7413 |
| 20 | JGI25160J50197_1000138 | 3300003354 | Bacteria | 65562 |
| 21 | JGI25160J50197_1067284 | 3300003354 | Bacteria | 694 |
| 22 | Ga0055529_1000645 | 3300003763 | Bacteria | 25333 |
| 23 | Ga0055526_1000025 | 3300003771 | Bacteria | 154279 |
| 24 | Ga0055524_1000340 | 3300003775 | Bacteria | 42965 |
| 25 | Ga0055528_1021709 | 3300003790 | Bacteria | 2025 |
| 26 | Ga0055530_10001296 | 3300003791 | Bacteria | 18885 |
| 27 | Ga0055540_1000202 | 3300003792 | Bacteria | 57757 |
| 28 | Ga0055531_10006224 | 3300003794 | Bacteria | 6815 |
| 29 | Ga0065165_1001498 | 3300005262 | Bacteria | 24704 |
| 30 | Ga0065714_10003524 | 3300005288 | Bacteria | 8451 |
| 31 | Ga0065714_10026103 | 3300005288 | Bacteria | 1684 |
| 32 | Ga0065704_10314299 | 3300005289 | Bacteria | 863 |
| 33 | Ga0065712_10139593 | 3300005290 | Bacteria | 1463 |
| 34 | Ga0065715_10382284 | 3300005293 | Bacteria | 906 |
| 35 | Ga0065707_10113921 | 3300005295 | Bacteria | 2312 |
| 36 | Ga0070658_10002159 | 3300005327 | Bacteria | 16503 |
| 37 | Ga0070658_10486117 | 3300005327 | Bacteria | 1066 |
| 38 | Ga0070658_10509300 | 3300005327 | Bacteria | 1040 |
| 39 | Ga0070676_10202976 | 3300005328 | Bacteria | 1301 |
| 40 | Ga0070676_11087146 | 3300005328 | Bacteria | 604 |
| 41 | Ga0070683_100025002 | 3300005329 | Bacteria | 5357 |
| 42 | Ga0070683_100454758 | 3300005329 | Bacteria | 1222 |
| 43 | Ga0070683_101498005 | 3300005329 | Bacteria | 648 |
| 44 | Ga0070683_101622339 | 3300005329 | Bacteria | 622 |
| 45 | Ga0070690_100000170 | 3300005330 | Bacteria | 33307 |
| 46 | Ga0070690_100006691 | 3300005330 | Bacteria | 6547 |
| 47 | Ga0070690_100628572 | 3300005330 | Bacteria | 818 |
| 48 | Ga0070670_100056500 | 3300005331 | Bacteria | 3368 |
| 49 | Ga0070670_100111461 | 3300005331 | Bacteria | 2358 |
| 50 | Ga0070670_100338079 | 3300005331 | Bacteria | 1321 |
| 51 | Ga0070670_101659532 | 3300005331 | Bacteria | 588 |
| 52 | Ga0070670_101999810 | 3300005331 | Bacteria | 534 |
| 53 | Ga0070677_10005411 | 3300005333 | Bacteria | 4206 |
| 54 | Ga0070677_10135632 | 3300005333 | Bacteria | 1129 |
| 55 | Ga0070677_10137563 | 3300005333 | Bacteria | 1122 |
| 56 | Ga0070677_10379468 | 3300005333 | Bacteria | 740 |
| 57 | Ga0070677_10500380 | 3300005333 | Bacteria | 658 |
| 58 | Ga0068869_100058329 | 3300005334 | Bacteria | 2822 |
| 59 | Ga0068869_100646122 | 3300005334 | Bacteria | 898 |
| 60 | Ga0068869_101210580 | 3300005334 | Bacteria | 664 |
| 61 | Ga0068869_101740734 | 3300005334 | Bacteria | 557 |
| 62 | Ga0070666_10003654 | 3300005335 | Bacteria | 9323 |
| 63 | Ga0070666_10005053 | 3300005335 | Bacteria | 8069 |
| 64 | Ga0070666_10005266 | 3300005335 | Bacteria | 7926 |
| 65 | Ga0070680_100021168 | 3300005336 | Bacteria | 5167 |
| 66 | Ga0070680_100075010 | 3300005336 | Bacteria | 2784 |
| 67 | Ga0070680_101381494 | 3300005336 | Bacteria | 610 |
| 68 | Ga0070682_100366538 | 3300005337 | Bacteria | 1079 |
| 69 | Ga0068868_100001028 | 3300005338 | Bacteria | 19079 |
| 70 | Ga0068868_100313646 | 3300005338 | Bacteria | 1335 |
| 71 | Ga0068868_100661690 | 3300005338 | Bacteria | 931 |
| 72 | Ga0068868_101195922 | 3300005338 | Bacteria | 703 |
| 73 | Ga0070660_100438171 | 3300005339 | Bacteria | 1083 |
| 74 | Ga0070660_100804856 | 3300005339 | Bacteria | 790 |
| 75 | Ga0070660_101608049 | 3300005339 | Bacteria | 553 |
| 76 | Ga0070689_100002054 | 3300005340 | Bacteria | 13071 |
| 77 | Ga0070689_100045528 | 3300005340 | Bacteria | 3379 |
| 78 | Ga0070689_100230457 | 3300005340 | Bacteria | 1522 |
| 79 | Ga0070689_100658192 | 3300005340 | Bacteria | 912 |
| 80 | Ga0070689_101011139 | 3300005340 | Bacteria | 740 |
| 81 | Ga0070689_101360385 | 3300005340 | Bacteria | 641 |
| 82 | Ga0070687_100161025 | 3300005343 | Bacteria | 1326 |
| 83 | Ga0070687_101181569 | 3300005343 | Bacteria | 563 |
| 84 | Ga0070661_100020048 | 3300005344 | Bacteria | 4766 |
| 85 | Ga0070661_100311536 | 3300005344 | Bacteria | 1227 |
| 86 | Ga0070661_100870899 | 3300005344 | Bacteria | 742 |
| 87 | Ga0070661_101040801 | 3300005344 | Bacteria | 680 |
| 88 | Ga0070692_11093151 | 3300005345 | Bacteria | 562 |
| 89 | Ga0070668_100004204 | 3300005347 | Bacteria | 10673 |
| 90 | Ga0070668_100059222 | 3300005347 | Bacteria | 2964 |
| 91 | Ga0070668_100442266 | 3300005347 | Bacteria | 1116 |
| 92 | Ga0070668_100483779 | 3300005347 | Bacteria | 1069 |
| 93 | Ga0070668_100527611 | 3300005347 | Bacteria | 1025 |
| 94 | Ga0070668_100573253 | 3300005347 | Bacteria | 984 |
| 95 | Ga0070668_101316589 | 3300005347 | Bacteria | 657 |
| 96 | Ga0070668_101458564 | 3300005347 | Bacteria | 625 |
| 97 | Ga0070669_100008000 | 3300005353 | Bacteria | 7551 |
| 98 | Ga0070669_100035511 | 3300005353 | Bacteria | 3612 |
| 99 | Ga0070669_100365896 | 3300005353 | Bacteria | 1173 |
| 100 | Ga0070669_100495557 | 3300005353 | Bacteria | 1013 |
| 101 | Ga0070669_101907033 | 3300005353 | Bacteria | 519 |
| 102 | Ga0070675_100002408 | 3300005354 | Bacteria | 13959 |
| 103 | Ga0070675_100132674 | 3300005354 | Bacteria | 2123 |
| 104 | Ga0070675_100211012 | 3300005354 | Bacteria | 1688 |
| 105 | Ga0070675_100761328 | 3300005354 | Bacteria | 884 |
| 106 | Ga0070675_100964261 | 3300005354 | Bacteria | 782 |
| 107 | Ga0070671_100000044 | 3300005355 | Bacteria | 86204 |
| 108 | Ga0070671_100012205 | 3300005355 | Bacteria | 6913 |
| 109 | Ga0070671_100020242 | 3300005355 | Bacteria | 5424 |
| 110 | Ga0070671_100109424 | 3300005355 | Bacteria | 2321 |
| 111 | Ga0070671_100246287 | 3300005355 | Bacteria | 1518 |
| 112 | Ga0070671_100252344 | 3300005355 | Bacteria | 1499 |
| 113 | Ga0070671_100304997 | 3300005355 | Bacteria | 1356 |
| 114 | Ga0070671_100314450 | 3300005355 | Bacteria | 1334 |
| 115 | Ga0070671_100493664 | 3300005355 | Bacteria | 1053 |
| 116 | Ga0070671_100553871 | 3300005355 | Bacteria | 992 |
| 117 | Ga0070671_101027822 | 3300005355 | Bacteria | 723 |
| 118 | Ga0070674_100014412 | 3300005356 | Bacteria | 4916 |
| 119 | Ga0070674_100053212 | 3300005356 | Bacteria | 2794 |
| 120 | Ga0070674_100321061 | 3300005356 | Bacteria | 1241 |
| 121 | Ga0070674_100375084 | 3300005356 | Bacteria | 1156 |
| 122 | Ga0070674_100668358 | 3300005356 | Bacteria | 885 |
| 123 | Ga0070674_100718574 | 3300005356 | Bacteria | 855 |
| 124 | Ga0070673_100002015 | 3300005364 | Bacteria | 12259 |
| 125 | Ga0070673_100017551 | 3300005364 | Bacteria | 5094 |
| 126 | Ga0070673_100189949 | 3300005364 | Bacteria | 1764 |
| 127 | Ga0070673_100394870 | 3300005364 | Bacteria | 1236 |
| 128 | Ga0070673_100415319 | 3300005364 | Bacteria | 1205 |
| 129 | Ga0070673_100718191 | 3300005364 | Bacteria | 918 |
| 130 | Ga0070673_100784061 | 3300005364 | Bacteria | 879 |
| 131 | Ga0070673_100921324 | 3300005364 | Bacteria | 811 |
| 132 | Ga0070688_100079229 | 3300005365 | Bacteria | 2121 |
| 133 | Ga0070688_100499717 | 3300005365 | Bacteria | 917 |
| 134 | Ga0070688_101305019 | 3300005365 | Bacteria | 586 |
| 135 | Ga0070688_101588166 | 3300005365 | Bacteria | 534 |
| 136 | Ga0070659_100445630 | 3300005366 | Bacteria | 1097 |
| 137 | Ga0070659_100466896 | 3300005366 | Bacteria | 1072 |
| 138 | Ga0070659_100622539 | 3300005366 | Bacteria | 929 |
| 139 | Ga0070659_100931856 | 3300005366 | Bacteria | 760 |
| 140 | Ga0070667_100000708 | 3300005367 | Bacteria | 32130 |
| 141 | Ga0070667_100001356 | 3300005367 | Bacteria | 21951 |
| 142 | Ga0070667_100010392 | 3300005367 | Bacteria | 7684 |
| 143 | Ga0070667_100011492 | 3300005367 | Bacteria | 7321 |
| 144 | Ga0070667_100044454 | 3300005367 | Bacteria | 3731 |
| 145 | Ga0070667_100053057 | 3300005367 | Bacteria | 3422 |
| 146 | Ga0070667_100174704 | 3300005367 | Bacteria | 1898 |
| 147 | Ga0070667_100220658 | 3300005367 | Bacteria | 1687 |
| 148 | Ga0070667_100679270 | 3300005367 | Bacteria | 952 |
| 149 | Ga0070701_10045625 | 3300005438 | Bacteria | 2250 |
| 150 | Ga0070701_10455387 | 3300005438 | Bacteria | 822 |
| 151 | Ga0070711_100023555 | 3300005439 | Bacteria | 4006 |
| 152 | Ga0070705_100523983 | 3300005440 | Bacteria | 904 |
| 153 | Ga0070700_100062062 | 3300005441 | Bacteria | 2360 |
| 154 | Ga0070700_100378742 | 3300005441 | Bacteria | 1058 |
| 155 | Ga0070700_100582930 | 3300005441 | Bacteria | 874 |
| 156 | Ga0070700_100591841 | 3300005441 | Bacteria | 868 |
| 157 | Ga0070694_100312606 | 3300005444 | Bacteria | 1207 |
| 158 | Ga0070708_100247604 | 3300005445 | Bacteria | 1674 |
| 159 | Ga0070663_100042514 | 3300005455 | Bacteria | 3193 |
| 160 | Ga0070663_100138790 | 3300005455 | Bacteria | 1853 |
| 161 | Ga0070663_100354199 | 3300005455 | Bacteria | 1189 |
| 162 | Ga0070663_100416219 | 3300005455 | Bacteria | 1102 |
| 163 | Ga0070678_100003442 | 3300005456 | Bacteria | 8830 |
| 164 | Ga0070678_100059660 | 3300005456 | Bacteria | 2805 |
| 165 | Ga0070678_100155746 | 3300005456 | Bacteria | 1845 |
| 166 | Ga0070678_100192916 | 3300005456 | Bacteria | 1676 |
| 167 | Ga0070678_100543016 | 3300005456 | Bacteria | 1031 |
| 168 | Ga0070678_100585829 | 3300005456 | Bacteria | 994 |
| 169 | Ga0070678_100636243 | 3300005456 | Bacteria | 956 |
| 170 | Ga0070662_100007793 | 3300005457 | Bacteria | 6957 |
| 171 | Ga0070662_100026968 | 3300005457 | Bacteria | 3983 |
| 172 | Ga0070662_100049235 | 3300005457 | Bacteria | 3038 |
| 173 | Ga0070662_100275954 | 3300005457 | Bacteria | 1359 |
| 174 | Ga0070662_100288620 | 3300005457 | Bacteria | 1329 |
| 175 | Ga0070662_100325760 | 3300005457 | Bacteria | 1254 |
| 176 | Ga0070662_100392451 | 3300005457 | Bacteria | 1144 |
| 177 | Ga0070662_100648410 | 3300005457 | Bacteria | 890 |
| 178 | Ga0070681_10009145 | 3300005458 | Bacteria | 9735 |
| 179 | Ga0070681_10235743 | 3300005458 | Bacteria | 1744 |
| 180 | Ga0068867_100006852 | 3300005459 | Bacteria | 8058 |
| 181 | Ga0068867_100010539 | 3300005459 | Bacteria | 6522 |
| 182 | Ga0068867_100020738 | 3300005459 | Bacteria | 4685 |
| 183 | Ga0068867_100194070 | 3300005459 | Bacteria | 1622 |
| 184 | Ga0068867_100278550 | 3300005459 | Bacteria | 1371 |
| 185 | Ga0068867_100451275 | 3300005459 | Bacteria | 1096 |
| 186 | Ga0068867_100511535 | 3300005459 | Bacteria | 1034 |
| 187 | Ga0070685_10093186 | 3300005466 | Bacteria | 1826 |
| 188 | Ga0070685_10131177 | 3300005466 | Bacteria | 1567 |
| 189 | Ga0070685_10244490 | 3300005466 | Bacteria | 1186 |
| 190 | Ga0070685_10499751 | 3300005466 | Bacteria | 860 |
| 191 | Ga0070685_10882300 | 3300005466 | Bacteria | 664 |
| 192 | Ga0070707_100718458 | 3300005468 | Bacteria | 962 |
| 193 | Ga0070679_100030083 | 3300005530 | Bacteria | 5359 |
| 194 | Ga0070684_100030247 | 3300005535 | Bacteria | 4599 |
| 195 | Ga0070684_100381892 | 3300005535 | Bacteria | 1297 |
| 196 | Ga0070684_100671024 | 3300005535 | Bacteria | 965 |
| 197 | Ga0068853_100346198 | 3300005539 | Bacteria | 1382 |
| 198 | Ga0070672_100000257 | 3300005543 | Bacteria | 30081 |
| 199 | Ga0070672_100129026 | 3300005543 | Bacteria | 2076 |
| 200 | Ga0070672_100164309 | 3300005543 | Bacteria | 1843 |
| 201 | Ga0070672_100179730 | 3300005543 | Bacteria | 1763 |
| 202 | Ga0070672_100964296 | 3300005543 | Bacteria | 755 |
| 203 | Ga0070672_100996118 | 3300005543 | Bacteria | 742 |
| 204 | Ga0070686_100017496 | 3300005544 | Bacteria | 4190 |
| 205 | Ga0070686_100017565 | 3300005544 | Bacteria | 4182 |
| 206 | Ga0070686_100141531 | 3300005544 | Bacteria | 1675 |
| 207 | Ga0070686_101514287 | 3300005544 | Bacteria | 566 |
| 208 | Ga0070693_100232265 | 3300005547 | Bacteria | 1214 |
| 209 | Ga0070693_100781224 | 3300005547 | Bacteria | 706 |
| 210 | Ga0070665_100000176 | 3300005548 | Bacteria | 113398 |
| 211 | Ga0070665_100203644 | 3300005548 | Bacteria | 1979 |
| 212 | Ga0070665_100730008 | 3300005548 | Bacteria | 1004 |
| 213 | Ga0070665_101767116 | 3300005548 | Bacteria | 625 |
| 214 | Ga0070665_101840637 | 3300005548 | Bacteria | 611 |
| 215 | Ga0070704_100333107 | 3300005549 | Bacteria | 1276 |
| 216 | Ga0070704_100386867 | 3300005549 | Bacteria | 1190 |
| 217 | Ga0070704_101179376 | 3300005549 | Bacteria | 698 |
| 218 | Ga0070704_101971345 | 3300005549 | Bacteria | 542 |
| 219 | Ga0068855_100006465 | 3300005563 | Bacteria | 14259 |
| 220 | Ga0068855_100568881 | 3300005563 | Bacteria | 1225 |
| 221 | Ga0070664_100018748 | 3300005564 | Bacteria | 5691 |
| 222 | Ga0070664_100034095 | 3300005564 | Bacteria | 4269 |
| 223 | Ga0070664_100055809 | 3300005564 | Bacteria | 3356 |
| 224 | Ga0070664_100085823 | 3300005564 | Bacteria | 2719 |
| 225 | Ga0070664_100093667 | 3300005564 | Bacteria | 2603 |
| 226 | Ga0070664_100203642 | 3300005564 | Bacteria | 1767 |
| 227 | Ga0070664_100205438 | 3300005564 | Bacteria | 1759 |
| 228 | Ga0070664_100443544 | 3300005564 | Bacteria | 1191 |
| 229 | Ga0068857_100007255 | 3300005577 | Bacteria | 9544 |
| 230 | Ga0068857_100356947 | 3300005577 | Bacteria | 1354 |
| 231 | Ga0068857_101795431 | 3300005577 | Bacteria | 600 |
| 232 | Ga0068854_100170399 | 3300005578 | Bacteria | 1694 |
| 233 | Ga0068854_100245764 | 3300005578 | Bacteria | 1427 |
| 234 | Ga0068854_100390034 | 3300005578 | Bacteria | 1150 |
| 235 | Ga0068856_100002512 | 3300005614 | Bacteria | 18891 |
| 236 | Ga0068856_100461730 | 3300005614 | Bacteria | 1291 |
| 237 | Ga0070702_100023624 | 3300005615 | Bacteria | 3270 |
| 238 | Ga0070702_100509795 | 3300005615 | Bacteria | 885 |
| 239 | Ga0068852_100200031 | 3300005616 | Bacteria | 1890 |
| 240 | Ga0068852_100229830 | 3300005616 | Bacteria | 1768 |
| 241 | Ga0068852_100368931 | 3300005616 | Bacteria | 1406 |
| 242 | Ga0068852_100431861 | 3300005616 | Bacteria | 1301 |
| 243 | Ga0068852_100746178 | 3300005616 | Bacteria | 991 |
| 244 | Ga0068859_100003821 | 3300005617 | Bacteria | 15382 |
| 245 | Ga0068859_100004139 | 3300005617 | Bacteria | 14808 |
| 246 | Ga0068859_100015467 | 3300005617 | Bacteria | 7665 |
| 247 | Ga0068859_100048360 | 3300005617 | Bacteria | 4273 |
| 248 | Ga0068859_101074221 | 3300005617 | Bacteria | 885 |
| 249 | Ga0068859_101256686 | 3300005617 | Bacteria | 816 |
| 250 | Ga0068859_102393699 | 3300005617 | Bacteria | 582 |
| 251 | Ga0068864_100000318 | 3300005618 | Bacteria | 42460 |
| 252 | Ga0068864_100001446 | 3300005618 | Bacteria | 19579 |
| 253 | Ga0068864_100161343 | 3300005618 | Bacteria | 2038 |
| 254 | Ga0068864_100505888 | 3300005618 | Bacteria | 1163 |
| 255 | Ga0068864_100841021 | 3300005618 | Bacteria | 904 |
| 256 | Ga0068864_101537811 | 3300005618 | Bacteria | 669 |
| 257 | Ga0068864_102026604 | 3300005618 | Bacteria | 582 |
| 258 | Ga0068866_10067940 | 3300005718 | Bacteria | 1873 |
| 259 | Ga0068866_10544798 | 3300005718 | Bacteria | 775 |
| 260 | Ga0068866_10667186 | 3300005718 | Bacteria | 710 |
| 261 | Ga0068866_10718958 | 3300005718 | Bacteria | 687 |
| 262 | Ga0068861_100016912 | 3300005719 | Bacteria | 5170 |
| 263 | Ga0068861_100099307 | 3300005719 | Bacteria | 2312 |
| 264 | Ga0068861_100101827 | 3300005719 | Bacteria | 2285 |
| 265 | Ga0068861_100143840 | 3300005719 | Bacteria | 1949 |
| 266 | Ga0068861_100310284 | 3300005719 | Bacteria | 1370 |
| 267 | Ga0068851_10089185 | 3300005834 | Bacteria | 1622 |
| 268 | Ga0068851_10609614 | 3300005834 | Bacteria | 665 |
| 269 | Ga0068870_10057911 | 3300005840 | Bacteria | 2073 |
| 270 | Ga0068870_10543450 | 3300005840 | Bacteria | 781 |
| 271 | Ga0068870_10599744 | 3300005840 | Bacteria | 748 |
| 272 | Ga0068870_11242059 | 3300005840 | Bacteria | 541 |
| 273 | Ga0068863_100000507 | 3300005841 | Bacteria | 39658 |
| 274 | Ga0068863_100026485 | 3300005841 | Bacteria | 5531 |
| 275 | Ga0068863_100061840 | 3300005841 | Bacteria | 3541 |
| 276 | Ga0068863_100081182 | 3300005841 | Bacteria | 3072 |
| 277 | Ga0068863_100238679 | 3300005841 | Bacteria | 1754 |
| 278 | Ga0068863_100269124 | 3300005841 | Bacteria | 1649 |
| 279 | Ga0068863_100689995 | 3300005841 | Bacteria | 1014 |
| 280 | Ga0068863_100752156 | 3300005841 | Bacteria | 971 |
| 281 | Ga0068863_101526968 | 3300005841 | Bacteria | 677 |
| 282 | Ga0068863_101550799 | 3300005841 | Bacteria | 671 |
| 283 | Ga0068858_100000774 | 3300005842 | Bacteria | 33365 |
| 284 | Ga0068858_100005599 | 3300005842 | Bacteria | 12287 |
| 285 | Ga0068858_100025183 | 3300005842 | Bacteria | 5537 |
| 286 | Ga0068858_100036108 | 3300005842 | Bacteria | 4582 |
| 287 | Ga0068858_100134912 | 3300005842 | Bacteria | 2316 |
| 288 | Ga0068858_101586275 | 3300005842 | Bacteria | 646 |
| 289 | Ga0068860_100014942 | 3300005843 | Bacteria | 7590 |
| 290 | Ga0068860_100094195 | 3300005843 | Bacteria | 2854 |
| 291 | Ga0068860_100098740 | 3300005843 | Bacteria | 2784 |
| 292 | Ga0068860_102388193 | 3300005843 | Bacteria | 549 |
| 293 | Ga0068862_100000837 | 3300005844 | Bacteria | 30443 |
| 294 | Ga0068862_100004861 | 3300005844 | Bacteria | 11312 |
| 295 | Ga0068862_100034683 | 3300005844 | Bacteria | 4271 |
| 296 | Ga0068862_100104541 | 3300005844 | Bacteria | 2481 |
| 297 | Ga0068862_100175575 | 3300005844 | Bacteria | 1920 |
| 298 | Ga0068862_100771972 | 3300005844 | Bacteria | 936 |
| 299 | Ga0068862_100928370 | 3300005844 | Bacteria | 857 |
| 300 | Ga0081455_10002344 | 3300005937 | Bacteria | 22600 |
| 301 | Ga0081455_10104070 | 3300005937 | Bacteria | 2271 |
| 302 | Ga0081538_10049157 | 3300005981 | Bacteria | 2561 |
| 303 | Ga0081539_10085913 | 3300005985 | Bacteria | 1639 |
| 304 | Ga0081539_10227273 | 3300005985 | Bacteria | 845 |
| 305 | Ga0075365_10173499 | 3300006038 | Bacteria | 1506 |
| 306 | Ga0075365_10174274 | 3300006038 | Bacteria | 1502 |
| 307 | Ga0075365_10181297 | 3300006038 | Bacteria | 1472 |
| 308 | Ga0075365_10189645 | 3300006038 | Bacteria | 1439 |
| 309 | Ga0075365_10957175 | 3300006038 | Bacteria | 603 |
| 310 | Ga0075368_10047802 | 3300006042 | Bacteria | 1694 |
| 311 | Ga0075368_10295813 | 3300006042 | Bacteria | 698 |
| 312 | Ga0075363_100003696 | 3300006048 | Bacteria | 6579 |
| 313 | Ga0075363_100011596 | 3300006048 | Bacteria | 4225 |
| 314 | Ga0075363_100011622 | 3300006048 | Bacteria | 4220 |
| 315 | Ga0075363_100020319 | 3300006048 | Bacteria | 3329 |
| 316 | Ga0075363_100034884 | 3300006048 | Bacteria | 2629 |
| 317 | Ga0075363_100146803 | 3300006048 | Bacteria | 1330 |
| 318 | Ga0075364_10036942 | 3300006051 | Bacteria | 3160 |
| 319 | Ga0075364_10209189 | 3300006051 | Bacteria | 1323 |
| 320 | Ga0075432_10023807 | 3300006058 | Bacteria | 2098 |
| 321 | Ga0075362_10004570 | 3300006177 | Bacteria | 4988 |
| 322 | Ga0075362_10009462 | 3300006177 | Bacteria | 3770 |
| 323 | Ga0075362_10011745 | 3300006177 | Bacteria | 3456 |
| 324 | Ga0075362_10056843 | 3300006177 | Bacteria | 1762 |
| 325 | Ga0075362_10098789 | 3300006177 | Bacteria | 1363 |
| 326 | Ga0075362_10198355 | 3300006177 | Bacteria | 976 |
| 327 | Ga0075367_10009821 | 3300006178 | Bacteria | 5015 |
| 328 | Ga0075367_10104037 | 3300006178 | Bacteria | 1738 |
| 329 | Ga0075367_10133780 | 3300006178 | Bacteria | 1534 |
| 330 | Ga0075367_10211778 | 3300006178 | Bacteria | 1212 |
| 331 | Ga0075367_10217941 | 3300006178 | Bacteria | 1194 |
| 332 | Ga0075367_10735713 | 3300006178 | Bacteria | 628 |
| 333 | Ga0075369_10019712 | 3300006186 | Bacteria | 2756 |
| 334 | Ga0075369_10222392 | 3300006186 | Bacteria | 874 |
| 335 | Ga0075366_10000689 | 3300006195 | Bacteria | 15998 |
| 336 | Ga0075366_10004381 | 3300006195 | Bacteria | 7576 |
| 337 | Ga0075366_10010042 | 3300006195 | Bacteria | 5305 |
| 338 | Ga0075366_10015818 | 3300006195 | Bacteria | 4332 |
| 339 | Ga0075366_10028399 | 3300006195 | Bacteria | 3283 |
| 340 | Ga0075366_10062491 | 3300006195 | Bacteria | 2213 |
| 341 | Ga0075366_10074050 | 3300006195 | Bacteria | 2030 |
| 342 | Ga0075366_10099983 | 3300006195 | Bacteria | 1740 |
| 343 | Ga0075366_10776752 | 3300006195 | Bacteria | 596 |
| 344 | Ga0075366_10953136 | 3300006195 | Bacteria | 535 |
| 345 | Ga0075366_11029513 | 3300006195 | Bacteria | 514 |
| 346 | Ga0097621_100027531 | 3300006237 | Bacteria | 4471 |
| 347 | Ga0097621_100214164 | 3300006237 | Bacteria | 1677 |
| 348 | Ga0097621_100352323 | 3300006237 | Bacteria | 1309 |
| 349 | Ga0097621_100710393 | 3300006237 | Bacteria | 926 |
| 350 | Ga0097621_101308900 | 3300006237 | Bacteria | 684 |
| 351 | Ga0097621_101903232 | 3300006237 | Bacteria | 568 |
| 352 | Ga0075370_10006289 | 3300006353 | Bacteria | 5962 |
| 353 | Ga0075370_10014688 | 3300006353 | Bacteria | 4181 |
| 354 | Ga0075370_10169646 | 3300006353 | Bacteria | 1282 |
| 355 | Ga0075370_10490162 | 3300006353 | Bacteria | 741 |
| 356 | Ga0075370_10746227 | 3300006353 | Bacteria | 596 |
| 357 | Ga0068871_100072625 | 3300006358 | Bacteria | 2834 |
| 358 | Ga0068871_100081581 | 3300006358 | Bacteria | 2680 |
| 359 | Ga0068871_100108479 | 3300006358 | Bacteria | 2333 |
| 360 | Ga0068871_100807603 | 3300006358 | Bacteria | 865 |
| 361 | Ga0068871_101024542 | 3300006358 | Bacteria | 769 |
| 362 | Ga0075428_100023230 | 3300006844 | Bacteria | 6858 |
| 363 | Ga0075428_100823553 | 3300006844 | Bacteria | 986 |
| 364 | Ga0075428_101030466 | 3300006844 | Bacteria | 871 |
| 365 | Ga0075428_101567842 | 3300006844 | Bacteria | 689 |
| 366 | Ga0075428_102383532 | 3300006844 | Bacteria | 544 |
| 367 | Ga0075430_100073642 | 3300006846 | Bacteria | 2864 |
| 368 | Ga0075433_10337117 | 3300006852 | Bacteria | 1333 |
| 369 | Ga0075433_11548766 | 3300006852 | Bacteria | 572 |
| 370 | Ga0075434_100319984 | 3300006871 | Bacteria | 1572 |
| 371 | Ga0068865_100064014 | 3300006881 | Bacteria | 2587 |
| 372 | Ga0068865_100137683 | 3300006881 | Bacteria | 1837 |
| 373 | Ga0068865_100234537 | 3300006881 | Bacteria | 1441 |
| 374 | Ga0068865_100241701 | 3300006881 | Bacteria | 1421 |
| 375 | Ga0068865_100341875 | 3300006881 | Bacteria | 1210 |
| 376 | Ga0068865_100402356 | 3300006881 | Bacteria | 1122 |
| 377 | Ga0068865_100769941 | 3300006881 | Bacteria | 828 |
| 378 | Ga0068865_100918610 | 3300006881 | Bacteria | 762 |
| 379 | Ga0097620_100003821 | 3300006931 | Bacteria | 15382 |
| 380 | Ga0097620_100004139 | 3300006931 | Bacteria | 14808 |
| 381 | Ga0097620_100015469 | 3300006931 | Bacteria | 7665 |
| 382 | Ga0097620_100048358 | 3300006931 | Bacteria | 4273 |
| 383 | Ga0097620_101074217 | 3300006931 | Bacteria | 885 |
| 384 | Ga0097620_101256553 | 3300006931 | Bacteria | 816 |
| 385 | Ga0097620_102393307 | 3300006931 | Bacteria | 582 |
| 386 | Ga0079104_1000007 | 3300006946 | Bacteria | 390531 |
| 387 | Ga0079104_1000328 | 3300006946 | Bacteria | 58129 |
| 388 | Ga0079104_1035251 | 3300006946 | Bacteria | 1209 |
| 389 | Ga0105251_10034197 | 3300009011 | Bacteria | 2518 |
| 390 | Ga0105251_10338706 | 3300009011 | Bacteria | 685 |
| 391 | Ga0105244_10005755 | 3300009036 | Bacteria | 8172 |
| 392 | Ga0105240_10007401 | 3300009093 | Bacteria | 15960 |
| 393 | Ga0105240_10051415 | 3300009093 | Bacteria | 5184 |
| 394 | Ga0105240_10068040 | 3300009093 | Bacteria | 4412 |
| 395 | Ga0105240_10263172 | 3300009093 | Bacteria | 1989 |
| 396 | Ga0105240_10266723 | 3300009093 | Bacteria | 1973 |
| 397 | Ga0105240_10532134 | 3300009093 | Bacteria | 1303 |
| 398 | Ga0105240_10562624 | 3300009093 | Bacteria | 1260 |
| 399 | Ga0105240_12041303 | 3300009093 | Bacteria | 596 |
| 400 | Ga0111539_10020185 | 3300009094 | Bacteria | 8212 |
| 401 | Ga0111539_10028960 | 3300009094 | Bacteria | 6754 |
| 402 | Ga0111539_10029107 | 3300009094 | Bacteria | 6735 |
| 403 | Ga0111539_10056854 | 3300009094 | Bacteria | 4649 |
| 404 | Ga0111539_10493667 | 3300009094 | Bacteria | 1426 |
| 405 | Ga0111539_10498702 | 3300009094 | Bacteria | 1418 |
| 406 | Ga0111539_10688131 | 3300009094 | Bacteria | 1190 |
| 407 | Ga0111539_12763341 | 3300009094 | Bacteria | 569 |
| 408 | Ga0105245_10002284 | 3300009098 | Bacteria | 17345 |
| 409 | Ga0105245_10009930 | 3300009098 | Bacteria | 8293 |
| 410 | Ga0105245_10150360 | 3300009098 | Bacteria | 2201 |
| 411 | Ga0105245_10534083 | 3300009098 | Bacteria | 1193 |
| 412 | Ga0105245_10819385 | 3300009098 | Bacteria | 969 |
| 413 | Ga0105245_11012952 | 3300009098 | Bacteria | 875 |
| 414 | Ga0105247_10031819 | 3300009101 | Bacteria | 3203 |
| 415 | Ga0105247_11035539 | 3300009101 | Bacteria | 643 |
| 416 | Ga0114129_10826805 | 3300009147 | Bacteria | 1179 |
| 417 | Ga0114129_11018182 | 3300009147 | Bacteria | 1042 |
| 418 | Ga0105243_10005465 | 3300009148 | Bacteria | 9912 |
| 419 | Ga0105243_10021175 | 3300009148 | Bacteria | 4934 |
| 420 | Ga0105243_10066031 | 3300009148 | Bacteria | 2909 |
| 421 | Ga0105243_10183927 | 3300009148 | Bacteria | 1820 |
| 422 | Ga0105243_10434969 | 3300009148 | Bacteria | 1227 |
| 423 | Ga0105243_11419139 | 3300009148 | Bacteria | 715 |
| 424 | Ga0105241_10025680 | 3300009174 | Bacteria | 4378 |
| 425 | Ga0105241_10076330 | 3300009174 | Bacteria | 2613 |
| 426 | Ga0105241_10408763 | 3300009174 | Bacteria | 1192 |
| 427 | Ga0105242_10084172 | 3300009176 | Bacteria | 2665 |
| 428 | Ga0105242_10257763 | 3300009176 | Bacteria | 1574 |
| 429 | Ga0105248_10000901 | 3300009177 | Bacteria | 33234 |
| 430 | Ga0105248_10013005 | 3300009177 | Bacteria | 9173 |
| 431 | Ga0105248_10019352 | 3300009177 | Bacteria | 7533 |
| 432 | Ga0105248_10034099 | 3300009177 | Bacteria | 5690 |
| 433 | Ga0105248_10274971 | 3300009177 | Unclassified | 1896 |
| 434 | Ga0105248_10590872 | 3300009177 | Bacteria | 1253 |
| 435 | Ga0105248_10707785 | 3300009177 | Bacteria | 1136 |
| 436 | Ga0105248_10774000 | 3300009177 | Bacteria | 1083 |
| 437 | Ga0105248_10792820 | 3300009177 | Bacteria | 1069 |
| 438 | Ga0105237_10036837 | 3300009545 | Bacteria | 4948 |
| 439 | Ga0105238_10091658 | 3300009551 | Bacteria | 3026 |
| 440 | Ga0105238_10550871 | 3300009551 | Bacteria | 1158 |
| 441 | Ga0105238_10561091 | 3300009551 | Bacteria | 1147 |
| 442 | Ga0105238_10950062 | 3300009551 | Bacteria | 879 |
| 443 | Ga0105249_10041313 | 3300009553 | Bacteria | 4192 |
| 444 | Ga0105249_10082716 | 3300009553 | Bacteria | 2987 |
| 445 | Ga0105249_10161627 | 3300009553 | Bacteria | 2165 |
| 446 | Ga0105249_10321811 | 3300009553 | Bacteria | 1558 |
| 447 | Ga0105249_11012623 | 3300009553 | Bacteria | 900 |
| 448 | Ga0105249_11074378 | 3300009553 | Bacteria | 875 |
| 449 | Ga0105249_11146707 | 3300009553 | Bacteria | 848 |
| 450 | Ga0105249_12477495 | 3300009553 | Bacteria | 591 |
| 451 | Ga0105239_10413081 | 3300010375 | Bacteria | 1528 |
| 452 | Ga0105239_11568414 | 3300010375 | Bacteria | 761 |
| 453 | Ga0105239_13550627 | 3300010375 | Bacteria | 507 |
| 454 | Ga0105246_10085296 | 3300011119 | Bacteria | 2261 |
| 455 | Ga0105246_10162659 | 3300011119 | Bacteria | 1701 |
| 456 | Ga0105246_10169905 | 3300011119 | Bacteria | 1669 |
| 457 | Ga0105246_11033510 | 3300011119 | Bacteria | 746 |
| 458 | Ga0157371_10192728 | 3300013102 | Bacteria | 1460 |
| 459 | Ga0157370_10044109 | 3300013104 | Bacteria | 4288 |
| 460 | Ga0157370_10072734 | 3300013104 | Bacteria | 3243 |
| 461 | Ga0157370_10882273 | 3300013104 | Bacteria | 812 |
| 462 | Ga0157370_11696108 | 3300013104 | Bacteria | 567 |
| 463 | Ga0157369_10000602 | 3300013105 | Bacteria | 46869 |
| 464 | Ga0157369_10023131 | 3300013105 | Bacteria | 6924 |
| 465 | Ga0157369_10162240 | 3300013105 | Bacteria | 2359 |
| 466 | Ga0157369_10329807 | 3300013105 | Bacteria | 1586 |
| 467 | Ga0157369_12075546 | 3300013105 | Bacteria | 576 |
| 468 | Ga0157374_10203428 | 3300013296 | Bacteria | 1939 |
| 469 | Ga0157374_10346348 | 3300013296 | Bacteria | 1476 |
| 470 | Ga0157374_10453679 | 3300013296 | Bacteria | 1284 |
| 471 | Ga0157374_10627225 | 3300013296 | Bacteria | 1086 |
| 472 | Ga0157374_11009373 | 3300013296 | Bacteria | 851 |
| 473 | Ga0157378_10001784 | 3300013297 | Bacteria | 19323 |
| 474 | Ga0157378_10099364 | 3300013297 | Bacteria | 2655 |
| 475 | Ga0157378_10336468 | 3300013297 | Bacteria | 1471 |
| 476 | Ga0157378_10400406 | 3300013297 | Bacteria | 1352 |
| 477 | Ga0157378_10598955 | 3300013297 | Bacteria | 1113 |
| 478 | Ga0157378_10715141 | 3300013297 | Bacteria | 1022 |
| 479 | Ga0157378_10807732 | 3300013297 | Bacteria | 964 |
| 480 | Ga0157378_12623690 | 3300013297 | Bacteria | 556 |
| 481 | Ga0163162_10000204 | 3300013306 | Bacteria | 54853 |
| 482 | Ga0163162_10000297 | 3300013306 | Bacteria | 45730 |
| 483 | Ga0163162_10112784 | 3300013306 | Bacteria | 2817 |
| 484 | Ga0163162_10113651 | 3300013306 | Bacteria | 2806 |
| 485 | Ga0163162_10186666 | 3300013306 | Bacteria | 2200 |
| 486 | Ga0163162_10508603 | 3300013306 | Bacteria | 1335 |
| 487 | Ga0163162_10715786 | 3300013306 | Bacteria | 1122 |
| 488 | Ga0163162_10796738 | 3300013306 | Bacteria | 1062 |
| 489 | Ga0163162_10910164 | 3300013306 | Bacteria | 992 |
| 490 | Ga0163162_12481903 | 3300013306 | Bacteria | 596 |
| 491 | Ga0157372_10325667 | 3300013307 | Bacteria | 1789 |
| 492 | Ga0157372_10464004 | 3300013307 | Bacteria | 1476 |
| 493 | Ga0157372_10554272 | 3300013307 | Bacteria | 1340 |
| 494 | Ga0157372_12263872 | 3300013307 | Bacteria | 624 |
| 495 | Ga0157375_10001119 | 3300013308 | Bacteria | 23247 |
| 496 | Ga0157375_10005543 | 3300013308 | Bacteria | 10980 |
| 497 | Ga0157375_10045314 | 3300013308 | Bacteria | 4280 |
| 498 | Ga0157375_10073202 | 3300013308 | Bacteria | 3445 |
| 499 | Ga0157375_10075281 | 3300013308 | Bacteria | 3400 |
| 500 | Ga0157375_10305261 | 3300013308 | Bacteria | 1755 |
| 501 | Ga0157375_10449430 | 3300013308 | Bacteria | 1454 |
| 502 | Ga0157375_12782199 | 3300013308 | Bacteria | 585 |
| 503 | Ga0163163_10004109 | 3300014325 | Bacteria | 12412 |
| 504 | Ga0163163_10082610 | 3300014325 | Bacteria | 3217 |
| 505 | Ga0163163_10530945 | 3300014325 | Bacteria | 1239 |
| 506 | Ga0163163_10563215 | 3300014325 | Bacteria | 1202 |
| 507 | Ga0163163_11228855 | 3300014325 | Bacteria | 812 |
| 508 | Ga0163163_11232236 | 3300014325 | Bacteria | 811 |
| 509 | Ga0163163_11948267 | 3300014325 | Bacteria | 647 |
| 510 | Ga0163163_13010961 | 3300014325 | Bacteria | 526 |
| 511 | Ga0157380_10034310 | 3300014326 | Bacteria | 3913 |
| 512 | Ga0157380_10144616 | 3300014326 | Bacteria | 2047 |
| 513 | Ga0157380_10353500 | 3300014326 | Bacteria | 1376 |
| 514 | Ga0157380_10967510 | 3300014326 | Bacteria | 882 |
| 515 | Ga0157380_11474836 | 3300014326 | Bacteria | 733 |
| 516 | Ga0157380_11535095 | 3300014326 | Bacteria | 720 |
| 517 | Ga0157380_11713249 | 3300014326 | Bacteria | 686 |
| 518 | Ga0182008_10018727 | 3300014497 | Bacteria | 3584 |
| 519 | Ga0182008_10050371 | 3300014497 | Bacteria | 2067 |
| 520 | Ga0182008_10098655 | 3300014497 | Bacteria | 1443 |
| 521 | Ga0182008_10111392 | 3300014497 | Bacteria | 1356 |
| 522 | Ga0157377_11041297 | 3300014745 | Bacteria | 623 |
| 523 | Ga0157379_10001453 | 3300014968 | Bacteria | 19486 |
| 524 | Ga0157379_10002672 | 3300014968 | Bacteria | 15018 |
| 525 | Ga0157379_10009921 | 3300014968 | Bacteria | 8294 |
| 526 | Ga0157379_10217391 | 3300014968 | Bacteria | 1731 |
| 527 | Ga0157379_10822840 | 3300014968 | Bacteria | 877 |
| 528 | Ga0157379_10887760 | 3300014968 | Bacteria | 845 |
| 529 | Ga0157376_10003212 | 3300014969 | Bacteria | 11247 |
| 530 | Ga0157376_10015114 | 3300014969 | Bacteria | 5819 |
| 531 | Ga0157376_10138950 | 3300014969 | Bacteria | 2177 |
| 532 | Ga0157376_10232185 | 3300014969 | Bacteria | 1714 |
| 533 | Ga0157376_10380523 | 3300014969 | Bacteria | 1359 |
| 534 | Ga0157376_10627043 | 3300014969 | Bacteria | 1073 |
| 535 | Ga0157376_10658432 | 3300014969 | Bacteria | 1048 |
| 536 | Ga0157376_11033266 | 3300014969 | Bacteria | 845 |
| 537 | Ga0182006_1026631 | 3300015261 | Bacteria | 2365 |
| 538 | Ga0182007_10000792 | 3300015262 | Bacteria | 17669 |
| 539 | Ga0182007_10001246 | 3300015262 | Bacteria | 13827 |
| 540 | Ga0182007_10031895 | 3300015262 | Bacteria | 1792 |
| 541 | Ga0182007_10075383 | 3300015262 | Bacteria | 1105 |
| 542 | Ga0182007_10145516 | 3300015262 | Bacteria | 803 |
| 543 | Ga0182007_10157393 | 3300015262 | Bacteria | 775 |
| 544 | Ga0182005_1085284 | 3300015265 | Bacteria | 875 |
| 545 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 546 | Ga0163161_10031277 | 3300017792 | Bacteria | 3791 |
| 547 | Ga0163161_10068966 | 3300017792 | Bacteria | 2584 |
| 548 | Ga0163161_10081853 | 3300017792 | Bacteria | 2378 |
| 549 | Ga0163161_11059143 | 3300017792 | Bacteria | 695 |
| 550 | Ga0163161_11245395 | 3300017792 | Bacteria | 645 |
| 551 | Ga0163161_11875135 | 3300017792 | Bacteria | 533 |
| 552 | Ga0197907_10551622 | 3300020069 | Bacteria | 2157 |
| 553 | Ga0206354_11176714 | 3300020081 | Bacteria | 954 |
| 554 | Ga0206353_10456852 | 3300020082 | Bacteria | 2350 |
| 555 | Ga0213872_10372609 | 3300021361 | Bacteria | 582 |
| 556 | Ga0224712_10000345 | 3300022467 | Bacteria | 8897 |
| 557 | Ga0228598_1012137 | 3300024227 | Bacteria | 1713 |
| 558 | Ga0209435_113861 | 3300025206 | Bacteria | 855 |
| 559 | Ga0209672_100267 | 3300025228 | Bacteria | 38481 |
| 560 | Ga0209672_122263 | 3300025228 | Bacteria | 598 |
| 561 | Ga0209258_119958 | 3300025242 | Bacteria | 706 |
| 562 | Ga0209759_1000120 | 3300025256 | Bacteria | 138967 |
| 563 | Ga0209129_1010485 | 3300025258 | Bacteria | 2306 |
| 564 | Ga0209565_1016199 | 3300025263 | Bacteria | 1663 |
| 565 | Ga0209455_1000449 | 3300025272 | Bacteria | 31628 |
| 566 | Ga0209673_1001396 | 3300025273 | Bacteria | 23530 |
| 567 | Ga0209130_1021741 | 3300025284 | Bacteria | 1443 |
| 568 | Ga0209025_1000394 | 3300025294 | Bacteria | 90347 |
| 569 | Ga0209564_1000027 | 3300025295 | Bacteria | 518458 |
| 570 | Ga0209564_1004085 | 3300025295 | Bacteria | 9200 |
| 571 | Ga0209758_1000045 | 3300025297 | Bacteria | 369174 |
| 572 | Ga0209758_1000252 | 3300025297 | Bacteria | 108214 |
| 573 | Ga0209758_1033518 | 3300025297 | Bacteria | 2060 |
| 574 | Ga0209758_1046589 | 3300025297 | Bacteria | 1561 |
| 575 | Ga0209050_1001032 | 3300025298 | Bacteria | 34539 |
| 576 | Ga0209050_1014128 | 3300025298 | Bacteria | 3470 |
| 577 | Ga0209256_1000120 | 3300025299 | Bacteria | 167691 |
| 578 | Ga0207426_1000018 | 3300025302 | Bacteria | 566740 |
| 579 | Ga0207426_1003365 | 3300025302 | Bacteria | 8775 |
| 580 | Ga0209051_1000018 | 3300025303 | Bacteria | 527061 |
| 581 | Ga0209257_1000260 | 3300025304 | Bacteria | 121653 |
| 582 | Ga0209257_1008085 | 3300025304 | Bacteria | 6119 |
| 583 | Ga0209257_1041875 | 3300025304 | Bacteria | 1356 |
| 584 | Ga0207697_10016505 | 3300025315 | Bacteria | 3041 |
| 585 | Ga0207697_10248339 | 3300025315 | Bacteria | 787 |
| 586 | Ga0207697_10268737 | 3300025315 | Bacteria | 755 |
| 587 | Ga0207656_10131603 | 3300025321 | Bacteria | 1172 |
| 588 | Ga0207655_1007702 | 3300025728 | Bacteria | 6949 |
| 589 | Ga0207713_1000892 | 3300025735 | Bacteria | 27070 |
| 590 | Ga0207713_1016353 | 3300025735 | Bacteria | 3767 |
| 591 | Ga0207682_10001857 | 3300025893 | Bacteria | 9619 |
| 592 | Ga0207682_10008143 | 3300025893 | Bacteria | 4156 |
| 593 | Ga0207682_10060636 | 3300025893 | Bacteria | 1582 |
| 594 | Ga0207642_10258044 | 3300025899 | Bacteria | 992 |
| 595 | Ga0207642_10540183 | 3300025899 | Bacteria | 718 |
| 596 | Ga0207642_10894388 | 3300025899 | Bacteria | 569 |
| 597 | Ga0207710_10319141 | 3300025900 | Bacteria | 787 |
| 598 | Ga0207688_10307397 | 3300025901 | Bacteria | 970 |
| 599 | Ga0207688_10448414 | 3300025901 | Bacteria | 804 |
| 600 | Ga0207688_10468896 | 3300025901 | Bacteria | 786 |
| 601 | Ga0207688_10604182 | 3300025901 | Bacteria | 691 |
| 602 | Ga0207680_10000693 | 3300025903 | Bacteria | 15837 |
| 603 | Ga0207680_10004179 | 3300025903 | Bacteria | 6833 |
| 604 | Ga0207680_10006026 | 3300025903 | Bacteria | 5836 |
| 605 | Ga0207647_10000722 | 3300025904 | Bacteria | 25906 |
| 606 | Ga0207647_10017131 | 3300025904 | Bacteria | 4932 |
| 607 | Ga0207647_10040574 | 3300025904 | Bacteria | 2930 |
| 608 | Ga0207647_10143800 | 3300025904 | Bacteria | 1397 |
| 609 | Ga0207645_10014790 | 3300025907 | Bacteria | 5210 |
| 610 | Ga0207645_10027805 | 3300025907 | Bacteria | 3651 |
| 611 | Ga0207645_10055006 | 3300025907 | Bacteria | 2541 |
| 612 | Ga0207645_10068284 | 3300025907 | Bacteria | 2273 |
| 613 | Ga0207645_10457571 | 3300025907 | Bacteria | 862 |
| 614 | Ga0207643_10018108 | 3300025908 | Bacteria | 3859 |
| 615 | Ga0207643_10550892 | 3300025908 | Bacteria | 740 |
| 616 | Ga0207705_10000980 | 3300025909 | Bacteria | 23325 |
| 617 | Ga0207705_10311432 | 3300025909 | Bacteria | 1209 |
| 618 | Ga0207705_10430846 | 3300025909 | Bacteria | 1022 |
| 619 | Ga0207654_10752926 | 3300025911 | Bacteria | 702 |
| 620 | Ga0207707_10015974 | 3300025912 | Bacteria | 6546 |
| 621 | Ga0207707_10179574 | 3300025912 | Bacteria | 1848 |
| 622 | Ga0207695_10005806 | 3300025913 | Bacteria | 16245 |
| 623 | Ga0207695_10099824 | 3300025913 | Bacteria | 2900 |
| 624 | Ga0207695_10109888 | 3300025913 | Bacteria | 2738 |
| 625 | Ga0207695_10208802 | 3300025913 | Bacteria | 1864 |
| 626 | Ga0207695_10227674 | 3300025913 | Bacteria | 1770 |
| 627 | Ga0207695_10438586 | 3300025913 | Bacteria | 1189 |
| 628 | Ga0207695_10704067 | 3300025913 | Bacteria | 890 |
| 629 | Ga0207671_10124914 | 3300025914 | Bacteria | 1970 |
| 630 | Ga0207660_10356226 | 3300025917 | Bacteria | 1173 |
| 631 | Ga0207662_10080085 | 3300025918 | Bacteria | 1991 |
| 632 | Ga0207657_10122373 | 3300025919 | Bacteria | 2140 |
| 633 | Ga0207657_10406625 | 3300025919 | Bacteria | 1070 |
| 634 | Ga0207657_10604910 | 3300025919 | Bacteria | 855 |
| 635 | Ga0207649_10015454 | 3300025920 | Bacteria | 4289 |
| 636 | Ga0207649_10262173 | 3300025920 | Bacteria | 1249 |
| 637 | Ga0207649_10365202 | 3300025920 | Bacteria | 1072 |
| 638 | Ga0207649_10449884 | 3300025920 | Bacteria | 972 |
| 639 | Ga0207649_11537253 | 3300025920 | Bacteria | 527 |
| 640 | Ga0207652_10247841 | 3300025921 | Bacteria | 1606 |
| 641 | Ga0207652_10344385 | 3300025921 | Bacteria | 1345 |
| 642 | Ga0207646_10673882 | 3300025922 | Bacteria | 926 |
| 643 | Ga0207646_10749262 | 3300025922 | Bacteria | 872 |
| 644 | Ga0207681_10003319 | 3300025923 | Bacteria | 10075 |
| 645 | Ga0207681_10108532 | 3300025923 | Bacteria | 2015 |
| 646 | Ga0207681_10184794 | 3300025923 | Bacteria | 1590 |
| 647 | Ga0207681_10216414 | 3300025923 | Bacteria | 1479 |
| 648 | Ga0207681_10268155 | 3300025923 | Bacteria | 1339 |
| 649 | Ga0207694_10235346 | 3300025924 | Bacteria | 1496 |
| 650 | Ga0207694_10280938 | 3300025924 | Bacteria | 1367 |
| 651 | Ga0207694_10386615 | 3300025924 | Bacteria | 1162 |
| 652 | Ga0207694_10623086 | 3300025924 | Bacteria | 908 |
| 653 | Ga0207650_10016870 | 3300025925 | Bacteria | 5107 |
| 654 | Ga0207650_10064404 | 3300025925 | Bacteria | 2744 |
| 655 | Ga0207650_10077573 | 3300025925 | Bacteria | 2512 |
| 656 | Ga0207650_10395428 | 3300025925 | Bacteria | 1143 |
| 657 | Ga0207650_11191954 | 3300025925 | Bacteria | 648 |
| 658 | Ga0207650_11617279 | 3300025925 | Bacteria | 550 |
| 659 | Ga0207659_10002593 | 3300025926 | Bacteria | 10766 |
| 660 | Ga0207659_10016636 | 3300025926 | Bacteria | 4791 |
| 661 | Ga0207659_10079914 | 3300025926 | Bacteria | 2414 |
| 662 | Ga0207659_10252106 | 3300025926 | Bacteria | 1432 |
| 663 | Ga0207659_10421828 | 3300025926 | Bacteria | 1119 |
| 664 | Ga0207659_10670008 | 3300025926 | Bacteria | 887 |
| 665 | Ga0207659_11670633 | 3300025926 | Bacteria | 543 |
| 666 | Ga0207687_10044264 | 3300025927 | Bacteria | 3071 |
| 667 | Ga0207687_10277079 | 3300025927 | Bacteria | 1343 |
| 668 | Ga0207687_11019872 | 3300025927 | Bacteria | 710 |
| 669 | Ga0207687_11553368 | 3300025927 | Bacteria | 568 |
| 670 | Ga0207700_10928918 | 3300025928 | Bacteria | 779 |
| 671 | Ga0207644_10000080 | 3300025931 | Bacteria | 70312 |
| 672 | Ga0207644_10006260 | 3300025931 | Bacteria | 7754 |
| 673 | Ga0207644_10037806 | 3300025931 | Bacteria | 3398 |
| 674 | Ga0207644_10116955 | 3300025931 | Bacteria | 2024 |
| 675 | Ga0207644_10455384 | 3300025931 | Bacteria | 1051 |
| 676 | Ga0207644_10895232 | 3300025931 | Bacteria | 744 |
| 677 | Ga0207644_10923302 | 3300025931 | Bacteria | 732 |
| 678 | Ga0207690_10416346 | 3300025932 | Bacteria | 1074 |
| 679 | Ga0207706_10005400 | 3300025933 | Bacteria | 11913 |
| 680 | Ga0207706_10018796 | 3300025933 | Bacteria | 6216 |
| 681 | Ga0207706_10022986 | 3300025933 | Bacteria | 5599 |
| 682 | Ga0207706_10028055 | 3300025933 | Bacteria | 5029 |
| 683 | Ga0207706_10080051 | 3300025933 | Bacteria | 2873 |
| 684 | Ga0207706_10963276 | 3300025933 | Bacteria | 718 |
| 685 | Ga0207686_10379724 | 3300025934 | Bacteria | 1071 |
| 686 | Ga0207709_10000112 | 3300025935 | Bacteria | 127357 |
| 687 | Ga0207709_10013548 | 3300025935 | Bacteria | 4497 |
| 688 | Ga0207709_10834727 | 3300025935 | Bacteria | 746 |
| 689 | Ga0207670_10003436 | 3300025936 | Bacteria | 8404 |
| 690 | Ga0207670_10005570 | 3300025936 | Bacteria | 6921 |
| 691 | Ga0207670_10038745 | 3300025936 | Bacteria | 3115 |
| 692 | Ga0207669_10008845 | 3300025937 | Bacteria | 4753 |
| 693 | Ga0207669_10056465 | 3300025937 | Bacteria | 2384 |
| 694 | Ga0207669_10306769 | 3300025937 | Bacteria | 1209 |
| 695 | Ga0207669_10576571 | 3300025937 | Bacteria | 911 |
| 696 | Ga0207704_10011663 | 3300025938 | Bacteria | 4337 |
| 697 | Ga0207704_10097382 | 3300025938 | Bacteria | 1951 |
| 698 | Ga0207704_10125104 | 3300025938 | Bacteria | 1768 |
| 699 | Ga0207704_10339386 | 3300025938 | Bacteria | 1166 |
| 700 | Ga0207704_10353319 | 3300025938 | Bacteria | 1145 |
| 701 | Ga0207704_10497274 | 3300025938 | Bacteria | 982 |
| 702 | Ga0207704_11785862 | 3300025938 | Bacteria | 529 |
| 703 | Ga0207691_10000814 | 3300025940 | Bacteria | 31075 |
| 704 | Ga0207691_10019301 | 3300025940 | Bacteria | 6452 |
| 705 | Ga0207691_10058201 | 3300025940 | Bacteria | 3515 |
| 706 | Ga0207691_10092568 | 3300025940 | Bacteria | 2707 |
| 707 | Ga0207691_10095826 | 3300025940 | Bacteria | 2653 |
| 708 | Ga0207691_10187620 | 3300025940 | Bacteria | 1804 |
| 709 | Ga0207691_10841879 | 3300025940 | Bacteria | 769 |
| 710 | Ga0207711_10001117 | 3300025941 | Bacteria | 25666 |
| 711 | Ga0207711_10002270 | 3300025941 | Bacteria | 17263 |
| 712 | Ga0207711_10006712 | 3300025941 | Bacteria | 9682 |
| 713 | Ga0207711_10114041 | 3300025941 | Bacteria | 2406 |
| 714 | Ga0207711_10648262 | 3300025941 | Bacteria | 985 |
| 715 | Ga0207711_10780189 | 3300025941 | Bacteria | 890 |
| 716 | Ga0207689_10006926 | 3300025942 | Bacteria | 9971 |
| 717 | Ga0207689_10023656 | 3300025942 | Bacteria | 5152 |
| 718 | Ga0207689_10258895 | 3300025942 | Bacteria | 1439 |
| 719 | Ga0207689_11519392 | 3300025942 | Bacteria | 559 |
| 720 | Ga0207661_10069974 | 3300025944 | Bacteria | 2863 |
| 721 | Ga0207661_10244030 | 3300025944 | Bacteria | 1595 |
| 722 | Ga0207661_10344539 | 3300025944 | Bacteria | 1343 |
| 723 | Ga0207679_10012324 | 3300025945 | Bacteria | 5573 |
| 724 | Ga0207679_10032483 | 3300025945 | Bacteria | 3664 |
| 725 | Ga0207679_10168836 | 3300025945 | Bacteria | 1799 |
| 726 | Ga0207679_10182044 | 3300025945 | Bacteria | 1739 |
| 727 | Ga0207679_10247932 | 3300025945 | Bacteria | 1512 |
| 728 | Ga0207679_10251553 | 3300025945 | Bacteria | 1502 |
| 729 | Ga0207667_10001900 | 3300025949 | Bacteria | 26214 |
| 730 | Ga0207651_10000144 | 3300025960 | Bacteria | 31275 |
| 731 | Ga0207651_10045168 | 3300025960 | Bacteria | 2953 |
| 732 | Ga0207651_10170057 | 3300025960 | Bacteria | 1718 |
| 733 | Ga0207651_10388881 | 3300025960 | Bacteria | 1184 |
| 734 | Ga0207651_10444822 | 3300025960 | Bacteria | 1111 |
| 735 | Ga0207651_11070911 | 3300025960 | Bacteria | 722 |
| 736 | Ga0207651_11267794 | 3300025960 | Bacteria | 662 |
| 737 | Ga0207712_10136720 | 3300025961 | Bacteria | 1875 |
| 738 | Ga0207712_10143511 | 3300025961 | Bacteria | 1835 |
| 739 | Ga0207712_10348307 | 3300025961 | Bacteria | 1231 |
| 740 | Ga0207668_10035062 | 3300025972 | Bacteria | 3337 |
| 741 | Ga0207668_10042223 | 3300025972 | Bacteria | 3087 |
| 742 | Ga0207668_10064096 | 3300025972 | Bacteria | 2596 |
| 743 | Ga0207668_10323754 | 3300025972 | Bacteria | 1280 |
| 744 | Ga0207668_10383712 | 3300025972 | Bacteria | 1183 |
| 745 | Ga0207640_10925885 | 3300025981 | Bacteria | 763 |
| 746 | Ga0207640_11161124 | 3300025981 | Bacteria | 685 |
| 747 | Ga0207658_10001163 | 3300025986 | Bacteria | 21016 |
| 748 | Ga0207658_10001928 | 3300025986 | Bacteria | 15487 |
| 749 | Ga0207658_10006797 | 3300025986 | Bacteria | 7792 |
| 750 | Ga0207658_10060167 | 3300025986 | Bacteria | 2833 |
| 751 | Ga0207658_10316108 | 3300025986 | Bacteria | 1350 |
| 752 | Ga0207658_11049995 | 3300025986 | Bacteria | 744 |
| 753 | Ga0207658_11596239 | 3300025986 | Bacteria | 596 |
| 754 | Ga0207677_10000686 | 3300026023 | Bacteria | 20040 |
| 755 | Ga0207677_10086316 | 3300026023 | Bacteria | 2268 |
| 756 | Ga0207677_10125707 | 3300026023 | Bacteria | 1938 |
| 757 | Ga0207677_11216370 | 3300026023 | Bacteria | 690 |
| 758 | Ga0207703_10000702 | 3300026035 | Bacteria | 33148 |
| 759 | Ga0207703_10009199 | 3300026035 | Bacteria | 7769 |
| 760 | Ga0207703_10035099 | 3300026035 | Bacteria | 3984 |
| 761 | Ga0207703_10262242 | 3300026035 | Bacteria | 1562 |
| 762 | Ga0207703_10333350 | 3300026035 | Bacteria | 1392 |
| 763 | Ga0207703_10843132 | 3300026035 | Bacteria | 876 |
| 764 | Ga0207639_10583343 | 3300026041 | Bacteria | 1029 |
| 765 | Ga0207639_10904484 | 3300026041 | Bacteria | 825 |
| 766 | Ga0207639_11902670 | 3300026041 | Bacteria | 556 |
| 767 | Ga0207678_10010590 | 3300026067 | Bacteria | 8101 |
| 768 | Ga0207678_10128514 | 3300026067 | Bacteria | 2161 |
| 769 | Ga0207678_10172462 | 3300026067 | Bacteria | 1847 |
| 770 | Ga0207678_10202581 | 3300026067 | Bacteria | 1697 |
| 771 | Ga0207678_10304781 | 3300026067 | Bacteria | 1369 |
| 772 | Ga0207678_10616168 | 3300026067 | Bacteria | 952 |
| 773 | Ga0207678_10705843 | 3300026067 | Bacteria | 888 |
| 774 | Ga0207678_10895209 | 3300026067 | Bacteria | 785 |
| 775 | Ga0207708_10145699 | 3300026075 | Bacteria | 1861 |
| 776 | Ga0207708_10276266 | 3300026075 | Bacteria | 1360 |
| 777 | Ga0207708_10428084 | 3300026075 | Bacteria | 1098 |
| 778 | Ga0207708_10919707 | 3300026075 | Bacteria | 758 |
| 779 | Ga0207702_10280361 | 3300026078 | Bacteria | 1575 |
| 780 | Ga0207702_10352781 | 3300026078 | Bacteria | 1408 |
| 781 | Ga0207641_10000926 | 3300026088 | Bacteria | 30280 |
| 782 | Ga0207641_10016664 | 3300026088 | Bacteria | 6016 |
| 783 | Ga0207641_10024608 | 3300026088 | Bacteria | 4962 |
| 784 | Ga0207641_10029474 | 3300026088 | Bacteria | 4539 |
| 785 | Ga0207641_10100857 | 3300026088 | Bacteria | 2543 |
| 786 | Ga0207641_10216887 | 3300026088 | Bacteria | 1772 |
| 787 | Ga0207641_11531460 | 3300026088 | Bacteria | 668 |
| 788 | Ga0207641_11751157 | 3300026088 | Bacteria | 623 |
| 789 | Ga0207648_10002833 | 3300026089 | Bacteria | 18391 |
| 790 | Ga0207648_10006529 | 3300026089 | Bacteria | 11575 |
| 791 | Ga0207648_10017050 | 3300026089 | Bacteria | 6620 |
| 792 | Ga0207648_10025610 | 3300026089 | Bacteria | 5253 |
| 793 | Ga0207648_10086004 | 3300026089 | Bacteria | 2743 |
| 794 | Ga0207648_10102038 | 3300026089 | Bacteria | 2514 |
| 795 | Ga0207648_10155576 | 3300026089 | Bacteria | 2018 |
| 796 | Ga0207648_10156071 | 3300026089 | Bacteria | 2015 |
| 797 | Ga0207648_10287144 | 3300026089 | Bacteria | 1472 |
| 798 | Ga0207648_10620448 | 3300026089 | Bacteria | 998 |
| 799 | Ga0207648_10677379 | 3300026089 | Bacteria | 954 |
| 800 | Ga0207676_10000656 | 3300026095 | Bacteria | 27723 |
| 801 | Ga0207676_10017506 | 3300026095 | Bacteria | 5195 |
| 802 | Ga0207676_10128103 | 3300026095 | Bacteria | 2153 |
| 803 | Ga0207676_10681033 | 3300026095 | Bacteria | 995 |
| 804 | Ga0207676_10916896 | 3300026095 | Bacteria | 860 |
| 805 | Ga0207674_10006947 | 3300026116 | Bacteria | 13257 |
| 806 | Ga0207674_10015020 | 3300026116 | Bacteria | 8530 |
| 807 | Ga0207674_10229216 | 3300026116 | Bacteria | 1805 |
| 808 | Ga0207674_10421489 | 3300026116 | Bacteria | 1290 |
| 809 | Ga0207674_11151625 | 3300026116 | Bacteria | 745 |
| 810 | Ga0207675_100016912 | 3300026118 | Bacteria | 6816 |
| 811 | Ga0207675_100018263 | 3300026118 | Bacteria | 6538 |
| 812 | Ga0207675_100071881 | 3300026118 | Bacteria | 3235 |
| 813 | Ga0207675_100136890 | 3300026118 | Bacteria | 2325 |
| 814 | Ga0207675_100653032 | 3300026118 | Bacteria | 1058 |
| 815 | Ga0207675_100787266 | 3300026118 | Bacteria | 964 |
| 816 | Ga0207675_101233782 | 3300026118 | Bacteria | 768 |
| 817 | Ga0207683_10010852 | 3300026121 | Bacteria | 7770 |
| 818 | Ga0207683_10065890 | 3300026121 | Bacteria | 3193 |
| 819 | Ga0207683_10075327 | 3300026121 | Bacteria | 2987 |
| 820 | Ga0207683_10085160 | 3300026121 | Bacteria | 2810 |
| 821 | Ga0207683_10090087 | 3300026121 | Bacteria | 2731 |
| 822 | Ga0207683_10184951 | 3300026121 | Bacteria | 1890 |
| 823 | Ga0207683_10412517 | 3300026121 | Bacteria | 1243 |
| 824 | Ga0207683_10565873 | 3300026121 | Bacteria | 1051 |
| 825 | Ga0207683_10666940 | 3300026121 | Bacteria | 964 |
| 826 | Ga0207683_10681226 | 3300026121 | Bacteria | 953 |
| 827 | Ga0207698_10575205 | 3300026142 | Bacteria | 1107 |
| 828 | Ga0207698_11700327 | 3300026142 | Bacteria | 646 |
| 829 | Ga0209281_1000020 | 3300027111 | Bacteria | 575972 |
| 830 | Ga0209281_1000455 | 3300027111 | Bacteria | 58143 |
| 831 | Ga0209281_1028254 | 3300027111 | Bacteria | 1020 |
| 832 | Ga0209973_1057037 | 3300027252 | Bacteria | 596 |
| 833 | Ga0209813_10031997 | 3300027866 | Bacteria | 1556 |
| 834 | Ga0207428_10115761 | 3300027907 | Bacteria | 2059 |
| 835 | Ga0207428_10184545 | 3300027907 | Bacteria | 1575 |
| 836 | Ga0207428_10744711 | 3300027907 | Bacteria | 699 |
| 837 | Ga0207428_11017070 | 3300027907 | Bacteria | 582 |
| 838 | Ga0268266_10000005 | 3300028379 | Bacteria | 1448194 |
| 839 | Ga0268266_10004503 | 3300028379 | Bacteria | 13320 |
| 840 | Ga0268266_11378564 | 3300028379 | Bacteria | 681 |
| 841 | Ga0268266_11398962 | 3300028379 | Bacteria | 675 |
| 842 | Ga0268266_11689948 | 3300028379 | Bacteria | 608 |
| 843 | Ga0268265_10011002 | 3300028380 | Bacteria | 6112 |
| 844 | Ga0268265_10040448 | 3300028380 | Bacteria | 3443 |
| 845 | Ga0268265_10305534 | 3300028380 | Bacteria | 1434 |
| 846 | Ga0268265_10442039 | 3300028380 | Bacteria | 1212 |
| 847 | Ga0268265_10918540 | 3300028380 | Bacteria | 860 |
| 848 | Ga0268264_10000046 | 3300028381 | Bacteria | 364597 |
| 849 | Ga0268264_10022682 | 3300028381 | Bacteria | 5123 |
| 850 | Ga0268264_10102789 | 3300028381 | Bacteria | 2487 |
| 851 | Ga0268264_10574605 | 3300028381 | Bacteria | 1108 |
| 852 | Ga0268264_12100554 | 3300028381 | Bacteria | 573 |
| 853 | Ga0307517_10009345 | 3300028786 | Bacteria | 13898 |
| 854 | Ga0307517_10422898 | 3300028786 | Bacteria | 698 |
| 855 | Ga0307515_10000722 | 3300028794 | Bacteria | 75999 |
| 856 | Ga0307515_10002592 | 3300028794 | Bacteria | 38996 |
| 857 | Ga0307515_10029667 | 3300028794 | Bacteria | 9230 |
| 858 | Ga0307515_10034932 | 3300028794 | Bacteria | 8202 |
| 859 | Ga0307515_10043798 | 3300028794 | Bacteria | 6943 |
| 860 | Ga0307515_10054641 | 3300028794 | Bacteria | 5856 |
| 861 | Ga0307515_10068092 | 3300028794 | Bacteria | 4897 |
| 862 | Ga0307515_10295665 | 3300028794 | Bacteria | 1310 |
| 863 | Ga0265338_10191218 | 3300028800 | Bacteria | 1551 |
| 864 | Ga0307512_10219233 | 3300030522 | Bacteria | 997 |
| 865 | Ga0307512_10320256 | 3300030522 | Bacteria | 706 |
| 866 | Ga0265332_10035345 | 3300031238 | Bacteria | 2170 |
| 867 | Ga0265328_10026618 | 3300031239 | Bacteria | 2173 |
| 868 | Ga0265331_10183458 | 3300031250 | Bacteria | 945 |
| 869 | Ga0265327_10028506 | 3300031251 | Bacteria | 3193 |
| 870 | Ga0265316_11296286 | 3300031344 | Bacteria | 503 |
| 871 | Ga0307513_10005609 | 3300031456 | Bacteria | 16541 |
| 872 | Ga0307513_10322208 | 3300031456 | Bacteria | 1303 |
| 873 | Ga0307509_10016410 | 3300031507 | Bacteria | 8572 |
| 874 | Ga0307509_10019184 | 3300031507 | Bacteria | 7814 |
| 875 | Ga0307509_10041676 | 3300031507 | Bacteria | 4980 |
| 876 | Ga0307509_10048077 | 3300031507 | Bacteria | 4584 |
| 877 | Ga0307509_10051517 | 3300031507 | Bacteria | 4401 |
| 878 | Ga0307509_10290106 | 3300031507 | Bacteria | 1391 |
| 879 | Ga0307509_10342052 | 3300031507 | Bacteria | 1223 |
| 880 | Ga0307509_10587745 | 3300031507 | Bacteria | 787 |
| 881 | Ga0307408_100014078 | 3300031548 | Bacteria | 5313 |
| 882 | Ga0307408_100020103 | 3300031548 | Bacteria | 4500 |
| 883 | Ga0307408_100037431 | 3300031548 | Bacteria | 3417 |
| 884 | Ga0307408_100044613 | 3300031548 | Bacteria | 3160 |
| 885 | Ga0307408_100068764 | 3300031548 | Bacteria | 2609 |
| 886 | Ga0307408_100184150 | 3300031548 | Bacteria | 1677 |
| 887 | Ga0307408_100308870 | 3300031548 | Bacteria | 1328 |
| 888 | Ga0307408_100644049 | 3300031548 | Bacteria | 947 |
| 889 | Ga0307408_100719100 | 3300031548 | Bacteria | 899 |
| 890 | Ga0307408_101455754 | 3300031548 | Bacteria | 646 |
| 891 | Ga0307408_101839818 | 3300031548 | Bacteria | 579 |
| 892 | Ga0307508_10000659 | 3300031616 | Bacteria | 41446 |
| 893 | Ga0307508_10001973 | 3300031616 | Bacteria | 22419 |
| 894 | Ga0307508_10070300 | 3300031616 | Bacteria | 3073 |
| 895 | Ga0307514_10008017 | 3300031649 | Bacteria | 9039 |
| 896 | Ga0307514_10175535 | 3300031649 | Bacteria | 1391 |
| 897 | Ga0265314_10018888 | 3300031711 | Bacteria | 5352 |
| 898 | Ga0265314_10111016 | 3300031711 | Bacteria | 1743 |
| 899 | Ga0307516_10003142 | 3300031730 | Bacteria | 21494 |
| 900 | Ga0307516_10062726 | 3300031730 | Bacteria | 3600 |
| 901 | Ga0307516_10170137 | 3300031730 | Bacteria | 1920 |
| 902 | Ga0307516_10348440 | 3300031730 | Bacteria | 1147 |
| 903 | Ga0307516_10558733 | 3300031730 | Bacteria | 798 |
| 904 | Ga0307516_10862698 | 3300031730 | Bacteria | 570 |
| 905 | Ga0307405_10056945 | 3300031731 | Bacteria | 2453 |
| 906 | Ga0307405_10081180 | 3300031731 | Bacteria | 2119 |
| 907 | Ga0307405_10595457 | 3300031731 | Bacteria | 901 |
| 908 | Ga0307405_10686049 | 3300031731 | Bacteria | 846 |
| 909 | Ga0307413_10239523 | 3300031824 | Bacteria | 1339 |
| 910 | Ga0307413_10376475 | 3300031824 | Bacteria | 1104 |
| 911 | Ga0307413_10401762 | 3300031824 | Bacteria | 1074 |
| 912 | Ga0307413_10554929 | 3300031824 | Bacteria | 932 |
| 913 | Ga0307413_10663139 | 3300031824 | Bacteria | 862 |
| 914 | Ga0307413_10997778 | 3300031824 | Bacteria | 717 |
| 915 | Ga0307413_11626169 | 3300031824 | Bacteria | 574 |
| 916 | Ga0307410_10067171 | 3300031852 | Bacteria | 2473 |
| 917 | Ga0307410_11023474 | 3300031852 | Bacteria | 713 |
| 918 | Ga0307406_10000971 | 3300031901 | Bacteria | 16012 |
| 919 | Ga0307406_10726998 | 3300031901 | Bacteria | 831 |
| 920 | Ga0307406_11344228 | 3300031901 | Bacteria | 625 |
| 921 | Ga0307407_10040614 | 3300031903 | Bacteria | 2596 |
| 922 | Ga0307407_10451482 | 3300031903 | Bacteria | 933 |
| 923 | Ga0307407_10504480 | 3300031903 | Bacteria | 887 |
| 924 | Ga0307412_10097649 | 3300031911 | Bacteria | 2070 |
| 925 | Ga0307412_10105216 | 3300031911 | Bacteria | 2004 |
| 926 | Ga0307412_10106305 | 3300031911 | Bacteria | 1995 |
| 927 | Ga0307412_10141151 | 3300031911 | Bacteria | 1764 |
| 928 | Ga0307412_10232371 | 3300031911 | Bacteria | 1421 |
| 929 | Ga0307412_10412449 | 3300031911 | Bacteria | 1103 |
| 930 | Ga0307412_10412637 | 3300031911 | Bacteria | 1102 |
| 931 | Ga0307412_10454638 | 3300031911 | Bacteria | 1056 |
| 932 | Ga0307412_11389008 | 3300031911 | Bacteria | 635 |
| 933 | Ga0307412_11427041 | 3300031911 | Bacteria | 627 |
| 934 | Ga0307412_11842723 | 3300031911 | Bacteria | 557 |
| 935 | Ga0307409_100137996 | 3300031995 | Bacteria | 2096 |
| 936 | Ga0307409_100328491 | 3300031995 | Bacteria | 1434 |
| 937 | Ga0307409_101043738 | 3300031995 | Bacteria | 837 |
| 938 | Ga0307409_101062858 | 3300031995 | Bacteria | 829 |
| 939 | Ga0307416_100025231 | 3300032002 | Bacteria | 4354 |
| 940 | Ga0307416_100205498 | 3300032002 | Bacteria | 1873 |
| 941 | Ga0307416_100911959 | 3300032002 | Bacteria | 979 |
| 942 | Ga0307416_102426847 | 3300032002 | Bacteria | 624 |
| 943 | Ga0307414_10093113 | 3300032004 | Bacteria | 2245 |
| 944 | Ga0307414_10101921 | 3300032004 | Bacteria | 2162 |
| 945 | Ga0307414_10319004 | 3300032004 | Bacteria | 1322 |
| 946 | Ga0307414_10786396 | 3300032004 | Bacteria | 867 |
| 947 | Ga0307414_11179229 | 3300032004 | Bacteria | 709 |
| 948 | Ga0307414_11218204 | 3300032004 | Bacteria | 697 |
| 949 | Ga0307411_10089972 | 3300032005 | Bacteria | 2139 |
| 950 | Ga0307411_10124567 | 3300032005 | Bacteria | 1871 |
| 951 | Ga0307411_10230864 | 3300032005 | Bacteria | 1442 |
| 952 | Ga0307411_10412559 | 3300032005 | Bacteria | 1119 |
| 953 | Ga0307411_10532091 | 3300032005 | Bacteria | 999 |
| 954 | Ga0307411_11430635 | 3300032005 | Bacteria | 633 |
| 955 | Ga0307411_11620561 | 3300032005 | Bacteria | 597 |
| 956 | Ga0307415_100802834 | 3300032126 | Bacteria | 859 |
| 957 | Ga0307507_10120827 | 3300033179 | Bacteria | 2096 |
| 958 | Ga0307507_10246671 | 3300033179 | Bacteria | 1160 |
| 959 | Ga0307507_10315566 | 3300033179 | Bacteria | 945 |
| 960 | Ga0307510_10008860 | 3300033180 | Bacteria | 11992 |
| 961 | Ga0307510_10267155 | 3300033180 | Bacteria | 1188 |
| 962 | Ga0373928_0125407 | 3300035084 | Bacteria | 692 |
| 963 | Ga0373936_0006785 | 3300035113 | Bacteria | 4310 |
| 964 | Ga0373936_0020797 | 3300035113 | Bacteria | 2551 |
| 965 | Ga0373956_0155219 | 3300035119 | Bacteria | 1077 |
| 966 | Ga0373943_0568338 | 3300035170 | Bacteria | 666 |
| 967 | Ga0373946_0283990 | 3300035171 | Bacteria | 815 |
| 968 | Ga0373955_0016520 | 3300035172 | Bacteria | 3635 |
| 969 | Ga0373931_1118482 | 3300035691 | Bacteria | 537 |
| 970 | Ga0373935_1442716 | 3300035692 | Bacteria | 515 |
| 971 | Ga0373927_0137483 | 3300035695 | Bacteria | 1597 |
| 972 | Ga0373933_0236278 | 3300035724 | Bacteria | 1175 |
| 973 | Ga0373933_0445795 | 3300035724 | Bacteria | 846 |
| 974 | Ga0373947_0402276 | 3300035725 | Bacteria | 924 |
| 975 | Ga0373937_0335188 | 3300036401 | Bacteria | 1432 |
| 976 | Ga0373937_0672974 | 3300036401 | Bacteria | 981 |
| 977 | Ga0373937_1036553 | 3300036401 | Bacteria | 769 |
| 978 | Ga0373925_0158603 | 3300037068 | Bacteria | 1781 |
| 979 | Ga0373925_0185903 | 3300037068 | Bacteria | 1647 |
| 980 | Ga0373925_0378943 | 3300037068 | Bacteria | 1152 |
| 981 | Ga0395899_0000521 | 3300037312 | Bacteria | 42304 |
| 982 | Ga0395899_0000581 | 3300037312 | Bacteria | 38482 |
| 983 | Ga0395899_0002985 | 3300037312 | Bacteria | 13526 |
| 984 | Ga0395899_0165992 | 3300037312 | Bacteria | 1557 |
| 985 | Ga0395900_0032760 | 3300037418 | Bacteria | 5345 |
| 986 | Ga0395900_0246211 | 3300037418 | Bacteria | 1791 |
| 987 | Ga0395898_0035761 | 3300037466 | Bacteria | 4935 |
| 988 | Ga0395898_0309599 | 3300037466 | Bacteria | 1506 |
| 989 | Ga0395898_0339749 | 3300037466 | Bacteria | 1432 |
| 990 | Ga0395905_0000029 | 3300037471 | Bacteria | 293016 |
| 991 | Ga0395905_0017408 | 3300037471 | Bacteria | 6823 |
| 992 | Ga0395905_0087795 | 3300037471 | Bacteria | 2915 |
| 993 | Ga0395905_0183254 | 3300037471 | Bacteria | 1966 |
| 994 | Ga0395905_0211610 | 3300037471 | Bacteria | 1816 |
| 995 | Ga0395905_1000623 | 3300037471 | Bacteria | 739 |
| 996 | Ga0395901_0032991 | 3300038443 | Bacteria | 5342 |
| 997 | Ga0395901_0095514 | 3300038443 | Bacteria | 3115 |
| 998 | Ga0395901_0427156 | 3300038443 | Bacteria | 1358 |
| 999 | Ga0436360_0988630 | 3300039438 | Bacteria | 2909 |
| 1000 | Ga0436361_0168617 | 3300039447 | Bacteria | 3812 |
| 1001 | Ga0436361_0209219 | 3300039447 | Bacteria | 916 |
| 1002 | Ga0439465_0005707 | 3300041413 | Bacteria | 3962 |
| 1003 | Ga0451791_1941958 | 3300041451 | Bacteria | 510 |
| 1004 | Ga0451793_1513956 | 3300041452 | Bacteria | 1873 |
| 1005 | Ga0451797_0629150 | 3300041453 | Bacteria | 1199 |
| 1006 | Ga0451797_1257626 | 3300041453 | Bacteria | 783 |
| 1007 | Ga0451795_0135458 | 3300041456 | Bacteria | 539 |
| 1008 | Ga0451795_0363756 | 3300041456 | Bacteria | 1551 |
| 1009 | Ga0451800_1298110 | 3300041459 | Bacteria | 946 |
| 1010 | Ga0451802_0323989 | 3300041460 | Bacteria | 919 |
| 1011 | Ga0451802_0711155 | 3300041460 | Bacteria | 691 |
| 1012 | Ga0451802_1304540 | 3300041460 | Bacteria | 559 |
| 1013 | Ga0451807_2074045 | 3300041486 | Bacteria | 968 |
| 1014 | Ga0451837_1338186 | 3300041494 | Bacteria | 3153 |
| 1015 | Ga0451839_1659939 | 3300041496 | Bacteria | 652 |
| 1016 | Ga0451845_0303794 | 3300041501 | Bacteria | 539 |
| 1017 | Ga0451847_0101710 | 3300041503 | Bacteria | 866 |
| 1018 | Ga0451849_0088262 | 3300041505 | Bacteria | 543 |
| 1019 | Ga0451843_0405520 | 3300041509 | Bacteria | 1134 |
| 1020 | Ga0451855_0963016 | 3300041511 | Bacteria | 1398 |
| 1021 | Ga0439431_0023450 | 3300041997 | Bacteria | 1494 |
| 1022 | Ga0439442_028403 | 3300042002 | Bacteria | 1166 |
| 1023 | Ga0439432_018326 | 3300042006 | Bacteria | 2340 |
| 1024 | Ga0439432_056988 | 3300042006 | Bacteria | 1210 |
| 1025 | Ga0439449_0002219 | 3300042007 | Bacteria | 7641 |
| 1026 | Ga0439450_081517 | 3300042008 | Bacteria | 805 |
| 1027 | Ga0439452_085163 | 3300042010 | Bacteria | 686 |
| 1028 | Ga0439462_0169395 | 3300042015 | Bacteria | 617 |
| 1029 | Ga0450914_016197 | 3300042118 | Bacteria | 787 |
| 1030 | Ga0450920_057362 | 3300042122 | Bacteria | 785 |
| 1031 | Ga0450890_046398 | 3300042127 | Bacteria | 654 |
| 1032 | Ga0450894_018669 | 3300042131 | Bacteria | 928 |
| 1033 | Ga0450898_151491 | 3300042134 | Bacteria | 508 |
| 1034 | Ga0450899_013055 | 3300042135 | Bacteria | 936 |
| 1035 | Ga0450904_020330 | 3300042139 | Bacteria | 673 |
| 1036 | Ga0450905_056616 | 3300042142 | Bacteria | 648 |
| 1037 | Ga0450910_063573 | 3300042147 | Bacteria | 626 |
| 1038 | Ga0439446_0030487 | 3300042156 | Bacteria | 1559 |
| 1039 | Ga0450908_001912 | 3300042184 | Bacteria | 4073 |
| 1040 | Ga0450918_002326 | 3300042531 | Bacteria | 3596 |
| 1041 | Ga0450893_0022938 | 3300042532 | Bacteria | 1083 |
| 1042 | Ga0466969_0000010 | 3300044656 | Bacteria | 117215 |
| 1043 | Ga0466969_0000531 | 3300044656 | Bacteria | 20971 |
| 1044 | Ga0466969_0012755 | 3300044656 | Bacteria | 4428 |
| 1045 | Ga0466969_0049614 | 3300044656 | Bacteria | 2070 |
| 1046 | Ga0466969_0186316 | 3300044656 | Bacteria | 949 |
| 1047 | Ga0466972_0034223 | 3300044658 | Bacteria | 2490 |
| 1048 | Ga0466972_0054011 | 3300044658 | Bacteria | 1934 |
| 1049 | Ga0466972_0191190 | 3300044658 | Bacteria | 959 |
| 1050 | Ga0466972_0239589 | 3300044658 | Bacteria | 849 |
| 1051 | Ga0466982_0059006 | 3300044672 | Bacteria | 2359 |
| 1052 | Ga0466965_0008841 | 3300044683 | Bacteria | 4671 |
| 1053 | Ga0466965_0073734 | 3300044683 | Bacteria | 1719 |
| 1054 | Ga0466965_0181326 | 3300044683 | Bacteria | 1111 |
| 1055 | Ga0466965_0197374 | 3300044683 | Bacteria | 1066 |
| 1056 | Ga0466965_0484145 | 3300044683 | Bacteria | 692 |
| 1057 | Ga0466966_0001046 | 3300044684 | Bacteria | 17660 |
| 1058 | Ga0466966_0017788 | 3300044684 | Bacteria | 4693 |
| 1059 | Ga0466966_0021565 | 3300044684 | Bacteria | 4230 |
| 1060 | Ga0466961_0001090 | 3300044693 | Bacteria | 16697 |
| 1061 | Ga0466961_0004702 | 3300044693 | Bacteria | 8585 |
| 1062 | Ga0466961_0020588 | 3300044693 | Bacteria | 4245 |
| 1063 | Ga0466961_0051247 | 3300044693 | Bacteria | 2636 |
| 1064 | Ga0466963_0217615 | 3300044694 | Bacteria | 1337 |
| 1065 | Ga0466963_0225588 | 3300044694 | Bacteria | 1312 |
| 1066 | Ga0466963_0717417 | 3300044694 | Bacteria | 705 |
| 1067 | Ga0466964_0018775 | 3300044706 | Bacteria | 2655 |
| 1068 | Ga0466964_0216361 | 3300044706 | Bacteria | 928 |
| 1069 | Ga0453684_1024299 | 3300044712 | Bacteria | 877 |
| 1070 | Ga0466971_0002065 | 3300044719 | Bacteria | 8510 |
| 1071 | Ga0466971_0267106 | 3300044719 | Bacteria | 817 |
| 1072 | Ga0466968_0179082 | 3300044735 | Bacteria | 985 |
| 1073 | Ga0466968_0251625 | 3300044735 | Bacteria | 839 |
| 1074 | Ga0466970_0001322 | 3300044765 | Bacteria | 11982 |
| 1075 | Ga0466970_0008987 | 3300044765 | Bacteria | 5039 |
| 1076 | Ga0466970_0031328 | 3300044765 | Bacteria | 2809 |
| 1077 | Ga0466970_0078991 | 3300044765 | Bacteria | 1776 |
| 1078 | Ga0466957_0001175 | 3300044842 | Bacteria | 13592 |
| 1079 | Ga0466957_0132372 | 3300044842 | Bacteria | 1599 |
| 1080 | Ga0466957_0606224 | 3300044842 | Bacteria | 767 |
| 1081 | Ga0466957_0725501 | 3300044842 | Bacteria | 702 |
| 1082 | Ga0466957_1023343 | 3300044842 | Bacteria | 594 |
| 1083 | Ga0466960_0030576 | 3300044901 | Bacteria | 2479 |
| 1084 | Ga0466960_0267490 | 3300044901 | Bacteria | 954 |
| 1085 | Ga0466959_0000206 | 3300045049 | Bacteria | 37971 |
| 1086 | Ga0466959_0002005 | 3300045049 | Bacteria | 12850 |
| 1087 | Ga0466959_0004323 | 3300045049 | Bacteria | 9486 |
| 1088 | Ga0466959_0050021 | 3300045049 | Bacteria | 3070 |
| 1089 | Ga0466959_0065358 | 3300045049 | Bacteria | 2639 |
| 1090 | Ga0451576_0033797 | 3300045051 | Bacteria | 5434 |
| 1091 | Ga0466958_0000881 | 3300045836 | Bacteria | 13422 |
| 1092 | Ga0466958_0020449 | 3300045836 | Bacteria | 3859 |
| 1093 | Ga0466958_0186688 | 3300045836 | Bacteria | 1317 |
| 1094 | Ga0495617_000107 | 3300046452 | Bacteria | 60888 |
| 1095 | Ga0495603_0001824 | 3300046455 | Bacteria | 12572 |
| 1096 | Ga0495603_0031354 | 3300046455 | Bacteria | 3200 |
| 1097 | Ga0495603_0100321 | 3300046455 | Bacteria | 1690 |
| 1098 | Ga0495603_0123732 | 3300046455 | Bacteria | 1507 |
| 1099 | Ga0495603_0322516 | 3300046455 | Bacteria | 887 |
| 1100 | Ga0495590_0004681 | 3300046457 | Bacteria | 5487 |
| 1101 | Ga0495590_0011833 | 3300046457 | Bacteria | 3253 |
| 1102 | Ga0495590_0046439 | 3300046457 | Bacteria | 1515 |
| 1103 | Ga0495591_142145 | 3300046458 | Bacteria | 579 |
| 1104 | Ga0495629_0000015 | 3300046459 | Bacteria | 182026 |
| 1105 | Ga0495629_0006500 | 3300046459 | Bacteria | 8660 |
| 1106 | Ga0495629_0056655 | 3300046459 | Bacteria | 2740 |
| 1107 | Ga0495629_0333449 | 3300046459 | Bacteria | 1036 |
| 1108 | Ga0495629_0538179 | 3300046459 | Bacteria | 785 |
| 1109 | Ga0495638_0003798 | 3300046460 | Bacteria | 11736 |
| 1110 | Ga0495638_0050177 | 3300046460 | Bacteria | 2607 |
| 1111 | Ga0495638_0147929 | 3300046460 | Bacteria | 1365 |
| 1112 | Ga0495638_0403732 | 3300046460 | Bacteria | 708 |
| 1113 | Ga0495653_0000305 | 3300046463 | Bacteria | 39770 |
| 1114 | Ga0495653_0000764 | 3300046463 | Bacteria | 24684 |
| 1115 | Ga0495653_0082522 | 3300046463 | Bacteria | 2372 |
| 1116 | Ga0495653_0139477 | 3300046463 | Bacteria | 1707 |
| 1117 | Ga0495650_0000100 | 3300046471 | Bacteria | 213752 |
| 1118 | Ga0495650_0000179 | 3300046471 | Bacteria | 138628 |
| 1119 | Ga0495650_0001583 | 3300046471 | Bacteria | 21335 |
| 1120 | Ga0495650_0061790 | 3300046471 | Bacteria | 1499 |
| 1121 | Ga0495650_0070473 | 3300046471 | Bacteria | 1373 |
| 1122 | Ga0495580_0000682 | 3300046472 | Bacteria | 28929 |
| 1123 | Ga0495580_0003234 | 3300046472 | Bacteria | 13935 |
| 1124 | Ga0495580_0011711 | 3300046472 | Bacteria | 6778 |
| 1125 | Ga0495580_0132594 | 3300046472 | Bacteria | 1727 |
| 1126 | Ga0495580_0173533 | 3300046472 | Bacteria | 1490 |
| 1127 | Ga0495580_0236568 | 3300046472 | Bacteria | 1253 |
| 1128 | Ga0495582_0157078 | 3300046473 | Bacteria | 1293 |
| 1129 | Ga0495582_0282972 | 3300046473 | Bacteria | 952 |
| 1130 | Ga0495582_0383422 | 3300046473 | Bacteria | 810 |
| 1131 | Ga0495605_0000098 | 3300046474 | Bacteria | 109816 |
| 1132 | Ga0495605_0005795 | 3300046474 | Bacteria | 7146 |
| 1133 | Ga0495605_0008391 | 3300046474 | Bacteria | 5841 |
| 1134 | Ga0495605_0008882 | 3300046474 | Bacteria | 5666 |
| 1135 | Ga0495605_0303499 | 3300046474 | Bacteria | 675 |
| 1136 | Ga0495639_0018021 | 3300046475 | Bacteria | 3071 |
| 1137 | Ga0495639_0035691 | 3300046475 | Bacteria | 2225 |
| 1138 | Ga0495662_0255167 | 3300046476 | Bacteria | 863 |
| 1139 | Ga0495664_0055653 | 3300046477 | Bacteria | 2353 |
| 1140 | Ga0495664_0361855 | 3300046477 | Bacteria | 873 |
| 1141 | Ga0495664_0666118 | 3300046477 | Bacteria | 616 |
| 1142 | Ga0495584_0098905 | 3300046491 | Bacteria | 1474 |
| 1143 | Ga0495584_0333587 | 3300046491 | Bacteria | 770 |
| 1144 | Ga0495584_0511391 | 3300046491 | Bacteria | 612 |
| 1145 | Ga0495584_0543681 | 3300046491 | Bacteria | 592 |
| 1146 | Ga0495585_0017777 | 3300046492 | Bacteria | 4104 |
| 1147 | Ga0495594_0188758 | 3300046499 | Bacteria | 1174 |
| 1148 | Ga0495596_0017244 | 3300046500 | Bacteria | 2994 |
| 1149 | Ga0495596_0032675 | 3300046500 | Bacteria | 2074 |
| 1150 | Ga0495596_0046637 | 3300046500 | Bacteria | 1702 |
| 1151 | Ga0495607_0005789 | 3300046501 | Bacteria | 8793 |
| 1152 | Ga0495607_0093899 | 3300046501 | Bacteria | 1619 |
| 1153 | Ga0495583_0030350 | 3300046506 | Bacteria | 2633 |
| 1154 | Ga0495583_0050726 | 3300046506 | Bacteria | 1895 |
| 1155 | Ga0495583_0124817 | 3300046506 | Bacteria | 1080 |
| 1156 | Ga0495606_0000223 | 3300046507 | Bacteria | 100501 |
| 1157 | Ga0495606_0001629 | 3300046507 | Bacteria | 29255 |
| 1158 | Ga0495606_0004296 | 3300046507 | Bacteria | 14340 |
| 1159 | Ga0495606_0049159 | 3300046507 | Bacteria | 2768 |
| 1160 | Ga0495606_0141852 | 3300046507 | Bacteria | 1418 |
| 1161 | Ga0495606_0259201 | 3300046507 | Bacteria | 960 |
| 1162 | Ga0495610_0000668 | 3300046512 | Bacteria | 33359 |
| 1163 | Ga0495616_0010325 | 3300046513 | Bacteria | 5411 |
| 1164 | Ga0495616_0059117 | 3300046513 | Bacteria | 1886 |
| 1165 | Ga0495618_0102943 | 3300046514 | Bacteria | 1828 |
| 1166 | Ga0495620_0001664 | 3300046515 | Bacteria | 13134 |
| 1167 | Ga0495620_0009834 | 3300046515 | Bacteria | 5073 |
| 1168 | Ga0495620_0018985 | 3300046515 | Bacteria | 3394 |
| 1169 | Ga0495620_0088850 | 3300046515 | Bacteria | 1241 |
| 1170 | Ga0495620_0105994 | 3300046515 | Bacteria | 1117 |
| 1171 | Ga0495628_0006614 | 3300046516 | Bacteria | 10116 |
| 1172 | Ga0495628_0096207 | 3300046516 | Bacteria | 2287 |
| 1173 | Ga0495628_0167939 | 3300046516 | Bacteria | 1664 |
| 1174 | Ga0495628_0494887 | 3300046516 | Bacteria | 883 |
| 1175 | Ga0495630_0048218 | 3300046517 | Bacteria | 3187 |
| 1176 | Ga0495630_0055261 | 3300046517 | Bacteria | 2975 |
| 1177 | Ga0495630_0082688 | 3300046517 | Bacteria | 2424 |
| 1178 | Ga0495630_0085128 | 3300046517 | Bacteria | 2386 |
| 1179 | Ga0495630_0297701 | 3300046517 | Bacteria | 1233 |
| 1180 | Ga0495631_0132417 | 3300046518 | Bacteria | 1071 |
| 1181 | Ga0495632_0012548 | 3300046519 | Bacteria | 4883 |
| 1182 | Ga0495632_0110693 | 3300046519 | Bacteria | 1289 |
| 1183 | Ga0495632_0384011 | 3300046519 | Bacteria | 615 |
| 1184 | Ga0495643_0097109 | 3300046522 | Bacteria | 1514 |
| 1185 | Ga0495643_0149712 | 3300046522 | Bacteria | 1157 |
| 1186 | Ga0495644_0021130 | 3300046523 | Bacteria | 2483 |
| 1187 | Ga0495648_0046740 | 3300046524 | Bacteria | 2680 |
| 1188 | Ga0495648_0323126 | 3300046524 | Bacteria | 714 |
| 1189 | Ga0495648_0514991 | 3300046524 | Bacteria | 510 |
| 1190 | Ga0495666_0012315 | 3300046526 | Bacteria | 4265 |
| 1191 | Ga0495666_0021388 | 3300046526 | Bacteria | 3202 |
| 1192 | Ga0495666_0218869 | 3300046526 | Bacteria | 872 |
| 1193 | Ga0495642_0002147 | 3300046528 | Bacteria | 8127 |
| 1194 | Ga0495642_0020756 | 3300046528 | Bacteria | 2582 |
| 1195 | Ga0495642_0082210 | 3300046528 | Bacteria | 1358 |
| 1196 | Ga0495642_0104138 | 3300046528 | Bacteria | 1210 |
| 1197 | Ga0495652_0012080 | 3300046529 | Bacteria | 7802 |
| 1198 | Ga0495652_0329182 | 3300046529 | Bacteria | 1101 |
| 1199 | Ga0495652_0399012 | 3300046529 | Bacteria | 974 |
| 1200 | Ga0495654_0182143 | 3300046530 | Bacteria | 909 |
| 1201 | Ga0495665_0023566 | 3300046531 | Bacteria | 3306 |
| 1202 | Ga0495665_0072296 | 3300046531 | Bacteria | 1816 |
| 1203 | Ga0495665_0366771 | 3300046531 | Bacteria | 732 |
| 1204 | Ga0495640_0232584 | 3300046533 | Bacteria | 1159 |
| 1205 | Ga0495640_0484021 | 3300046533 | Bacteria | 754 |
| 1206 | Ga0495586_0026649 | 3300046535 | Bacteria | 3093 |
| 1207 | Ga0495586_0159525 | 3300046535 | Bacteria | 1272 |
| 1208 | Ga0495586_0345761 | 3300046535 | Bacteria | 854 |
| 1209 | Ga0495586_0402611 | 3300046535 | Bacteria | 788 |
| 1210 | Ga0495587_0174854 | 3300046536 | Bacteria | 1219 |
| 1211 | Ga0495598_0168993 | 3300046537 | Bacteria | 774 |
| 1212 | Ga0495621_0111138 | 3300046539 | Bacteria | 1051 |
| 1213 | Ga0495621_0451777 | 3300046539 | Bacteria | 550 |
| 1214 | Ga0495597_0014880 | 3300046542 | Bacteria | 3698 |
| 1215 | Ga0495597_0133370 | 3300046542 | Bacteria | 1029 |
| 1216 | Ga0495597_0144813 | 3300046542 | Bacteria | 978 |
| 1217 | Ga0495597_0362131 | 3300046542 | Bacteria | 555 |
| 1218 | Ga0495645_0000828 | 3300046543 | Bacteria | 21073 |
| 1219 | Ga0495645_0071080 | 3300046543 | Bacteria | 2510 |
| 1220 | Ga0495645_0224513 | 3300046543 | Bacteria | 1261 |
| 1221 | Ga0495622_0127207 | 3300046557 | Bacteria | 1161 |
| 1222 | Ga0495633_0040223 | 3300046558 | Bacteria | 2228 |
| 1223 | Ga0495633_0268598 | 3300046558 | Bacteria | 777 |
| 1224 | Ga0495667_0054299 | 3300046559 | Bacteria | 2636 |
| 1225 | Ga0495656_0150540 | 3300046615 | Bacteria | 1123 |
| 1226 | Ga0495656_0297203 | 3300046615 | Bacteria | 827 |
| 1227 | Ga0495668_0000286 | 3300046616 | Bacteria | 69771 |
| 1228 | Ga0495668_0001540 | 3300046616 | Bacteria | 21860 |
| 1229 | Ga0495668_0218340 | 3300046616 | Bacteria | 1044 |
| 1230 | Ga0495668_0282230 | 3300046616 | Bacteria | 910 |
| 1231 | Ga0495668_0408441 | 3300046616 | Bacteria | 746 |
| 1232 | Ga0495611_0052076 | 3300046648 | Bacteria | 1846 |
| 1233 | Ga0495611_0053471 | 3300046648 | Bacteria | 1823 |
| 1234 | Ga0495611_0132255 | 3300046648 | Bacteria | 1164 |
| 1235 | Ga0495611_0345865 | 3300046648 | Bacteria | 683 |
| 1236 | Ga0495625_0000052 | 3300046660 | Bacteria | 190656 |
| 1237 | Ga0495625_0016474 | 3300046660 | Bacteria | 5816 |
| 1238 | Ga0495625_0018472 | 3300046660 | Bacteria | 5442 |
| 1239 | Ga0495625_0095074 | 3300046660 | Bacteria | 2055 |
| 1240 | Ga0495625_0340715 | 3300046660 | Bacteria | 950 |
| 1241 | Ga0495625_0371583 | 3300046660 | Bacteria | 899 |
| 1242 | Ga0495625_0402574 | 3300046660 | Bacteria | 855 |
| 1243 | Ga0495635_0003000 | 3300046663 | Bacteria | 11588 |
| 1244 | Ga0495635_0405564 | 3300046663 | Bacteria | 905 |
| 1245 | Ga0495635_0767973 | 3300046663 | Bacteria | 622 |
| 1246 | Ga0495661_0254645 | 3300046665 | Bacteria | 894 |
| 1247 | Ga0495588_0033636 | 3300046674 | Bacteria | 2590 |
| 1248 | Ga0495599_0019631 | 3300046678 | Bacteria | 4213 |
| 1249 | Ga0495599_0082904 | 3300046678 | Bacteria | 2003 |
| 1250 | Ga0495599_0136926 | 3300046678 | Bacteria | 1520 |
| 1251 | Ga0495623_0011726 | 3300046679 | Bacteria | 5679 |
| 1252 | Ga0495623_0079976 | 3300046679 | Bacteria | 2024 |
| 1253 | Ga0495646_0004613 | 3300046680 | Bacteria | 8676 |
| 1254 | Ga0495646_0066210 | 3300046680 | Bacteria | 2137 |
| 1255 | Ga0495646_0172171 | 3300046680 | Bacteria | 1192 |
| 1256 | Ga0495658_0059118 | 3300046683 | Bacteria | 2194 |
| 1257 | Ga0495658_0135353 | 3300046683 | Bacteria | 1503 |
| 1258 | Ga0495658_0141182 | 3300046683 | Bacteria | 1473 |
| 1259 | Ga0495669_0028555 | 3300046684 | Bacteria | 2444 |
| 1260 | Ga0495669_0329173 | 3300046684 | Bacteria | 738 |
| 1261 | Ga0495613_0015073 | 3300046689 | Bacteria | 5740 |
| 1262 | Ga0495613_0244010 | 3300046689 | Bacteria | 1255 |
| 1263 | Ga0495613_0283876 | 3300046689 | Bacteria | 1149 |
| 1264 | Ga0495624_0000973 | 3300046690 | Bacteria | 22631 |
| 1265 | Ga0495624_0001711 | 3300046690 | Bacteria | 16766 |
| 1266 | Ga0495624_0067091 | 3300046690 | Bacteria | 2239 |
| 1267 | Ga0495624_0371596 | 3300046690 | Bacteria | 859 |
| 1268 | Ga0495624_0629737 | 3300046690 | Bacteria | 639 |
| 1269 | Ga0495670_0000022 | 3300046691 | Bacteria | 101451 |
| 1270 | Ga0495670_0000846 | 3300046691 | Bacteria | 14802 |
| 1271 | Ga0495670_0039618 | 3300046691 | Bacteria | 2350 |
| 1272 | Ga0495671_0050658 | 3300046692 | Bacteria | 2067 |
| 1273 | Ga0495649_0034647 | 3300046694 | Bacteria | 2777 |
| 1274 | Ga0495649_0106358 | 3300046694 | Bacteria | 1489 |
| 1275 | Ga0495649_0373096 | 3300046694 | Bacteria | 719 |
| 1276 | Ga0495649_0457901 | 3300046694 | Bacteria | 637 |
| 1277 | Ga0495589_0004109 | 3300046794 | Bacteria | 7791 |
| 1278 | Ga0495589_0091240 | 3300046794 | Bacteria | 1479 |
| 1279 | Ga0495589_0094426 | 3300046794 | Bacteria | 1451 |
| 1280 | Ga0495589_0169690 | 3300046794 | Bacteria | 1037 |
| 1281 | Ga0495600_0085491 | 3300046809 | Bacteria | 2058 |
| 1282 | Ga0495660_0076155 | 3300046810 | Bacteria | 1768 |
| 1283 | Ga0495581_0003470 | 3300047315 | Bacteria | 9048 |
| 1284 | Ga0495604_0014295 | 3300047317 | Bacteria | 6328 |
| 1285 | Ga0495604_0019898 | 3300047317 | Bacteria | 5368 |
| 1286 | Ga0495604_0028637 | 3300047317 | Bacteria | 4432 |
| 1287 | Ga0495674_0000529 | 3300047319 | Bacteria | 35241 |
| 1288 | Ga0495674_0024644 | 3300047319 | Bacteria | 5522 |
| 1289 | Ga0495674_0120170 | 3300047319 | Bacteria | 2220 |
| 1290 | Ga0495674_0683939 | 3300047319 | Bacteria | 806 |
| 1291 | Ga0495674_1433416 | 3300047319 | Bacteria | 513 |
| 1292 | Ga0495672_0012806 | 3300047320 | Bacteria | 5827 |
| 1293 | Ga0495676_0043008 | 3300047321 | Bacteria | 3701 |
| 1294 | Ga0495680_0015339 | 3300047322 | Bacteria | 6611 |
| 1295 | Ga0495680_0145811 | 3300047322 | Bacteria | 1729 |
| 1296 | Ga0495680_0763067 | 3300047322 | Bacteria | 634 |
| 1297 | Ga0495683_0001263 | 3300047323 | Bacteria | 17158 |
| 1298 | Ga0495683_0059121 | 3300047323 | Bacteria | 1902 |
| 1299 | Ga0495683_0165830 | 3300047323 | Bacteria | 1018 |
| 1300 | Ga0495687_023020 | 3300047443 | Bacteria | 2982 |
| 1301 | Ga0495687_093290 | 3300047443 | Bacteria | 1147 |
| 1302 | Ga0495675_0042917 | 3300047444 | Bacteria | 2881 |
| 1303 | Ga0495675_0047428 | 3300047444 | Bacteria | 2733 |
| 1304 | Ga0495675_0055935 | 3300047444 | Bacteria | 2502 |
| 1305 | Ga0495677_0164299 | 3300047445 | Bacteria | 857 |
| 1306 | Ga0495679_000045 | 3300047446 | Bacteria | 133780 |
| 1307 | Ga0495679_060283 | 3300047446 | Bacteria | 1114 |
| 1308 | Ga0495685_059424 | 3300047447 | Bacteria | 1290 |
| 1309 | Ga0495673_0080335 | 3300047469 | Bacteria | 1352 |
| 1310 | Ga0495673_0082151 | 3300047469 | Bacteria | 1333 |
| 1311 | Ga0495673_0151112 | 3300047469 | Bacteria | 897 |
| 1312 | Ga0495681_0044114 | 3300047470 | Bacteria | 2146 |
| 1313 | Ga0495681_0309890 | 3300047470 | Bacteria | 609 |
| 1314 | Ga0495684_0301756 | 3300047471 | Bacteria | 1150 |
| 1315 | Ga0495684_0596202 | 3300047471 | Bacteria | 746 |
| 1316 | Ga0495686_0017669 | 3300047472 | Bacteria | 4800 |
| 1317 | Ga0495686_0034356 | 3300047472 | Bacteria | 3266 |
| 1318 | Ga0495686_0070368 | 3300047472 | Bacteria | 2156 |
| 1319 | Ga0495686_0236455 | 3300047472 | Bacteria | 1032 |
| 1320 | Ga0495593_0004158 | 3300047673 | Bacteria | 8618 |
| 1321 | Ga0495593_0006841 | 3300047673 | Bacteria | 6675 |
| 1322 | Ga0495593_0018177 | 3300047673 | Bacteria | 3954 |
| 1323 | Ga0495593_0118478 | 3300047673 | Bacteria | 1348 |
| 1324 | Ga0495593_0153095 | 3300047673 | Bacteria | 1166 |
| 1325 | Ga0495602_0000451 | 3300048088 | Bacteria | 38382 |
| 1326 | Ga0495602_0051921 | 3300048088 | Bacteria | 3647 |
| 1327 | Ga0495602_0388114 | 3300048088 | Bacteria | 998 |
| 1328 | Ga0495614_0024646 | 3300048089 | Bacteria | 2597 |
| 1329 | Ga0495626_0056877 | 3300048091 | Bacteria | 1790 |
| 1330 | Ga0495626_0082558 | 3300048091 | Bacteria | 1425 |
| 1331 | Ga0495626_0085873 | 3300048091 | Bacteria | 1391 |
| 1332 | Ga0495626_0096506 | 3300048091 | Bacteria | 1294 |
| 1333 | Ga0496100_0000149 | 3300048903 | Bacteria | 38827 |
| 1334 | Ga0496100_0033277 | 3300048903 | Bacteria | 3224 |
| 1335 | Ga0496100_0041046 | 3300048903 | Bacteria | 2947 |
| 1336 | Ga0496100_0264530 | 3300048903 | Bacteria | 1276 |
| 1337 | Ga0496100_0358057 | 3300048903 | Bacteria | 1103 |
| 1338 | Ga0496101_0000204 | 3300048904 | Bacteria | 45284 |
| 1339 | Ga0496101_0035408 | 3300048904 | Bacteria | 3531 |
| 1340 | Ga0496101_0065053 | 3300048904 | Bacteria | 2658 |
| 1341 | Ga0496101_0071732 | 3300048904 | Bacteria | 2540 |
| 1342 | Ga0496101_0093750 | 3300048904 | Bacteria | 2237 |
| 1343 | Ga0496101_0500979 | 3300048904 | Bacteria | 959 |
| 1344 | Ga0496101_0897247 | 3300048904 | Bacteria | 698 |
| 1345 | Ga0496102_0000298 | 3300048905 | Bacteria | 63657 |
| 1346 | Ga0496102_0003655 | 3300048905 | Bacteria | 13004 |
| 1347 | Ga0496102_0006544 | 3300048905 | Bacteria | 9946 |
| 1348 | Ga0496102_0007864 | 3300048905 | Bacteria | 9109 |
| 1349 | Ga0496102_0009745 | 3300048905 | Bacteria | 8261 |
| 1350 | Ga0496102_0154782 | 3300048905 | Bacteria | 2155 |
| 1351 | Ga0496102_0323893 | 3300048905 | Bacteria | 1452 |
| 1352 | Ga0496102_0401113 | 3300048905 | Bacteria | 1289 |
| 1353 | Ga0496102_0540259 | 3300048905 | Bacteria | 1088 |
| 1354 | Ga0496102_1356304 | 3300048905 | Bacteria | 630 |
| 1355 | Ga0496103_0000253 | 3300048906 | Bacteria | 51430 |
| 1356 | Ga0496103_0017224 | 3300048906 | Bacteria | 4322 |
| 1357 | Ga0496103_0021495 | 3300048906 | Bacteria | 3882 |
| 1358 | Ga0496103_0069087 | 3300048906 | Bacteria | 2208 |
| 1359 | Ga0496104_0015320 | 3300048907 | Bacteria | 6943 |
| 1360 | Ga0496104_0019627 | 3300048907 | Bacteria | 6188 |
| 1361 | Ga0496104_0049079 | 3300048907 | Bacteria | 3980 |
| 1362 | Ga0496104_0057978 | 3300048907 | Bacteria | 3665 |
| 1363 | Ga0496104_0061505 | 3300048907 | Bacteria | 3560 |
| 1364 | Ga0496104_0071071 | 3300048907 | Bacteria | 3309 |
| 1365 | Ga0496104_0139105 | 3300048907 | Bacteria | 2333 |
| 1366 | Ga0496104_0379489 | 3300048907 | Bacteria | 1326 |
| 1367 | Ga0496104_0398067 | 3300048907 | Bacteria | 1289 |
| 1368 | Ga0496104_0552097 | 3300048907 | Bacteria | 1063 |
| 1369 | Ga0496105_0004996 | 3300048908 | Bacteria | 10039 |
| 1370 | Ga0496105_0041568 | 3300048908 | Bacteria | 3789 |
| 1371 | Ga0496105_0045123 | 3300048908 | Bacteria | 3636 |
| 1372 | Ga0496105_0057930 | 3300048908 | Bacteria | 3198 |
| 1373 | Ga0496105_0110101 | 3300048908 | Bacteria | 2273 |
| 1374 | Ga0496105_0238098 | 3300048908 | Bacteria | 1478 |
| 1375 | Ga0496106_0000032 | 3300048909 | Bacteria | 134707 |
| 1376 | Ga0496106_0006719 | 3300048909 | Bacteria | 8522 |
| 1377 | Ga0496106_0007795 | 3300048909 | Bacteria | 7922 |
| 1378 | Ga0496106_0063916 | 3300048909 | Bacteria | 2798 |
| 1379 | Ga0496106_0066374 | 3300048909 | Bacteria | 2748 |
| 1380 | Ga0496106_0180366 | 3300048909 | Bacteria | 1676 |
| 1381 | Ga0496106_0206439 | 3300048909 | Bacteria | 1564 |
| 1382 | Ga0496106_1390027 | 3300048909 | Bacteria | 543 |
| 1383 | Ga0496107_0030005 | 3300048910 | Bacteria | 3874 |
| 1384 | Ga0496107_0145813 | 3300048910 | Bacteria | 1750 |
| 1385 | Ga0496107_0246379 | 3300048910 | Bacteria | 1330 |
| 1386 | Ga0496107_0296782 | 3300048910 | Bacteria | 1203 |
| 1387 | Ga0496107_0332851 | 3300048910 | Bacteria | 1130 |
| 1388 | Ga0496108_0323820 | 3300048911 | Bacteria | 1344 |
| 1389 | Ga0496108_0353499 | 3300048911 | Bacteria | 1282 |
| 1390 | Ga0496108_0861419 | 3300048911 | Bacteria | 779 |
| 1391 | Ga0496108_0872131 | 3300048911 | Bacteria | 774 |
| 1392 | Ga0496108_1252712 | 3300048911 | Bacteria | 625 |
| 1393 | Ga0496109_0129267 | 3300048912 | Bacteria | 2357 |
| 1394 | Ga0496109_0171760 | 3300048912 | Bacteria | 2034 |
| 1395 | Ga0496109_0333029 | 3300048912 | Bacteria | 1433 |
| 1396 | Ga0496109_0628005 | 3300048912 | Unclassified | 1011 |
| 1397 | Ga0496109_1422020 | 3300048912 | Bacteria | 629 |
| 1398 | Ga0496109_1547810 | 3300048912 | Bacteria | 598 |
| 1399 | Ga0496110_0004145 | 3300048913 | Bacteria | 11203 |
| 1400 | Ga0496110_0022093 | 3300048913 | Bacteria | 5397 |
| 1401 | Ga0496110_0053482 | 3300048913 | Bacteria | 3550 |
| 1402 | Ga0496110_0114337 | 3300048913 | Bacteria | 2428 |
| 1403 | Ga0496110_0144298 | 3300048913 | Bacteria | 2153 |
| 1404 | Ga0496110_1375052 | 3300048913 | Bacteria | 615 |
| 1405 | Ga0496110_1641845 | 3300048913 | Bacteria | 553 |
| 1406 | Ga0496111_0057815 | 3300048914 | Bacteria | 2807 |
| 1407 | Ga0496111_0076658 | 3300048914 | Bacteria | 2437 |
| 1408 | Ga0496111_0116895 | 3300048914 | Bacteria | 1967 |
| 1409 | Ga0496111_0194734 | 3300048914 | Bacteria | 1507 |
| 1410 | Ga0496111_0409439 | 3300048914 | Bacteria | 1002 |
| 1411 | Ga0496111_0957551 | 3300048914 | Bacteria | 615 |
| 1412 | Ga0496112_0081915 | 3300048915 | Bacteria | 3192 |
| 1413 | Ga0496112_0107336 | 3300048915 | Bacteria | 2762 |
| 1414 | Ga0496112_0120672 | 3300048915 | Bacteria | 2591 |
| 1415 | Ga0496112_0341432 | 3300048915 | Bacteria | 1441 |
| 1416 | Ga0496113_0001027 | 3300048916 | Bacteria | 15012 |
| 1417 | Ga0496113_0005040 | 3300048916 | Bacteria | 8196 |
| 1418 | Ga0496114_0003149 | 3300048917 | Bacteria | 12672 |
| 1419 | Ga0496114_0008418 | 3300048917 | Bacteria | 8168 |
| 1420 | Ga0496114_0026734 | 3300048917 | Bacteria | 4727 |
| 1421 | Ga0496114_0072860 | 3300048917 | Bacteria | 2890 |
| 1422 | Ga0496114_0090054 | 3300048917 | Bacteria | 2604 |
| 1423 | Ga0496114_0185758 | 3300048917 | Bacteria | 1816 |
| 1424 | Ga0496114_0229483 | 3300048917 | Bacteria | 1631 |
| 1425 | Ga0496114_0674838 | 3300048917 | Bacteria | 908 |
| 1426 | Ga0496115_0000844 | 3300048918 | Bacteria | 22363 |
| 1427 | Ga0496115_0002412 | 3300048918 | Bacteria | 13419 |
| 1428 | Ga0496115_0051522 | 3300048918 | Bacteria | 3301 |
| 1429 | Ga0496115_0058192 | 3300048918 | Bacteria | 3110 |
| 1430 | Ga0496115_0176999 | 3300048918 | Bacteria | 1764 |
| 1431 | Ga0496115_0905442 | 3300048918 | Bacteria | 680 |
| 1432 | Ga0496116_0018763 | 3300048919 | Bacteria | 5316 |
| 1433 | Ga0496116_0046983 | 3300048919 | Bacteria | 2910 |
| 1434 | Ga0496116_0087140 | 3300048919 | Bacteria | 1912 |
| 1435 | Ga0496116_0104014 | 3300048919 | Bacteria | 1688 |
| 1436 | Ga0496116_0107605 | 3300048919 | Bacteria | 1648 |
| 1437 | Ga0496117_0000171 | 3300048920 | Bacteria | 135051 |
| 1438 | Ga0496117_0089273 | 3300048920 | Bacteria | 1991 |
| 1439 | Ga0496117_0102805 | 3300048920 | Bacteria | 1802 |
| 1440 | Ga0496117_0220037 | 3300048920 | Bacteria | 1057 |
| 1441 | Ga0496117_0292987 | 3300048920 | Bacteria | 865 |
| 1442 | Ga0496118_0000276 | 3300048921 | Bacteria | 90379 |
| 1443 | Ga0496118_0000354 | 3300048921 | Bacteria | 77586 |
| 1444 | Ga0496118_0029441 | 3300048921 | Bacteria | 4604 |
| 1445 | Ga0496118_0045259 | 3300048921 | Bacteria | 3438 |
| 1446 | Ga0496118_0127903 | 3300048921 | Bacteria | 1638 |
| 1447 | Ga0496119_0017495 | 3300048922 | Bacteria | 5388 |
| 1448 | Ga0496119_0050922 | 3300048922 | Bacteria | 2549 |
| 1449 | Ga0496120_0257633 | 3300048923 | Bacteria | 816 |
| 1450 | Ga0496121_0000141 | 3300048924 | Bacteria | 161556 |
| 1451 | Ga0496121_0003156 | 3300048924 | Bacteria | 23758 |
| 1452 | Ga0496121_0003736 | 3300048924 | Bacteria | 21331 |
| 1453 | Ga0496121_0005380 | 3300048924 | Bacteria | 16449 |
| 1454 | Ga0496121_0016043 | 3300048924 | Bacteria | 7764 |
| 1455 | Ga0496121_0112777 | 3300048924 | Bacteria | 2070 |
| 1456 | Ga0496121_0152653 | 3300048924 | Bacteria | 1698 |
| 1457 | Ga0496122_0012850 | 3300048925 | Bacteria | 8279 |
| 1458 | Ga0496122_0068789 | 3300048925 | Bacteria | 2540 |
| 1459 | Ga0496123_0130883 | 3300048926 | Bacteria | 1390 |
| 1460 | Ga0496124_0000282 | 3300048927 | Bacteria | 96697 |
| 1461 | Ga0496124_0056706 | 3300048927 | Bacteria | 3303 |
| 1462 | Ga0496124_0085211 | 3300048927 | Bacteria | 2590 |
| 1463 | Ga0496124_0148795 | 3300048927 | Unclassified | 1840 |
| 1464 | Ga0496124_0288008 | 3300048927 | Bacteria | 1194 |
| 1465 | Ga0496125_0071926 | 3300048928 | Bacteria | 2699 |
| 1466 | Ga0496125_0086012 | 3300048928 | Unclassified | 2380 |
| 1467 | Ga0496125_0172295 | 3300048928 | Bacteria | 1453 |
| 1468 | Ga0496126_0001351 | 3300048929 | Bacteria | 38922 |
| 1469 | Ga0496126_0003785 | 3300048929 | Bacteria | 18777 |
| 1470 | Ga0496126_0004234 | 3300048929 | Bacteria | 17268 |
| 1471 | Ga0496126_0078962 | 3300048929 | Bacteria | 2915 |
| 1472 | Ga0496126_0332429 | 3300048929 | Bacteria | 1247 |
| 1473 | Ga0496126_0875021 | 3300048929 | Bacteria | 683 |
| 1474 | Ga0496126_1417230 | 3300048929 | Bacteria | 501 |
| 1475 | Ga0495678_013024 | 3300049459 | Bacteria | 3920 |
| 1476 | Ga0495678_084829 | 3300049459 | Bacteria | 1129 |
| 1477 | Ga0495682_0037955 | 3300049460 | Bacteria | 1770 |
| 1478 | Ga0495682_0067637 | 3300049460 | Bacteria | 1287 |
| 1479 | Ga0495682_0079624 | 3300049460 | Bacteria | 1178 |
| 1480 | Ga0495682_0177830 | 3300049460 | Bacteria | 756 |
| 1481 | Ga0501031_0054357 | 3300049568 | Bacteria | 2609 |
| 1482 | Ga0501031_0236266 | 3300049568 | Bacteria | 1189 |
| 1483 | Ga0501032_0065568 | 3300049569 | Bacteria | 2428 |
| 1484 | Ga0501032_0166614 | 3300049569 | Bacteria | 1446 |
| 1485 | Ga0501033_0051248 | 3300049570 | Bacteria | 3059 |
| 1486 | Ga0501033_0063844 | 3300049570 | Bacteria | 2710 |
| 1487 | Ga0501033_0226356 | 3300049570 | Bacteria | 1330 |
| 1488 | Ga0501033_0779283 | 3300049570 | Bacteria | 647 |
| 1489 | Ga0501034_0163377 | 3300049571 | Bacteria | 2196 |
| 1490 | Ga0501034_0204748 | 3300049571 | Bacteria | 1930 |
| 1491 | Ga0501034_0412934 | 3300049571 | Bacteria | 1272 |
| 1492 | Ga0501034_0473025 | 3300049571 | Bacteria | 1169 |
| 1493 | Ga0501036_0086051 | 3300049572 | Bacteria | 2657 |
| 1494 | Ga0501037_0063212 | 3300049573 | Bacteria | 2698 |
| 1495 | Ga0501037_0701472 | 3300049573 | Bacteria | 673 |
| 1496 | Ga0501038_0015812 | 3300049574 | Bacteria | 6856 |
| 1497 | Ga0501038_0345643 | 3300049574 | Bacteria | 1159 |
| 1498 | Ga0501039_0167357 | 3300049575 | Bacteria | 1728 |
| 1499 | Ga0501040_0421083 | 3300049576 | Bacteria | 960 |
| 1500 | Ga0501040_1050476 | 3300049576 | Bacteria | 591 |
| 1501 | Ga0501041_0097199 | 3300049577 | Bacteria | 1821 |
| 1502 | Ga0501043_0110685 | 3300049579 | Bacteria | 2156 |
| 1503 | Ga0501043_0148973 | 3300049579 | Bacteria | 1831 |
| 1504 | Ga0501043_0234142 | 3300049579 | Bacteria | 1418 |
| 1505 | Ga0501043_0387597 | 3300049579 | Bacteria | 1057 |
| 1506 | Ga0501043_0545554 | 3300049579 | Bacteria | 862 |
| 1507 | Ga0501043_0580313 | 3300049579 | Bacteria | 830 |
| 1508 | Ga0501046_0224994 | 3300049580 | Bacteria | 1388 |
| 1509 | Ga0501047_0000767 | 3300049581 | Bacteria | 33628 |
| 1510 | Ga0501047_0047995 | 3300049581 | Bacteria | 4124 |
| 1511 | Ga0501047_0113015 | 3300049581 | Bacteria | 2598 |
| 1512 | Ga0501047_0275039 | 3300049581 | Bacteria | 1530 |
| 1513 | Ga0501047_0641583 | 3300049581 | Bacteria | 882 |
| 1514 | Ga0501048_0041574 | 3300049582 | Bacteria | 3292 |
| 1515 | Ga0501048_0166114 | 3300049582 | Bacteria | 1563 |
| 1516 | Ga0501068_0083238 | 3300049584 | Bacteria | 1966 |
| 1517 | Ga0501068_0401870 | 3300049584 | Bacteria | 883 |
| 1518 | Ga0501069_0041447 | 3300049585 | Bacteria | 2545 |
| 1519 | Ga0501070_0036539 | 3300049586 | Bacteria | 4101 |
| 1520 | Ga0501070_0082455 | 3300049586 | Bacteria | 2662 |
| 1521 | Ga0501070_0334466 | 3300049586 | Bacteria | 1230 |
| 1522 | Ga0501070_0443715 | 3300049586 | Bacteria | 1047 |
| 1523 | Ga0501070_0448025 | 3300049586 | Bacteria | 1041 |
| 1524 | Ga0501070_0814577 | 3300049586 | Bacteria | 732 |
| 1525 | Ga0501071_0123633 | 3300049587 | Bacteria | 1919 |
| 1526 | Ga0501071_0162122 | 3300049587 | Bacteria | 1671 |
| 1527 | Ga0501071_0662665 | 3300049587 | Bacteria | 803 |
| 1528 | Ga0501072_0175138 | 3300049588 | Bacteria | 1711 |
| 1529 | Ga0501072_0742313 | 3300049588 | Bacteria | 770 |
| 1530 | Ga0501073_0018731 | 3300049589 | Bacteria | 5005 |
| 1531 | Ga0501073_0092455 | 3300049589 | Bacteria | 2102 |
| 1532 | Ga0501073_0193696 | 3300049589 | Bacteria | 1406 |
| 1533 | Ga0501073_0227964 | 3300049589 | Bacteria | 1287 |
| 1534 | Ga0501073_0961909 | 3300049589 | Bacteria | 588 |
| 1535 | Ga0501074_0013400 | 3300049590 | Bacteria | 5961 |
| 1536 | Ga0501074_0170120 | 3300049590 | Bacteria | 1555 |
| 1537 | Ga0501074_0187727 | 3300049590 | Bacteria | 1474 |
| 1538 | Ga0501076_0008169 | 3300049592 | Bacteria | 7660 |
| 1539 | Ga0501076_0032944 | 3300049592 | Bacteria | 4046 |
| 1540 | Ga0501077_0791896 | 3300049593 | Bacteria | 609 |
| 1541 | Ga0501202_010428 | 3300049652 | Bacteria | 1724 |
| 1542 | Ga0501230_010201 | 3300049667 | Bacteria | 1462 |
| 1543 | Ga0501240_043357 | 3300049673 | Bacteria | 754 |
| 1544 | Ga0501249_029960 | 3300049679 | Bacteria | 1211 |
| 1545 | Ga0501253_110990 | 3300049683 | Bacteria | 654 |
| 1546 | Ga0501079_0004373 | 3300049741 | Bacteria | 10472 |
| 1547 | Ga0501079_0086110 | 3300049741 | Bacteria | 2432 |
| 1548 | Ga0501079_0250664 | 3300049741 | Bacteria | 1384 |
| 1549 | Ga0501080_0005264 | 3300049742 | Bacteria | 11520 |
| 1550 | Ga0501080_0005282 | 3300049742 | Bacteria | 11503 |
| 1551 | Ga0501080_0204010 | 3300049742 | Bacteria | 1814 |
| 1552 | Ga0501080_1085673 | 3300049742 | Bacteria | 691 |
| 1553 | Ga0501081_0202231 | 3300049743 | Bacteria | 1441 |
| 1554 | Ga0501081_0286665 | 3300049743 | Bacteria | 1206 |
| 1555 | Ga0501083_0015218 | 3300049744 | Bacteria | 5385 |
| 1556 | Ga0501083_0364549 | 3300049744 | Bacteria | 940 |
| 1557 | Ga0501241_074598 | 3300049758 | Bacteria | 698 |
| 1558 | Ga0501262_000018 | 3300049759 | Bacteria | 23886 |
| 1559 | Ga0501035_0002389 | 3300049822 | Bacteria | 18435 |
| 1560 | Ga0501035_0007057 | 3300049822 | Bacteria | 10501 |
| 1561 | Ga0501035_0022406 | 3300049822 | Bacteria | 5800 |
| 1562 | Ga0501035_0043215 | 3300049822 | Bacteria | 4062 |
| 1563 | Ga0501035_0048919 | 3300049822 | Bacteria | 3790 |
| 1564 | Ga0501035_0066424 | 3300049822 | Bacteria | 3201 |
| 1565 | Ga0501035_0262795 | 3300049822 | Bacteria | 1463 |
| 1566 | Ga0501035_0304279 | 3300049822 | Bacteria | 1343 |
| 1567 | Ga0501035_0428886 | 3300049822 | Bacteria | 1097 |
| 1568 | Ga0501044_0008426 | 3300049823 | Bacteria | 11305 |
| 1569 | Ga0501044_0015381 | 3300049823 | Bacteria | 8240 |
| 1570 | Ga0501044_0030021 | 3300049823 | Bacteria | 5730 |
| 1571 | Ga0501044_0191621 | 3300049823 | Bacteria | 2007 |
| 1572 | Ga0501044_0272016 | 3300049823 | Bacteria | 1629 |
| 1573 | Ga0501044_0654710 | 3300049823 | Bacteria | 939 |
| 1574 | Ga0501044_0828805 | 3300049823 | Bacteria | 803 |
| 1575 | Ga0501044_0832002 | 3300049823 | Bacteria | 801 |
| 1576 | Ga0501045_0053177 | 3300049824 | Bacteria | 2959 |
| 1577 | nmdc:mga03683_177937_c1 | 3300050489 | Bacteria | 969 |
| 1578 | nmdc:mga03683_18418_c1 | 3300050489 | Bacteria | 2655 |
| 1579 | nmdc:mga03683_261517_c1 | 3300050489 | Bacteria | 805 |
| 1580 | nmdc:mga03683_302002_c1 | 3300050489 | Bacteria | 751 |
| 1581 | nmdc:mga03683_30365_c1 | 3300050489 | Bacteria | 2162 |
| 1582 | nmdc:mga03683_40018_c1 | 3300050489 | Bacteria | 1921 |
| 1583 | nmdc:mga03n38_242378_c1 | 3300050490 | Bacteria | 949 |
| 1584 | nmdc:mga03n38_4824_c1 | 3300050490 | Bacteria | 4517 |
| 1585 | nmdc:mga00v17_14257_c1 | 3300050491 | Bacteria | 4433 |
| 1586 | nmdc:mga0yw44_1012827_c1 | 3300050492 | Bacteria | 562 |
| 1587 | nmdc:mga0yw44_105510_c1 | 3300050492 | Bacteria | 1800 |
| 1588 | nmdc:mga0yw44_4066_c1 | 3300050492 | Bacteria | 6626 |
| 1589 | nmdc:mga0yw44_49946_c1 | 3300050492 | Bacteria | 2527 |
| 1590 | nmdc:mga0k408_151171_c1 | 3300050493 | Bacteria | 1383 |
| 1591 | nmdc:mga0k408_17982_c1 | 3300050493 | Bacteria | 3941 |
| 1592 | nmdc:mga0k408_26346_c1 | 3300050493 | Bacteria | 3296 |
| 1593 | nmdc:mga0k408_4257_c1 | 3300050493 | Bacteria | 7595 |
| 1594 | nmdc:mga0k408_534112_c1 | 3300050493 | Bacteria | 694 |
| 1595 | nmdc:mga0k408_773_c1 | 3300050493 | Bacteria | 17576 |
| 1596 | nmdc:mga0k408_781_c1 | 3300050493 | Bacteria | 17522 |
| 1597 | nmdc:mga0k408_85857_c1 | 3300050493 | Bacteria | 1847 |
| 1598 | nmdc:mga06z11_111075_c1 | 3300050494 | Bacteria | 1518 |
| 1599 | nmdc:mga06z11_13314_c1 | 3300050494 | Bacteria | 3608 |
| 1600 | nmdc:mga06z11_348575_c1 | 3300050494 | Bacteria | 886 |
| 1601 | nmdc:mga06z11_444249_c1 | 3300050494 | Bacteria | 783 |
| 1602 | nmdc:mga06z11_57469_c1 | 3300050494 | Bacteria | 2015 |
| 1603 | nmdc:mga06z11_724228_c1 | 3300050494 | Bacteria | 606 |
| 1604 | nmdc:mga04h51_3324_c1 | 3300050495 | Bacteria | 2168 |
| 1605 | nmdc:mga07m45_185475_c1 | 3300050496 | Bacteria | 1210 |
| 1606 | nmdc:mga07m45_226359_c1 | 3300050496 | Bacteria | 1088 |
| 1607 | nmdc:mga07m45_23225_c1 | 3300050496 | Bacteria | 3388 |
| 1608 | nmdc:mga07m45_37997_c1 | 3300050496 | Bacteria | 2686 |
| 1609 | nmdc:mga0qj67_10909_c1 | 3300050509 | Bacteria | 6798 |
| 1610 | nmdc:mga0qj67_81413_c1 | 3300050509 | Bacteria | 2596 |
| 1611 | nmdc:mga08y16_1342194_c1 | 3300050511 | Bacteria | 680 |
| 1612 | nmdc:mga08y16_26645_c1 | 3300050511 | Bacteria | 6092 |
| 1613 | nmdc:mga08y16_271743_c1 | 3300050511 | Bacteria | 1749 |
| 1614 | nmdc:mga08y16_709729_c1 | 3300050511 | Bacteria | 1005 |
| 1615 | nmdc:mga08y16_786418_c1 | 3300050511 | Bacteria | 945 |
| 1616 | nmdc:mga08y16_857049_c1 | 3300050511 | Bacteria | 897 |
| 1617 | nmdc:mga08y16_99364_c1 | 3300050511 | Bacteria | 3030 |
| 1618 | nmdc:mga0a205_108416_c1 | 3300050515 | Bacteria | 2675 |
| 1619 | nmdc:mga0sz30_105712_c1 | 3300050516 | Bacteria | 769 |
| 1620 | nmdc:mga0sz30_27582_c1 | 3300050516 | Bacteria | 2333 |
| 1621 | Ga0500578_0000002 | 3300053086 | Bacteria | 293507 |
| 1622 | Ga0500644_0001458 | 3300053088 | Bacteria | 6243 |
| 1623 | Ga0500646_0005532 | 3300053090 | Bacteria | 3195 |
| 1624 | Ga0500651_0038444 | 3300053093 | Bacteria | 3014 |
| 1625 | Ga0500651_0077221 | 3300053093 | Bacteria | 2067 |
| 1626 | Ga0500555_150950 | 3300053103 | Bacteria | 569 |
| 1627 | Ga0500591_142302 | 3300053115 | Bacteria | 944 |
| 1628 | Ga0500594_0001847 | 3300053118 | Bacteria | 4583 |
| 1629 | Ga0500608_002001 | 3300053122 | Bacteria | 7299 |
| 1630 | Ga0500628_002992 | 3300053129 | Bacteria | 2778 |
| 1631 | Ga0500652_000076 | 3300053131 | Bacteria | 42942 |
| 1632 | Ga0500655_003466 | 3300053133 | Bacteria | 2850 |
| 1633 | Ga0500559_0000038 | 3300053136 | Bacteria | 109922 |
| 1634 | Ga0500559_0405411 | 3300053136 | Bacteria | 634 |
| 1635 | Ga0500568_0049523 | 3300053139 | Bacteria | 1657 |
| 1636 | Ga0500568_0107014 | 3300053139 | Bacteria | 1047 |
| 1637 | Ga0500577_0023081 | 3300053142 | Bacteria | 2074 |
| 1638 | Ga0500604_0001378 | 3300053151 | Bacteria | 6775 |
| 1639 | Ga0500604_0043040 | 3300053151 | Bacteria | 1371 |
| 1640 | Ga0500619_000367 | 3300053154 | Bacteria | 8432 |
| 1641 | Ga0500622_0000236 | 3300053156 | Bacteria | 57393 |
| 1642 | Ga0500622_0001043 | 3300053156 | Bacteria | 23134 |
| 1643 | Ga0500645_002979 | 3300053730 | Bacteria | 7180 |
| 1644 | Ga0500587_003821 | 3300053739 | Bacteria | 2091 |
| 1645 | Ga0501084_0257970 | 3300054114 | Bacteria | 1472 |
| 1646 | Ga0501084_0315009 | 3300054114 | Bacteria | 1321 |
| 1647 | Ga0501082_0235260 | 3300060353 | Bacteria | 1594 |
| 1648 | Ga0501082_0406808 | 3300060353 | Bacteria | 1188 |
| 1649 | Ga0501082_0407180 | 3300060353 | Bacteria | 1187 |
| 1650 | Ga0501082_0962972 | 3300060353 | Bacteria | 746 |
| 1651 | Ga0466962_0000671 | 3300061719 | Bacteria | 15203 |
| 1652 | Ga0466962_0026155 | 3300061719 | Bacteria | 2803 |
| 1653 | 2501070363 | 2501025501 | Bacteria | 7768574 |
| 1654 | 2501406829 | 2501025504 | Bacteria | 8008976 |
| 1655 | 2510247336 | 2510065045 | Bacteria | 7761063 |
| 1656 | 2511092901 | 2510917013 | Bacteria | 9951648 |
| 1657 | 2511097737 | 2510917014 | Bacteria | 8296963 |
| 1658 | 2511109342 | 2510917015 | Bacteria | 7950052 |
| 1659 | 2512351164 | 2512047030 | Bacteria | 9031815 |
| 1660 | 2513554785 | 2513237082 | Bacteria | 8640282 |
| 1661 | 2513565441 | 2513237083 | Bacteria | 8410967 |
| 1662 | 2514048330 | 2513237166 | Bacteria | 10373764 |
| 1663 | 2515685421 | 2515154122 | Bacteria | 8609520 |
| 1664 | 2516022627 | 2515154189 | Bacteria | 9629850 |
| 1665 | 2548497973 | 2547132374 | Bacteria | 5530232 |
| 1666 | 2563056692 | 2562617112 | Bacteria | 10918404 |
| 1667 | 2587733019 | 2585428058 | Bacteria | 6853932 |
| 1668 | 2587757295 | 2585428062 | Bacteria | 6842168 |
| 1669 | 2600815389 | 2600255067 | Bacteria | 6795583 |
| 1670 | 2643991488 | 2643221596 | Bacteria | 5006805 |
| 1671 | 2644062434 | 2643221609 | Bacteria | 6756331 |
| 1672 | 2644076533 | 2643221611 | Bacteria | 6820941 |
| 1673 | 2644159796 | 2643221628 | Bacteria | 5745828 |
| 1674 | 2644245725 | 2643221644 | Bacteria | 6865017 |
| 1675 | 2644529063 | 2643221695 | Bacteria | 3441323 |
| 1676 | 2644646072 | 2643221717 | Bacteria | 5676132 |
| 1677 | 2713481299 | 2711768613 | Bacteria | 11048459 |
| 1678 | 2719638490 | 2718217991 | Bacteria | 7829542 |
| 1679 | 2721028365 | 2718218334 | Bacteria | 4765486 |
| 1680 | 2816474857 | 2816332133 | Bacteria | 7249298 |
| 1681 | 2819619688 | 2818991450 | Bacteria | 6962147 |
| 1682 | 2821446133 | 2821443989 | Bacteria | 7658172 |
| 1683 | 2839142828 | 2839138175 | Bacteria | 6549354 |
| 1684 | 2842325987 | 2842324504 | Bacteria | 9364110 |
| 1685 | 2842351492 | 2842348783 | Bacteria | 9002918 |
| 1686 | 2842455309 | 2842454564 | Bacteria | 8730687 |
| 1687 | 2856291168 | 2856287931 | Bacteria | 7223934 |
| 1688 | 2857364207 | 2857357740 | Bacteria | 9937880 |
| 1689 | 2883095724 | 2883087390 | Bacteria | 9532701 |
| 1690 | 2885280221 | 2885270888 | Bacteria | 9831543 |
| 1691 | 2894656750 | 2894652903 | Bacteria | 4587256 |
| 1692 | 2902684627 | 2902682994 | Bacteria | 8951596 |
| 1693 | 2921647049 | 2921643360 | Bacteria | 11448031 |
| 1694 | 2928111295 | 2928108538 | Bacteria | 7360024 |
| 1695 | 2928138097 | 2928135762 | Bacteria | 7259641 |
| 1696 | 2928506741 | 2928503688 | Bacteria | 7268108 |
| 1697 | 2945947783 | 2945945610 | Bacteria | 5951079 |
| 1698 | 2945972510 | 2945972063 | Bacteria | 6086495 |
| 1699 | 2990711568 | 2990710928 | Bacteria | 5002431 |
| 1700 | 642620405 | 642555113 | Bacteria | 8214658 |
| 1701 | 8003961864 | 8003955200 | Bacteria | 8601927 |
| 1702 | Ga0163161_10034921 | |||
| 1703 | JGI24739J22299_10003364 | |||
| 1704 | JGI24739J22299_10023427 | |||
| 1705 | JGI24739J22299_10084174 | |||
| 1706 | JGI24739J22299_10182118 | |||
| 1707 | JGI24737J22298_10024487 | |||
| 1708 | JGI24737J22298_10035457 | |||
| 1709 | JGI24735J21928_10000218 | |||
| 1710 | JGI24735J21928_10019288 | |||
| 1711 | JGI24735J21928_10084510 | |||
| 1712 | JGI24738J21930_10001339 | |||
| 1713 | JGI25151J46595_10002650 | |||
| 1714 | JGI25153J46596_10002559 | |||
| 1715 | JGI25153J46596_10004432 | |||
| 1716 | rootH2_10017111 | |||
| 1717 | rootL2_10017630 | |||
| 1718 | rootL2_10063704 | |||
| 1719 | rootH1_10057484 | |||
| 1720 | rootH1_10106569 | |||
| 1721 | JGI25160J50197_1000138 | |||
| 1722 | JGI25160J50197_1067284 | |||
| 1723 | Ga0055529_1000645 | |||
| 1724 | Ga0055526_1000025 | |||
| 1725 | Ga0055524_1000340 | |||
| 1726 | Ga0055528_1021709 | |||
| 1727 | Ga0055530_10001296 | |||
| 1728 | Ga0055540_1000202 | |||
| 1729 | Ga0055531_10006224 | |||
| 1730 | Ga0065165_1001498 | |||
| 1731 | Ga0065714_10003524 | |||
| 1732 | Ga0065714_10026103 | |||
| 1733 | Ga0065704_10314299 | |||
| 1734 | Ga0065712_10139593 | |||
| 1735 | Ga0065715_10382284 | |||
| 1736 | Ga0065707_10113921 | |||
| 1737 | Ga0070658_10002159 | |||
| 1738 | Ga0070658_10486117 | |||
| 1739 | Ga0070658_10509300 | |||
| 1740 | Ga0070676_10202976 | |||
| 1741 | Ga0070676_11087146 | |||
| 1742 | Ga0070683_100025002 | |||
| 1743 | Ga0070683_100454758 | |||
| 1744 | Ga0070683_101498005 | |||
| 1745 | Ga0070683_101622339 | |||
| 1746 | Ga0070690_100000170 | |||
| 1747 | Ga0070690_100006691 | |||
| 1748 | Ga0070690_100628572 | |||
| 1749 | Ga0070670_100056500 | |||
| 1750 | Ga0070670_100111461 | |||
| 1751 | Ga0070670_100338079 | |||
| 1752 | Ga0070670_101659532 | |||
| 1753 | Ga0070670_101999810 | |||
| 1754 | Ga0070677_10005411 | |||
| 1755 | Ga0070677_10135632 | |||
| 1756 | Ga0070677_10137563 | |||
| 1757 | Ga0070677_10379468 | |||
| 1758 | Ga0070677_10500380 | |||
| 1759 | Ga0068869_100058329 | |||
| 1760 | Ga0068869_100646122 | |||
| 1761 | Ga0068869_101210580 | |||
| 1762 | Ga0068869_101740734 | |||
| 1763 | Ga0070666_10003654 | |||
| 1764 | Ga0070666_10005053 | |||
| 1765 | Ga0070666_10005266 | |||
| 1766 | Ga0070680_100021168 | |||
| 1767 | Ga0070680_100075010 | |||
| 1768 | Ga0070680_101381494 | |||
| 1769 | Ga0070682_100366538 | |||
| 1770 | Ga0068868_100001028 | |||
| 1771 | Ga0068868_100313646 | |||
| 1772 | Ga0068868_100661690 | |||
| 1773 | Ga0068868_101195922 | |||
| 1774 | Ga0070660_100438171 | |||
| 1775 | Ga0070660_100804856 | |||
| 1776 | Ga0070660_101608049 | |||
| 1777 | Ga0070689_100002054 | |||
| 1778 | Ga0070689_100045528 | |||
| 1779 | Ga0070689_100230457 | |||
| 1780 | Ga0070689_100658192 | |||
| 1781 | Ga0070689_101011139 | |||
| 1782 | Ga0070689_101360385 | |||
| 1783 | Ga0070687_100161025 | |||
| 1784 | Ga0070687_101181569 | |||
| 1785 | Ga0070661_100020048 | |||
| 1786 | Ga0070661_100311536 | |||
| 1787 | Ga0070661_100870899 | |||
| 1788 | Ga0070661_101040801 | |||
| 1789 | Ga0070692_11093151 | |||
| 1790 | Ga0070668_100004204 | |||
| 1791 | Ga0070668_100059222 | |||
| 1792 | Ga0070668_100442266 | |||
| 1793 | Ga0070668_100483779 | |||
| 1794 | Ga0070668_100527611 | |||
| 1795 | Ga0070668_100573253 | |||
| 1796 | Ga0070668_101316589 | |||
| 1797 | Ga0070668_101458564 | |||
| 1798 | Ga0070669_100008000 | |||
| 1799 | Ga0070669_100035511 | |||
| 1800 | Ga0070669_100365896 | |||
| 1801 | Ga0070669_100495557 | |||
| 1802 | Ga0070669_101907033 | |||
| 1803 | Ga0070675_100002408 | |||
| 1804 | Ga0070675_100132674 | |||
| 1805 | Ga0070675_100211012 | |||
| 1806 | Ga0070675_100761328 | |||
| 1807 | Ga0070675_100964261 | |||
| 1808 | Ga0070671_100000044 | |||
| 1809 | Ga0070671_100012205 | |||
| 1810 | Ga0070671_100020242 | |||
| 1811 | Ga0070671_100109424 | |||
| 1812 | Ga0070671_100246287 | |||
| 1813 | Ga0070671_100252344 | |||
| 1814 | Ga0070671_100304997 | |||
| 1815 | Ga0070671_100314450 | |||
| 1816 | Ga0070671_100493664 | |||
| 1817 | Ga0070671_100553871 | |||
| 1818 | Ga0070671_101027822 | |||
| 1819 | Ga0070674_100014412 | |||
| 1820 | Ga0070674_100053212 | |||
| 1821 | Ga0070674_100321061 | |||
| 1822 | Ga0070674_100375084 | |||
| 1823 | Ga0070674_100668358 | |||
| 1824 | Ga0070674_100718574 | |||
| 1825 | Ga0070673_100002015 | |||
| 1826 | Ga0070673_100017551 | |||
| 1827 | Ga0070673_100189949 | |||
| 1828 | Ga0070673_100394870 | |||
| 1829 | Ga0070673_100415319 | |||
| 1830 | Ga0070673_100718191 | |||
| 1831 | Ga0070673_100784061 | |||
| 1832 | Ga0070673_100921324 | |||
| 1833 | Ga0070688_100079229 | |||
| 1834 | Ga0070688_100499717 | |||
| 1835 | Ga0070688_101305019 | |||
| 1836 | Ga0070688_101588166 | |||
| 1837 | Ga0070659_100445630 | |||
| 1838 | Ga0070659_100466896 | |||
| 1839 | Ga0070659_100622539 | |||
| 1840 | Ga0070659_100931856 | |||
| 1841 | Ga0070667_100000708 | |||
| 1842 | Ga0070667_100001356 | |||
| 1843 | Ga0070667_100010392 | |||
| 1844 | Ga0070667_100011492 | |||
| 1845 | Ga0070667_100044454 | |||
| 1846 | Ga0070667_100053057 | |||
| 1847 | Ga0070667_100174704 | |||
| 1848 | Ga0070667_100220658 | |||
| 1849 | Ga0070667_100679270 | |||
| 1850 | Ga0070701_10045625 | |||
| 1851 | Ga0070701_10455387 | |||
| 1852 | Ga0070711_100023555 | |||
| 1853 | Ga0070705_100523983 | |||
| 1854 | Ga0070700_100062062 | |||
| 1855 | Ga0070700_100378742 | |||
| 1856 | Ga0070700_100582930 | |||
| 1857 | Ga0070700_100591841 | |||
| 1858 | Ga0070694_100312606 | |||
| 1859 | Ga0070708_100247604 | |||
| 1860 | Ga0070663_100042514 | |||
| 1861 | Ga0070663_100138790 | |||
| 1862 | Ga0070663_100354199 | |||
| 1863 | Ga0070663_100416219 | |||
| 1864 | Ga0070678_100003442 | |||
| 1865 | Ga0070678_100059660 | |||
| 1866 | Ga0070678_100155746 | |||
| 1867 | Ga0070678_100192916 | |||
| 1868 | Ga0070678_100543016 | |||
| 1869 | Ga0070678_100585829 | |||
| 1870 | Ga0070678_100636243 | |||
| 1871 | Ga0070662_100007793 | |||
| 1872 | Ga0070662_100026968 | |||
| 1873 | Ga0070662_100049235 | |||
| 1874 | Ga0070662_100275954 | |||
| 1875 | Ga0070662_100288620 | |||
| 1876 | Ga0070662_100325760 | |||
| 1877 | Ga0070662_100392451 | |||
| 1878 | Ga0070662_100648410 | |||
| 1879 | Ga0070681_10009145 | |||
| 1880 | Ga0070681_10235743 | |||
| 1881 | Ga0068867_100006852 | |||
| 1882 | Ga0068867_100010539 | |||
| 1883 | Ga0068867_100020738 | |||
| 1884 | Ga0068867_100194070 | |||
| 1885 | Ga0068867_100278550 | |||
| 1886 | Ga0068867_100451275 | |||
| 1887 | Ga0068867_100511535 | |||
| 1888 | Ga0070685_10093186 | |||
| 1889 | Ga0070685_10131177 | |||
| 1890 | Ga0070685_10244490 | |||
| 1891 | Ga0070685_10499751 | |||
| 1892 | Ga0070685_10882300 | |||
| 1893 | Ga0070707_100718458 | |||
| 1894 | Ga0070679_100030083 | |||
| 1895 | Ga0070684_100030247 | |||
| 1896 | Ga0070684_100381892 | |||
| 1897 | Ga0070684_100671024 | |||
| 1898 | Ga0068853_100346198 | |||
| 1899 | Ga0070672_100000257 | |||
| 1900 | Ga0070672_100129026 | |||
| 1901 | Ga0070672_100164309 | |||
| 1902 | Ga0070672_100179730 | |||
| 1903 | Ga0070672_100964296 | |||
| 1904 | Ga0070672_100996118 | |||
| 1905 | Ga0070686_100017496 | |||
| 1906 | Ga0070686_100017565 | |||
| 1907 | Ga0070686_100141531 | |||
| 1908 | Ga0070686_101514287 | |||
| 1909 | Ga0070693_100232265 | |||
| 1910 | Ga0070693_100781224 | |||
| 1911 | Ga0070665_100000176 | |||
| 1912 | Ga0070665_100203644 | |||
| 1913 | Ga0070665_100730008 | |||
| 1914 | Ga0070665_101767116 | |||
| 1915 | Ga0070665_101840637 | |||
| 1916 | Ga0070704_100333107 | |||
| 1917 | Ga0070704_100386867 | |||
| 1918 | Ga0070704_101179376 | |||
| 1919 | Ga0070704_101971345 | |||
| 1920 | Ga0068855_100006465 | |||
| 1921 | Ga0068855_100568881 | |||
| 1922 | Ga0070664_100018748 | |||
| 1923 | Ga0070664_100034095 | |||
| 1924 | Ga0070664_100055809 | |||
| 1925 | Ga0070664_100085823 | |||
| 1926 | Ga0070664_100093667 | |||
| 1927 | Ga0070664_100203642 | |||
| 1928 | Ga0070664_100205438 | |||
| 1929 | Ga0070664_100443544 | |||
| 1930 | Ga0068857_100007255 | |||
| 1931 | Ga0068857_100356947 | |||
| 1932 | Ga0068857_101795431 | |||
| 1933 | Ga0068854_100170399 | |||
| 1934 | Ga0068854_100245764 | |||
| 1935 | Ga0068854_100390034 | |||
| 1936 | Ga0068856_100002512 | |||
| 1937 | Ga0068856_100461730 | |||
| 1938 | Ga0070702_100023624 | |||
| 1939 | Ga0070702_100509795 | |||
| 1940 | Ga0068852_100200031 | |||
| 1941 | Ga0068852_100229830 | |||
| 1942 | Ga0068852_100368931 | |||
| 1943 | Ga0068852_100431861 | |||
| 1944 | Ga0068852_100746178 | |||
| 1945 | Ga0068859_100003821 | |||
| 1946 | Ga0068859_100004139 | |||
| 1947 | Ga0068859_100015467 | |||
| 1948 | Ga0068859_100048360 | |||
| 1949 | Ga0068859_101074221 | |||
| 1950 | Ga0068859_101256686 | |||
| 1951 | Ga0068859_102393699 | |||
| 1952 | Ga0068864_100000318 | |||
| 1953 | Ga0068864_100001446 | |||
| 1954 | Ga0068864_100161343 | |||
| 1955 | Ga0068864_100505888 | |||
| 1956 | Ga0068864_100841021 | |||
| 1957 | Ga0068864_101537811 | |||
| 1958 | Ga0068864_102026604 | |||
| 1959 | Ga0068866_10067940 | |||
| 1960 | Ga0068866_10544798 | |||
| 1961 | Ga0068866_10667186 | |||
| 1962 | Ga0068866_10718958 | |||
| 1963 | Ga0068861_100016912 | |||
| 1964 | Ga0068861_100099307 | |||
| 1965 | Ga0068861_100101827 | |||
| 1966 | Ga0068861_100143840 | |||
| 1967 | Ga0068861_100310284 | |||
| 1968 | Ga0068851_10089185 | |||
| 1969 | Ga0068851_10609614 | |||
| 1970 | Ga0068870_10057911 | |||
| 1971 | Ga0068870_10543450 | |||
| 1972 | Ga0068870_10599744 | |||
| 1973 | Ga0068870_11242059 | |||
| 1974 | Ga0068863_100000507 | |||
| 1975 | Ga0068863_100026485 | |||
| 1976 | Ga0068863_100061840 | |||
| 1977 | Ga0068863_100081182 | |||
| 1978 | Ga0068863_100238679 | |||
| 1979 | Ga0068863_100269124 | |||
| 1980 | Ga0068863_100689995 | |||
| 1981 | Ga0068863_100752156 | |||
| 1982 | Ga0068863_101526968 | |||
| 1983 | Ga0068863_101550799 | |||
| 1984 | Ga0068858_100000774 | |||
| 1985 | Ga0068858_100005599 | |||
| 1986 | Ga0068858_100025183 | |||
| 1987 | Ga0068858_100036108 | |||
| 1988 | Ga0068858_100134912 | |||
| 1989 | Ga0068858_101586275 | |||
| 1990 | Ga0068860_100014942 | |||
| 1991 | Ga0068860_100094195 | |||
| 1992 | Ga0068860_100098740 | |||
| 1993 | Ga0068860_102388193 | |||
| 1994 | Ga0068862_100000837 | |||
| 1995 | Ga0068862_100004861 | |||
| 1996 | Ga0068862_100034683 | |||
| 1997 | Ga0068862_100104541 | |||
| 1998 | Ga0068862_100175575 | |||
| 1999 | Ga0068862_100771972 | |||
| 2000 | Ga0068862_100928370 | |||
| 2001 | Ga0081455_10002344 | |||
| 2002 | Ga0081455_10104070 | |||
| 2003 | Ga0081538_10049157 | |||
| 2004 | Ga0081539_10085913 | |||
| 2005 | Ga0081539_10227273 | |||
| 2006 | Ga0075365_10173499 | |||
| 2007 | Ga0075365_10174274 | |||
| 2008 | Ga0075365_10181297 | |||
| 2009 | Ga0075365_10189645 | |||
| 2010 | Ga0075365_10957175 | |||
| 2011 | Ga0075368_10047802 | |||
| 2012 | Ga0075368_10295813 | |||
| 2013 | Ga0075363_100003696 | |||
| 2014 | Ga0075363_100011596 | |||
| 2015 | Ga0075363_100011622 | |||
| 2016 | Ga0075363_100020319 | |||
| 2017 | Ga0075363_100034884 | |||
| 2018 | Ga0075363_100146803 | |||
| 2019 | Ga0075364_10036942 | |||
| 2020 | Ga0075364_10209189 | |||
| 2021 | Ga0075432_10023807 | |||
| 2022 | Ga0075362_10004570 | |||
| 2023 | Ga0075362_10009462 | |||
| 2024 | Ga0075362_10011745 | |||
| 2025 | Ga0075362_10056843 | |||
| 2026 | Ga0075362_10098789 | |||
| 2027 | Ga0075362_10198355 | |||
| 2028 | Ga0075367_10009821 | |||
| 2029 | Ga0075367_10104037 | |||
| 2030 | Ga0075367_10133780 | |||
| 2031 | Ga0075367_10211778 | |||
| 2032 | Ga0075367_10217941 | |||
| 2033 | Ga0075367_10735713 | |||
| 2034 | Ga0075369_10019712 | |||
| 2035 | Ga0075369_10222392 | |||
| 2036 | Ga0075366_10000689 | |||
| 2037 | Ga0075366_10004381 | |||
| 2038 | Ga0075366_10010042 | |||
| 2039 | Ga0075366_10015818 | |||
| 2040 | Ga0075366_10028399 | |||
| 2041 | Ga0075366_10062491 | |||
| 2042 | Ga0075366_10074050 | |||
| 2043 | Ga0075366_10099983 | |||
| 2044 | Ga0075366_10776752 | |||
| 2045 | Ga0075366_10953136 | |||
| 2046 | Ga0075366_11029513 | |||
| 2047 | Ga0097621_100027531 | |||
| 2048 | Ga0097621_100214164 | |||
| 2049 | Ga0097621_100352323 | |||
| 2050 | Ga0097621_100710393 | |||
| 2051 | Ga0097621_101308900 | |||
| 2052 | Ga0097621_101903232 | |||
| 2053 | Ga0075370_10006289 | |||
| 2054 | Ga0075370_10014688 | |||
| 2055 | Ga0075370_10169646 | |||
| 2056 | Ga0075370_10490162 | |||
| 2057 | Ga0075370_10746227 | |||
| 2058 | Ga0068871_100072625 | |||
| 2059 | Ga0068871_100081581 | |||
| 2060 | Ga0068871_100108479 | |||
| 2061 | Ga0068871_100807603 | |||
| 2062 | Ga0068871_101024542 | |||
| 2063 | Ga0075428_100023230 | |||
| 2064 | Ga0075428_100823553 | |||
| 2065 | Ga0075428_101030466 | |||
| 2066 | Ga0075428_101567842 | |||
| 2067 | Ga0075428_102383532 | |||
| 2068 | Ga0075430_100073642 | |||
| 2069 | Ga0075433_10337117 | |||
| 2070 | Ga0075433_11548766 | |||
| 2071 | Ga0075434_100319984 | |||
| 2072 | Ga0068865_100064014 | |||
| 2073 | Ga0068865_100137683 | |||
| 2074 | Ga0068865_100234537 | |||
| 2075 | Ga0068865_100241701 | |||
| 2076 | Ga0068865_100341875 | |||
| 2077 | Ga0068865_100402356 | |||
| 2078 | Ga0068865_100769941 | |||
| 2079 | Ga0068865_100918610 | |||
| 2080 | Ga0097620_100003821 | |||
| 2081 | Ga0097620_100004139 | |||
| 2082 | Ga0097620_100015469 | |||
| 2083 | Ga0097620_100048358 | |||
| 2084 | Ga0097620_101074217 | |||
| 2085 | Ga0097620_101256553 | |||
| 2086 | Ga0097620_102393307 | |||
| 2087 | Ga0079104_1000007 | |||
| 2088 | Ga0079104_1000328 | |||
| 2089 | Ga0079104_1035251 | |||
| 2090 | Ga0105251_10034197 | |||
| 2091 | Ga0105251_10338706 | |||
| 2092 | Ga0105244_10005755 | |||
| 2093 | Ga0105240_10007401 | |||
| 2094 | Ga0105240_10051415 | |||
| 2095 | Ga0105240_10068040 | |||
| 2096 | Ga0105240_10263172 | |||
| 2097 | Ga0105240_10266723 | |||
| 2098 | Ga0105240_10532134 | |||
| 2099 | Ga0105240_10562624 | |||
| 2100 | Ga0105240_12041303 | |||
| 2101 | Ga0111539_10020185 | |||
| 2102 | Ga0111539_10028960 | |||
| 2103 | Ga0111539_10029107 | |||
| 2104 | Ga0111539_10056854 | |||
| 2105 | Ga0111539_10493667 | |||
| 2106 | Ga0111539_10498702 | |||
| 2107 | Ga0111539_10688131 | |||
| 2108 | Ga0111539_12763341 | |||
| 2109 | Ga0105245_10002284 | |||
| 2110 | Ga0105245_10009930 | |||
| 2111 | Ga0105245_10150360 | |||
| 2112 | Ga0105245_10534083 | |||
| 2113 | Ga0105245_10819385 | |||
| 2114 | Ga0105245_11012952 | |||
| 2115 | Ga0105247_10031819 | |||
| 2116 | Ga0105247_11035539 | |||
| 2117 | Ga0114129_10826805 | |||
| 2118 | Ga0114129_11018182 | |||
| 2119 | Ga0105243_10005465 | |||
| 2120 | Ga0105243_10021175 | |||
| 2121 | Ga0105243_10066031 | |||
| 2122 | Ga0105243_10183927 | |||
| 2123 | Ga0105243_10434969 | |||
| 2124 | Ga0105243_11419139 | |||
| 2125 | Ga0105241_10025680 | |||
| 2126 | Ga0105241_10076330 | |||
| 2127 | Ga0105241_10408763 | |||
| 2128 | Ga0105242_10084172 | |||
| 2129 | Ga0105242_10257763 | |||
| 2130 | Ga0105248_10000901 | |||
| 2131 | Ga0105248_10013005 | |||
| 2132 | Ga0105248_10019352 | |||
| 2133 | Ga0105248_10034099 | |||
| 2134 | Ga0105248_10274971 | |||
| 2135 | Ga0105248_10590872 | |||
| 2136 | Ga0105248_10707785 | |||
| 2137 | Ga0105248_10774000 | |||
| 2138 | Ga0105248_10792820 | |||
| 2139 | Ga0105237_10036837 | |||
| 2140 | Ga0105238_10091658 | |||
| 2141 | Ga0105238_10550871 | |||
| 2142 | Ga0105238_10561091 | |||
| 2143 | Ga0105238_10950062 | |||
| 2144 | Ga0105249_10041313 | |||
| 2145 | Ga0105249_10082716 | |||
| 2146 | Ga0105249_10161627 | |||
| 2147 | Ga0105249_10321811 | |||
| 2148 | Ga0105249_11012623 | |||
| 2149 | Ga0105249_11074378 | |||
| 2150 | Ga0105249_11146707 | |||
| 2151 | Ga0105249_12477495 | |||
| 2152 | Ga0105239_10413081 | |||
| 2153 | Ga0105239_11568414 | |||
| 2154 | Ga0105239_13550627 | |||
| 2155 | Ga0105246_10085296 | |||
| 2156 | Ga0105246_10162659 | |||
| 2157 | Ga0105246_10169905 | |||
| 2158 | Ga0105246_11033510 | |||
| 2159 | Ga0157371_10192728 | |||
| 2160 | Ga0157370_10044109 | |||
| 2161 | Ga0157370_10072734 | |||
| 2162 | Ga0157370_10882273 | |||
| 2163 | Ga0157370_11696108 | |||
| 2164 | Ga0157369_10000602 | |||
| 2165 | Ga0157369_10023131 | |||
| 2166 | Ga0157369_10162240 | |||
| 2167 | Ga0157369_10329807 | |||
| 2168 | Ga0157369_12075546 | |||
| 2169 | Ga0157374_10203428 | |||
| 2170 | Ga0157374_10346348 | |||
| 2171 | Ga0157374_10453679 | |||
| 2172 | Ga0157374_10627225 | |||
| 2173 | Ga0157374_11009373 | |||
| 2174 | Ga0157378_10001784 | |||
| 2175 | Ga0157378_10099364 | |||
| 2176 | Ga0157378_10336468 | |||
| 2177 | Ga0157378_10400406 | |||
| 2178 | Ga0157378_10598955 | |||
| 2179 | Ga0157378_10715141 | |||
| 2180 | Ga0157378_10807732 | |||
| 2181 | Ga0157378_12623690 | |||
| 2182 | Ga0163162_10000204 | |||
| 2183 | Ga0163162_10000297 | |||
| 2184 | Ga0163162_10112784 | |||
| 2185 | Ga0163162_10113651 | |||
| 2186 | Ga0163162_10186666 | |||
| 2187 | Ga0163162_10508603 | |||
| 2188 | Ga0163162_10715786 | |||
| 2189 | Ga0163162_10796738 | |||
| 2190 | Ga0163162_10910164 | |||
| 2191 | Ga0163162_12481903 | |||
| 2192 | Ga0157372_10325667 | |||
| 2193 | Ga0157372_10464004 | |||
| 2194 | Ga0157372_10554272 | |||
| 2195 | Ga0157372_12263872 | |||
| 2196 | Ga0157375_10001119 | |||
| 2197 | Ga0157375_10005543 | |||
| 2198 | Ga0157375_10045314 | |||
| 2199 | Ga0157375_10073202 | |||
| 2200 | Ga0157375_10075281 | |||
| 2201 | Ga0157375_10305261 | |||
| 2202 | Ga0157375_10449430 | |||
| 2203 | Ga0157375_12782199 | |||
| 2204 | Ga0163163_10004109 | |||
| 2205 | Ga0163163_10082610 | |||
| 2206 | Ga0163163_10530945 | |||
| 2207 | Ga0163163_10563215 | |||
| 2208 | Ga0163163_11228855 | |||
| 2209 | Ga0163163_11232236 | |||
| 2210 | Ga0163163_11948267 | |||
| 2211 | Ga0163163_13010961 | |||
| 2212 | Ga0157380_10034310 | |||
| 2213 | Ga0157380_10144616 | |||
| 2214 | Ga0157380_10353500 | |||
| 2215 | Ga0157380_10967510 | |||
| 2216 | Ga0157380_11474836 | |||
| 2217 | Ga0157380_11535095 | |||
| 2218 | Ga0157380_11713249 | |||
| 2219 | Ga0182008_10018727 | |||
| 2220 | Ga0182008_10050371 | |||
| 2221 | Ga0182008_10098655 | |||
| 2222 | Ga0182008_10111392 | |||
| 2223 | Ga0157377_11041297 | |||
| 2224 | Ga0157379_10001453 | |||
| 2225 | Ga0157379_10002672 | |||
| 2226 | Ga0157379_10009921 | |||
| 2227 | Ga0157379_10217391 | |||
| 2228 | Ga0157379_10822840 | |||
| 2229 | Ga0157379_10887760 | |||
| 2230 | Ga0157376_10003212 | |||
| 2231 | Ga0157376_10015114 | |||
| 2232 | Ga0157376_10138950 | |||
| 2233 | Ga0157376_10232185 | |||
| 2234 | Ga0157376_10380523 | |||
| 2235 | Ga0157376_10627043 | |||
| 2236 | Ga0157376_10658432 | |||
| 2237 | Ga0157376_11033266 | |||
| 2238 | Ga0182006_1026631 | |||
| 2239 | Ga0182007_10000792 | |||
| 2240 | Ga0182007_10001246 | |||
| 2241 | Ga0182007_10031895 | |||
| 2242 | Ga0182007_10075383 | |||
| 2243 | Ga0182007_10145516 | |||
| 2244 | Ga0182007_10157393 | |||
| 2245 | Ga0182005_1085284 | |||
| 2246 | Ga0183362_10001 | |||
| 2247 | Ga0163161_10031277 | |||
| 2248 | Ga0163161_10068966 | |||
| 2249 | Ga0163161_10081853 | |||
| 2250 | Ga0163161_11059143 | |||
| 2251 | Ga0163161_11245395 | |||
| 2252 | Ga0163161_11875135 | |||
| 2253 | Ga0197907_10551622 | |||
| 2254 | Ga0206354_11176714 | |||
| 2255 | Ga0206353_10456852 | |||
| 2256 | Ga0213872_10372609 | |||
| 2257 | Ga0224712_10000345 | |||
| 2258 | Ga0228598_1012137 | |||
| 2259 | Ga0209435_113861 | |||
| 2260 | Ga0209672_100267 | |||
| 2261 | Ga0209672_122263 | |||
| 2262 | Ga0209258_119958 | |||
| 2263 | Ga0209759_1000120 | |||
| 2264 | Ga0209129_1010485 | |||
| 2265 | Ga0209565_1016199 | |||
| 2266 | Ga0209455_1000449 | |||
| 2267 | Ga0209673_1001396 | |||
| 2268 | Ga0209130_1021741 | |||
| 2269 | Ga0209025_1000394 | |||
| 2270 | Ga0209564_1000027 | |||
| 2271 | Ga0209564_1004085 | |||
| 2272 | Ga0209758_1000045 | |||
| 2273 | Ga0209758_1000252 | |||
| 2274 | Ga0209758_1033518 | |||
| 2275 | Ga0209758_1046589 | |||
| 2276 | Ga0209050_1001032 | |||
| 2277 | Ga0209050_1014128 | |||
| 2278 | Ga0209256_1000120 | |||
| 2279 | Ga0207426_1000018 | |||
| 2280 | Ga0207426_1003365 | |||
| 2281 | Ga0209051_1000018 | |||
| 2282 | Ga0209257_1000260 | |||
| 2283 | Ga0209257_1008085 | |||
| 2284 | Ga0209257_1041875 | |||
| 2285 | Ga0207697_10016505 | |||
| 2286 | Ga0207697_10248339 | |||
| 2287 | Ga0207697_10268737 | |||
| 2288 | Ga0207656_10131603 | |||
| 2289 | Ga0207655_1007702 | |||
| 2290 | Ga0207713_1000892 | |||
| 2291 | Ga0207713_1016353 | |||
| 2292 | Ga0207682_10001857 | |||
| 2293 | Ga0207682_10008143 | |||
| 2294 | Ga0207682_10060636 | |||
| 2295 | Ga0207642_10258044 | |||
| 2296 | Ga0207642_10540183 | |||
| 2297 | Ga0207642_10894388 | |||
| 2298 | Ga0207710_10319141 | |||
| 2299 | Ga0207688_10307397 | |||
| 2300 | Ga0207688_10448414 | |||
| 2301 | Ga0207688_10468896 | |||
| 2302 | Ga0207688_10604182 | |||
| 2303 | Ga0207680_10000693 | |||
| 2304 | Ga0207680_10004179 | |||
| 2305 | Ga0207680_10006026 | |||
| 2306 | Ga0207647_10000722 | |||
| 2307 | Ga0207647_10017131 | |||
| 2308 | Ga0207647_10040574 | |||
| 2309 | Ga0207647_10143800 | |||
| 2310 | Ga0207645_10014790 | |||
| 2311 | Ga0207645_10027805 | |||
| 2312 | Ga0207645_10055006 | |||
| 2313 | Ga0207645_10068284 | |||
| 2314 | Ga0207645_10457571 | |||
| 2315 | Ga0207643_10018108 | |||
| 2316 | Ga0207643_10550892 | |||
| 2317 | Ga0207705_10000980 | |||
| 2318 | Ga0207705_10311432 | |||
| 2319 | Ga0207705_10430846 | |||
| 2320 | Ga0207654_10752926 | |||
| 2321 | Ga0207707_10015974 | |||
| 2322 | Ga0207707_10179574 | |||
| 2323 | Ga0207695_10005806 | |||
| 2324 | Ga0207695_10099824 | |||
| 2325 | Ga0207695_10109888 | |||
| 2326 | Ga0207695_10208802 | |||
| 2327 | Ga0207695_10227674 | |||
| 2328 | Ga0207695_10438586 | |||
| 2329 | Ga0207695_10704067 | |||
| 2330 | Ga0207671_10124914 | |||
| 2331 | Ga0207660_10356226 | |||
| 2332 | Ga0207662_10080085 | |||
| 2333 | Ga0207657_10122373 | |||
| 2334 | Ga0207657_10406625 | |||
| 2335 | Ga0207657_10604910 | |||
| 2336 | Ga0207649_10015454 | |||
| 2337 | Ga0207649_10262173 | |||
| 2338 | Ga0207649_10365202 | |||
| 2339 | Ga0207649_10449884 | |||
| 2340 | Ga0207649_11537253 | |||
| 2341 | Ga0207652_10247841 | |||
| 2342 | Ga0207652_10344385 | |||
| 2343 | Ga0207646_10673882 | |||
| 2344 | Ga0207646_10749262 | |||
| 2345 | Ga0207681_10003319 | |||
| 2346 | Ga0207681_10108532 | |||
| 2347 | Ga0207681_10184794 | |||
| 2348 | Ga0207681_10216414 | |||
| 2349 | Ga0207681_10268155 | |||
| 2350 | Ga0207694_10235346 | |||
| 2351 | Ga0207694_10280938 | |||
| 2352 | Ga0207694_10386615 | |||
| 2353 | Ga0207694_10623086 | |||
| 2354 | Ga0207650_10016870 | |||
| 2355 | Ga0207650_10064404 | |||
| 2356 | Ga0207650_10077573 | |||
| 2357 | Ga0207650_10395428 | |||
| 2358 | Ga0207650_11191954 | |||
| 2359 | Ga0207650_11617279 | |||
| 2360 | Ga0207659_10002593 | |||
| 2361 | Ga0207659_10016636 | |||
| 2362 | Ga0207659_10079914 | |||
| 2363 | Ga0207659_10252106 | |||
| 2364 | Ga0207659_10421828 | |||
| 2365 | Ga0207659_10670008 | |||
| 2366 | Ga0207659_11670633 | |||
| 2367 | Ga0207687_10044264 | |||
| 2368 | Ga0207687_10277079 | |||
| 2369 | Ga0207687_11019872 | |||
| 2370 | Ga0207687_11553368 | |||
| 2371 | Ga0207700_10928918 | |||
| 2372 | Ga0207644_10000080 | |||
| 2373 | Ga0207644_10006260 | |||
| 2374 | Ga0207644_10037806 | |||
| 2375 | Ga0207644_10116955 | |||
| 2376 | Ga0207644_10455384 | |||
| 2377 | Ga0207644_10895232 | |||
| 2378 | Ga0207644_10923302 | |||
| 2379 | Ga0207690_10416346 | |||
| 2380 | Ga0207706_10005400 | |||
| 2381 | Ga0207706_10018796 | |||
| 2382 | Ga0207706_10022986 | |||
| 2383 | Ga0207706_10028055 | |||
| 2384 | Ga0207706_10080051 | |||
| 2385 | Ga0207706_10963276 | |||
| 2386 | Ga0207686_10379724 | |||
| 2387 | Ga0207709_10000112 | |||
| 2388 | Ga0207709_10013548 | |||
| 2389 | Ga0207709_10834727 | |||
| 2390 | Ga0207670_10003436 | |||
| 2391 | Ga0207670_10005570 | |||
| 2392 | Ga0207670_10038745 | |||
| 2393 | Ga0207669_10008845 | |||
| 2394 | Ga0207669_10056465 | |||
| 2395 | Ga0207669_10306769 | |||
| 2396 | Ga0207669_10576571 | |||
| 2397 | Ga0207704_10011663 | |||
| 2398 | Ga0207704_10097382 | |||
| 2399 | Ga0207704_10125104 | |||
| 2400 | Ga0207704_10339386 | |||
| 2401 | Ga0207704_10353319 | |||
| 2402 | Ga0207704_10497274 | |||
| 2403 | Ga0207704_11785862 | |||
| 2404 | Ga0207691_10000814 | |||
| 2405 | Ga0207691_10019301 | |||
| 2406 | Ga0207691_10058201 | |||
| 2407 | Ga0207691_10092568 | |||
| 2408 | Ga0207691_10095826 | |||
| 2409 | Ga0207691_10187620 | |||
| 2410 | Ga0207691_10841879 | |||
| 2411 | Ga0207711_10001117 | |||
| 2412 | Ga0207711_10002270 | |||
| 2413 | Ga0207711_10006712 | |||
| 2414 | Ga0207711_10114041 | |||
| 2415 | Ga0207711_10648262 | |||
| 2416 | Ga0207711_10780189 | |||
| 2417 | Ga0207689_10006926 | |||
| 2418 | Ga0207689_10023656 | |||
| 2419 | Ga0207689_10258895 | |||
| 2420 | Ga0207689_11519392 | |||
| 2421 | Ga0207661_10069974 | |||
| 2422 | Ga0207661_10244030 | |||
| 2423 | Ga0207661_10344539 | |||
| 2424 | Ga0207679_10012324 | |||
| 2425 | Ga0207679_10032483 | |||
| 2426 | Ga0207679_10168836 | |||
| 2427 | Ga0207679_10182044 | |||
| 2428 | Ga0207679_10247932 | |||
| 2429 | Ga0207679_10251553 | |||
| 2430 | Ga0207667_10001900 | |||
| 2431 | Ga0207651_10000144 | |||
| 2432 | Ga0207651_10045168 | |||
| 2433 | Ga0207651_10170057 | |||
| 2434 | Ga0207651_10388881 | |||
| 2435 | Ga0207651_10444822 | |||
| 2436 | Ga0207651_11070911 | |||
| 2437 | Ga0207651_11267794 | |||
| 2438 | Ga0207712_10136720 | |||
| 2439 | Ga0207712_10143511 | |||
| 2440 | Ga0207712_10348307 | |||
| 2441 | Ga0207668_10035062 | |||
| 2442 | Ga0207668_10042223 | |||
| 2443 | Ga0207668_10064096 | |||
| 2444 | Ga0207668_10323754 | |||
| 2445 | Ga0207668_10383712 | |||
| 2446 | Ga0207640_10925885 | |||
| 2447 | Ga0207640_11161124 | |||
| 2448 | Ga0207658_10001163 | |||
| 2449 | Ga0207658_10001928 | |||
| 2450 | Ga0207658_10006797 | |||
| 2451 | Ga0207658_10060167 | |||
| 2452 | Ga0207658_10316108 | |||
| 2453 | Ga0207658_11049995 | |||
| 2454 | Ga0207658_11596239 | |||
| 2455 | Ga0207677_10000686 | |||
| 2456 | Ga0207677_10086316 | |||
| 2457 | Ga0207677_10125707 | |||
| 2458 | Ga0207677_11216370 | |||
| 2459 | Ga0207703_10000702 | |||
| 2460 | Ga0207703_10009199 | |||
| 2461 | Ga0207703_10035099 | |||
| 2462 | Ga0207703_10262242 | |||
| 2463 | Ga0207703_10333350 | |||
| 2464 | Ga0207703_10843132 | |||
| 2465 | Ga0207639_10583343 | |||
| 2466 | Ga0207639_10904484 | |||
| 2467 | Ga0207639_11902670 | |||
| 2468 | Ga0207678_10010590 | |||
| 2469 | Ga0207678_10128514 | |||
| 2470 | Ga0207678_10172462 | |||
| 2471 | Ga0207678_10202581 | |||
| 2472 | Ga0207678_10304781 | |||
| 2473 | Ga0207678_10616168 | |||
| 2474 | Ga0207678_10705843 | |||
| 2475 | Ga0207678_10895209 | |||
| 2476 | Ga0207708_10145699 | |||
| 2477 | Ga0207708_10276266 | |||
| 2478 | Ga0207708_10428084 | |||
| 2479 | Ga0207708_10919707 | |||
| 2480 | Ga0207702_10280361 | |||
| 2481 | Ga0207702_10352781 | |||
| 2482 | Ga0207641_10000926 | |||
| 2483 | Ga0207641_10016664 | |||
| 2484 | Ga0207641_10024608 | |||
| 2485 | Ga0207641_10029474 | |||
| 2486 | Ga0207641_10100857 | |||
| 2487 | Ga0207641_10216887 | |||
| 2488 | Ga0207641_11531460 | |||
| 2489 | Ga0207641_11751157 | |||
| 2490 | Ga0207648_10002833 | |||
| 2491 | Ga0207648_10006529 | |||
| 2492 | Ga0207648_10017050 | |||
| 2493 | Ga0207648_10025610 | |||
| 2494 | Ga0207648_10086004 | |||
| 2495 | Ga0207648_10102038 | |||
| 2496 | Ga0207648_10155576 | |||
| 2497 | Ga0207648_10156071 | |||
| 2498 | Ga0207648_10287144 | |||
| 2499 | Ga0207648_10620448 | |||
| 2500 | Ga0207648_10677379 | |||
| 2501 | Ga0207676_10000656 | |||
| 2502 | Ga0207676_10017506 | |||
| 2503 | Ga0207676_10128103 | |||
| 2504 | Ga0207676_10681033 | |||
| 2505 | Ga0207676_10916896 | |||
| 2506 | Ga0207674_10006947 | |||
| 2507 | Ga0207674_10015020 | |||
| 2508 | Ga0207674_10229216 | |||
| 2509 | Ga0207674_10421489 | |||
| 2510 | Ga0207674_11151625 | |||
| 2511 | Ga0207675_100016912 | |||
| 2512 | Ga0207675_100018263 | |||
| 2513 | Ga0207675_100071881 | |||
| 2514 | Ga0207675_100136890 | |||
| 2515 | Ga0207675_100653032 | |||
| 2516 | Ga0207675_100787266 | |||
| 2517 | Ga0207675_101233782 | |||
| 2518 | Ga0207683_10010852 | |||
| 2519 | Ga0207683_10065890 | |||
| 2520 | Ga0207683_10075327 | |||
| 2521 | Ga0207683_10085160 | |||
| 2522 | Ga0207683_10090087 | |||
| 2523 | Ga0207683_10184951 | |||
| 2524 | Ga0207683_10412517 | |||
| 2525 | Ga0207683_10565873 | |||
| 2526 | Ga0207683_10666940 | |||
| 2527 | Ga0207683_10681226 | |||
| 2528 | Ga0207698_10575205 | |||
| 2529 | Ga0207698_11700327 | |||
| 2530 | Ga0209281_1000020 | |||
| 2531 | Ga0209281_1000455 | |||
| 2532 | Ga0209281_1028254 | |||
| 2533 | Ga0209973_1057037 | |||
| 2534 | Ga0209813_10031997 | |||
| 2535 | Ga0207428_10115761 | |||
| 2536 | Ga0207428_10184545 | |||
| 2537 | Ga0207428_10744711 | |||
| 2538 | Ga0207428_11017070 | |||
| 2539 | Ga0268266_10000005 | |||
| 2540 | Ga0268266_10004503 | |||
| 2541 | Ga0268266_11378564 | |||
| 2542 | Ga0268266_11398962 | |||
| 2543 | Ga0268266_11689948 | |||
| 2544 | Ga0268265_10011002 | |||
| 2545 | Ga0268265_10040448 | |||
| 2546 | Ga0268265_10305534 | |||
| 2547 | Ga0268265_10442039 | |||
| 2548 | Ga0268265_10918540 | |||
| 2549 | Ga0268264_10000046 | |||
| 2550 | Ga0268264_10022682 | |||
| 2551 | Ga0268264_10102789 | |||
| 2552 | Ga0268264_10574605 | |||
| 2553 | Ga0268264_12100554 | |||
| 2554 | Ga0307517_10009345 | |||
| 2555 | Ga0307517_10422898 | |||
| 2556 | Ga0307515_10000722 | |||
| 2557 | Ga0307515_10002592 | |||
| 2558 | Ga0307515_10029667 | |||
| 2559 | Ga0307515_10034932 | |||
| 2560 | Ga0307515_10043798 | |||
| 2561 | Ga0307515_10054641 | |||
| 2562 | Ga0307515_10068092 | |||
| 2563 | Ga0307515_10295665 | |||
| 2564 | Ga0265338_10191218 | |||
| 2565 | Ga0307512_10219233 | |||
| 2566 | Ga0307512_10320256 | |||
| 2567 | Ga0265332_10035345 | |||
| 2568 | Ga0265328_10026618 | |||
| 2569 | Ga0265331_10183458 | |||
| 2570 | Ga0265327_10028506 | |||
| 2571 | Ga0265316_11296286 | |||
| 2572 | Ga0307513_10005609 | |||
| 2573 | Ga0307513_10322208 | |||
| 2574 | Ga0307509_10016410 | |||
| 2575 | Ga0307509_10019184 | |||
| 2576 | Ga0307509_10041676 | |||
| 2577 | Ga0307509_10048077 | |||
| 2578 | Ga0307509_10051517 | |||
| 2579 | Ga0307509_10290106 | |||
| 2580 | Ga0307509_10342052 | |||
| 2581 | Ga0307509_10587745 | |||
| 2582 | Ga0307408_100014078 | |||
| 2583 | Ga0307408_100020103 | |||
| 2584 | Ga0307408_100037431 | |||
| 2585 | Ga0307408_100044613 | |||
| 2586 | Ga0307408_100068764 | |||
| 2587 | Ga0307408_100184150 | |||
| 2588 | Ga0307408_100308870 | |||
| 2589 | Ga0307408_100644049 | |||
| 2590 | Ga0307408_100719100 | |||
| 2591 | Ga0307408_101455754 | |||
| 2592 | Ga0307408_101839818 | |||
| 2593 | Ga0307508_10000659 | |||
| 2594 | Ga0307508_10001973 | |||
| 2595 | Ga0307508_10070300 | |||
| 2596 | Ga0307514_10008017 | |||
| 2597 | Ga0307514_10175535 | |||
| 2598 | Ga0265314_10018888 | |||
| 2599 | Ga0265314_10111016 | |||
| 2600 | Ga0307516_10003142 | |||
| 2601 | Ga0307516_10062726 | |||
| 2602 | Ga0307516_10170137 | |||
| 2603 | Ga0307516_10348440 | |||
| 2604 | Ga0307516_10558733 | |||
| 2605 | Ga0307516_10862698 | |||
| 2606 | Ga0307405_10056945 | |||
| 2607 | Ga0307405_10081180 | |||
| 2608 | Ga0307405_10595457 | |||
| 2609 | Ga0307405_10686049 | |||
| 2610 | Ga0307413_10239523 | |||
| 2611 | Ga0307413_10376475 | |||
| 2612 | Ga0307413_10401762 | |||
| 2613 | Ga0307413_10554929 | |||
| 2614 | Ga0307413_10663139 | |||
| 2615 | Ga0307413_10997778 | |||
| 2616 | Ga0307413_11626169 | |||
| 2617 | Ga0307410_10067171 | |||
| 2618 | Ga0307410_11023474 | |||
| 2619 | Ga0307406_10000971 | |||
| 2620 | Ga0307406_10726998 | |||
| 2621 | Ga0307406_11344228 | |||
| 2622 | Ga0307407_10040614 | |||
| 2623 | Ga0307407_10451482 | |||
| 2624 | Ga0307407_10504480 | |||
| 2625 | Ga0307412_10097649 | |||
| 2626 | Ga0307412_10105216 | |||
| 2627 | Ga0307412_10106305 | |||
| 2628 | Ga0307412_10141151 | |||
| 2629 | Ga0307412_10232371 | |||
| 2630 | Ga0307412_10412449 | |||
| 2631 | Ga0307412_10412637 | |||
| 2632 | Ga0307412_10454638 | |||
| 2633 | Ga0307412_11389008 | |||
| 2634 | Ga0307412_11427041 | |||
| 2635 | Ga0307412_11842723 | |||
| 2636 | Ga0307409_100137996 | |||
| 2637 | Ga0307409_100328491 | |||
| 2638 | Ga0307409_101043738 | |||
| 2639 | Ga0307409_101062858 | |||
| 2640 | Ga0307416_100025231 | |||
| 2641 | Ga0307416_100205498 | |||
| 2642 | Ga0307416_100911959 | |||
| 2643 | Ga0307416_102426847 | |||
| 2644 | Ga0307414_10093113 | |||
| 2645 | Ga0307414_10101921 | |||
| 2646 | Ga0307414_10319004 | |||
| 2647 | Ga0307414_10786396 | |||
| 2648 | Ga0307414_11179229 | |||
| 2649 | Ga0307414_11218204 | |||
| 2650 | Ga0307411_10089972 | |||
| 2651 | Ga0307411_10124567 | |||
| 2652 | Ga0307411_10230864 | |||
| 2653 | Ga0307411_10412559 | |||
| 2654 | Ga0307411_10532091 | |||
| 2655 | Ga0307411_11430635 | |||
| 2656 | Ga0307411_11620561 | |||
| 2657 | Ga0307415_100802834 | |||
| 2658 | Ga0307507_10120827 | |||
| 2659 | Ga0307507_10246671 | |||
| 2660 | Ga0307507_10315566 | |||
| 2661 | Ga0307510_10008860 | |||
| 2662 | Ga0307510_10267155 | |||
| 2663 | Ga0373928_0125407 | |||
| 2664 | Ga0373936_0006785 | |||
| 2665 | Ga0373936_0020797 | |||
| 2666 | Ga0373956_0155219 | |||
| 2667 | Ga0373943_0568338 | |||
| 2668 | Ga0373946_0283990 | |||
| 2669 | Ga0373955_0016520 | |||
| 2670 | Ga0373931_1118482 | |||
| 2671 | Ga0373935_1442716 | |||
| 2672 | Ga0373927_0137483 | |||
| 2673 | Ga0373933_0236278 | |||
| 2674 | Ga0373933_0445795 | |||
| 2675 | Ga0373947_0402276 | |||
| 2676 | Ga0373937_0335188 | |||
| 2677 | Ga0373937_0672974 | |||
| 2678 | Ga0373937_1036553 | |||
| 2679 | Ga0373925_0158603 | |||
| 2680 | Ga0373925_0185903 | |||
| 2681 | Ga0373925_0378943 | |||
| 2682 | Ga0395899_0000521 | |||
| 2683 | Ga0395899_0000581 | |||
| 2684 | Ga0395899_0002985 | |||
| 2685 | Ga0395899_0165992 | |||
| 2686 | Ga0395900_0032760 | |||
| 2687 | Ga0395900_0246211 | |||
| 2688 | Ga0395898_0035761 | |||
| 2689 | Ga0395898_0309599 | |||
| 2690 | Ga0395898_0339749 | |||
| 2691 | Ga0395905_0000029 | |||
| 2692 | Ga0395905_0017408 | |||
| 2693 | Ga0395905_0087795 | |||
| 2694 | Ga0395905_0183254 | |||
| 2695 | Ga0395905_0211610 | |||
| 2696 | Ga0395905_1000623 | |||
| 2697 | Ga0395901_0032991 | |||
| 2698 | Ga0395901_0095514 | |||
| 2699 | Ga0395901_0427156 | |||
| 2700 | Ga0436360_0988630 | |||
| 2701 | Ga0436361_0168617 | |||
| 2702 | Ga0436361_0209219 | |||
| 2703 | Ga0439465_0005707 | |||
| 2704 | Ga0451791_1941958 | |||
| 2705 | Ga0451793_1513956 | |||
| 2706 | Ga0451797_0629150 | |||
| 2707 | Ga0451797_1257626 | |||
| 2708 | Ga0451795_0135458 | |||
| 2709 | Ga0451795_0363756 | |||
| 2710 | Ga0451800_1298110 | |||
| 2711 | Ga0451802_0323989 | |||
| 2712 | Ga0451802_0711155 | |||
| 2713 | Ga0451802_1304540 | |||
| 2714 | Ga0451807_2074045 | |||
| 2715 | Ga0451837_1338186 | |||
| 2716 | Ga0451839_1659939 | |||
| 2717 | Ga0451845_0303794 | |||
| 2718 | Ga0451847_0101710 | |||
| 2719 | Ga0451849_0088262 | |||
| 2720 | Ga0451843_0405520 | |||
| 2721 | Ga0451855_0963016 | |||
| 2722 | Ga0439431_0023450 | |||
| 2723 | Ga0439442_028403 | |||
| 2724 | Ga0439432_018326 | |||
| 2725 | Ga0439432_056988 | |||
| 2726 | Ga0439449_0002219 | |||
| 2727 | Ga0439450_081517 | |||
| 2728 | Ga0439452_085163 | |||
| 2729 | Ga0439462_0169395 | |||
| 2730 | Ga0450914_016197 | |||
| 2731 | Ga0450920_057362 | |||
| 2732 | Ga0450890_046398 | |||
| 2733 | Ga0450894_018669 | |||
| 2734 | Ga0450898_151491 | |||
| 2735 | Ga0450899_013055 | |||
| 2736 | Ga0450904_020330 | |||
| 2737 | Ga0450905_056616 | |||
| 2738 | Ga0450910_063573 | |||
| 2739 | Ga0439446_0030487 | |||
| 2740 | Ga0450908_001912 | |||
| 2741 | Ga0450918_002326 | |||
| 2742 | Ga0450893_0022938 | |||
| 2743 | Ga0466969_0000010 | |||
| 2744 | Ga0466969_0000531 | |||
| 2745 | Ga0466969_0012755 | |||
| 2746 | Ga0466969_0049614 | |||
| 2747 | Ga0466969_0186316 | |||
| 2748 | Ga0466972_0034223 | |||
| 2749 | Ga0466972_0054011 | |||
| 2750 | Ga0466972_0191190 | |||
| 2751 | Ga0466972_0239589 | |||
| 2752 | Ga0466982_0059006 | |||
| 2753 | Ga0466965_0008841 | |||
| 2754 | Ga0466965_0073734 | |||
| 2755 | Ga0466965_0181326 | |||
| 2756 | Ga0466965_0197374 | |||
| 2757 | Ga0466965_0484145 | |||
| 2758 | Ga0466966_0001046 | |||
| 2759 | Ga0466966_0017788 | |||
| 2760 | Ga0466966_0021565 | |||
| 2761 | Ga0466961_0001090 | |||
| 2762 | Ga0466961_0004702 | |||
| 2763 | Ga0466961_0020588 | |||
| 2764 | Ga0466961_0051247 | |||
| 2765 | Ga0466963_0217615 | |||
| 2766 | Ga0466963_0225588 | |||
| 2767 | Ga0466963_0717417 | |||
| 2768 | Ga0466964_0018775 | |||
| 2769 | Ga0466964_0216361 | |||
| 2770 | Ga0453684_1024299 | |||
| 2771 | Ga0466971_0002065 | |||
| 2772 | Ga0466971_0267106 | |||
| 2773 | Ga0466968_0179082 | |||
| 2774 | Ga0466968_0251625 | |||
| 2775 | Ga0466970_0001322 | |||
| 2776 | Ga0466970_0008987 | |||
| 2777 | Ga0466970_0031328 | |||
| 2778 | Ga0466970_0078991 | |||
| 2779 | Ga0466957_0001175 | |||
| 2780 | Ga0466957_0132372 | |||
| 2781 | Ga0466957_0606224 | |||
| 2782 | Ga0466957_0725501 | |||
| 2783 | Ga0466957_1023343 | |||
| 2784 | Ga0466960_0030576 | |||
| 2785 | Ga0466960_0267490 | |||
| 2786 | Ga0466959_0000206 | |||
| 2787 | Ga0466959_0002005 | |||
| 2788 | Ga0466959_0004323 | |||
| 2789 | Ga0466959_0050021 | |||
| 2790 | Ga0466959_0065358 | |||
| 2791 | Ga0451576_0033797 | |||
| 2792 | Ga0466958_0000881 | |||
| 2793 | Ga0466958_0020449 | |||
| 2794 | Ga0466958_0186688 | |||
| 2795 | Ga0495617_000107 | |||
| 2796 | Ga0495603_0001824 | |||
| 2797 | Ga0495603_0031354 | |||
| 2798 | Ga0495603_0100321 | |||
| 2799 | Ga0495603_0123732 | |||
| 2800 | Ga0495603_0322516 | |||
| 2801 | Ga0495590_0004681 | |||
| 2802 | Ga0495590_0011833 | |||
| 2803 | Ga0495590_0046439 | |||
| 2804 | Ga0495591_142145 | |||
| 2805 | Ga0495629_0000015 | |||
| 2806 | Ga0495629_0006500 | |||
| 2807 | Ga0495629_0056655 | |||
| 2808 | Ga0495629_0333449 | |||
| 2809 | Ga0495629_0538179 | |||
| 2810 | Ga0495638_0003798 | |||
| 2811 | Ga0495638_0050177 | |||
| 2812 | Ga0495638_0147929 | |||
| 2813 | Ga0495638_0403732 | |||
| 2814 | Ga0495653_0000305 | |||
| 2815 | Ga0495653_0000764 | |||
| 2816 | Ga0495653_0082522 | |||
| 2817 | Ga0495653_0139477 | |||
| 2818 | Ga0495650_0000100 | |||
| 2819 | Ga0495650_0000179 | |||
| 2820 | Ga0495650_0001583 | |||
| 2821 | Ga0495650_0061790 | |||
| 2822 | Ga0495650_0070473 | |||
| 2823 | Ga0495580_0000682 | |||
| 2824 | Ga0495580_0003234 | |||
| 2825 | Ga0495580_0011711 | |||
| 2826 | Ga0495580_0132594 | |||
| 2827 | Ga0495580_0173533 | |||
| 2828 | Ga0495580_0236568 | |||
| 2829 | Ga0495582_0157078 | |||
| 2830 | Ga0495582_0282972 | |||
| 2831 | Ga0495582_0383422 | |||
| 2832 | Ga0495605_0000098 | |||
| 2833 | Ga0495605_0005795 | |||
| 2834 | Ga0495605_0008391 | |||
| 2835 | Ga0495605_0008882 | |||
| 2836 | Ga0495605_0303499 | |||
| 2837 | Ga0495639_0018021 | |||
| 2838 | Ga0495639_0035691 | |||
| 2839 | Ga0495662_0255167 | |||
| 2840 | Ga0495664_0055653 | |||
| 2841 | Ga0495664_0361855 | |||
| 2842 | Ga0495664_0666118 | |||
| 2843 | Ga0495584_0098905 | |||
| 2844 | Ga0495584_0333587 | |||
| 2845 | Ga0495584_0511391 | |||
| 2846 | Ga0495584_0543681 | |||
| 2847 | Ga0495585_0017777 | |||
| 2848 | Ga0495594_0188758 | |||
| 2849 | Ga0495596_0017244 | |||
| 2850 | Ga0495596_0032675 | |||
| 2851 | Ga0495596_0046637 | |||
| 2852 | Ga0495607_0005789 | |||
| 2853 | Ga0495607_0093899 | |||
| 2854 | Ga0495583_0030350 | |||
| 2855 | Ga0495583_0050726 | |||
| 2856 | Ga0495583_0124817 | |||
| 2857 | Ga0495606_0000223 | |||
| 2858 | Ga0495606_0001629 | |||
| 2859 | Ga0495606_0004296 | |||
| 2860 | Ga0495606_0049159 | |||
| 2861 | Ga0495606_0141852 | |||
| 2862 | Ga0495606_0259201 | |||
| 2863 | Ga0495610_0000668 | |||
| 2864 | Ga0495616_0010325 | |||
| 2865 | Ga0495616_0059117 | |||
| 2866 | Ga0495618_0102943 | |||
| 2867 | Ga0495620_0001664 | |||
| 2868 | Ga0495620_0009834 | |||
| 2869 | Ga0495620_0018985 | |||
| 2870 | Ga0495620_0088850 | |||
| 2871 | Ga0495620_0105994 | |||
| 2872 | Ga0495628_0006614 | |||
| 2873 | Ga0495628_0096207 | |||
| 2874 | Ga0495628_0167939 | |||
| 2875 | Ga0495628_0494887 | |||
| 2876 | Ga0495630_0048218 | |||
| 2877 | Ga0495630_0055261 | |||
| 2878 | Ga0495630_0082688 | |||
| 2879 | Ga0495630_0085128 | |||
| 2880 | Ga0495630_0297701 | |||
| 2881 | Ga0495631_0132417 | |||
| 2882 | Ga0495632_0012548 | |||
| 2883 | Ga0495632_0110693 | |||
| 2884 | Ga0495632_0384011 | |||
| 2885 | Ga0495643_0097109 | |||
| 2886 | Ga0495643_0149712 | |||
| 2887 | Ga0495644_0021130 | |||
| 2888 | Ga0495648_0046740 | |||
| 2889 | Ga0495648_0323126 | |||
| 2890 | Ga0495648_0514991 | |||
| 2891 | Ga0495666_0012315 | |||
| 2892 | Ga0495666_0021388 | |||
| 2893 | Ga0495666_0218869 | |||
| 2894 | Ga0495642_0002147 | |||
| 2895 | Ga0495642_0020756 | |||
| 2896 | Ga0495642_0082210 | |||
| 2897 | Ga0495642_0104138 | |||
| 2898 | Ga0495652_0012080 | |||
| 2899 | Ga0495652_0329182 | |||
| 2900 | Ga0495652_0399012 | |||
| 2901 | Ga0495654_0182143 | |||
| 2902 | Ga0495665_0023566 | |||
| 2903 | Ga0495665_0072296 | |||
| 2904 | Ga0495665_0366771 | |||
| 2905 | Ga0495640_0232584 | |||
| 2906 | Ga0495640_0484021 | |||
| 2907 | Ga0495586_0026649 | |||
| 2908 | Ga0495586_0159525 | |||
| 2909 | Ga0495586_0345761 | |||
| 2910 | Ga0495586_0402611 | |||
| 2911 | Ga0495587_0174854 | |||
| 2912 | Ga0495598_0168993 | |||
| 2913 | Ga0495621_0111138 | |||
| 2914 | Ga0495621_0451777 | |||
| 2915 | Ga0495597_0014880 | |||
| 2916 | Ga0495597_0133370 | |||
| 2917 | Ga0495597_0144813 | |||
| 2918 | Ga0495597_0362131 | |||
| 2919 | Ga0495645_0000828 | |||
| 2920 | Ga0495645_0071080 | |||
| 2921 | Ga0495645_0224513 | |||
| 2922 | Ga0495622_0127207 | |||
| 2923 | Ga0495633_0040223 | |||
| 2924 | Ga0495633_0268598 | |||
| 2925 | Ga0495667_0054299 | |||
| 2926 | Ga0495656_0150540 | |||
| 2927 | Ga0495656_0297203 | |||
| 2928 | Ga0495668_0000286 | |||
| 2929 | Ga0495668_0001540 | |||
| 2930 | Ga0495668_0218340 | |||
| 2931 | Ga0495668_0282230 | |||
| 2932 | Ga0495668_0408441 | |||
| 2933 | Ga0495611_0052076 | |||
| 2934 | Ga0495611_0053471 | |||
| 2935 | Ga0495611_0132255 | |||
| 2936 | Ga0495611_0345865 | |||
| 2937 | Ga0495625_0000052 | |||
| 2938 | Ga0495625_0016474 | |||
| 2939 | Ga0495625_0018472 | |||
| 2940 | Ga0495625_0095074 | |||
| 2941 | Ga0495625_0340715 | |||
| 2942 | Ga0495625_0371583 | |||
| 2943 | Ga0495625_0402574 | |||
| 2944 | Ga0495635_0003000 | |||
| 2945 | Ga0495635_0405564 | |||
| 2946 | Ga0495635_0767973 | |||
| 2947 | Ga0495661_0254645 | |||
| 2948 | Ga0495588_0033636 | |||
| 2949 | Ga0495599_0019631 | |||
| 2950 | Ga0495599_0082904 | |||
| 2951 | Ga0495599_0136926 | |||
| 2952 | Ga0495623_0011726 | |||
| 2953 | Ga0495623_0079976 | |||
| 2954 | Ga0495646_0004613 | |||
| 2955 | Ga0495646_0066210 | |||
| 2956 | Ga0495646_0172171 | |||
| 2957 | Ga0495658_0059118 | |||
| 2958 | Ga0495658_0135353 | |||
| 2959 | Ga0495658_0141182 | |||
| 2960 | Ga0495669_0028555 | |||
| 2961 | Ga0495669_0329173 | |||
| 2962 | Ga0495613_0015073 | |||
| 2963 | Ga0495613_0244010 | |||
| 2964 | Ga0495613_0283876 | |||
| 2965 | Ga0495624_0000973 | |||
| 2966 | Ga0495624_0001711 | |||
| 2967 | Ga0495624_0067091 | |||
| 2968 | Ga0495624_0371596 | |||
| 2969 | Ga0495624_0629737 | |||
| 2970 | Ga0495670_0000022 | |||
| 2971 | Ga0495670_0000846 | |||
| 2972 | Ga0495670_0039618 | |||
| 2973 | Ga0495671_0050658 | |||
| 2974 | Ga0495649_0034647 | |||
| 2975 | Ga0495649_0106358 | |||
| 2976 | Ga0495649_0373096 | |||
| 2977 | Ga0495649_0457901 | |||
| 2978 | Ga0495589_0004109 | |||
| 2979 | Ga0495589_0091240 | |||
| 2980 | Ga0495589_0094426 | |||
| 2981 | Ga0495589_0169690 | |||
| 2982 | Ga0495600_0085491 | |||
| 2983 | Ga0495660_0076155 | |||
| 2984 | Ga0495581_0003470 | |||
| 2985 | Ga0495604_0014295 | |||
| 2986 | Ga0495604_0019898 | |||
| 2987 | Ga0495604_0028637 | |||
| 2988 | Ga0495674_0000529 | |||
| 2989 | Ga0495674_0024644 | |||
| 2990 | Ga0495674_0120170 | |||
| 2991 | Ga0495674_0683939 | |||
| 2992 | Ga0495674_1433416 | |||
| 2993 | Ga0495672_0012806 | |||
| 2994 | Ga0495676_0043008 | |||
| 2995 | Ga0495680_0015339 | |||
| 2996 | Ga0495680_0145811 | |||
| 2997 | Ga0495680_0763067 | |||
| 2998 | Ga0495683_0001263 | |||
| 2999 | Ga0495683_0059121 | |||
| 3000 | Ga0495683_0165830 | |||
| 3001 | Ga0495687_023020 | |||
| 3002 | Ga0495687_093290 | |||
| 3003 | Ga0495675_0042917 | |||
| 3004 | Ga0495675_0047428 | |||
| 3005 | Ga0495675_0055935 | |||
| 3006 | Ga0495677_0164299 | |||
| 3007 | Ga0495679_000045 | |||
| 3008 | Ga0495679_060283 | |||
| 3009 | Ga0495685_059424 | |||
| 3010 | Ga0495673_0080335 | |||
| 3011 | Ga0495673_0082151 | |||
| 3012 | Ga0495673_0151112 | |||
| 3013 | Ga0495681_0044114 | |||
| 3014 | Ga0495681_0309890 | |||
| 3015 | Ga0495684_0301756 | |||
| 3016 | Ga0495684_0596202 | |||
| 3017 | Ga0495686_0017669 | |||
| 3018 | Ga0495686_0034356 | |||
| 3019 | Ga0495686_0070368 | |||
| 3020 | Ga0495686_0236455 | |||
| 3021 | Ga0495593_0004158 | |||
| 3022 | Ga0495593_0006841 | |||
| 3023 | Ga0495593_0018177 | |||
| 3024 | Ga0495593_0118478 | |||
| 3025 | Ga0495593_0153095 | |||
| 3026 | Ga0495602_0000451 | |||
| 3027 | Ga0495602_0051921 | |||
| 3028 | Ga0495602_0388114 | |||
| 3029 | Ga0495614_0024646 | |||
| 3030 | Ga0495626_0056877 | |||
| 3031 | Ga0495626_0082558 | |||
| 3032 | Ga0495626_0085873 | |||
| 3033 | Ga0495626_0096506 | |||
| 3034 | Ga0496100_0000149 | |||
| 3035 | Ga0496100_0033277 | |||
| 3036 | Ga0496100_0041046 | |||
| 3037 | Ga0496100_0264530 | |||
| 3038 | Ga0496100_0358057 | |||
| 3039 | Ga0496101_0000204 | |||
| 3040 | Ga0496101_0035408 | |||
| 3041 | Ga0496101_0065053 | |||
| 3042 | Ga0496101_0071732 | |||
| 3043 | Ga0496101_0093750 | |||
| 3044 | Ga0496101_0500979 | |||
| 3045 | Ga0496101_0897247 | |||
| 3046 | Ga0496102_0000298 | |||
| 3047 | Ga0496102_0003655 | |||
| 3048 | Ga0496102_0006544 | |||
| 3049 | Ga0496102_0007864 | |||
| 3050 | Ga0496102_0009745 | |||
| 3051 | Ga0496102_0154782 | |||
| 3052 | Ga0496102_0323893 | |||
| 3053 | Ga0496102_0401113 | |||
| 3054 | Ga0496102_0540259 | |||
| 3055 | Ga0496102_1356304 | |||
| 3056 | Ga0496103_0000253 | |||
| 3057 | Ga0496103_0017224 | |||
| 3058 | Ga0496103_0021495 | |||
| 3059 | Ga0496103_0069087 | |||
| 3060 | Ga0496104_0015320 | |||
| 3061 | Ga0496104_0019627 | |||
| 3062 | Ga0496104_0049079 | |||
| 3063 | Ga0496104_0057978 | |||
| 3064 | Ga0496104_0061505 | |||
| 3065 | Ga0496104_0071071 | |||
| 3066 | Ga0496104_0139105 | |||
| 3067 | Ga0496104_0379489 | |||
| 3068 | Ga0496104_0398067 | |||
| 3069 | Ga0496104_0552097 | |||
| 3070 | Ga0496105_0004996 | |||
| 3071 | Ga0496105_0041568 | |||
| 3072 | Ga0496105_0045123 | |||
| 3073 | Ga0496105_0057930 | |||
| 3074 | Ga0496105_0110101 | |||
| 3075 | Ga0496105_0238098 | |||
| 3076 | Ga0496106_0000032 | |||
| 3077 | Ga0496106_0006719 | |||
| 3078 | Ga0496106_0007795 | |||
| 3079 | Ga0496106_0063916 | |||
| 3080 | Ga0496106_0066374 | |||
| 3081 | Ga0496106_0180366 | |||
| 3082 | Ga0496106_0206439 | |||
| 3083 | Ga0496106_1390027 | |||
| 3084 | Ga0496107_0030005 | |||
| 3085 | Ga0496107_0145813 | |||
| 3086 | Ga0496107_0246379 | |||
| 3087 | Ga0496107_0296782 | |||
| 3088 | Ga0496107_0332851 | |||
| 3089 | Ga0496108_0323820 | |||
| 3090 | Ga0496108_0353499 | |||
| 3091 | Ga0496108_0861419 | |||
| 3092 | Ga0496108_0872131 | |||
| 3093 | Ga0496108_1252712 | |||
| 3094 | Ga0496109_0129267 | |||
| 3095 | Ga0496109_0171760 | |||
| 3096 | Ga0496109_0333029 | |||
| 3097 | Ga0496109_0628005 | |||
| 3098 | Ga0496109_1422020 | |||
| 3099 | Ga0496109_1547810 | |||
| 3100 | Ga0496110_0004145 | |||
| 3101 | Ga0496110_0022093 | |||
| 3102 | Ga0496110_0053482 | |||
| 3103 | Ga0496110_0114337 | |||
| 3104 | Ga0496110_0144298 | |||
| 3105 | Ga0496110_1375052 | |||
| 3106 | Ga0496110_1641845 | |||
| 3107 | Ga0496111_0057815 | |||
| 3108 | Ga0496111_0076658 | |||
| 3109 | Ga0496111_0116895 | |||
| 3110 | Ga0496111_0194734 | |||
| 3111 | Ga0496111_0409439 | |||
| 3112 | Ga0496111_0957551 | |||
| 3113 | Ga0496112_0081915 | |||
| 3114 | Ga0496112_0107336 | |||
| 3115 | Ga0496112_0120672 | |||
| 3116 | Ga0496112_0341432 | |||
| 3117 | Ga0496113_0001027 | |||
| 3118 | Ga0496113_0005040 | |||
| 3119 | Ga0496114_0003149 | |||
| 3120 | Ga0496114_0008418 | |||
| 3121 | Ga0496114_0026734 | |||
| 3122 | Ga0496114_0072860 | |||
| 3123 | Ga0496114_0090054 | |||
| 3124 | Ga0496114_0185758 | |||
| 3125 | Ga0496114_0229483 | |||
| 3126 | Ga0496114_0674838 | |||
| 3127 | Ga0496115_0000844 | |||
| 3128 | Ga0496115_0002412 | |||
| 3129 | Ga0496115_0051522 | |||
| 3130 | Ga0496115_0058192 | |||
| 3131 | Ga0496115_0176999 | |||
| 3132 | Ga0496115_0905442 | |||
| 3133 | Ga0496116_0018763 | |||
| 3134 | Ga0496116_0046983 | |||
| 3135 | Ga0496116_0087140 | |||
| 3136 | Ga0496116_0104014 | |||
| 3137 | Ga0496116_0107605 | |||
| 3138 | Ga0496117_0000171 | |||
| 3139 | Ga0496117_0089273 | |||
| 3140 | Ga0496117_0102805 | |||
| 3141 | Ga0496117_0220037 | |||
| 3142 | Ga0496117_0292987 | |||
| 3143 | Ga0496118_0000276 | |||
| 3144 | Ga0496118_0000354 | |||
| 3145 | Ga0496118_0029441 | |||
| 3146 | Ga0496118_0045259 | |||
| 3147 | Ga0496118_0127903 | |||
| 3148 | Ga0496119_0017495 | |||
| 3149 | Ga0496119_0050922 | |||
| 3150 | Ga0496120_0257633 | |||
| 3151 | Ga0496121_0000141 | |||
| 3152 | Ga0496121_0003156 | |||
| 3153 | Ga0496121_0003736 | |||
| 3154 | Ga0496121_0005380 | |||
| 3155 | Ga0496121_0016043 | |||
| 3156 | Ga0496121_0112777 | |||
| 3157 | Ga0496121_0152653 | |||
| 3158 | Ga0496122_0012850 | |||
| 3159 | Ga0496122_0068789 | |||
| 3160 | Ga0496123_0130883 | |||
| 3161 | Ga0496124_0000282 | |||
| 3162 | Ga0496124_0056706 | |||
| 3163 | Ga0496124_0085211 | |||
| 3164 | Ga0496124_0148795 | |||
| 3165 | Ga0496124_0288008 | |||
| 3166 | Ga0496125_0071926 | |||
| 3167 | Ga0496125_0086012 | |||
| 3168 | Ga0496125_0172295 | |||
| 3169 | Ga0496126_0001351 | |||
| 3170 | Ga0496126_0003785 | |||
| 3171 | Ga0496126_0004234 | |||
| 3172 | Ga0496126_0078962 | |||
| 3173 | Ga0496126_0332429 | |||
| 3174 | Ga0496126_0875021 | |||
| 3175 | Ga0496126_1417230 | |||
| 3176 | Ga0495678_013024 | |||
| 3177 | Ga0495678_084829 | |||
| 3178 | Ga0495682_0037955 | |||
| 3179 | Ga0495682_0067637 | |||
| 3180 | Ga0495682_0079624 | |||
| 3181 | Ga0495682_0177830 | |||
| 3182 | Ga0501031_0054357 | |||
| 3183 | Ga0501031_0236266 | |||
| 3184 | Ga0501032_0065568 | |||
| 3185 | Ga0501032_0166614 | |||
| 3186 | Ga0501033_0051248 | |||
| 3187 | Ga0501033_0063844 | |||
| 3188 | Ga0501033_0226356 | |||
| 3189 | Ga0501033_0779283 | |||
| 3190 | Ga0501034_0163377 | |||
| 3191 | Ga0501034_0204748 | |||
| 3192 | Ga0501034_0412934 | |||
| 3193 | Ga0501034_0473025 | |||
| 3194 | Ga0501036_0086051 | |||
| 3195 | Ga0501037_0063212 | |||
| 3196 | Ga0501037_0701472 | |||
| 3197 | Ga0501038_0015812 | |||
| 3198 | Ga0501038_0345643 | |||
| 3199 | Ga0501039_0167357 | |||
| 3200 | Ga0501040_0421083 | |||
| 3201 | Ga0501040_1050476 | |||
| 3202 | Ga0501041_0097199 | |||
| 3203 | Ga0501043_0110685 | |||
| 3204 | Ga0501043_0148973 | |||
| 3205 | Ga0501043_0234142 | |||
| 3206 | Ga0501043_0387597 | |||
| 3207 | Ga0501043_0545554 | |||
| 3208 | Ga0501043_0580313 | |||
| 3209 | Ga0501046_0224994 | |||
| 3210 | Ga0501047_0000767 | |||
| 3211 | Ga0501047_0047995 | |||
| 3212 | Ga0501047_0113015 | |||
| 3213 | Ga0501047_0275039 | |||
| 3214 | Ga0501047_0641583 | |||
| 3215 | Ga0501048_0041574 | |||
| 3216 | Ga0501048_0166114 | |||
| 3217 | Ga0501068_0083238 | |||
| 3218 | Ga0501068_0401870 | |||
| 3219 | Ga0501069_0041447 | |||
| 3220 | Ga0501070_0036539 | |||
| 3221 | Ga0501070_0082455 | |||
| 3222 | Ga0501070_0334466 | |||
| 3223 | Ga0501070_0443715 | |||
| 3224 | Ga0501070_0448025 | |||
| 3225 | Ga0501070_0814577 | |||
| 3226 | Ga0501071_0123633 | |||
| 3227 | Ga0501071_0162122 | |||
| 3228 | Ga0501071_0662665 | |||
| 3229 | Ga0501072_0175138 | |||
| 3230 | Ga0501072_0742313 | |||
| 3231 | Ga0501073_0018731 | |||
| 3232 | Ga0501073_0092455 | |||
| 3233 | Ga0501073_0193696 | |||
| 3234 | Ga0501073_0227964 | |||
| 3235 | Ga0501073_0961909 | |||
| 3236 | Ga0501074_0013400 | |||
| 3237 | Ga0501074_0170120 | |||
| 3238 | Ga0501074_0187727 | |||
| 3239 | Ga0501076_0008169 | |||
| 3240 | Ga0501076_0032944 | |||
| 3241 | Ga0501077_0791896 | |||
| 3242 | Ga0501202_010428 | |||
| 3243 | Ga0501230_010201 | |||
| 3244 | Ga0501240_043357 | |||
| 3245 | Ga0501249_029960 | |||
| 3246 | Ga0501253_110990 | |||
| 3247 | Ga0501079_0004373 | |||
| 3248 | Ga0501079_0086110 | |||
| 3249 | Ga0501079_0250664 | |||
| 3250 | Ga0501080_0005264 | |||
| 3251 | Ga0501080_0005282 | |||
| 3252 | Ga0501080_0204010 | |||
| 3253 | Ga0501080_1085673 | |||
| 3254 | Ga0501081_0202231 | |||
| 3255 | Ga0501081_0286665 | |||
| 3256 | Ga0501083_0015218 | |||
| 3257 | Ga0501083_0364549 | |||
| 3258 | Ga0501241_074598 | |||
| 3259 | Ga0501262_000018 | |||
| 3260 | Ga0501035_0002389 | |||
| 3261 | Ga0501035_0007057 | |||
| 3262 | Ga0501035_0022406 | |||
| 3263 | Ga0501035_0043215 | |||
| 3264 | Ga0501035_0048919 | |||
| 3265 | Ga0501035_0066424 | |||
| 3266 | Ga0501035_0262795 | |||
| 3267 | Ga0501035_0304279 | |||
| 3268 | Ga0501035_0428886 | |||
| 3269 | Ga0501044_0008426 | |||
| 3270 | Ga0501044_0015381 | |||
| 3271 | Ga0501044_0030021 | |||
| 3272 | Ga0501044_0191621 | |||
| 3273 | Ga0501044_0272016 | |||
| 3274 | Ga0501044_0654710 | |||
| 3275 | Ga0501044_0828805 | |||
| 3276 | Ga0501044_0832002 | |||
| 3277 | Ga0501045_0053177 | |||
| 3278 | nmdc:mga03683_177937_c1 | |||
| 3279 | nmdc:mga03683_18418_c1 | |||
| 3280 | nmdc:mga03683_261517_c1 | |||
| 3281 | nmdc:mga03683_302002_c1 | |||
| 3282 | nmdc:mga03683_30365_c1 | |||
| 3283 | nmdc:mga03683_40018_c1 | |||
| 3284 | nmdc:mga03n38_242378_c1 | |||
| 3285 | nmdc:mga03n38_4824_c1 | |||
| 3286 | nmdc:mga00v17_14257_c1 | |||
| 3287 | nmdc:mga0yw44_1012827_c1 | |||
| 3288 | nmdc:mga0yw44_105510_c1 | |||
| 3289 | nmdc:mga0yw44_4066_c1 | |||
| 3290 | nmdc:mga0yw44_49946_c1 | |||
| 3291 | nmdc:mga0k408_151171_c1 | |||
| 3292 | nmdc:mga0k408_17982_c1 | |||
| 3293 | nmdc:mga0k408_26346_c1 | |||
| 3294 | nmdc:mga0k408_4257_c1 | |||
| 3295 | nmdc:mga0k408_534112_c1 | |||
| 3296 | nmdc:mga0k408_773_c1 | |||
| 3297 | nmdc:mga0k408_781_c1 | |||
| 3298 | nmdc:mga0k408_85857_c1 | |||
| 3299 | nmdc:mga06z11_111075_c1 | |||
| 3300 | nmdc:mga06z11_13314_c1 | |||
| 3301 | nmdc:mga06z11_348575_c1 | |||
| 3302 | nmdc:mga06z11_444249_c1 | |||
| 3303 | nmdc:mga06z11_57469_c1 | |||
| 3304 | nmdc:mga06z11_724228_c1 | |||
| 3305 | nmdc:mga04h51_3324_c1 | |||
| 3306 | nmdc:mga07m45_185475_c1 | |||
| 3307 | nmdc:mga07m45_226359_c1 | |||
| 3308 | nmdc:mga07m45_23225_c1 | |||
| 3309 | nmdc:mga07m45_37997_c1 | |||
| 3310 | nmdc:mga0qj67_10909_c1 | |||
| 3311 | nmdc:mga0qj67_81413_c1 | |||
| 3312 | nmdc:mga08y16_1342194_c1 | |||
| 3313 | nmdc:mga08y16_26645_c1 | |||
| 3314 | nmdc:mga08y16_271743_c1 | |||
| 3315 | nmdc:mga08y16_709729_c1 | |||
| 3316 | nmdc:mga08y16_786418_c1 | |||
| 3317 | nmdc:mga08y16_857049_c1 | |||
| 3318 | nmdc:mga08y16_99364_c1 | |||
| 3319 | nmdc:mga0a205_108416_c1 | |||
| 3320 | nmdc:mga0sz30_105712_c1 | |||
| 3321 | nmdc:mga0sz30_27582_c1 | |||
| 3322 | Ga0500578_0000002 | |||
| 3323 | Ga0500644_0001458 | |||
| 3324 | Ga0500646_0005532 | |||
| 3325 | Ga0500651_0038444 | |||
| 3326 | Ga0500651_0077221 | |||
| 3327 | Ga0500555_150950 | |||
| 3328 | Ga0500591_142302 | |||
| 3329 | Ga0500594_0001847 | |||
| 3330 | Ga0500608_002001 | |||
| 3331 | Ga0500628_002992 | |||
| 3332 | Ga0500652_000076 | |||
| 3333 | Ga0500655_003466 | |||
| 3334 | Ga0500559_0000038 | |||
| 3335 | Ga0500559_0405411 | |||
| 3336 | Ga0500568_0049523 | |||
| 3337 | Ga0500568_0107014 | |||
| 3338 | Ga0500577_0023081 | |||
| 3339 | Ga0500604_0001378 | |||
| 3340 | Ga0500604_0043040 | |||
| 3341 | Ga0500619_000367 | |||
| 3342 | Ga0500622_0000236 | |||
| 3343 | Ga0500622_0001043 | |||
| 3344 | Ga0500645_002979 | |||
| 3345 | Ga0500587_003821 | |||
| 3346 | Ga0501084_0257970 | |||
| 3347 | Ga0501084_0315009 | |||
| 3348 | Ga0501082_0235260 | |||
| 3349 | Ga0501082_0406808 | |||
| 3350 | Ga0501082_0407180 | |||
| 3351 | Ga0501082_0962972 | |||
| 3352 | Ga0466962_0000671 | |||
| 3353 | Ga0466962_0026155 | |||
| 3354 | 2501070363 | |||
| 3355 | 2501406829 | |||
| 3356 | 2510247336 | |||
| 3357 | 2511092901 | |||
| 3358 | 2511097737 | |||
| 3359 | 2511109342 | |||
| 3360 | 2512351164 | |||
| 3361 | 2513554785 | |||
| 3362 | 2513565441 | |||
| 3363 | 2514048330 | |||
| 3364 | 2515685421 | |||
| 3365 | 2516022627 | |||
| 3366 | 2548497973 | |||
| 3367 | 2563056692 | |||
| 3368 | 2587733019 | |||
| 3369 | 2587757295 | |||
| 3370 | 2600815389 | |||
| 3371 | 2643991488 | |||
| 3372 | 2644062434 | |||
| 3373 | 2644076533 | |||
| 3374 | 2644159796 | |||
| 3375 | 2644245725 | |||
| 3376 | 2644529063 | |||
| 3377 | 2644646072 | |||
| 3378 | 2713481299 | |||
| 3379 | 2719638490 | |||
| 3380 | 2721028365 | |||
| 3381 | 2816474857 | |||
| 3382 | 2819619688 | |||
| 3383 | 2821446133 | |||
| 3384 | 2839142828 | |||
| 3385 | 2842325987 | |||
| 3386 | 2842351492 | |||
| 3387 | 2842455309 | |||
| 3388 | 2856291168 | |||
| 3389 | 2857364207 | |||
| 3390 | 2883095724 | |||
| 3391 | 2885280221 | |||
| 3392 | 2894656750 | |||
| 3393 | 2902684627 | |||
| 3394 | 2921647049 | |||
| 3395 | 2928111295 | |||
| 3396 | 2928138097 | |||
| 3397 | 2928506741 | |||
| 3398 | 2945947783 | |||
| 3399 | 2945972510 | |||
| 3400 | 2990711568 | |||
| 3401 | 642620405 | |||
| 3402 | 8003961864 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5umw-assembly3.cif.gz_D | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.9459 | 1 | 133 |
| 5umw-assembly3.cif.gz_D | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.939 | 1 | 133 |
| 5umw-assembly2.cif.gz_B | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.9369 | 2 | 134 |
| 6cky-assembly1.cif.gz_B | crystal structure of ucms2 | 0.9267 | 1 | 133 |
| 6cky-assembly1.cif.gz_B | crystal structure of ucms2 | 0.9201 | 1 | 133 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9064 | 83 | 132 | 3.30.720.110 |
| 3sk1A02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8742 | 82 | 133 | 3.30.720.110 |
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8503 | 81 | 132 | 3.30.720.110 |
| 3itwB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8502 | 83 | 134 | 3.30.720.110 |
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8484 | 84 | 132 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257KH99-F1-model_v4 | Glyoxalase | 0.9974 | 1 | 133 |
|
| AF-A0A1H1H8R4-F1-model_v4 | Catechol 2,3-dioxygenase | 0.9908 | 1 | 133 |
GO:0051213
|
| AF-A0A257KH99-F1-model_v4 | Glyoxalase | 0.99 | 1 | 133 |
|
| AF-A0A522EC71-F1-model_v4 | VOC family protein | 0.9882 | 1 | 133 |
|
| AF-A0A0Q8S3J9-F1-model_v4 | Glyoxalase | 0.9868 | 2 | 133 |
|