F495394

General Info

Members Datasets Scaffolds Average Seq Length
1701 571 3402 136

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10034921|Ga0163161_100349215
Length 147
Sequence MIQGIQVVGLYVRDQDEALAFYVEQLGFRVHTDVANGAYRWLTVQHPDQPSFQLGLFTPGPPVLDAATAQAVRAIVAKGAMPPLVLAVDDCRAAYDRMLARGVEFTQEPVDRYGTVDAGFRDPSGNGWKMIEARRDALGARSQRRSQ

Samples

Sample ID Description Type Environment
1 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
93 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
104 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
105 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
110 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
111 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
141 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
142 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
143 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
144 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
148 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
150 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
151 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
154 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
155 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
162 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
165 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
229 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
231 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
232 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
236 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
237 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
238 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
239 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
240 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
241 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
242 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
243 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
244 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
245 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
246 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
247 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
248 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
249 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
250 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
251 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
252 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
253 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
254 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
255 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
256 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
257 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
258 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
259 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
260 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
261 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
262 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
263 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
264 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
265 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
266 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
267 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
268 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
269 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
270 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
271 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
273 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
274 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
278 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
279 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
280 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
281 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
282 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
283 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
284 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
285 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
286 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
287 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
288 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
289 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
290 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
291 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
292 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
293 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
294 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
295 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
296 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
297 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
298 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
299 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
300 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
301 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
302 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
303 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
304 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
305 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
306 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
307 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
308 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
309 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
310 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
311 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
312 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
313 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
314 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
315 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
316 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
317 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
318 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
319 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
320 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
321 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
322 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
323 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
324 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
325 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
326 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
327 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
328 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
329 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
330 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
331 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
332 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
333 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
334 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
335 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
336 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
337 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
338 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
339 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
340 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
341 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
342 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
343 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
344 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
345 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
346 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
347 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
348 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
349 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
350 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
351 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
352 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
353 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
354 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
355 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
356 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
357 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
358 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
359 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
360 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
361 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
362 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
363 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
364 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
365 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
366 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
367 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
368 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
369 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
370 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
371 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
372 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
373 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
374 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
375 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
376 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
377 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
378 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
379 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
380 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
381 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
382 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
383 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
384 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
385 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
386 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
387 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
388 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
389 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
390 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
391 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
392 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
393 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
394 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
395 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
396 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
397 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
398 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
399 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
400 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
401 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
402 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
403 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
404 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
405 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
406 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
407 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
408 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
409 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
410 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
411 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
412 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
413 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
414 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
415 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
416 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
417 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
418 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
419 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
420 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
421 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
422 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
423 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
424 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
425 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
426 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
427 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
428 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
429 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
430 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
431 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
432 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
433 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
434 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
435 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
436 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
437 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
438 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
439 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
440 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
441 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
442 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
443 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
444 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
445 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
446 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
447 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
448 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
449 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
450 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
451 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
452 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
467 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
468 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
469 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
470 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
471 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
472 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
473 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
474 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
475 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
476 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
477 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
478 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
479 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
480 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
481 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
482 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
483 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
484 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
485 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
486 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
488 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
489 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
490 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
491 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
492 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
493 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
494 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
495 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
496 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
497 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
498 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
499 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
500 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
501 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
502 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
503 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
504 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
505 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
506 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
507 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
508 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
509 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
510 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
511 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
512 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
513 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
514 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
515 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
516 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
517 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
518 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
519 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
520 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
521 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
522 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
523 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
524 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
525 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
526 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
527 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
528 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
529 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
530 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
531 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
532 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
533 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
534 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
535 2547132374 Acidovorax radicis N35 Isolate Unclassified
536 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
537 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
538 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
539 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
540 2643221596 Acidovorax sp. Root70 Isolate Unclassified
541 2643221609 Acidovorax sp. Root217 Isolate Unclassified
542 2643221611 Acidovorax sp. Root219 Isolate Unclassified
543 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
544 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
545 2643221695 Lysobacter sp. Root494 Isolate Unclassified
546 2643221717 Acidovorax sp. Root267 Isolate Unclassified
547 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
548 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
549 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
550 2816332133 Acidovorax radicis 2721A Isolate Unclassified
551 2818991450 Burkholderia sp. 604 Isolate Unclassified
552 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
553 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
554 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
555 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
556 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
557 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
558 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
559 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
560 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
561 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
562 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
563 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
564 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
565 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
566 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
567 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
568 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
569 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
570 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
571 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.88
Metatranscriptomes 0.24
Isolates 2.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.29
Nodule 1.06
Rhizoplane 6.47
Rhizosphere 77.25
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163161_10034921 3300017792 Bacteria 3597
2 JGI24739J22299_10003364 3300001989 Bacteria 6102
3 JGI24739J22299_10023427 3300001989 Bacteria 2183
4 JGI24739J22299_10084174 3300001989 Bacteria 974
5 JGI24739J22299_10182118 3300001989 Bacteria 618
6 JGI24737J22298_10024487 3300001990 Bacteria 1911
7 JGI24737J22298_10035457 3300001990 Bacteria 1544
8 JGI24735J21928_10000218 3300002067 Bacteria 20136
9 JGI24735J21928_10019288 3300002067 Bacteria 2096
10 JGI24735J21928_10084510 3300002067 Bacteria 909
11 JGI24738J21930_10001339 3300002075 Bacteria 6845
12 JGI25151J46595_10002650 3300003187 Bacteria 10524
13 JGI25153J46596_10002559 3300003215 Bacteria 10429
14 JGI25153J46596_10004432 3300003215 Bacteria 7574
15 rootH2_10017111 3300003320 Bacteria 8496
16 rootL2_10017630 3300003322 Bacteria 6871
17 rootL2_10063704 3300003322 Bacteria 4615
18 rootH1_10057484 3300003323 Bacteria 1079
19 rootH1_10106569 3300003323 Bacteria 7413
20 JGI25160J50197_1000138 3300003354 Bacteria 65562
21 JGI25160J50197_1067284 3300003354 Bacteria 694
22 Ga0055529_1000645 3300003763 Bacteria 25333
23 Ga0055526_1000025 3300003771 Bacteria 154279
24 Ga0055524_1000340 3300003775 Bacteria 42965
25 Ga0055528_1021709 3300003790 Bacteria 2025
26 Ga0055530_10001296 3300003791 Bacteria 18885
27 Ga0055540_1000202 3300003792 Bacteria 57757
28 Ga0055531_10006224 3300003794 Bacteria 6815
29 Ga0065165_1001498 3300005262 Bacteria 24704
30 Ga0065714_10003524 3300005288 Bacteria 8451
31 Ga0065714_10026103 3300005288 Bacteria 1684
32 Ga0065704_10314299 3300005289 Bacteria 863
33 Ga0065712_10139593 3300005290 Bacteria 1463
34 Ga0065715_10382284 3300005293 Bacteria 906
35 Ga0065707_10113921 3300005295 Bacteria 2312
36 Ga0070658_10002159 3300005327 Bacteria 16503
37 Ga0070658_10486117 3300005327 Bacteria 1066
38 Ga0070658_10509300 3300005327 Bacteria 1040
39 Ga0070676_10202976 3300005328 Bacteria 1301
40 Ga0070676_11087146 3300005328 Bacteria 604
41 Ga0070683_100025002 3300005329 Bacteria 5357
42 Ga0070683_100454758 3300005329 Bacteria 1222
43 Ga0070683_101498005 3300005329 Bacteria 648
44 Ga0070683_101622339 3300005329 Bacteria 622
45 Ga0070690_100000170 3300005330 Bacteria 33307
46 Ga0070690_100006691 3300005330 Bacteria 6547
47 Ga0070690_100628572 3300005330 Bacteria 818
48 Ga0070670_100056500 3300005331 Bacteria 3368
49 Ga0070670_100111461 3300005331 Bacteria 2358
50 Ga0070670_100338079 3300005331 Bacteria 1321
51 Ga0070670_101659532 3300005331 Bacteria 588
52 Ga0070670_101999810 3300005331 Bacteria 534
53 Ga0070677_10005411 3300005333 Bacteria 4206
54 Ga0070677_10135632 3300005333 Bacteria 1129
55 Ga0070677_10137563 3300005333 Bacteria 1122
56 Ga0070677_10379468 3300005333 Bacteria 740
57 Ga0070677_10500380 3300005333 Bacteria 658
58 Ga0068869_100058329 3300005334 Bacteria 2822
59 Ga0068869_100646122 3300005334 Bacteria 898
60 Ga0068869_101210580 3300005334 Bacteria 664
61 Ga0068869_101740734 3300005334 Bacteria 557
62 Ga0070666_10003654 3300005335 Bacteria 9323
63 Ga0070666_10005053 3300005335 Bacteria 8069
64 Ga0070666_10005266 3300005335 Bacteria 7926
65 Ga0070680_100021168 3300005336 Bacteria 5167
66 Ga0070680_100075010 3300005336 Bacteria 2784
67 Ga0070680_101381494 3300005336 Bacteria 610
68 Ga0070682_100366538 3300005337 Bacteria 1079
69 Ga0068868_100001028 3300005338 Bacteria 19079
70 Ga0068868_100313646 3300005338 Bacteria 1335
71 Ga0068868_100661690 3300005338 Bacteria 931
72 Ga0068868_101195922 3300005338 Bacteria 703
73 Ga0070660_100438171 3300005339 Bacteria 1083
74 Ga0070660_100804856 3300005339 Bacteria 790
75 Ga0070660_101608049 3300005339 Bacteria 553
76 Ga0070689_100002054 3300005340 Bacteria 13071
77 Ga0070689_100045528 3300005340 Bacteria 3379
78 Ga0070689_100230457 3300005340 Bacteria 1522
79 Ga0070689_100658192 3300005340 Bacteria 912
80 Ga0070689_101011139 3300005340 Bacteria 740
81 Ga0070689_101360385 3300005340 Bacteria 641
82 Ga0070687_100161025 3300005343 Bacteria 1326
83 Ga0070687_101181569 3300005343 Bacteria 563
84 Ga0070661_100020048 3300005344 Bacteria 4766
85 Ga0070661_100311536 3300005344 Bacteria 1227
86 Ga0070661_100870899 3300005344 Bacteria 742
87 Ga0070661_101040801 3300005344 Bacteria 680
88 Ga0070692_11093151 3300005345 Bacteria 562
89 Ga0070668_100004204 3300005347 Bacteria 10673
90 Ga0070668_100059222 3300005347 Bacteria 2964
91 Ga0070668_100442266 3300005347 Bacteria 1116
92 Ga0070668_100483779 3300005347 Bacteria 1069
93 Ga0070668_100527611 3300005347 Bacteria 1025
94 Ga0070668_100573253 3300005347 Bacteria 984
95 Ga0070668_101316589 3300005347 Bacteria 657
96 Ga0070668_101458564 3300005347 Bacteria 625
97 Ga0070669_100008000 3300005353 Bacteria 7551
98 Ga0070669_100035511 3300005353 Bacteria 3612
99 Ga0070669_100365896 3300005353 Bacteria 1173
100 Ga0070669_100495557 3300005353 Bacteria 1013
101 Ga0070669_101907033 3300005353 Bacteria 519
102 Ga0070675_100002408 3300005354 Bacteria 13959
103 Ga0070675_100132674 3300005354 Bacteria 2123
104 Ga0070675_100211012 3300005354 Bacteria 1688
105 Ga0070675_100761328 3300005354 Bacteria 884
106 Ga0070675_100964261 3300005354 Bacteria 782
107 Ga0070671_100000044 3300005355 Bacteria 86204
108 Ga0070671_100012205 3300005355 Bacteria 6913
109 Ga0070671_100020242 3300005355 Bacteria 5424
110 Ga0070671_100109424 3300005355 Bacteria 2321
111 Ga0070671_100246287 3300005355 Bacteria 1518
112 Ga0070671_100252344 3300005355 Bacteria 1499
113 Ga0070671_100304997 3300005355 Bacteria 1356
114 Ga0070671_100314450 3300005355 Bacteria 1334
115 Ga0070671_100493664 3300005355 Bacteria 1053
116 Ga0070671_100553871 3300005355 Bacteria 992
117 Ga0070671_101027822 3300005355 Bacteria 723
118 Ga0070674_100014412 3300005356 Bacteria 4916
119 Ga0070674_100053212 3300005356 Bacteria 2794
120 Ga0070674_100321061 3300005356 Bacteria 1241
121 Ga0070674_100375084 3300005356 Bacteria 1156
122 Ga0070674_100668358 3300005356 Bacteria 885
123 Ga0070674_100718574 3300005356 Bacteria 855
124 Ga0070673_100002015 3300005364 Bacteria 12259
125 Ga0070673_100017551 3300005364 Bacteria 5094
126 Ga0070673_100189949 3300005364 Bacteria 1764
127 Ga0070673_100394870 3300005364 Bacteria 1236
128 Ga0070673_100415319 3300005364 Bacteria 1205
129 Ga0070673_100718191 3300005364 Bacteria 918
130 Ga0070673_100784061 3300005364 Bacteria 879
131 Ga0070673_100921324 3300005364 Bacteria 811
132 Ga0070688_100079229 3300005365 Bacteria 2121
133 Ga0070688_100499717 3300005365 Bacteria 917
134 Ga0070688_101305019 3300005365 Bacteria 586
135 Ga0070688_101588166 3300005365 Bacteria 534
136 Ga0070659_100445630 3300005366 Bacteria 1097
137 Ga0070659_100466896 3300005366 Bacteria 1072
138 Ga0070659_100622539 3300005366 Bacteria 929
139 Ga0070659_100931856 3300005366 Bacteria 760
140 Ga0070667_100000708 3300005367 Bacteria 32130
141 Ga0070667_100001356 3300005367 Bacteria 21951
142 Ga0070667_100010392 3300005367 Bacteria 7684
143 Ga0070667_100011492 3300005367 Bacteria 7321
144 Ga0070667_100044454 3300005367 Bacteria 3731
145 Ga0070667_100053057 3300005367 Bacteria 3422
146 Ga0070667_100174704 3300005367 Bacteria 1898
147 Ga0070667_100220658 3300005367 Bacteria 1687
148 Ga0070667_100679270 3300005367 Bacteria 952
149 Ga0070701_10045625 3300005438 Bacteria 2250
150 Ga0070701_10455387 3300005438 Bacteria 822
151 Ga0070711_100023555 3300005439 Bacteria 4006
152 Ga0070705_100523983 3300005440 Bacteria 904
153 Ga0070700_100062062 3300005441 Bacteria 2360
154 Ga0070700_100378742 3300005441 Bacteria 1058
155 Ga0070700_100582930 3300005441 Bacteria 874
156 Ga0070700_100591841 3300005441 Bacteria 868
157 Ga0070694_100312606 3300005444 Bacteria 1207
158 Ga0070708_100247604 3300005445 Bacteria 1674
159 Ga0070663_100042514 3300005455 Bacteria 3193
160 Ga0070663_100138790 3300005455 Bacteria 1853
161 Ga0070663_100354199 3300005455 Bacteria 1189
162 Ga0070663_100416219 3300005455 Bacteria 1102
163 Ga0070678_100003442 3300005456 Bacteria 8830
164 Ga0070678_100059660 3300005456 Bacteria 2805
165 Ga0070678_100155746 3300005456 Bacteria 1845
166 Ga0070678_100192916 3300005456 Bacteria 1676
167 Ga0070678_100543016 3300005456 Bacteria 1031
168 Ga0070678_100585829 3300005456 Bacteria 994
169 Ga0070678_100636243 3300005456 Bacteria 956
170 Ga0070662_100007793 3300005457 Bacteria 6957
171 Ga0070662_100026968 3300005457 Bacteria 3983
172 Ga0070662_100049235 3300005457 Bacteria 3038
173 Ga0070662_100275954 3300005457 Bacteria 1359
174 Ga0070662_100288620 3300005457 Bacteria 1329
175 Ga0070662_100325760 3300005457 Bacteria 1254
176 Ga0070662_100392451 3300005457 Bacteria 1144
177 Ga0070662_100648410 3300005457 Bacteria 890
178 Ga0070681_10009145 3300005458 Bacteria 9735
179 Ga0070681_10235743 3300005458 Bacteria 1744
180 Ga0068867_100006852 3300005459 Bacteria 8058
181 Ga0068867_100010539 3300005459 Bacteria 6522
182 Ga0068867_100020738 3300005459 Bacteria 4685
183 Ga0068867_100194070 3300005459 Bacteria 1622
184 Ga0068867_100278550 3300005459 Bacteria 1371
185 Ga0068867_100451275 3300005459 Bacteria 1096
186 Ga0068867_100511535 3300005459 Bacteria 1034
187 Ga0070685_10093186 3300005466 Bacteria 1826
188 Ga0070685_10131177 3300005466 Bacteria 1567
189 Ga0070685_10244490 3300005466 Bacteria 1186
190 Ga0070685_10499751 3300005466 Bacteria 860
191 Ga0070685_10882300 3300005466 Bacteria 664
192 Ga0070707_100718458 3300005468 Bacteria 962
193 Ga0070679_100030083 3300005530 Bacteria 5359
194 Ga0070684_100030247 3300005535 Bacteria 4599
195 Ga0070684_100381892 3300005535 Bacteria 1297
196 Ga0070684_100671024 3300005535 Bacteria 965
197 Ga0068853_100346198 3300005539 Bacteria 1382
198 Ga0070672_100000257 3300005543 Bacteria 30081
199 Ga0070672_100129026 3300005543 Bacteria 2076
200 Ga0070672_100164309 3300005543 Bacteria 1843
201 Ga0070672_100179730 3300005543 Bacteria 1763
202 Ga0070672_100964296 3300005543 Bacteria 755
203 Ga0070672_100996118 3300005543 Bacteria 742
204 Ga0070686_100017496 3300005544 Bacteria 4190
205 Ga0070686_100017565 3300005544 Bacteria 4182
206 Ga0070686_100141531 3300005544 Bacteria 1675
207 Ga0070686_101514287 3300005544 Bacteria 566
208 Ga0070693_100232265 3300005547 Bacteria 1214
209 Ga0070693_100781224 3300005547 Bacteria 706
210 Ga0070665_100000176 3300005548 Bacteria 113398
211 Ga0070665_100203644 3300005548 Bacteria 1979
212 Ga0070665_100730008 3300005548 Bacteria 1004
213 Ga0070665_101767116 3300005548 Bacteria 625
214 Ga0070665_101840637 3300005548 Bacteria 611
215 Ga0070704_100333107 3300005549 Bacteria 1276
216 Ga0070704_100386867 3300005549 Bacteria 1190
217 Ga0070704_101179376 3300005549 Bacteria 698
218 Ga0070704_101971345 3300005549 Bacteria 542
219 Ga0068855_100006465 3300005563 Bacteria 14259
220 Ga0068855_100568881 3300005563 Bacteria 1225
221 Ga0070664_100018748 3300005564 Bacteria 5691
222 Ga0070664_100034095 3300005564 Bacteria 4269
223 Ga0070664_100055809 3300005564 Bacteria 3356
224 Ga0070664_100085823 3300005564 Bacteria 2719
225 Ga0070664_100093667 3300005564 Bacteria 2603
226 Ga0070664_100203642 3300005564 Bacteria 1767
227 Ga0070664_100205438 3300005564 Bacteria 1759
228 Ga0070664_100443544 3300005564 Bacteria 1191
229 Ga0068857_100007255 3300005577 Bacteria 9544
230 Ga0068857_100356947 3300005577 Bacteria 1354
231 Ga0068857_101795431 3300005577 Bacteria 600
232 Ga0068854_100170399 3300005578 Bacteria 1694
233 Ga0068854_100245764 3300005578 Bacteria 1427
234 Ga0068854_100390034 3300005578 Bacteria 1150
235 Ga0068856_100002512 3300005614 Bacteria 18891
236 Ga0068856_100461730 3300005614 Bacteria 1291
237 Ga0070702_100023624 3300005615 Bacteria 3270
238 Ga0070702_100509795 3300005615 Bacteria 885
239 Ga0068852_100200031 3300005616 Bacteria 1890
240 Ga0068852_100229830 3300005616 Bacteria 1768
241 Ga0068852_100368931 3300005616 Bacteria 1406
242 Ga0068852_100431861 3300005616 Bacteria 1301
243 Ga0068852_100746178 3300005616 Bacteria 991
244 Ga0068859_100003821 3300005617 Bacteria 15382
245 Ga0068859_100004139 3300005617 Bacteria 14808
246 Ga0068859_100015467 3300005617 Bacteria 7665
247 Ga0068859_100048360 3300005617 Bacteria 4273
248 Ga0068859_101074221 3300005617 Bacteria 885
249 Ga0068859_101256686 3300005617 Bacteria 816
250 Ga0068859_102393699 3300005617 Bacteria 582
251 Ga0068864_100000318 3300005618 Bacteria 42460
252 Ga0068864_100001446 3300005618 Bacteria 19579
253 Ga0068864_100161343 3300005618 Bacteria 2038
254 Ga0068864_100505888 3300005618 Bacteria 1163
255 Ga0068864_100841021 3300005618 Bacteria 904
256 Ga0068864_101537811 3300005618 Bacteria 669
257 Ga0068864_102026604 3300005618 Bacteria 582
258 Ga0068866_10067940 3300005718 Bacteria 1873
259 Ga0068866_10544798 3300005718 Bacteria 775
260 Ga0068866_10667186 3300005718 Bacteria 710
261 Ga0068866_10718958 3300005718 Bacteria 687
262 Ga0068861_100016912 3300005719 Bacteria 5170
263 Ga0068861_100099307 3300005719 Bacteria 2312
264 Ga0068861_100101827 3300005719 Bacteria 2285
265 Ga0068861_100143840 3300005719 Bacteria 1949
266 Ga0068861_100310284 3300005719 Bacteria 1370
267 Ga0068851_10089185 3300005834 Bacteria 1622
268 Ga0068851_10609614 3300005834 Bacteria 665
269 Ga0068870_10057911 3300005840 Bacteria 2073
270 Ga0068870_10543450 3300005840 Bacteria 781
271 Ga0068870_10599744 3300005840 Bacteria 748
272 Ga0068870_11242059 3300005840 Bacteria 541
273 Ga0068863_100000507 3300005841 Bacteria 39658
274 Ga0068863_100026485 3300005841 Bacteria 5531
275 Ga0068863_100061840 3300005841 Bacteria 3541
276 Ga0068863_100081182 3300005841 Bacteria 3072
277 Ga0068863_100238679 3300005841 Bacteria 1754
278 Ga0068863_100269124 3300005841 Bacteria 1649
279 Ga0068863_100689995 3300005841 Bacteria 1014
280 Ga0068863_100752156 3300005841 Bacteria 971
281 Ga0068863_101526968 3300005841 Bacteria 677
282 Ga0068863_101550799 3300005841 Bacteria 671
283 Ga0068858_100000774 3300005842 Bacteria 33365
284 Ga0068858_100005599 3300005842 Bacteria 12287
285 Ga0068858_100025183 3300005842 Bacteria 5537
286 Ga0068858_100036108 3300005842 Bacteria 4582
287 Ga0068858_100134912 3300005842 Bacteria 2316
288 Ga0068858_101586275 3300005842 Bacteria 646
289 Ga0068860_100014942 3300005843 Bacteria 7590
290 Ga0068860_100094195 3300005843 Bacteria 2854
291 Ga0068860_100098740 3300005843 Bacteria 2784
292 Ga0068860_102388193 3300005843 Bacteria 549
293 Ga0068862_100000837 3300005844 Bacteria 30443
294 Ga0068862_100004861 3300005844 Bacteria 11312
295 Ga0068862_100034683 3300005844 Bacteria 4271
296 Ga0068862_100104541 3300005844 Bacteria 2481
297 Ga0068862_100175575 3300005844 Bacteria 1920
298 Ga0068862_100771972 3300005844 Bacteria 936
299 Ga0068862_100928370 3300005844 Bacteria 857
300 Ga0081455_10002344 3300005937 Bacteria 22600
301 Ga0081455_10104070 3300005937 Bacteria 2271
302 Ga0081538_10049157 3300005981 Bacteria 2561
303 Ga0081539_10085913 3300005985 Bacteria 1639
304 Ga0081539_10227273 3300005985 Bacteria 845
305 Ga0075365_10173499 3300006038 Bacteria 1506
306 Ga0075365_10174274 3300006038 Bacteria 1502
307 Ga0075365_10181297 3300006038 Bacteria 1472
308 Ga0075365_10189645 3300006038 Bacteria 1439
309 Ga0075365_10957175 3300006038 Bacteria 603
310 Ga0075368_10047802 3300006042 Bacteria 1694
311 Ga0075368_10295813 3300006042 Bacteria 698
312 Ga0075363_100003696 3300006048 Bacteria 6579
313 Ga0075363_100011596 3300006048 Bacteria 4225
314 Ga0075363_100011622 3300006048 Bacteria 4220
315 Ga0075363_100020319 3300006048 Bacteria 3329
316 Ga0075363_100034884 3300006048 Bacteria 2629
317 Ga0075363_100146803 3300006048 Bacteria 1330
318 Ga0075364_10036942 3300006051 Bacteria 3160
319 Ga0075364_10209189 3300006051 Bacteria 1323
320 Ga0075432_10023807 3300006058 Bacteria 2098
321 Ga0075362_10004570 3300006177 Bacteria 4988
322 Ga0075362_10009462 3300006177 Bacteria 3770
323 Ga0075362_10011745 3300006177 Bacteria 3456
324 Ga0075362_10056843 3300006177 Bacteria 1762
325 Ga0075362_10098789 3300006177 Bacteria 1363
326 Ga0075362_10198355 3300006177 Bacteria 976
327 Ga0075367_10009821 3300006178 Bacteria 5015
328 Ga0075367_10104037 3300006178 Bacteria 1738
329 Ga0075367_10133780 3300006178 Bacteria 1534
330 Ga0075367_10211778 3300006178 Bacteria 1212
331 Ga0075367_10217941 3300006178 Bacteria 1194
332 Ga0075367_10735713 3300006178 Bacteria 628
333 Ga0075369_10019712 3300006186 Bacteria 2756
334 Ga0075369_10222392 3300006186 Bacteria 874
335 Ga0075366_10000689 3300006195 Bacteria 15998
336 Ga0075366_10004381 3300006195 Bacteria 7576
337 Ga0075366_10010042 3300006195 Bacteria 5305
338 Ga0075366_10015818 3300006195 Bacteria 4332
339 Ga0075366_10028399 3300006195 Bacteria 3283
340 Ga0075366_10062491 3300006195 Bacteria 2213
341 Ga0075366_10074050 3300006195 Bacteria 2030
342 Ga0075366_10099983 3300006195 Bacteria 1740
343 Ga0075366_10776752 3300006195 Bacteria 596
344 Ga0075366_10953136 3300006195 Bacteria 535
345 Ga0075366_11029513 3300006195 Bacteria 514
346 Ga0097621_100027531 3300006237 Bacteria 4471
347 Ga0097621_100214164 3300006237 Bacteria 1677
348 Ga0097621_100352323 3300006237 Bacteria 1309
349 Ga0097621_100710393 3300006237 Bacteria 926
350 Ga0097621_101308900 3300006237 Bacteria 684
351 Ga0097621_101903232 3300006237 Bacteria 568
352 Ga0075370_10006289 3300006353 Bacteria 5962
353 Ga0075370_10014688 3300006353 Bacteria 4181
354 Ga0075370_10169646 3300006353 Bacteria 1282
355 Ga0075370_10490162 3300006353 Bacteria 741
356 Ga0075370_10746227 3300006353 Bacteria 596
357 Ga0068871_100072625 3300006358 Bacteria 2834
358 Ga0068871_100081581 3300006358 Bacteria 2680
359 Ga0068871_100108479 3300006358 Bacteria 2333
360 Ga0068871_100807603 3300006358 Bacteria 865
361 Ga0068871_101024542 3300006358 Bacteria 769
362 Ga0075428_100023230 3300006844 Bacteria 6858
363 Ga0075428_100823553 3300006844 Bacteria 986
364 Ga0075428_101030466 3300006844 Bacteria 871
365 Ga0075428_101567842 3300006844 Bacteria 689
366 Ga0075428_102383532 3300006844 Bacteria 544
367 Ga0075430_100073642 3300006846 Bacteria 2864
368 Ga0075433_10337117 3300006852 Bacteria 1333
369 Ga0075433_11548766 3300006852 Bacteria 572
370 Ga0075434_100319984 3300006871 Bacteria 1572
371 Ga0068865_100064014 3300006881 Bacteria 2587
372 Ga0068865_100137683 3300006881 Bacteria 1837
373 Ga0068865_100234537 3300006881 Bacteria 1441
374 Ga0068865_100241701 3300006881 Bacteria 1421
375 Ga0068865_100341875 3300006881 Bacteria 1210
376 Ga0068865_100402356 3300006881 Bacteria 1122
377 Ga0068865_100769941 3300006881 Bacteria 828
378 Ga0068865_100918610 3300006881 Bacteria 762
379 Ga0097620_100003821 3300006931 Bacteria 15382
380 Ga0097620_100004139 3300006931 Bacteria 14808
381 Ga0097620_100015469 3300006931 Bacteria 7665
382 Ga0097620_100048358 3300006931 Bacteria 4273
383 Ga0097620_101074217 3300006931 Bacteria 885
384 Ga0097620_101256553 3300006931 Bacteria 816
385 Ga0097620_102393307 3300006931 Bacteria 582
386 Ga0079104_1000007 3300006946 Bacteria 390531
387 Ga0079104_1000328 3300006946 Bacteria 58129
388 Ga0079104_1035251 3300006946 Bacteria 1209
389 Ga0105251_10034197 3300009011 Bacteria 2518
390 Ga0105251_10338706 3300009011 Bacteria 685
391 Ga0105244_10005755 3300009036 Bacteria 8172
392 Ga0105240_10007401 3300009093 Bacteria 15960
393 Ga0105240_10051415 3300009093 Bacteria 5184
394 Ga0105240_10068040 3300009093 Bacteria 4412
395 Ga0105240_10263172 3300009093 Bacteria 1989
396 Ga0105240_10266723 3300009093 Bacteria 1973
397 Ga0105240_10532134 3300009093 Bacteria 1303
398 Ga0105240_10562624 3300009093 Bacteria 1260
399 Ga0105240_12041303 3300009093 Bacteria 596
400 Ga0111539_10020185 3300009094 Bacteria 8212
401 Ga0111539_10028960 3300009094 Bacteria 6754
402 Ga0111539_10029107 3300009094 Bacteria 6735
403 Ga0111539_10056854 3300009094 Bacteria 4649
404 Ga0111539_10493667 3300009094 Bacteria 1426
405 Ga0111539_10498702 3300009094 Bacteria 1418
406 Ga0111539_10688131 3300009094 Bacteria 1190
407 Ga0111539_12763341 3300009094 Bacteria 569
408 Ga0105245_10002284 3300009098 Bacteria 17345
409 Ga0105245_10009930 3300009098 Bacteria 8293
410 Ga0105245_10150360 3300009098 Bacteria 2201
411 Ga0105245_10534083 3300009098 Bacteria 1193
412 Ga0105245_10819385 3300009098 Bacteria 969
413 Ga0105245_11012952 3300009098 Bacteria 875
414 Ga0105247_10031819 3300009101 Bacteria 3203
415 Ga0105247_11035539 3300009101 Bacteria 643
416 Ga0114129_10826805 3300009147 Bacteria 1179
417 Ga0114129_11018182 3300009147 Bacteria 1042
418 Ga0105243_10005465 3300009148 Bacteria 9912
419 Ga0105243_10021175 3300009148 Bacteria 4934
420 Ga0105243_10066031 3300009148 Bacteria 2909
421 Ga0105243_10183927 3300009148 Bacteria 1820
422 Ga0105243_10434969 3300009148 Bacteria 1227
423 Ga0105243_11419139 3300009148 Bacteria 715
424 Ga0105241_10025680 3300009174 Bacteria 4378
425 Ga0105241_10076330 3300009174 Bacteria 2613
426 Ga0105241_10408763 3300009174 Bacteria 1192
427 Ga0105242_10084172 3300009176 Bacteria 2665
428 Ga0105242_10257763 3300009176 Bacteria 1574
429 Ga0105248_10000901 3300009177 Bacteria 33234
430 Ga0105248_10013005 3300009177 Bacteria 9173
431 Ga0105248_10019352 3300009177 Bacteria 7533
432 Ga0105248_10034099 3300009177 Bacteria 5690
433 Ga0105248_10274971 3300009177 Unclassified 1896
434 Ga0105248_10590872 3300009177 Bacteria 1253
435 Ga0105248_10707785 3300009177 Bacteria 1136
436 Ga0105248_10774000 3300009177 Bacteria 1083
437 Ga0105248_10792820 3300009177 Bacteria 1069
438 Ga0105237_10036837 3300009545 Bacteria 4948
439 Ga0105238_10091658 3300009551 Bacteria 3026
440 Ga0105238_10550871 3300009551 Bacteria 1158
441 Ga0105238_10561091 3300009551 Bacteria 1147
442 Ga0105238_10950062 3300009551 Bacteria 879
443 Ga0105249_10041313 3300009553 Bacteria 4192
444 Ga0105249_10082716 3300009553 Bacteria 2987
445 Ga0105249_10161627 3300009553 Bacteria 2165
446 Ga0105249_10321811 3300009553 Bacteria 1558
447 Ga0105249_11012623 3300009553 Bacteria 900
448 Ga0105249_11074378 3300009553 Bacteria 875
449 Ga0105249_11146707 3300009553 Bacteria 848
450 Ga0105249_12477495 3300009553 Bacteria 591
451 Ga0105239_10413081 3300010375 Bacteria 1528
452 Ga0105239_11568414 3300010375 Bacteria 761
453 Ga0105239_13550627 3300010375 Bacteria 507
454 Ga0105246_10085296 3300011119 Bacteria 2261
455 Ga0105246_10162659 3300011119 Bacteria 1701
456 Ga0105246_10169905 3300011119 Bacteria 1669
457 Ga0105246_11033510 3300011119 Bacteria 746
458 Ga0157371_10192728 3300013102 Bacteria 1460
459 Ga0157370_10044109 3300013104 Bacteria 4288
460 Ga0157370_10072734 3300013104 Bacteria 3243
461 Ga0157370_10882273 3300013104 Bacteria 812
462 Ga0157370_11696108 3300013104 Bacteria 567
463 Ga0157369_10000602 3300013105 Bacteria 46869
464 Ga0157369_10023131 3300013105 Bacteria 6924
465 Ga0157369_10162240 3300013105 Bacteria 2359
466 Ga0157369_10329807 3300013105 Bacteria 1586
467 Ga0157369_12075546 3300013105 Bacteria 576
468 Ga0157374_10203428 3300013296 Bacteria 1939
469 Ga0157374_10346348 3300013296 Bacteria 1476
470 Ga0157374_10453679 3300013296 Bacteria 1284
471 Ga0157374_10627225 3300013296 Bacteria 1086
472 Ga0157374_11009373 3300013296 Bacteria 851
473 Ga0157378_10001784 3300013297 Bacteria 19323
474 Ga0157378_10099364 3300013297 Bacteria 2655
475 Ga0157378_10336468 3300013297 Bacteria 1471
476 Ga0157378_10400406 3300013297 Bacteria 1352
477 Ga0157378_10598955 3300013297 Bacteria 1113
478 Ga0157378_10715141 3300013297 Bacteria 1022
479 Ga0157378_10807732 3300013297 Bacteria 964
480 Ga0157378_12623690 3300013297 Bacteria 556
481 Ga0163162_10000204 3300013306 Bacteria 54853
482 Ga0163162_10000297 3300013306 Bacteria 45730
483 Ga0163162_10112784 3300013306 Bacteria 2817
484 Ga0163162_10113651 3300013306 Bacteria 2806
485 Ga0163162_10186666 3300013306 Bacteria 2200
486 Ga0163162_10508603 3300013306 Bacteria 1335
487 Ga0163162_10715786 3300013306 Bacteria 1122
488 Ga0163162_10796738 3300013306 Bacteria 1062
489 Ga0163162_10910164 3300013306 Bacteria 992
490 Ga0163162_12481903 3300013306 Bacteria 596
491 Ga0157372_10325667 3300013307 Bacteria 1789
492 Ga0157372_10464004 3300013307 Bacteria 1476
493 Ga0157372_10554272 3300013307 Bacteria 1340
494 Ga0157372_12263872 3300013307 Bacteria 624
495 Ga0157375_10001119 3300013308 Bacteria 23247
496 Ga0157375_10005543 3300013308 Bacteria 10980
497 Ga0157375_10045314 3300013308 Bacteria 4280
498 Ga0157375_10073202 3300013308 Bacteria 3445
499 Ga0157375_10075281 3300013308 Bacteria 3400
500 Ga0157375_10305261 3300013308 Bacteria 1755
501 Ga0157375_10449430 3300013308 Bacteria 1454
502 Ga0157375_12782199 3300013308 Bacteria 585
503 Ga0163163_10004109 3300014325 Bacteria 12412
504 Ga0163163_10082610 3300014325 Bacteria 3217
505 Ga0163163_10530945 3300014325 Bacteria 1239
506 Ga0163163_10563215 3300014325 Bacteria 1202
507 Ga0163163_11228855 3300014325 Bacteria 812
508 Ga0163163_11232236 3300014325 Bacteria 811
509 Ga0163163_11948267 3300014325 Bacteria 647
510 Ga0163163_13010961 3300014325 Bacteria 526
511 Ga0157380_10034310 3300014326 Bacteria 3913
512 Ga0157380_10144616 3300014326 Bacteria 2047
513 Ga0157380_10353500 3300014326 Bacteria 1376
514 Ga0157380_10967510 3300014326 Bacteria 882
515 Ga0157380_11474836 3300014326 Bacteria 733
516 Ga0157380_11535095 3300014326 Bacteria 720
517 Ga0157380_11713249 3300014326 Bacteria 686
518 Ga0182008_10018727 3300014497 Bacteria 3584
519 Ga0182008_10050371 3300014497 Bacteria 2067
520 Ga0182008_10098655 3300014497 Bacteria 1443
521 Ga0182008_10111392 3300014497 Bacteria 1356
522 Ga0157377_11041297 3300014745 Bacteria 623
523 Ga0157379_10001453 3300014968 Bacteria 19486
524 Ga0157379_10002672 3300014968 Bacteria 15018
525 Ga0157379_10009921 3300014968 Bacteria 8294
526 Ga0157379_10217391 3300014968 Bacteria 1731
527 Ga0157379_10822840 3300014968 Bacteria 877
528 Ga0157379_10887760 3300014968 Bacteria 845
529 Ga0157376_10003212 3300014969 Bacteria 11247
530 Ga0157376_10015114 3300014969 Bacteria 5819
531 Ga0157376_10138950 3300014969 Bacteria 2177
532 Ga0157376_10232185 3300014969 Bacteria 1714
533 Ga0157376_10380523 3300014969 Bacteria 1359
534 Ga0157376_10627043 3300014969 Bacteria 1073
535 Ga0157376_10658432 3300014969 Bacteria 1048
536 Ga0157376_11033266 3300014969 Bacteria 845
537 Ga0182006_1026631 3300015261 Bacteria 2365
538 Ga0182007_10000792 3300015262 Bacteria 17669
539 Ga0182007_10001246 3300015262 Bacteria 13827
540 Ga0182007_10031895 3300015262 Bacteria 1792
541 Ga0182007_10075383 3300015262 Bacteria 1105
542 Ga0182007_10145516 3300015262 Bacteria 803
543 Ga0182007_10157393 3300015262 Bacteria 775
544 Ga0182005_1085284 3300015265 Bacteria 875
545 Ga0183362_10001 3300015683 Bacteria 2046624
546 Ga0163161_10031277 3300017792 Bacteria 3791
547 Ga0163161_10068966 3300017792 Bacteria 2584
548 Ga0163161_10081853 3300017792 Bacteria 2378
549 Ga0163161_11059143 3300017792 Bacteria 695
550 Ga0163161_11245395 3300017792 Bacteria 645
551 Ga0163161_11875135 3300017792 Bacteria 533
552 Ga0197907_10551622 3300020069 Bacteria 2157
553 Ga0206354_11176714 3300020081 Bacteria 954
554 Ga0206353_10456852 3300020082 Bacteria 2350
555 Ga0213872_10372609 3300021361 Bacteria 582
556 Ga0224712_10000345 3300022467 Bacteria 8897
557 Ga0228598_1012137 3300024227 Bacteria 1713
558 Ga0209435_113861 3300025206 Bacteria 855
559 Ga0209672_100267 3300025228 Bacteria 38481
560 Ga0209672_122263 3300025228 Bacteria 598
561 Ga0209258_119958 3300025242 Bacteria 706
562 Ga0209759_1000120 3300025256 Bacteria 138967
563 Ga0209129_1010485 3300025258 Bacteria 2306
564 Ga0209565_1016199 3300025263 Bacteria 1663
565 Ga0209455_1000449 3300025272 Bacteria 31628
566 Ga0209673_1001396 3300025273 Bacteria 23530
567 Ga0209130_1021741 3300025284 Bacteria 1443
568 Ga0209025_1000394 3300025294 Bacteria 90347
569 Ga0209564_1000027 3300025295 Bacteria 518458
570 Ga0209564_1004085 3300025295 Bacteria 9200
571 Ga0209758_1000045 3300025297 Bacteria 369174
572 Ga0209758_1000252 3300025297 Bacteria 108214
573 Ga0209758_1033518 3300025297 Bacteria 2060
574 Ga0209758_1046589 3300025297 Bacteria 1561
575 Ga0209050_1001032 3300025298 Bacteria 34539
576 Ga0209050_1014128 3300025298 Bacteria 3470
577 Ga0209256_1000120 3300025299 Bacteria 167691
578 Ga0207426_1000018 3300025302 Bacteria 566740
579 Ga0207426_1003365 3300025302 Bacteria 8775
580 Ga0209051_1000018 3300025303 Bacteria 527061
581 Ga0209257_1000260 3300025304 Bacteria 121653
582 Ga0209257_1008085 3300025304 Bacteria 6119
583 Ga0209257_1041875 3300025304 Bacteria 1356
584 Ga0207697_10016505 3300025315 Bacteria 3041
585 Ga0207697_10248339 3300025315 Bacteria 787
586 Ga0207697_10268737 3300025315 Bacteria 755
587 Ga0207656_10131603 3300025321 Bacteria 1172
588 Ga0207655_1007702 3300025728 Bacteria 6949
589 Ga0207713_1000892 3300025735 Bacteria 27070
590 Ga0207713_1016353 3300025735 Bacteria 3767
591 Ga0207682_10001857 3300025893 Bacteria 9619
592 Ga0207682_10008143 3300025893 Bacteria 4156
593 Ga0207682_10060636 3300025893 Bacteria 1582
594 Ga0207642_10258044 3300025899 Bacteria 992
595 Ga0207642_10540183 3300025899 Bacteria 718
596 Ga0207642_10894388 3300025899 Bacteria 569
597 Ga0207710_10319141 3300025900 Bacteria 787
598 Ga0207688_10307397 3300025901 Bacteria 970
599 Ga0207688_10448414 3300025901 Bacteria 804
600 Ga0207688_10468896 3300025901 Bacteria 786
601 Ga0207688_10604182 3300025901 Bacteria 691
602 Ga0207680_10000693 3300025903 Bacteria 15837
603 Ga0207680_10004179 3300025903 Bacteria 6833
604 Ga0207680_10006026 3300025903 Bacteria 5836
605 Ga0207647_10000722 3300025904 Bacteria 25906
606 Ga0207647_10017131 3300025904 Bacteria 4932
607 Ga0207647_10040574 3300025904 Bacteria 2930
608 Ga0207647_10143800 3300025904 Bacteria 1397
609 Ga0207645_10014790 3300025907 Bacteria 5210
610 Ga0207645_10027805 3300025907 Bacteria 3651
611 Ga0207645_10055006 3300025907 Bacteria 2541
612 Ga0207645_10068284 3300025907 Bacteria 2273
613 Ga0207645_10457571 3300025907 Bacteria 862
614 Ga0207643_10018108 3300025908 Bacteria 3859
615 Ga0207643_10550892 3300025908 Bacteria 740
616 Ga0207705_10000980 3300025909 Bacteria 23325
617 Ga0207705_10311432 3300025909 Bacteria 1209
618 Ga0207705_10430846 3300025909 Bacteria 1022
619 Ga0207654_10752926 3300025911 Bacteria 702
620 Ga0207707_10015974 3300025912 Bacteria 6546
621 Ga0207707_10179574 3300025912 Bacteria 1848
622 Ga0207695_10005806 3300025913 Bacteria 16245
623 Ga0207695_10099824 3300025913 Bacteria 2900
624 Ga0207695_10109888 3300025913 Bacteria 2738
625 Ga0207695_10208802 3300025913 Bacteria 1864
626 Ga0207695_10227674 3300025913 Bacteria 1770
627 Ga0207695_10438586 3300025913 Bacteria 1189
628 Ga0207695_10704067 3300025913 Bacteria 890
629 Ga0207671_10124914 3300025914 Bacteria 1970
630 Ga0207660_10356226 3300025917 Bacteria 1173
631 Ga0207662_10080085 3300025918 Bacteria 1991
632 Ga0207657_10122373 3300025919 Bacteria 2140
633 Ga0207657_10406625 3300025919 Bacteria 1070
634 Ga0207657_10604910 3300025919 Bacteria 855
635 Ga0207649_10015454 3300025920 Bacteria 4289
636 Ga0207649_10262173 3300025920 Bacteria 1249
637 Ga0207649_10365202 3300025920 Bacteria 1072
638 Ga0207649_10449884 3300025920 Bacteria 972
639 Ga0207649_11537253 3300025920 Bacteria 527
640 Ga0207652_10247841 3300025921 Bacteria 1606
641 Ga0207652_10344385 3300025921 Bacteria 1345
642 Ga0207646_10673882 3300025922 Bacteria 926
643 Ga0207646_10749262 3300025922 Bacteria 872
644 Ga0207681_10003319 3300025923 Bacteria 10075
645 Ga0207681_10108532 3300025923 Bacteria 2015
646 Ga0207681_10184794 3300025923 Bacteria 1590
647 Ga0207681_10216414 3300025923 Bacteria 1479
648 Ga0207681_10268155 3300025923 Bacteria 1339
649 Ga0207694_10235346 3300025924 Bacteria 1496
650 Ga0207694_10280938 3300025924 Bacteria 1367
651 Ga0207694_10386615 3300025924 Bacteria 1162
652 Ga0207694_10623086 3300025924 Bacteria 908
653 Ga0207650_10016870 3300025925 Bacteria 5107
654 Ga0207650_10064404 3300025925 Bacteria 2744
655 Ga0207650_10077573 3300025925 Bacteria 2512
656 Ga0207650_10395428 3300025925 Bacteria 1143
657 Ga0207650_11191954 3300025925 Bacteria 648
658 Ga0207650_11617279 3300025925 Bacteria 550
659 Ga0207659_10002593 3300025926 Bacteria 10766
660 Ga0207659_10016636 3300025926 Bacteria 4791
661 Ga0207659_10079914 3300025926 Bacteria 2414
662 Ga0207659_10252106 3300025926 Bacteria 1432
663 Ga0207659_10421828 3300025926 Bacteria 1119
664 Ga0207659_10670008 3300025926 Bacteria 887
665 Ga0207659_11670633 3300025926 Bacteria 543
666 Ga0207687_10044264 3300025927 Bacteria 3071
667 Ga0207687_10277079 3300025927 Bacteria 1343
668 Ga0207687_11019872 3300025927 Bacteria 710
669 Ga0207687_11553368 3300025927 Bacteria 568
670 Ga0207700_10928918 3300025928 Bacteria 779
671 Ga0207644_10000080 3300025931 Bacteria 70312
672 Ga0207644_10006260 3300025931 Bacteria 7754
673 Ga0207644_10037806 3300025931 Bacteria 3398
674 Ga0207644_10116955 3300025931 Bacteria 2024
675 Ga0207644_10455384 3300025931 Bacteria 1051
676 Ga0207644_10895232 3300025931 Bacteria 744
677 Ga0207644_10923302 3300025931 Bacteria 732
678 Ga0207690_10416346 3300025932 Bacteria 1074
679 Ga0207706_10005400 3300025933 Bacteria 11913
680 Ga0207706_10018796 3300025933 Bacteria 6216
681 Ga0207706_10022986 3300025933 Bacteria 5599
682 Ga0207706_10028055 3300025933 Bacteria 5029
683 Ga0207706_10080051 3300025933 Bacteria 2873
684 Ga0207706_10963276 3300025933 Bacteria 718
685 Ga0207686_10379724 3300025934 Bacteria 1071
686 Ga0207709_10000112 3300025935 Bacteria 127357
687 Ga0207709_10013548 3300025935 Bacteria 4497
688 Ga0207709_10834727 3300025935 Bacteria 746
689 Ga0207670_10003436 3300025936 Bacteria 8404
690 Ga0207670_10005570 3300025936 Bacteria 6921
691 Ga0207670_10038745 3300025936 Bacteria 3115
692 Ga0207669_10008845 3300025937 Bacteria 4753
693 Ga0207669_10056465 3300025937 Bacteria 2384
694 Ga0207669_10306769 3300025937 Bacteria 1209
695 Ga0207669_10576571 3300025937 Bacteria 911
696 Ga0207704_10011663 3300025938 Bacteria 4337
697 Ga0207704_10097382 3300025938 Bacteria 1951
698 Ga0207704_10125104 3300025938 Bacteria 1768
699 Ga0207704_10339386 3300025938 Bacteria 1166
700 Ga0207704_10353319 3300025938 Bacteria 1145
701 Ga0207704_10497274 3300025938 Bacteria 982
702 Ga0207704_11785862 3300025938 Bacteria 529
703 Ga0207691_10000814 3300025940 Bacteria 31075
704 Ga0207691_10019301 3300025940 Bacteria 6452
705 Ga0207691_10058201 3300025940 Bacteria 3515
706 Ga0207691_10092568 3300025940 Bacteria 2707
707 Ga0207691_10095826 3300025940 Bacteria 2653
708 Ga0207691_10187620 3300025940 Bacteria 1804
709 Ga0207691_10841879 3300025940 Bacteria 769
710 Ga0207711_10001117 3300025941 Bacteria 25666
711 Ga0207711_10002270 3300025941 Bacteria 17263
712 Ga0207711_10006712 3300025941 Bacteria 9682
713 Ga0207711_10114041 3300025941 Bacteria 2406
714 Ga0207711_10648262 3300025941 Bacteria 985
715 Ga0207711_10780189 3300025941 Bacteria 890
716 Ga0207689_10006926 3300025942 Bacteria 9971
717 Ga0207689_10023656 3300025942 Bacteria 5152
718 Ga0207689_10258895 3300025942 Bacteria 1439
719 Ga0207689_11519392 3300025942 Bacteria 559
720 Ga0207661_10069974 3300025944 Bacteria 2863
721 Ga0207661_10244030 3300025944 Bacteria 1595
722 Ga0207661_10344539 3300025944 Bacteria 1343
723 Ga0207679_10012324 3300025945 Bacteria 5573
724 Ga0207679_10032483 3300025945 Bacteria 3664
725 Ga0207679_10168836 3300025945 Bacteria 1799
726 Ga0207679_10182044 3300025945 Bacteria 1739
727 Ga0207679_10247932 3300025945 Bacteria 1512
728 Ga0207679_10251553 3300025945 Bacteria 1502
729 Ga0207667_10001900 3300025949 Bacteria 26214
730 Ga0207651_10000144 3300025960 Bacteria 31275
731 Ga0207651_10045168 3300025960 Bacteria 2953
732 Ga0207651_10170057 3300025960 Bacteria 1718
733 Ga0207651_10388881 3300025960 Bacteria 1184
734 Ga0207651_10444822 3300025960 Bacteria 1111
735 Ga0207651_11070911 3300025960 Bacteria 722
736 Ga0207651_11267794 3300025960 Bacteria 662
737 Ga0207712_10136720 3300025961 Bacteria 1875
738 Ga0207712_10143511 3300025961 Bacteria 1835
739 Ga0207712_10348307 3300025961 Bacteria 1231
740 Ga0207668_10035062 3300025972 Bacteria 3337
741 Ga0207668_10042223 3300025972 Bacteria 3087
742 Ga0207668_10064096 3300025972 Bacteria 2596
743 Ga0207668_10323754 3300025972 Bacteria 1280
744 Ga0207668_10383712 3300025972 Bacteria 1183
745 Ga0207640_10925885 3300025981 Bacteria 763
746 Ga0207640_11161124 3300025981 Bacteria 685
747 Ga0207658_10001163 3300025986 Bacteria 21016
748 Ga0207658_10001928 3300025986 Bacteria 15487
749 Ga0207658_10006797 3300025986 Bacteria 7792
750 Ga0207658_10060167 3300025986 Bacteria 2833
751 Ga0207658_10316108 3300025986 Bacteria 1350
752 Ga0207658_11049995 3300025986 Bacteria 744
753 Ga0207658_11596239 3300025986 Bacteria 596
754 Ga0207677_10000686 3300026023 Bacteria 20040
755 Ga0207677_10086316 3300026023 Bacteria 2268
756 Ga0207677_10125707 3300026023 Bacteria 1938
757 Ga0207677_11216370 3300026023 Bacteria 690
758 Ga0207703_10000702 3300026035 Bacteria 33148
759 Ga0207703_10009199 3300026035 Bacteria 7769
760 Ga0207703_10035099 3300026035 Bacteria 3984
761 Ga0207703_10262242 3300026035 Bacteria 1562
762 Ga0207703_10333350 3300026035 Bacteria 1392
763 Ga0207703_10843132 3300026035 Bacteria 876
764 Ga0207639_10583343 3300026041 Bacteria 1029
765 Ga0207639_10904484 3300026041 Bacteria 825
766 Ga0207639_11902670 3300026041 Bacteria 556
767 Ga0207678_10010590 3300026067 Bacteria 8101
768 Ga0207678_10128514 3300026067 Bacteria 2161
769 Ga0207678_10172462 3300026067 Bacteria 1847
770 Ga0207678_10202581 3300026067 Bacteria 1697
771 Ga0207678_10304781 3300026067 Bacteria 1369
772 Ga0207678_10616168 3300026067 Bacteria 952
773 Ga0207678_10705843 3300026067 Bacteria 888
774 Ga0207678_10895209 3300026067 Bacteria 785
775 Ga0207708_10145699 3300026075 Bacteria 1861
776 Ga0207708_10276266 3300026075 Bacteria 1360
777 Ga0207708_10428084 3300026075 Bacteria 1098
778 Ga0207708_10919707 3300026075 Bacteria 758
779 Ga0207702_10280361 3300026078 Bacteria 1575
780 Ga0207702_10352781 3300026078 Bacteria 1408
781 Ga0207641_10000926 3300026088 Bacteria 30280
782 Ga0207641_10016664 3300026088 Bacteria 6016
783 Ga0207641_10024608 3300026088 Bacteria 4962
784 Ga0207641_10029474 3300026088 Bacteria 4539
785 Ga0207641_10100857 3300026088 Bacteria 2543
786 Ga0207641_10216887 3300026088 Bacteria 1772
787 Ga0207641_11531460 3300026088 Bacteria 668
788 Ga0207641_11751157 3300026088 Bacteria 623
789 Ga0207648_10002833 3300026089 Bacteria 18391
790 Ga0207648_10006529 3300026089 Bacteria 11575
791 Ga0207648_10017050 3300026089 Bacteria 6620
792 Ga0207648_10025610 3300026089 Bacteria 5253
793 Ga0207648_10086004 3300026089 Bacteria 2743
794 Ga0207648_10102038 3300026089 Bacteria 2514
795 Ga0207648_10155576 3300026089 Bacteria 2018
796 Ga0207648_10156071 3300026089 Bacteria 2015
797 Ga0207648_10287144 3300026089 Bacteria 1472
798 Ga0207648_10620448 3300026089 Bacteria 998
799 Ga0207648_10677379 3300026089 Bacteria 954
800 Ga0207676_10000656 3300026095 Bacteria 27723
801 Ga0207676_10017506 3300026095 Bacteria 5195
802 Ga0207676_10128103 3300026095 Bacteria 2153
803 Ga0207676_10681033 3300026095 Bacteria 995
804 Ga0207676_10916896 3300026095 Bacteria 860
805 Ga0207674_10006947 3300026116 Bacteria 13257
806 Ga0207674_10015020 3300026116 Bacteria 8530
807 Ga0207674_10229216 3300026116 Bacteria 1805
808 Ga0207674_10421489 3300026116 Bacteria 1290
809 Ga0207674_11151625 3300026116 Bacteria 745
810 Ga0207675_100016912 3300026118 Bacteria 6816
811 Ga0207675_100018263 3300026118 Bacteria 6538
812 Ga0207675_100071881 3300026118 Bacteria 3235
813 Ga0207675_100136890 3300026118 Bacteria 2325
814 Ga0207675_100653032 3300026118 Bacteria 1058
815 Ga0207675_100787266 3300026118 Bacteria 964
816 Ga0207675_101233782 3300026118 Bacteria 768
817 Ga0207683_10010852 3300026121 Bacteria 7770
818 Ga0207683_10065890 3300026121 Bacteria 3193
819 Ga0207683_10075327 3300026121 Bacteria 2987
820 Ga0207683_10085160 3300026121 Bacteria 2810
821 Ga0207683_10090087 3300026121 Bacteria 2731
822 Ga0207683_10184951 3300026121 Bacteria 1890
823 Ga0207683_10412517 3300026121 Bacteria 1243
824 Ga0207683_10565873 3300026121 Bacteria 1051
825 Ga0207683_10666940 3300026121 Bacteria 964
826 Ga0207683_10681226 3300026121 Bacteria 953
827 Ga0207698_10575205 3300026142 Bacteria 1107
828 Ga0207698_11700327 3300026142 Bacteria 646
829 Ga0209281_1000020 3300027111 Bacteria 575972
830 Ga0209281_1000455 3300027111 Bacteria 58143
831 Ga0209281_1028254 3300027111 Bacteria 1020
832 Ga0209973_1057037 3300027252 Bacteria 596
833 Ga0209813_10031997 3300027866 Bacteria 1556
834 Ga0207428_10115761 3300027907 Bacteria 2059
835 Ga0207428_10184545 3300027907 Bacteria 1575
836 Ga0207428_10744711 3300027907 Bacteria 699
837 Ga0207428_11017070 3300027907 Bacteria 582
838 Ga0268266_10000005 3300028379 Bacteria 1448194
839 Ga0268266_10004503 3300028379 Bacteria 13320
840 Ga0268266_11378564 3300028379 Bacteria 681
841 Ga0268266_11398962 3300028379 Bacteria 675
842 Ga0268266_11689948 3300028379 Bacteria 608
843 Ga0268265_10011002 3300028380 Bacteria 6112
844 Ga0268265_10040448 3300028380 Bacteria 3443
845 Ga0268265_10305534 3300028380 Bacteria 1434
846 Ga0268265_10442039 3300028380 Bacteria 1212
847 Ga0268265_10918540 3300028380 Bacteria 860
848 Ga0268264_10000046 3300028381 Bacteria 364597
849 Ga0268264_10022682 3300028381 Bacteria 5123
850 Ga0268264_10102789 3300028381 Bacteria 2487
851 Ga0268264_10574605 3300028381 Bacteria 1108
852 Ga0268264_12100554 3300028381 Bacteria 573
853 Ga0307517_10009345 3300028786 Bacteria 13898
854 Ga0307517_10422898 3300028786 Bacteria 698
855 Ga0307515_10000722 3300028794 Bacteria 75999
856 Ga0307515_10002592 3300028794 Bacteria 38996
857 Ga0307515_10029667 3300028794 Bacteria 9230
858 Ga0307515_10034932 3300028794 Bacteria 8202
859 Ga0307515_10043798 3300028794 Bacteria 6943
860 Ga0307515_10054641 3300028794 Bacteria 5856
861 Ga0307515_10068092 3300028794 Bacteria 4897
862 Ga0307515_10295665 3300028794 Bacteria 1310
863 Ga0265338_10191218 3300028800 Bacteria 1551
864 Ga0307512_10219233 3300030522 Bacteria 997
865 Ga0307512_10320256 3300030522 Bacteria 706
866 Ga0265332_10035345 3300031238 Bacteria 2170
867 Ga0265328_10026618 3300031239 Bacteria 2173
868 Ga0265331_10183458 3300031250 Bacteria 945
869 Ga0265327_10028506 3300031251 Bacteria 3193
870 Ga0265316_11296286 3300031344 Bacteria 503
871 Ga0307513_10005609 3300031456 Bacteria 16541
872 Ga0307513_10322208 3300031456 Bacteria 1303
873 Ga0307509_10016410 3300031507 Bacteria 8572
874 Ga0307509_10019184 3300031507 Bacteria 7814
875 Ga0307509_10041676 3300031507 Bacteria 4980
876 Ga0307509_10048077 3300031507 Bacteria 4584
877 Ga0307509_10051517 3300031507 Bacteria 4401
878 Ga0307509_10290106 3300031507 Bacteria 1391
879 Ga0307509_10342052 3300031507 Bacteria 1223
880 Ga0307509_10587745 3300031507 Bacteria 787
881 Ga0307408_100014078 3300031548 Bacteria 5313
882 Ga0307408_100020103 3300031548 Bacteria 4500
883 Ga0307408_100037431 3300031548 Bacteria 3417
884 Ga0307408_100044613 3300031548 Bacteria 3160
885 Ga0307408_100068764 3300031548 Bacteria 2609
886 Ga0307408_100184150 3300031548 Bacteria 1677
887 Ga0307408_100308870 3300031548 Bacteria 1328
888 Ga0307408_100644049 3300031548 Bacteria 947
889 Ga0307408_100719100 3300031548 Bacteria 899
890 Ga0307408_101455754 3300031548 Bacteria 646
891 Ga0307408_101839818 3300031548 Bacteria 579
892 Ga0307508_10000659 3300031616 Bacteria 41446
893 Ga0307508_10001973 3300031616 Bacteria 22419
894 Ga0307508_10070300 3300031616 Bacteria 3073
895 Ga0307514_10008017 3300031649 Bacteria 9039
896 Ga0307514_10175535 3300031649 Bacteria 1391
897 Ga0265314_10018888 3300031711 Bacteria 5352
898 Ga0265314_10111016 3300031711 Bacteria 1743
899 Ga0307516_10003142 3300031730 Bacteria 21494
900 Ga0307516_10062726 3300031730 Bacteria 3600
901 Ga0307516_10170137 3300031730 Bacteria 1920
902 Ga0307516_10348440 3300031730 Bacteria 1147
903 Ga0307516_10558733 3300031730 Bacteria 798
904 Ga0307516_10862698 3300031730 Bacteria 570
905 Ga0307405_10056945 3300031731 Bacteria 2453
906 Ga0307405_10081180 3300031731 Bacteria 2119
907 Ga0307405_10595457 3300031731 Bacteria 901
908 Ga0307405_10686049 3300031731 Bacteria 846
909 Ga0307413_10239523 3300031824 Bacteria 1339
910 Ga0307413_10376475 3300031824 Bacteria 1104
911 Ga0307413_10401762 3300031824 Bacteria 1074
912 Ga0307413_10554929 3300031824 Bacteria 932
913 Ga0307413_10663139 3300031824 Bacteria 862
914 Ga0307413_10997778 3300031824 Bacteria 717
915 Ga0307413_11626169 3300031824 Bacteria 574
916 Ga0307410_10067171 3300031852 Bacteria 2473
917 Ga0307410_11023474 3300031852 Bacteria 713
918 Ga0307406_10000971 3300031901 Bacteria 16012
919 Ga0307406_10726998 3300031901 Bacteria 831
920 Ga0307406_11344228 3300031901 Bacteria 625
921 Ga0307407_10040614 3300031903 Bacteria 2596
922 Ga0307407_10451482 3300031903 Bacteria 933
923 Ga0307407_10504480 3300031903 Bacteria 887
924 Ga0307412_10097649 3300031911 Bacteria 2070
925 Ga0307412_10105216 3300031911 Bacteria 2004
926 Ga0307412_10106305 3300031911 Bacteria 1995
927 Ga0307412_10141151 3300031911 Bacteria 1764
928 Ga0307412_10232371 3300031911 Bacteria 1421
929 Ga0307412_10412449 3300031911 Bacteria 1103
930 Ga0307412_10412637 3300031911 Bacteria 1102
931 Ga0307412_10454638 3300031911 Bacteria 1056
932 Ga0307412_11389008 3300031911 Bacteria 635
933 Ga0307412_11427041 3300031911 Bacteria 627
934 Ga0307412_11842723 3300031911 Bacteria 557
935 Ga0307409_100137996 3300031995 Bacteria 2096
936 Ga0307409_100328491 3300031995 Bacteria 1434
937 Ga0307409_101043738 3300031995 Bacteria 837
938 Ga0307409_101062858 3300031995 Bacteria 829
939 Ga0307416_100025231 3300032002 Bacteria 4354
940 Ga0307416_100205498 3300032002 Bacteria 1873
941 Ga0307416_100911959 3300032002 Bacteria 979
942 Ga0307416_102426847 3300032002 Bacteria 624
943 Ga0307414_10093113 3300032004 Bacteria 2245
944 Ga0307414_10101921 3300032004 Bacteria 2162
945 Ga0307414_10319004 3300032004 Bacteria 1322
946 Ga0307414_10786396 3300032004 Bacteria 867
947 Ga0307414_11179229 3300032004 Bacteria 709
948 Ga0307414_11218204 3300032004 Bacteria 697
949 Ga0307411_10089972 3300032005 Bacteria 2139
950 Ga0307411_10124567 3300032005 Bacteria 1871
951 Ga0307411_10230864 3300032005 Bacteria 1442
952 Ga0307411_10412559 3300032005 Bacteria 1119
953 Ga0307411_10532091 3300032005 Bacteria 999
954 Ga0307411_11430635 3300032005 Bacteria 633
955 Ga0307411_11620561 3300032005 Bacteria 597
956 Ga0307415_100802834 3300032126 Bacteria 859
957 Ga0307507_10120827 3300033179 Bacteria 2096
958 Ga0307507_10246671 3300033179 Bacteria 1160
959 Ga0307507_10315566 3300033179 Bacteria 945
960 Ga0307510_10008860 3300033180 Bacteria 11992
961 Ga0307510_10267155 3300033180 Bacteria 1188
962 Ga0373928_0125407 3300035084 Bacteria 692
963 Ga0373936_0006785 3300035113 Bacteria 4310
964 Ga0373936_0020797 3300035113 Bacteria 2551
965 Ga0373956_0155219 3300035119 Bacteria 1077
966 Ga0373943_0568338 3300035170 Bacteria 666
967 Ga0373946_0283990 3300035171 Bacteria 815
968 Ga0373955_0016520 3300035172 Bacteria 3635
969 Ga0373931_1118482 3300035691 Bacteria 537
970 Ga0373935_1442716 3300035692 Bacteria 515
971 Ga0373927_0137483 3300035695 Bacteria 1597
972 Ga0373933_0236278 3300035724 Bacteria 1175
973 Ga0373933_0445795 3300035724 Bacteria 846
974 Ga0373947_0402276 3300035725 Bacteria 924
975 Ga0373937_0335188 3300036401 Bacteria 1432
976 Ga0373937_0672974 3300036401 Bacteria 981
977 Ga0373937_1036553 3300036401 Bacteria 769
978 Ga0373925_0158603 3300037068 Bacteria 1781
979 Ga0373925_0185903 3300037068 Bacteria 1647
980 Ga0373925_0378943 3300037068 Bacteria 1152
981 Ga0395899_0000521 3300037312 Bacteria 42304
982 Ga0395899_0000581 3300037312 Bacteria 38482
983 Ga0395899_0002985 3300037312 Bacteria 13526
984 Ga0395899_0165992 3300037312 Bacteria 1557
985 Ga0395900_0032760 3300037418 Bacteria 5345
986 Ga0395900_0246211 3300037418 Bacteria 1791
987 Ga0395898_0035761 3300037466 Bacteria 4935
988 Ga0395898_0309599 3300037466 Bacteria 1506
989 Ga0395898_0339749 3300037466 Bacteria 1432
990 Ga0395905_0000029 3300037471 Bacteria 293016
991 Ga0395905_0017408 3300037471 Bacteria 6823
992 Ga0395905_0087795 3300037471 Bacteria 2915
993 Ga0395905_0183254 3300037471 Bacteria 1966
994 Ga0395905_0211610 3300037471 Bacteria 1816
995 Ga0395905_1000623 3300037471 Bacteria 739
996 Ga0395901_0032991 3300038443 Bacteria 5342
997 Ga0395901_0095514 3300038443 Bacteria 3115
998 Ga0395901_0427156 3300038443 Bacteria 1358
999 Ga0436360_0988630 3300039438 Bacteria 2909
1000 Ga0436361_0168617 3300039447 Bacteria 3812
1001 Ga0436361_0209219 3300039447 Bacteria 916
1002 Ga0439465_0005707 3300041413 Bacteria 3962
1003 Ga0451791_1941958 3300041451 Bacteria 510
1004 Ga0451793_1513956 3300041452 Bacteria 1873
1005 Ga0451797_0629150 3300041453 Bacteria 1199
1006 Ga0451797_1257626 3300041453 Bacteria 783
1007 Ga0451795_0135458 3300041456 Bacteria 539
1008 Ga0451795_0363756 3300041456 Bacteria 1551
1009 Ga0451800_1298110 3300041459 Bacteria 946
1010 Ga0451802_0323989 3300041460 Bacteria 919
1011 Ga0451802_0711155 3300041460 Bacteria 691
1012 Ga0451802_1304540 3300041460 Bacteria 559
1013 Ga0451807_2074045 3300041486 Bacteria 968
1014 Ga0451837_1338186 3300041494 Bacteria 3153
1015 Ga0451839_1659939 3300041496 Bacteria 652
1016 Ga0451845_0303794 3300041501 Bacteria 539
1017 Ga0451847_0101710 3300041503 Bacteria 866
1018 Ga0451849_0088262 3300041505 Bacteria 543
1019 Ga0451843_0405520 3300041509 Bacteria 1134
1020 Ga0451855_0963016 3300041511 Bacteria 1398
1021 Ga0439431_0023450 3300041997 Bacteria 1494
1022 Ga0439442_028403 3300042002 Bacteria 1166
1023 Ga0439432_018326 3300042006 Bacteria 2340
1024 Ga0439432_056988 3300042006 Bacteria 1210
1025 Ga0439449_0002219 3300042007 Bacteria 7641
1026 Ga0439450_081517 3300042008 Bacteria 805
1027 Ga0439452_085163 3300042010 Bacteria 686
1028 Ga0439462_0169395 3300042015 Bacteria 617
1029 Ga0450914_016197 3300042118 Bacteria 787
1030 Ga0450920_057362 3300042122 Bacteria 785
1031 Ga0450890_046398 3300042127 Bacteria 654
1032 Ga0450894_018669 3300042131 Bacteria 928
1033 Ga0450898_151491 3300042134 Bacteria 508
1034 Ga0450899_013055 3300042135 Bacteria 936
1035 Ga0450904_020330 3300042139 Bacteria 673
1036 Ga0450905_056616 3300042142 Bacteria 648
1037 Ga0450910_063573 3300042147 Bacteria 626
1038 Ga0439446_0030487 3300042156 Bacteria 1559
1039 Ga0450908_001912 3300042184 Bacteria 4073
1040 Ga0450918_002326 3300042531 Bacteria 3596
1041 Ga0450893_0022938 3300042532 Bacteria 1083
1042 Ga0466969_0000010 3300044656 Bacteria 117215
1043 Ga0466969_0000531 3300044656 Bacteria 20971
1044 Ga0466969_0012755 3300044656 Bacteria 4428
1045 Ga0466969_0049614 3300044656 Bacteria 2070
1046 Ga0466969_0186316 3300044656 Bacteria 949
1047 Ga0466972_0034223 3300044658 Bacteria 2490
1048 Ga0466972_0054011 3300044658 Bacteria 1934
1049 Ga0466972_0191190 3300044658 Bacteria 959
1050 Ga0466972_0239589 3300044658 Bacteria 849
1051 Ga0466982_0059006 3300044672 Bacteria 2359
1052 Ga0466965_0008841 3300044683 Bacteria 4671
1053 Ga0466965_0073734 3300044683 Bacteria 1719
1054 Ga0466965_0181326 3300044683 Bacteria 1111
1055 Ga0466965_0197374 3300044683 Bacteria 1066
1056 Ga0466965_0484145 3300044683 Bacteria 692
1057 Ga0466966_0001046 3300044684 Bacteria 17660
1058 Ga0466966_0017788 3300044684 Bacteria 4693
1059 Ga0466966_0021565 3300044684 Bacteria 4230
1060 Ga0466961_0001090 3300044693 Bacteria 16697
1061 Ga0466961_0004702 3300044693 Bacteria 8585
1062 Ga0466961_0020588 3300044693 Bacteria 4245
1063 Ga0466961_0051247 3300044693 Bacteria 2636
1064 Ga0466963_0217615 3300044694 Bacteria 1337
1065 Ga0466963_0225588 3300044694 Bacteria 1312
1066 Ga0466963_0717417 3300044694 Bacteria 705
1067 Ga0466964_0018775 3300044706 Bacteria 2655
1068 Ga0466964_0216361 3300044706 Bacteria 928
1069 Ga0453684_1024299 3300044712 Bacteria 877
1070 Ga0466971_0002065 3300044719 Bacteria 8510
1071 Ga0466971_0267106 3300044719 Bacteria 817
1072 Ga0466968_0179082 3300044735 Bacteria 985
1073 Ga0466968_0251625 3300044735 Bacteria 839
1074 Ga0466970_0001322 3300044765 Bacteria 11982
1075 Ga0466970_0008987 3300044765 Bacteria 5039
1076 Ga0466970_0031328 3300044765 Bacteria 2809
1077 Ga0466970_0078991 3300044765 Bacteria 1776
1078 Ga0466957_0001175 3300044842 Bacteria 13592
1079 Ga0466957_0132372 3300044842 Bacteria 1599
1080 Ga0466957_0606224 3300044842 Bacteria 767
1081 Ga0466957_0725501 3300044842 Bacteria 702
1082 Ga0466957_1023343 3300044842 Bacteria 594
1083 Ga0466960_0030576 3300044901 Bacteria 2479
1084 Ga0466960_0267490 3300044901 Bacteria 954
1085 Ga0466959_0000206 3300045049 Bacteria 37971
1086 Ga0466959_0002005 3300045049 Bacteria 12850
1087 Ga0466959_0004323 3300045049 Bacteria 9486
1088 Ga0466959_0050021 3300045049 Bacteria 3070
1089 Ga0466959_0065358 3300045049 Bacteria 2639
1090 Ga0451576_0033797 3300045051 Bacteria 5434
1091 Ga0466958_0000881 3300045836 Bacteria 13422
1092 Ga0466958_0020449 3300045836 Bacteria 3859
1093 Ga0466958_0186688 3300045836 Bacteria 1317
1094 Ga0495617_000107 3300046452 Bacteria 60888
1095 Ga0495603_0001824 3300046455 Bacteria 12572
1096 Ga0495603_0031354 3300046455 Bacteria 3200
1097 Ga0495603_0100321 3300046455 Bacteria 1690
1098 Ga0495603_0123732 3300046455 Bacteria 1507
1099 Ga0495603_0322516 3300046455 Bacteria 887
1100 Ga0495590_0004681 3300046457 Bacteria 5487
1101 Ga0495590_0011833 3300046457 Bacteria 3253
1102 Ga0495590_0046439 3300046457 Bacteria 1515
1103 Ga0495591_142145 3300046458 Bacteria 579
1104 Ga0495629_0000015 3300046459 Bacteria 182026
1105 Ga0495629_0006500 3300046459 Bacteria 8660
1106 Ga0495629_0056655 3300046459 Bacteria 2740
1107 Ga0495629_0333449 3300046459 Bacteria 1036
1108 Ga0495629_0538179 3300046459 Bacteria 785
1109 Ga0495638_0003798 3300046460 Bacteria 11736
1110 Ga0495638_0050177 3300046460 Bacteria 2607
1111 Ga0495638_0147929 3300046460 Bacteria 1365
1112 Ga0495638_0403732 3300046460 Bacteria 708
1113 Ga0495653_0000305 3300046463 Bacteria 39770
1114 Ga0495653_0000764 3300046463 Bacteria 24684
1115 Ga0495653_0082522 3300046463 Bacteria 2372
1116 Ga0495653_0139477 3300046463 Bacteria 1707
1117 Ga0495650_0000100 3300046471 Bacteria 213752
1118 Ga0495650_0000179 3300046471 Bacteria 138628
1119 Ga0495650_0001583 3300046471 Bacteria 21335
1120 Ga0495650_0061790 3300046471 Bacteria 1499
1121 Ga0495650_0070473 3300046471 Bacteria 1373
1122 Ga0495580_0000682 3300046472 Bacteria 28929
1123 Ga0495580_0003234 3300046472 Bacteria 13935
1124 Ga0495580_0011711 3300046472 Bacteria 6778
1125 Ga0495580_0132594 3300046472 Bacteria 1727
1126 Ga0495580_0173533 3300046472 Bacteria 1490
1127 Ga0495580_0236568 3300046472 Bacteria 1253
1128 Ga0495582_0157078 3300046473 Bacteria 1293
1129 Ga0495582_0282972 3300046473 Bacteria 952
1130 Ga0495582_0383422 3300046473 Bacteria 810
1131 Ga0495605_0000098 3300046474 Bacteria 109816
1132 Ga0495605_0005795 3300046474 Bacteria 7146
1133 Ga0495605_0008391 3300046474 Bacteria 5841
1134 Ga0495605_0008882 3300046474 Bacteria 5666
1135 Ga0495605_0303499 3300046474 Bacteria 675
1136 Ga0495639_0018021 3300046475 Bacteria 3071
1137 Ga0495639_0035691 3300046475 Bacteria 2225
1138 Ga0495662_0255167 3300046476 Bacteria 863
1139 Ga0495664_0055653 3300046477 Bacteria 2353
1140 Ga0495664_0361855 3300046477 Bacteria 873
1141 Ga0495664_0666118 3300046477 Bacteria 616
1142 Ga0495584_0098905 3300046491 Bacteria 1474
1143 Ga0495584_0333587 3300046491 Bacteria 770
1144 Ga0495584_0511391 3300046491 Bacteria 612
1145 Ga0495584_0543681 3300046491 Bacteria 592
1146 Ga0495585_0017777 3300046492 Bacteria 4104
1147 Ga0495594_0188758 3300046499 Bacteria 1174
1148 Ga0495596_0017244 3300046500 Bacteria 2994
1149 Ga0495596_0032675 3300046500 Bacteria 2074
1150 Ga0495596_0046637 3300046500 Bacteria 1702
1151 Ga0495607_0005789 3300046501 Bacteria 8793
1152 Ga0495607_0093899 3300046501 Bacteria 1619
1153 Ga0495583_0030350 3300046506 Bacteria 2633
1154 Ga0495583_0050726 3300046506 Bacteria 1895
1155 Ga0495583_0124817 3300046506 Bacteria 1080
1156 Ga0495606_0000223 3300046507 Bacteria 100501
1157 Ga0495606_0001629 3300046507 Bacteria 29255
1158 Ga0495606_0004296 3300046507 Bacteria 14340
1159 Ga0495606_0049159 3300046507 Bacteria 2768
1160 Ga0495606_0141852 3300046507 Bacteria 1418
1161 Ga0495606_0259201 3300046507 Bacteria 960
1162 Ga0495610_0000668 3300046512 Bacteria 33359
1163 Ga0495616_0010325 3300046513 Bacteria 5411
1164 Ga0495616_0059117 3300046513 Bacteria 1886
1165 Ga0495618_0102943 3300046514 Bacteria 1828
1166 Ga0495620_0001664 3300046515 Bacteria 13134
1167 Ga0495620_0009834 3300046515 Bacteria 5073
1168 Ga0495620_0018985 3300046515 Bacteria 3394
1169 Ga0495620_0088850 3300046515 Bacteria 1241
1170 Ga0495620_0105994 3300046515 Bacteria 1117
1171 Ga0495628_0006614 3300046516 Bacteria 10116
1172 Ga0495628_0096207 3300046516 Bacteria 2287
1173 Ga0495628_0167939 3300046516 Bacteria 1664
1174 Ga0495628_0494887 3300046516 Bacteria 883
1175 Ga0495630_0048218 3300046517 Bacteria 3187
1176 Ga0495630_0055261 3300046517 Bacteria 2975
1177 Ga0495630_0082688 3300046517 Bacteria 2424
1178 Ga0495630_0085128 3300046517 Bacteria 2386
1179 Ga0495630_0297701 3300046517 Bacteria 1233
1180 Ga0495631_0132417 3300046518 Bacteria 1071
1181 Ga0495632_0012548 3300046519 Bacteria 4883
1182 Ga0495632_0110693 3300046519 Bacteria 1289
1183 Ga0495632_0384011 3300046519 Bacteria 615
1184 Ga0495643_0097109 3300046522 Bacteria 1514
1185 Ga0495643_0149712 3300046522 Bacteria 1157
1186 Ga0495644_0021130 3300046523 Bacteria 2483
1187 Ga0495648_0046740 3300046524 Bacteria 2680
1188 Ga0495648_0323126 3300046524 Bacteria 714
1189 Ga0495648_0514991 3300046524 Bacteria 510
1190 Ga0495666_0012315 3300046526 Bacteria 4265
1191 Ga0495666_0021388 3300046526 Bacteria 3202
1192 Ga0495666_0218869 3300046526 Bacteria 872
1193 Ga0495642_0002147 3300046528 Bacteria 8127
1194 Ga0495642_0020756 3300046528 Bacteria 2582
1195 Ga0495642_0082210 3300046528 Bacteria 1358
1196 Ga0495642_0104138 3300046528 Bacteria 1210
1197 Ga0495652_0012080 3300046529 Bacteria 7802
1198 Ga0495652_0329182 3300046529 Bacteria 1101
1199 Ga0495652_0399012 3300046529 Bacteria 974
1200 Ga0495654_0182143 3300046530 Bacteria 909
1201 Ga0495665_0023566 3300046531 Bacteria 3306
1202 Ga0495665_0072296 3300046531 Bacteria 1816
1203 Ga0495665_0366771 3300046531 Bacteria 732
1204 Ga0495640_0232584 3300046533 Bacteria 1159
1205 Ga0495640_0484021 3300046533 Bacteria 754
1206 Ga0495586_0026649 3300046535 Bacteria 3093
1207 Ga0495586_0159525 3300046535 Bacteria 1272
1208 Ga0495586_0345761 3300046535 Bacteria 854
1209 Ga0495586_0402611 3300046535 Bacteria 788
1210 Ga0495587_0174854 3300046536 Bacteria 1219
1211 Ga0495598_0168993 3300046537 Bacteria 774
1212 Ga0495621_0111138 3300046539 Bacteria 1051
1213 Ga0495621_0451777 3300046539 Bacteria 550
1214 Ga0495597_0014880 3300046542 Bacteria 3698
1215 Ga0495597_0133370 3300046542 Bacteria 1029
1216 Ga0495597_0144813 3300046542 Bacteria 978
1217 Ga0495597_0362131 3300046542 Bacteria 555
1218 Ga0495645_0000828 3300046543 Bacteria 21073
1219 Ga0495645_0071080 3300046543 Bacteria 2510
1220 Ga0495645_0224513 3300046543 Bacteria 1261
1221 Ga0495622_0127207 3300046557 Bacteria 1161
1222 Ga0495633_0040223 3300046558 Bacteria 2228
1223 Ga0495633_0268598 3300046558 Bacteria 777
1224 Ga0495667_0054299 3300046559 Bacteria 2636
1225 Ga0495656_0150540 3300046615 Bacteria 1123
1226 Ga0495656_0297203 3300046615 Bacteria 827
1227 Ga0495668_0000286 3300046616 Bacteria 69771
1228 Ga0495668_0001540 3300046616 Bacteria 21860
1229 Ga0495668_0218340 3300046616 Bacteria 1044
1230 Ga0495668_0282230 3300046616 Bacteria 910
1231 Ga0495668_0408441 3300046616 Bacteria 746
1232 Ga0495611_0052076 3300046648 Bacteria 1846
1233 Ga0495611_0053471 3300046648 Bacteria 1823
1234 Ga0495611_0132255 3300046648 Bacteria 1164
1235 Ga0495611_0345865 3300046648 Bacteria 683
1236 Ga0495625_0000052 3300046660 Bacteria 190656
1237 Ga0495625_0016474 3300046660 Bacteria 5816
1238 Ga0495625_0018472 3300046660 Bacteria 5442
1239 Ga0495625_0095074 3300046660 Bacteria 2055
1240 Ga0495625_0340715 3300046660 Bacteria 950
1241 Ga0495625_0371583 3300046660 Bacteria 899
1242 Ga0495625_0402574 3300046660 Bacteria 855
1243 Ga0495635_0003000 3300046663 Bacteria 11588
1244 Ga0495635_0405564 3300046663 Bacteria 905
1245 Ga0495635_0767973 3300046663 Bacteria 622
1246 Ga0495661_0254645 3300046665 Bacteria 894
1247 Ga0495588_0033636 3300046674 Bacteria 2590
1248 Ga0495599_0019631 3300046678 Bacteria 4213
1249 Ga0495599_0082904 3300046678 Bacteria 2003
1250 Ga0495599_0136926 3300046678 Bacteria 1520
1251 Ga0495623_0011726 3300046679 Bacteria 5679
1252 Ga0495623_0079976 3300046679 Bacteria 2024
1253 Ga0495646_0004613 3300046680 Bacteria 8676
1254 Ga0495646_0066210 3300046680 Bacteria 2137
1255 Ga0495646_0172171 3300046680 Bacteria 1192
1256 Ga0495658_0059118 3300046683 Bacteria 2194
1257 Ga0495658_0135353 3300046683 Bacteria 1503
1258 Ga0495658_0141182 3300046683 Bacteria 1473
1259 Ga0495669_0028555 3300046684 Bacteria 2444
1260 Ga0495669_0329173 3300046684 Bacteria 738
1261 Ga0495613_0015073 3300046689 Bacteria 5740
1262 Ga0495613_0244010 3300046689 Bacteria 1255
1263 Ga0495613_0283876 3300046689 Bacteria 1149
1264 Ga0495624_0000973 3300046690 Bacteria 22631
1265 Ga0495624_0001711 3300046690 Bacteria 16766
1266 Ga0495624_0067091 3300046690 Bacteria 2239
1267 Ga0495624_0371596 3300046690 Bacteria 859
1268 Ga0495624_0629737 3300046690 Bacteria 639
1269 Ga0495670_0000022 3300046691 Bacteria 101451
1270 Ga0495670_0000846 3300046691 Bacteria 14802
1271 Ga0495670_0039618 3300046691 Bacteria 2350
1272 Ga0495671_0050658 3300046692 Bacteria 2067
1273 Ga0495649_0034647 3300046694 Bacteria 2777
1274 Ga0495649_0106358 3300046694 Bacteria 1489
1275 Ga0495649_0373096 3300046694 Bacteria 719
1276 Ga0495649_0457901 3300046694 Bacteria 637
1277 Ga0495589_0004109 3300046794 Bacteria 7791
1278 Ga0495589_0091240 3300046794 Bacteria 1479
1279 Ga0495589_0094426 3300046794 Bacteria 1451
1280 Ga0495589_0169690 3300046794 Bacteria 1037
1281 Ga0495600_0085491 3300046809 Bacteria 2058
1282 Ga0495660_0076155 3300046810 Bacteria 1768
1283 Ga0495581_0003470 3300047315 Bacteria 9048
1284 Ga0495604_0014295 3300047317 Bacteria 6328
1285 Ga0495604_0019898 3300047317 Bacteria 5368
1286 Ga0495604_0028637 3300047317 Bacteria 4432
1287 Ga0495674_0000529 3300047319 Bacteria 35241
1288 Ga0495674_0024644 3300047319 Bacteria 5522
1289 Ga0495674_0120170 3300047319 Bacteria 2220
1290 Ga0495674_0683939 3300047319 Bacteria 806
1291 Ga0495674_1433416 3300047319 Bacteria 513
1292 Ga0495672_0012806 3300047320 Bacteria 5827
1293 Ga0495676_0043008 3300047321 Bacteria 3701
1294 Ga0495680_0015339 3300047322 Bacteria 6611
1295 Ga0495680_0145811 3300047322 Bacteria 1729
1296 Ga0495680_0763067 3300047322 Bacteria 634
1297 Ga0495683_0001263 3300047323 Bacteria 17158
1298 Ga0495683_0059121 3300047323 Bacteria 1902
1299 Ga0495683_0165830 3300047323 Bacteria 1018
1300 Ga0495687_023020 3300047443 Bacteria 2982
1301 Ga0495687_093290 3300047443 Bacteria 1147
1302 Ga0495675_0042917 3300047444 Bacteria 2881
1303 Ga0495675_0047428 3300047444 Bacteria 2733
1304 Ga0495675_0055935 3300047444 Bacteria 2502
1305 Ga0495677_0164299 3300047445 Bacteria 857
1306 Ga0495679_000045 3300047446 Bacteria 133780
1307 Ga0495679_060283 3300047446 Bacteria 1114
1308 Ga0495685_059424 3300047447 Bacteria 1290
1309 Ga0495673_0080335 3300047469 Bacteria 1352
1310 Ga0495673_0082151 3300047469 Bacteria 1333
1311 Ga0495673_0151112 3300047469 Bacteria 897
1312 Ga0495681_0044114 3300047470 Bacteria 2146
1313 Ga0495681_0309890 3300047470 Bacteria 609
1314 Ga0495684_0301756 3300047471 Bacteria 1150
1315 Ga0495684_0596202 3300047471 Bacteria 746
1316 Ga0495686_0017669 3300047472 Bacteria 4800
1317 Ga0495686_0034356 3300047472 Bacteria 3266
1318 Ga0495686_0070368 3300047472 Bacteria 2156
1319 Ga0495686_0236455 3300047472 Bacteria 1032
1320 Ga0495593_0004158 3300047673 Bacteria 8618
1321 Ga0495593_0006841 3300047673 Bacteria 6675
1322 Ga0495593_0018177 3300047673 Bacteria 3954
1323 Ga0495593_0118478 3300047673 Bacteria 1348
1324 Ga0495593_0153095 3300047673 Bacteria 1166
1325 Ga0495602_0000451 3300048088 Bacteria 38382
1326 Ga0495602_0051921 3300048088 Bacteria 3647
1327 Ga0495602_0388114 3300048088 Bacteria 998
1328 Ga0495614_0024646 3300048089 Bacteria 2597
1329 Ga0495626_0056877 3300048091 Bacteria 1790
1330 Ga0495626_0082558 3300048091 Bacteria 1425
1331 Ga0495626_0085873 3300048091 Bacteria 1391
1332 Ga0495626_0096506 3300048091 Bacteria 1294
1333 Ga0496100_0000149 3300048903 Bacteria 38827
1334 Ga0496100_0033277 3300048903 Bacteria 3224
1335 Ga0496100_0041046 3300048903 Bacteria 2947
1336 Ga0496100_0264530 3300048903 Bacteria 1276
1337 Ga0496100_0358057 3300048903 Bacteria 1103
1338 Ga0496101_0000204 3300048904 Bacteria 45284
1339 Ga0496101_0035408 3300048904 Bacteria 3531
1340 Ga0496101_0065053 3300048904 Bacteria 2658
1341 Ga0496101_0071732 3300048904 Bacteria 2540
1342 Ga0496101_0093750 3300048904 Bacteria 2237
1343 Ga0496101_0500979 3300048904 Bacteria 959
1344 Ga0496101_0897247 3300048904 Bacteria 698
1345 Ga0496102_0000298 3300048905 Bacteria 63657
1346 Ga0496102_0003655 3300048905 Bacteria 13004
1347 Ga0496102_0006544 3300048905 Bacteria 9946
1348 Ga0496102_0007864 3300048905 Bacteria 9109
1349 Ga0496102_0009745 3300048905 Bacteria 8261
1350 Ga0496102_0154782 3300048905 Bacteria 2155
1351 Ga0496102_0323893 3300048905 Bacteria 1452
1352 Ga0496102_0401113 3300048905 Bacteria 1289
1353 Ga0496102_0540259 3300048905 Bacteria 1088
1354 Ga0496102_1356304 3300048905 Bacteria 630
1355 Ga0496103_0000253 3300048906 Bacteria 51430
1356 Ga0496103_0017224 3300048906 Bacteria 4322
1357 Ga0496103_0021495 3300048906 Bacteria 3882
1358 Ga0496103_0069087 3300048906 Bacteria 2208
1359 Ga0496104_0015320 3300048907 Bacteria 6943
1360 Ga0496104_0019627 3300048907 Bacteria 6188
1361 Ga0496104_0049079 3300048907 Bacteria 3980
1362 Ga0496104_0057978 3300048907 Bacteria 3665
1363 Ga0496104_0061505 3300048907 Bacteria 3560
1364 Ga0496104_0071071 3300048907 Bacteria 3309
1365 Ga0496104_0139105 3300048907 Bacteria 2333
1366 Ga0496104_0379489 3300048907 Bacteria 1326
1367 Ga0496104_0398067 3300048907 Bacteria 1289
1368 Ga0496104_0552097 3300048907 Bacteria 1063
1369 Ga0496105_0004996 3300048908 Bacteria 10039
1370 Ga0496105_0041568 3300048908 Bacteria 3789
1371 Ga0496105_0045123 3300048908 Bacteria 3636
1372 Ga0496105_0057930 3300048908 Bacteria 3198
1373 Ga0496105_0110101 3300048908 Bacteria 2273
1374 Ga0496105_0238098 3300048908 Bacteria 1478
1375 Ga0496106_0000032 3300048909 Bacteria 134707
1376 Ga0496106_0006719 3300048909 Bacteria 8522
1377 Ga0496106_0007795 3300048909 Bacteria 7922
1378 Ga0496106_0063916 3300048909 Bacteria 2798
1379 Ga0496106_0066374 3300048909 Bacteria 2748
1380 Ga0496106_0180366 3300048909 Bacteria 1676
1381 Ga0496106_0206439 3300048909 Bacteria 1564
1382 Ga0496106_1390027 3300048909 Bacteria 543
1383 Ga0496107_0030005 3300048910 Bacteria 3874
1384 Ga0496107_0145813 3300048910 Bacteria 1750
1385 Ga0496107_0246379 3300048910 Bacteria 1330
1386 Ga0496107_0296782 3300048910 Bacteria 1203
1387 Ga0496107_0332851 3300048910 Bacteria 1130
1388 Ga0496108_0323820 3300048911 Bacteria 1344
1389 Ga0496108_0353499 3300048911 Bacteria 1282
1390 Ga0496108_0861419 3300048911 Bacteria 779
1391 Ga0496108_0872131 3300048911 Bacteria 774
1392 Ga0496108_1252712 3300048911 Bacteria 625
1393 Ga0496109_0129267 3300048912 Bacteria 2357
1394 Ga0496109_0171760 3300048912 Bacteria 2034
1395 Ga0496109_0333029 3300048912 Bacteria 1433
1396 Ga0496109_0628005 3300048912 Unclassified 1011
1397 Ga0496109_1422020 3300048912 Bacteria 629
1398 Ga0496109_1547810 3300048912 Bacteria 598
1399 Ga0496110_0004145 3300048913 Bacteria 11203
1400 Ga0496110_0022093 3300048913 Bacteria 5397
1401 Ga0496110_0053482 3300048913 Bacteria 3550
1402 Ga0496110_0114337 3300048913 Bacteria 2428
1403 Ga0496110_0144298 3300048913 Bacteria 2153
1404 Ga0496110_1375052 3300048913 Bacteria 615
1405 Ga0496110_1641845 3300048913 Bacteria 553
1406 Ga0496111_0057815 3300048914 Bacteria 2807
1407 Ga0496111_0076658 3300048914 Bacteria 2437
1408 Ga0496111_0116895 3300048914 Bacteria 1967
1409 Ga0496111_0194734 3300048914 Bacteria 1507
1410 Ga0496111_0409439 3300048914 Bacteria 1002
1411 Ga0496111_0957551 3300048914 Bacteria 615
1412 Ga0496112_0081915 3300048915 Bacteria 3192
1413 Ga0496112_0107336 3300048915 Bacteria 2762
1414 Ga0496112_0120672 3300048915 Bacteria 2591
1415 Ga0496112_0341432 3300048915 Bacteria 1441
1416 Ga0496113_0001027 3300048916 Bacteria 15012
1417 Ga0496113_0005040 3300048916 Bacteria 8196
1418 Ga0496114_0003149 3300048917 Bacteria 12672
1419 Ga0496114_0008418 3300048917 Bacteria 8168
1420 Ga0496114_0026734 3300048917 Bacteria 4727
1421 Ga0496114_0072860 3300048917 Bacteria 2890
1422 Ga0496114_0090054 3300048917 Bacteria 2604
1423 Ga0496114_0185758 3300048917 Bacteria 1816
1424 Ga0496114_0229483 3300048917 Bacteria 1631
1425 Ga0496114_0674838 3300048917 Bacteria 908
1426 Ga0496115_0000844 3300048918 Bacteria 22363
1427 Ga0496115_0002412 3300048918 Bacteria 13419
1428 Ga0496115_0051522 3300048918 Bacteria 3301
1429 Ga0496115_0058192 3300048918 Bacteria 3110
1430 Ga0496115_0176999 3300048918 Bacteria 1764
1431 Ga0496115_0905442 3300048918 Bacteria 680
1432 Ga0496116_0018763 3300048919 Bacteria 5316
1433 Ga0496116_0046983 3300048919 Bacteria 2910
1434 Ga0496116_0087140 3300048919 Bacteria 1912
1435 Ga0496116_0104014 3300048919 Bacteria 1688
1436 Ga0496116_0107605 3300048919 Bacteria 1648
1437 Ga0496117_0000171 3300048920 Bacteria 135051
1438 Ga0496117_0089273 3300048920 Bacteria 1991
1439 Ga0496117_0102805 3300048920 Bacteria 1802
1440 Ga0496117_0220037 3300048920 Bacteria 1057
1441 Ga0496117_0292987 3300048920 Bacteria 865
1442 Ga0496118_0000276 3300048921 Bacteria 90379
1443 Ga0496118_0000354 3300048921 Bacteria 77586
1444 Ga0496118_0029441 3300048921 Bacteria 4604
1445 Ga0496118_0045259 3300048921 Bacteria 3438
1446 Ga0496118_0127903 3300048921 Bacteria 1638
1447 Ga0496119_0017495 3300048922 Bacteria 5388
1448 Ga0496119_0050922 3300048922 Bacteria 2549
1449 Ga0496120_0257633 3300048923 Bacteria 816
1450 Ga0496121_0000141 3300048924 Bacteria 161556
1451 Ga0496121_0003156 3300048924 Bacteria 23758
1452 Ga0496121_0003736 3300048924 Bacteria 21331
1453 Ga0496121_0005380 3300048924 Bacteria 16449
1454 Ga0496121_0016043 3300048924 Bacteria 7764
1455 Ga0496121_0112777 3300048924 Bacteria 2070
1456 Ga0496121_0152653 3300048924 Bacteria 1698
1457 Ga0496122_0012850 3300048925 Bacteria 8279
1458 Ga0496122_0068789 3300048925 Bacteria 2540
1459 Ga0496123_0130883 3300048926 Bacteria 1390
1460 Ga0496124_0000282 3300048927 Bacteria 96697
1461 Ga0496124_0056706 3300048927 Bacteria 3303
1462 Ga0496124_0085211 3300048927 Bacteria 2590
1463 Ga0496124_0148795 3300048927 Unclassified 1840
1464 Ga0496124_0288008 3300048927 Bacteria 1194
1465 Ga0496125_0071926 3300048928 Bacteria 2699
1466 Ga0496125_0086012 3300048928 Unclassified 2380
1467 Ga0496125_0172295 3300048928 Bacteria 1453
1468 Ga0496126_0001351 3300048929 Bacteria 38922
1469 Ga0496126_0003785 3300048929 Bacteria 18777
1470 Ga0496126_0004234 3300048929 Bacteria 17268
1471 Ga0496126_0078962 3300048929 Bacteria 2915
1472 Ga0496126_0332429 3300048929 Bacteria 1247
1473 Ga0496126_0875021 3300048929 Bacteria 683
1474 Ga0496126_1417230 3300048929 Bacteria 501
1475 Ga0495678_013024 3300049459 Bacteria 3920
1476 Ga0495678_084829 3300049459 Bacteria 1129
1477 Ga0495682_0037955 3300049460 Bacteria 1770
1478 Ga0495682_0067637 3300049460 Bacteria 1287
1479 Ga0495682_0079624 3300049460 Bacteria 1178
1480 Ga0495682_0177830 3300049460 Bacteria 756
1481 Ga0501031_0054357 3300049568 Bacteria 2609
1482 Ga0501031_0236266 3300049568 Bacteria 1189
1483 Ga0501032_0065568 3300049569 Bacteria 2428
1484 Ga0501032_0166614 3300049569 Bacteria 1446
1485 Ga0501033_0051248 3300049570 Bacteria 3059
1486 Ga0501033_0063844 3300049570 Bacteria 2710
1487 Ga0501033_0226356 3300049570 Bacteria 1330
1488 Ga0501033_0779283 3300049570 Bacteria 647
1489 Ga0501034_0163377 3300049571 Bacteria 2196
1490 Ga0501034_0204748 3300049571 Bacteria 1930
1491 Ga0501034_0412934 3300049571 Bacteria 1272
1492 Ga0501034_0473025 3300049571 Bacteria 1169
1493 Ga0501036_0086051 3300049572 Bacteria 2657
1494 Ga0501037_0063212 3300049573 Bacteria 2698
1495 Ga0501037_0701472 3300049573 Bacteria 673
1496 Ga0501038_0015812 3300049574 Bacteria 6856
1497 Ga0501038_0345643 3300049574 Bacteria 1159
1498 Ga0501039_0167357 3300049575 Bacteria 1728
1499 Ga0501040_0421083 3300049576 Bacteria 960
1500 Ga0501040_1050476 3300049576 Bacteria 591
1501 Ga0501041_0097199 3300049577 Bacteria 1821
1502 Ga0501043_0110685 3300049579 Bacteria 2156
1503 Ga0501043_0148973 3300049579 Bacteria 1831
1504 Ga0501043_0234142 3300049579 Bacteria 1418
1505 Ga0501043_0387597 3300049579 Bacteria 1057
1506 Ga0501043_0545554 3300049579 Bacteria 862
1507 Ga0501043_0580313 3300049579 Bacteria 830
1508 Ga0501046_0224994 3300049580 Bacteria 1388
1509 Ga0501047_0000767 3300049581 Bacteria 33628
1510 Ga0501047_0047995 3300049581 Bacteria 4124
1511 Ga0501047_0113015 3300049581 Bacteria 2598
1512 Ga0501047_0275039 3300049581 Bacteria 1530
1513 Ga0501047_0641583 3300049581 Bacteria 882
1514 Ga0501048_0041574 3300049582 Bacteria 3292
1515 Ga0501048_0166114 3300049582 Bacteria 1563
1516 Ga0501068_0083238 3300049584 Bacteria 1966
1517 Ga0501068_0401870 3300049584 Bacteria 883
1518 Ga0501069_0041447 3300049585 Bacteria 2545
1519 Ga0501070_0036539 3300049586 Bacteria 4101
1520 Ga0501070_0082455 3300049586 Bacteria 2662
1521 Ga0501070_0334466 3300049586 Bacteria 1230
1522 Ga0501070_0443715 3300049586 Bacteria 1047
1523 Ga0501070_0448025 3300049586 Bacteria 1041
1524 Ga0501070_0814577 3300049586 Bacteria 732
1525 Ga0501071_0123633 3300049587 Bacteria 1919
1526 Ga0501071_0162122 3300049587 Bacteria 1671
1527 Ga0501071_0662665 3300049587 Bacteria 803
1528 Ga0501072_0175138 3300049588 Bacteria 1711
1529 Ga0501072_0742313 3300049588 Bacteria 770
1530 Ga0501073_0018731 3300049589 Bacteria 5005
1531 Ga0501073_0092455 3300049589 Bacteria 2102
1532 Ga0501073_0193696 3300049589 Bacteria 1406
1533 Ga0501073_0227964 3300049589 Bacteria 1287
1534 Ga0501073_0961909 3300049589 Bacteria 588
1535 Ga0501074_0013400 3300049590 Bacteria 5961
1536 Ga0501074_0170120 3300049590 Bacteria 1555
1537 Ga0501074_0187727 3300049590 Bacteria 1474
1538 Ga0501076_0008169 3300049592 Bacteria 7660
1539 Ga0501076_0032944 3300049592 Bacteria 4046
1540 Ga0501077_0791896 3300049593 Bacteria 609
1541 Ga0501202_010428 3300049652 Bacteria 1724
1542 Ga0501230_010201 3300049667 Bacteria 1462
1543 Ga0501240_043357 3300049673 Bacteria 754
1544 Ga0501249_029960 3300049679 Bacteria 1211
1545 Ga0501253_110990 3300049683 Bacteria 654
1546 Ga0501079_0004373 3300049741 Bacteria 10472
1547 Ga0501079_0086110 3300049741 Bacteria 2432
1548 Ga0501079_0250664 3300049741 Bacteria 1384
1549 Ga0501080_0005264 3300049742 Bacteria 11520
1550 Ga0501080_0005282 3300049742 Bacteria 11503
1551 Ga0501080_0204010 3300049742 Bacteria 1814
1552 Ga0501080_1085673 3300049742 Bacteria 691
1553 Ga0501081_0202231 3300049743 Bacteria 1441
1554 Ga0501081_0286665 3300049743 Bacteria 1206
1555 Ga0501083_0015218 3300049744 Bacteria 5385
1556 Ga0501083_0364549 3300049744 Bacteria 940
1557 Ga0501241_074598 3300049758 Bacteria 698
1558 Ga0501262_000018 3300049759 Bacteria 23886
1559 Ga0501035_0002389 3300049822 Bacteria 18435
1560 Ga0501035_0007057 3300049822 Bacteria 10501
1561 Ga0501035_0022406 3300049822 Bacteria 5800
1562 Ga0501035_0043215 3300049822 Bacteria 4062
1563 Ga0501035_0048919 3300049822 Bacteria 3790
1564 Ga0501035_0066424 3300049822 Bacteria 3201
1565 Ga0501035_0262795 3300049822 Bacteria 1463
1566 Ga0501035_0304279 3300049822 Bacteria 1343
1567 Ga0501035_0428886 3300049822 Bacteria 1097
1568 Ga0501044_0008426 3300049823 Bacteria 11305
1569 Ga0501044_0015381 3300049823 Bacteria 8240
1570 Ga0501044_0030021 3300049823 Bacteria 5730
1571 Ga0501044_0191621 3300049823 Bacteria 2007
1572 Ga0501044_0272016 3300049823 Bacteria 1629
1573 Ga0501044_0654710 3300049823 Bacteria 939
1574 Ga0501044_0828805 3300049823 Bacteria 803
1575 Ga0501044_0832002 3300049823 Bacteria 801
1576 Ga0501045_0053177 3300049824 Bacteria 2959
1577 nmdc:mga03683_177937_c1 3300050489 Bacteria 969
1578 nmdc:mga03683_18418_c1 3300050489 Bacteria 2655
1579 nmdc:mga03683_261517_c1 3300050489 Bacteria 805
1580 nmdc:mga03683_302002_c1 3300050489 Bacteria 751
1581 nmdc:mga03683_30365_c1 3300050489 Bacteria 2162
1582 nmdc:mga03683_40018_c1 3300050489 Bacteria 1921
1583 nmdc:mga03n38_242378_c1 3300050490 Bacteria 949
1584 nmdc:mga03n38_4824_c1 3300050490 Bacteria 4517
1585 nmdc:mga00v17_14257_c1 3300050491 Bacteria 4433
1586 nmdc:mga0yw44_1012827_c1 3300050492 Bacteria 562
1587 nmdc:mga0yw44_105510_c1 3300050492 Bacteria 1800
1588 nmdc:mga0yw44_4066_c1 3300050492 Bacteria 6626
1589 nmdc:mga0yw44_49946_c1 3300050492 Bacteria 2527
1590 nmdc:mga0k408_151171_c1 3300050493 Bacteria 1383
1591 nmdc:mga0k408_17982_c1 3300050493 Bacteria 3941
1592 nmdc:mga0k408_26346_c1 3300050493 Bacteria 3296
1593 nmdc:mga0k408_4257_c1 3300050493 Bacteria 7595
1594 nmdc:mga0k408_534112_c1 3300050493 Bacteria 694
1595 nmdc:mga0k408_773_c1 3300050493 Bacteria 17576
1596 nmdc:mga0k408_781_c1 3300050493 Bacteria 17522
1597 nmdc:mga0k408_85857_c1 3300050493 Bacteria 1847
1598 nmdc:mga06z11_111075_c1 3300050494 Bacteria 1518
1599 nmdc:mga06z11_13314_c1 3300050494 Bacteria 3608
1600 nmdc:mga06z11_348575_c1 3300050494 Bacteria 886
1601 nmdc:mga06z11_444249_c1 3300050494 Bacteria 783
1602 nmdc:mga06z11_57469_c1 3300050494 Bacteria 2015
1603 nmdc:mga06z11_724228_c1 3300050494 Bacteria 606
1604 nmdc:mga04h51_3324_c1 3300050495 Bacteria 2168
1605 nmdc:mga07m45_185475_c1 3300050496 Bacteria 1210
1606 nmdc:mga07m45_226359_c1 3300050496 Bacteria 1088
1607 nmdc:mga07m45_23225_c1 3300050496 Bacteria 3388
1608 nmdc:mga07m45_37997_c1 3300050496 Bacteria 2686
1609 nmdc:mga0qj67_10909_c1 3300050509 Bacteria 6798
1610 nmdc:mga0qj67_81413_c1 3300050509 Bacteria 2596
1611 nmdc:mga08y16_1342194_c1 3300050511 Bacteria 680
1612 nmdc:mga08y16_26645_c1 3300050511 Bacteria 6092
1613 nmdc:mga08y16_271743_c1 3300050511 Bacteria 1749
1614 nmdc:mga08y16_709729_c1 3300050511 Bacteria 1005
1615 nmdc:mga08y16_786418_c1 3300050511 Bacteria 945
1616 nmdc:mga08y16_857049_c1 3300050511 Bacteria 897
1617 nmdc:mga08y16_99364_c1 3300050511 Bacteria 3030
1618 nmdc:mga0a205_108416_c1 3300050515 Bacteria 2675
1619 nmdc:mga0sz30_105712_c1 3300050516 Bacteria 769
1620 nmdc:mga0sz30_27582_c1 3300050516 Bacteria 2333
1621 Ga0500578_0000002 3300053086 Bacteria 293507
1622 Ga0500644_0001458 3300053088 Bacteria 6243
1623 Ga0500646_0005532 3300053090 Bacteria 3195
1624 Ga0500651_0038444 3300053093 Bacteria 3014
1625 Ga0500651_0077221 3300053093 Bacteria 2067
1626 Ga0500555_150950 3300053103 Bacteria 569
1627 Ga0500591_142302 3300053115 Bacteria 944
1628 Ga0500594_0001847 3300053118 Bacteria 4583
1629 Ga0500608_002001 3300053122 Bacteria 7299
1630 Ga0500628_002992 3300053129 Bacteria 2778
1631 Ga0500652_000076 3300053131 Bacteria 42942
1632 Ga0500655_003466 3300053133 Bacteria 2850
1633 Ga0500559_0000038 3300053136 Bacteria 109922
1634 Ga0500559_0405411 3300053136 Bacteria 634
1635 Ga0500568_0049523 3300053139 Bacteria 1657
1636 Ga0500568_0107014 3300053139 Bacteria 1047
1637 Ga0500577_0023081 3300053142 Bacteria 2074
1638 Ga0500604_0001378 3300053151 Bacteria 6775
1639 Ga0500604_0043040 3300053151 Bacteria 1371
1640 Ga0500619_000367 3300053154 Bacteria 8432
1641 Ga0500622_0000236 3300053156 Bacteria 57393
1642 Ga0500622_0001043 3300053156 Bacteria 23134
1643 Ga0500645_002979 3300053730 Bacteria 7180
1644 Ga0500587_003821 3300053739 Bacteria 2091
1645 Ga0501084_0257970 3300054114 Bacteria 1472
1646 Ga0501084_0315009 3300054114 Bacteria 1321
1647 Ga0501082_0235260 3300060353 Bacteria 1594
1648 Ga0501082_0406808 3300060353 Bacteria 1188
1649 Ga0501082_0407180 3300060353 Bacteria 1187
1650 Ga0501082_0962972 3300060353 Bacteria 746
1651 Ga0466962_0000671 3300061719 Bacteria 15203
1652 Ga0466962_0026155 3300061719 Bacteria 2803
1653 2501070363 2501025501 Bacteria 7768574
1654 2501406829 2501025504 Bacteria 8008976
1655 2510247336 2510065045 Bacteria 7761063
1656 2511092901 2510917013 Bacteria 9951648
1657 2511097737 2510917014 Bacteria 8296963
1658 2511109342 2510917015 Bacteria 7950052
1659 2512351164 2512047030 Bacteria 9031815
1660 2513554785 2513237082 Bacteria 8640282
1661 2513565441 2513237083 Bacteria 8410967
1662 2514048330 2513237166 Bacteria 10373764
1663 2515685421 2515154122 Bacteria 8609520
1664 2516022627 2515154189 Bacteria 9629850
1665 2548497973 2547132374 Bacteria 5530232
1666 2563056692 2562617112 Bacteria 10918404
1667 2587733019 2585428058 Bacteria 6853932
1668 2587757295 2585428062 Bacteria 6842168
1669 2600815389 2600255067 Bacteria 6795583
1670 2643991488 2643221596 Bacteria 5006805
1671 2644062434 2643221609 Bacteria 6756331
1672 2644076533 2643221611 Bacteria 6820941
1673 2644159796 2643221628 Bacteria 5745828
1674 2644245725 2643221644 Bacteria 6865017
1675 2644529063 2643221695 Bacteria 3441323
1676 2644646072 2643221717 Bacteria 5676132
1677 2713481299 2711768613 Bacteria 11048459
1678 2719638490 2718217991 Bacteria 7829542
1679 2721028365 2718218334 Bacteria 4765486
1680 2816474857 2816332133 Bacteria 7249298
1681 2819619688 2818991450 Bacteria 6962147
1682 2821446133 2821443989 Bacteria 7658172
1683 2839142828 2839138175 Bacteria 6549354
1684 2842325987 2842324504 Bacteria 9364110
1685 2842351492 2842348783 Bacteria 9002918
1686 2842455309 2842454564 Bacteria 8730687
1687 2856291168 2856287931 Bacteria 7223934
1688 2857364207 2857357740 Bacteria 9937880
1689 2883095724 2883087390 Bacteria 9532701
1690 2885280221 2885270888 Bacteria 9831543
1691 2894656750 2894652903 Bacteria 4587256
1692 2902684627 2902682994 Bacteria 8951596
1693 2921647049 2921643360 Bacteria 11448031
1694 2928111295 2928108538 Bacteria 7360024
1695 2928138097 2928135762 Bacteria 7259641
1696 2928506741 2928503688 Bacteria 7268108
1697 2945947783 2945945610 Bacteria 5951079
1698 2945972510 2945972063 Bacteria 6086495
1699 2990711568 2990710928 Bacteria 5002431
1700 642620405 642555113 Bacteria 8214658
1701 8003961864 8003955200 Bacteria 8601927
1702 Ga0163161_10034921
1703 JGI24739J22299_10003364
1704 JGI24739J22299_10023427
1705 JGI24739J22299_10084174
1706 JGI24739J22299_10182118
1707 JGI24737J22298_10024487
1708 JGI24737J22298_10035457
1709 JGI24735J21928_10000218
1710 JGI24735J21928_10019288
1711 JGI24735J21928_10084510
1712 JGI24738J21930_10001339
1713 JGI25151J46595_10002650
1714 JGI25153J46596_10002559
1715 JGI25153J46596_10004432
1716 rootH2_10017111
1717 rootL2_10017630
1718 rootL2_10063704
1719 rootH1_10057484
1720 rootH1_10106569
1721 JGI25160J50197_1000138
1722 JGI25160J50197_1067284
1723 Ga0055529_1000645
1724 Ga0055526_1000025
1725 Ga0055524_1000340
1726 Ga0055528_1021709
1727 Ga0055530_10001296
1728 Ga0055540_1000202
1729 Ga0055531_10006224
1730 Ga0065165_1001498
1731 Ga0065714_10003524
1732 Ga0065714_10026103
1733 Ga0065704_10314299
1734 Ga0065712_10139593
1735 Ga0065715_10382284
1736 Ga0065707_10113921
1737 Ga0070658_10002159
1738 Ga0070658_10486117
1739 Ga0070658_10509300
1740 Ga0070676_10202976
1741 Ga0070676_11087146
1742 Ga0070683_100025002
1743 Ga0070683_100454758
1744 Ga0070683_101498005
1745 Ga0070683_101622339
1746 Ga0070690_100000170
1747 Ga0070690_100006691
1748 Ga0070690_100628572
1749 Ga0070670_100056500
1750 Ga0070670_100111461
1751 Ga0070670_100338079
1752 Ga0070670_101659532
1753 Ga0070670_101999810
1754 Ga0070677_10005411
1755 Ga0070677_10135632
1756 Ga0070677_10137563
1757 Ga0070677_10379468
1758 Ga0070677_10500380
1759 Ga0068869_100058329
1760 Ga0068869_100646122
1761 Ga0068869_101210580
1762 Ga0068869_101740734
1763 Ga0070666_10003654
1764 Ga0070666_10005053
1765 Ga0070666_10005266
1766 Ga0070680_100021168
1767 Ga0070680_100075010
1768 Ga0070680_101381494
1769 Ga0070682_100366538
1770 Ga0068868_100001028
1771 Ga0068868_100313646
1772 Ga0068868_100661690
1773 Ga0068868_101195922
1774 Ga0070660_100438171
1775 Ga0070660_100804856
1776 Ga0070660_101608049
1777 Ga0070689_100002054
1778 Ga0070689_100045528
1779 Ga0070689_100230457
1780 Ga0070689_100658192
1781 Ga0070689_101011139
1782 Ga0070689_101360385
1783 Ga0070687_100161025
1784 Ga0070687_101181569
1785 Ga0070661_100020048
1786 Ga0070661_100311536
1787 Ga0070661_100870899
1788 Ga0070661_101040801
1789 Ga0070692_11093151
1790 Ga0070668_100004204
1791 Ga0070668_100059222
1792 Ga0070668_100442266
1793 Ga0070668_100483779
1794 Ga0070668_100527611
1795 Ga0070668_100573253
1796 Ga0070668_101316589
1797 Ga0070668_101458564
1798 Ga0070669_100008000
1799 Ga0070669_100035511
1800 Ga0070669_100365896
1801 Ga0070669_100495557
1802 Ga0070669_101907033
1803 Ga0070675_100002408
1804 Ga0070675_100132674
1805 Ga0070675_100211012
1806 Ga0070675_100761328
1807 Ga0070675_100964261
1808 Ga0070671_100000044
1809 Ga0070671_100012205
1810 Ga0070671_100020242
1811 Ga0070671_100109424
1812 Ga0070671_100246287
1813 Ga0070671_100252344
1814 Ga0070671_100304997
1815 Ga0070671_100314450
1816 Ga0070671_100493664
1817 Ga0070671_100553871
1818 Ga0070671_101027822
1819 Ga0070674_100014412
1820 Ga0070674_100053212
1821 Ga0070674_100321061
1822 Ga0070674_100375084
1823 Ga0070674_100668358
1824 Ga0070674_100718574
1825 Ga0070673_100002015
1826 Ga0070673_100017551
1827 Ga0070673_100189949
1828 Ga0070673_100394870
1829 Ga0070673_100415319
1830 Ga0070673_100718191
1831 Ga0070673_100784061
1832 Ga0070673_100921324
1833 Ga0070688_100079229
1834 Ga0070688_100499717
1835 Ga0070688_101305019
1836 Ga0070688_101588166
1837 Ga0070659_100445630
1838 Ga0070659_100466896
1839 Ga0070659_100622539
1840 Ga0070659_100931856
1841 Ga0070667_100000708
1842 Ga0070667_100001356
1843 Ga0070667_100010392
1844 Ga0070667_100011492
1845 Ga0070667_100044454
1846 Ga0070667_100053057
1847 Ga0070667_100174704
1848 Ga0070667_100220658
1849 Ga0070667_100679270
1850 Ga0070701_10045625
1851 Ga0070701_10455387
1852 Ga0070711_100023555
1853 Ga0070705_100523983
1854 Ga0070700_100062062
1855 Ga0070700_100378742
1856 Ga0070700_100582930
1857 Ga0070700_100591841
1858 Ga0070694_100312606
1859 Ga0070708_100247604
1860 Ga0070663_100042514
1861 Ga0070663_100138790
1862 Ga0070663_100354199
1863 Ga0070663_100416219
1864 Ga0070678_100003442
1865 Ga0070678_100059660
1866 Ga0070678_100155746
1867 Ga0070678_100192916
1868 Ga0070678_100543016
1869 Ga0070678_100585829
1870 Ga0070678_100636243
1871 Ga0070662_100007793
1872 Ga0070662_100026968
1873 Ga0070662_100049235
1874 Ga0070662_100275954
1875 Ga0070662_100288620
1876 Ga0070662_100325760
1877 Ga0070662_100392451
1878 Ga0070662_100648410
1879 Ga0070681_10009145
1880 Ga0070681_10235743
1881 Ga0068867_100006852
1882 Ga0068867_100010539
1883 Ga0068867_100020738
1884 Ga0068867_100194070
1885 Ga0068867_100278550
1886 Ga0068867_100451275
1887 Ga0068867_100511535
1888 Ga0070685_10093186
1889 Ga0070685_10131177
1890 Ga0070685_10244490
1891 Ga0070685_10499751
1892 Ga0070685_10882300
1893 Ga0070707_100718458
1894 Ga0070679_100030083
1895 Ga0070684_100030247
1896 Ga0070684_100381892
1897 Ga0070684_100671024
1898 Ga0068853_100346198
1899 Ga0070672_100000257
1900 Ga0070672_100129026
1901 Ga0070672_100164309
1902 Ga0070672_100179730
1903 Ga0070672_100964296
1904 Ga0070672_100996118
1905 Ga0070686_100017496
1906 Ga0070686_100017565
1907 Ga0070686_100141531
1908 Ga0070686_101514287
1909 Ga0070693_100232265
1910 Ga0070693_100781224
1911 Ga0070665_100000176
1912 Ga0070665_100203644
1913 Ga0070665_100730008
1914 Ga0070665_101767116
1915 Ga0070665_101840637
1916 Ga0070704_100333107
1917 Ga0070704_100386867
1918 Ga0070704_101179376
1919 Ga0070704_101971345
1920 Ga0068855_100006465
1921 Ga0068855_100568881
1922 Ga0070664_100018748
1923 Ga0070664_100034095
1924 Ga0070664_100055809
1925 Ga0070664_100085823
1926 Ga0070664_100093667
1927 Ga0070664_100203642
1928 Ga0070664_100205438
1929 Ga0070664_100443544
1930 Ga0068857_100007255
1931 Ga0068857_100356947
1932 Ga0068857_101795431
1933 Ga0068854_100170399
1934 Ga0068854_100245764
1935 Ga0068854_100390034
1936 Ga0068856_100002512
1937 Ga0068856_100461730
1938 Ga0070702_100023624
1939 Ga0070702_100509795
1940 Ga0068852_100200031
1941 Ga0068852_100229830
1942 Ga0068852_100368931
1943 Ga0068852_100431861
1944 Ga0068852_100746178
1945 Ga0068859_100003821
1946 Ga0068859_100004139
1947 Ga0068859_100015467
1948 Ga0068859_100048360
1949 Ga0068859_101074221
1950 Ga0068859_101256686
1951 Ga0068859_102393699
1952 Ga0068864_100000318
1953 Ga0068864_100001446
1954 Ga0068864_100161343
1955 Ga0068864_100505888
1956 Ga0068864_100841021
1957 Ga0068864_101537811
1958 Ga0068864_102026604
1959 Ga0068866_10067940
1960 Ga0068866_10544798
1961 Ga0068866_10667186
1962 Ga0068866_10718958
1963 Ga0068861_100016912
1964 Ga0068861_100099307
1965 Ga0068861_100101827
1966 Ga0068861_100143840
1967 Ga0068861_100310284
1968 Ga0068851_10089185
1969 Ga0068851_10609614
1970 Ga0068870_10057911
1971 Ga0068870_10543450
1972 Ga0068870_10599744
1973 Ga0068870_11242059
1974 Ga0068863_100000507
1975 Ga0068863_100026485
1976 Ga0068863_100061840
1977 Ga0068863_100081182
1978 Ga0068863_100238679
1979 Ga0068863_100269124
1980 Ga0068863_100689995
1981 Ga0068863_100752156
1982 Ga0068863_101526968
1983 Ga0068863_101550799
1984 Ga0068858_100000774
1985 Ga0068858_100005599
1986 Ga0068858_100025183
1987 Ga0068858_100036108
1988 Ga0068858_100134912
1989 Ga0068858_101586275
1990 Ga0068860_100014942
1991 Ga0068860_100094195
1992 Ga0068860_100098740
1993 Ga0068860_102388193
1994 Ga0068862_100000837
1995 Ga0068862_100004861
1996 Ga0068862_100034683
1997 Ga0068862_100104541
1998 Ga0068862_100175575
1999 Ga0068862_100771972
2000 Ga0068862_100928370
2001 Ga0081455_10002344
2002 Ga0081455_10104070
2003 Ga0081538_10049157
2004 Ga0081539_10085913
2005 Ga0081539_10227273
2006 Ga0075365_10173499
2007 Ga0075365_10174274
2008 Ga0075365_10181297
2009 Ga0075365_10189645
2010 Ga0075365_10957175
2011 Ga0075368_10047802
2012 Ga0075368_10295813
2013 Ga0075363_100003696
2014 Ga0075363_100011596
2015 Ga0075363_100011622
2016 Ga0075363_100020319
2017 Ga0075363_100034884
2018 Ga0075363_100146803
2019 Ga0075364_10036942
2020 Ga0075364_10209189
2021 Ga0075432_10023807
2022 Ga0075362_10004570
2023 Ga0075362_10009462
2024 Ga0075362_10011745
2025 Ga0075362_10056843
2026 Ga0075362_10098789
2027 Ga0075362_10198355
2028 Ga0075367_10009821
2029 Ga0075367_10104037
2030 Ga0075367_10133780
2031 Ga0075367_10211778
2032 Ga0075367_10217941
2033 Ga0075367_10735713
2034 Ga0075369_10019712
2035 Ga0075369_10222392
2036 Ga0075366_10000689
2037 Ga0075366_10004381
2038 Ga0075366_10010042
2039 Ga0075366_10015818
2040 Ga0075366_10028399
2041 Ga0075366_10062491
2042 Ga0075366_10074050
2043 Ga0075366_10099983
2044 Ga0075366_10776752
2045 Ga0075366_10953136
2046 Ga0075366_11029513
2047 Ga0097621_100027531
2048 Ga0097621_100214164
2049 Ga0097621_100352323
2050 Ga0097621_100710393
2051 Ga0097621_101308900
2052 Ga0097621_101903232
2053 Ga0075370_10006289
2054 Ga0075370_10014688
2055 Ga0075370_10169646
2056 Ga0075370_10490162
2057 Ga0075370_10746227
2058 Ga0068871_100072625
2059 Ga0068871_100081581
2060 Ga0068871_100108479
2061 Ga0068871_100807603
2062 Ga0068871_101024542
2063 Ga0075428_100023230
2064 Ga0075428_100823553
2065 Ga0075428_101030466
2066 Ga0075428_101567842
2067 Ga0075428_102383532
2068 Ga0075430_100073642
2069 Ga0075433_10337117
2070 Ga0075433_11548766
2071 Ga0075434_100319984
2072 Ga0068865_100064014
2073 Ga0068865_100137683
2074 Ga0068865_100234537
2075 Ga0068865_100241701
2076 Ga0068865_100341875
2077 Ga0068865_100402356
2078 Ga0068865_100769941
2079 Ga0068865_100918610
2080 Ga0097620_100003821
2081 Ga0097620_100004139
2082 Ga0097620_100015469
2083 Ga0097620_100048358
2084 Ga0097620_101074217
2085 Ga0097620_101256553
2086 Ga0097620_102393307
2087 Ga0079104_1000007
2088 Ga0079104_1000328
2089 Ga0079104_1035251
2090 Ga0105251_10034197
2091 Ga0105251_10338706
2092 Ga0105244_10005755
2093 Ga0105240_10007401
2094 Ga0105240_10051415
2095 Ga0105240_10068040
2096 Ga0105240_10263172
2097 Ga0105240_10266723
2098 Ga0105240_10532134
2099 Ga0105240_10562624
2100 Ga0105240_12041303
2101 Ga0111539_10020185
2102 Ga0111539_10028960
2103 Ga0111539_10029107
2104 Ga0111539_10056854
2105 Ga0111539_10493667
2106 Ga0111539_10498702
2107 Ga0111539_10688131
2108 Ga0111539_12763341
2109 Ga0105245_10002284
2110 Ga0105245_10009930
2111 Ga0105245_10150360
2112 Ga0105245_10534083
2113 Ga0105245_10819385
2114 Ga0105245_11012952
2115 Ga0105247_10031819
2116 Ga0105247_11035539
2117 Ga0114129_10826805
2118 Ga0114129_11018182
2119 Ga0105243_10005465
2120 Ga0105243_10021175
2121 Ga0105243_10066031
2122 Ga0105243_10183927
2123 Ga0105243_10434969
2124 Ga0105243_11419139
2125 Ga0105241_10025680
2126 Ga0105241_10076330
2127 Ga0105241_10408763
2128 Ga0105242_10084172
2129 Ga0105242_10257763
2130 Ga0105248_10000901
2131 Ga0105248_10013005
2132 Ga0105248_10019352
2133 Ga0105248_10034099
2134 Ga0105248_10274971
2135 Ga0105248_10590872
2136 Ga0105248_10707785
2137 Ga0105248_10774000
2138 Ga0105248_10792820
2139 Ga0105237_10036837
2140 Ga0105238_10091658
2141 Ga0105238_10550871
2142 Ga0105238_10561091
2143 Ga0105238_10950062
2144 Ga0105249_10041313
2145 Ga0105249_10082716
2146 Ga0105249_10161627
2147 Ga0105249_10321811
2148 Ga0105249_11012623
2149 Ga0105249_11074378
2150 Ga0105249_11146707
2151 Ga0105249_12477495
2152 Ga0105239_10413081
2153 Ga0105239_11568414
2154 Ga0105239_13550627
2155 Ga0105246_10085296
2156 Ga0105246_10162659
2157 Ga0105246_10169905
2158 Ga0105246_11033510
2159 Ga0157371_10192728
2160 Ga0157370_10044109
2161 Ga0157370_10072734
2162 Ga0157370_10882273
2163 Ga0157370_11696108
2164 Ga0157369_10000602
2165 Ga0157369_10023131
2166 Ga0157369_10162240
2167 Ga0157369_10329807
2168 Ga0157369_12075546
2169 Ga0157374_10203428
2170 Ga0157374_10346348
2171 Ga0157374_10453679
2172 Ga0157374_10627225
2173 Ga0157374_11009373
2174 Ga0157378_10001784
2175 Ga0157378_10099364
2176 Ga0157378_10336468
2177 Ga0157378_10400406
2178 Ga0157378_10598955
2179 Ga0157378_10715141
2180 Ga0157378_10807732
2181 Ga0157378_12623690
2182 Ga0163162_10000204
2183 Ga0163162_10000297
2184 Ga0163162_10112784
2185 Ga0163162_10113651
2186 Ga0163162_10186666
2187 Ga0163162_10508603
2188 Ga0163162_10715786
2189 Ga0163162_10796738
2190 Ga0163162_10910164
2191 Ga0163162_12481903
2192 Ga0157372_10325667
2193 Ga0157372_10464004
2194 Ga0157372_10554272
2195 Ga0157372_12263872
2196 Ga0157375_10001119
2197 Ga0157375_10005543
2198 Ga0157375_10045314
2199 Ga0157375_10073202
2200 Ga0157375_10075281
2201 Ga0157375_10305261
2202 Ga0157375_10449430
2203 Ga0157375_12782199
2204 Ga0163163_10004109
2205 Ga0163163_10082610
2206 Ga0163163_10530945
2207 Ga0163163_10563215
2208 Ga0163163_11228855
2209 Ga0163163_11232236
2210 Ga0163163_11948267
2211 Ga0163163_13010961
2212 Ga0157380_10034310
2213 Ga0157380_10144616
2214 Ga0157380_10353500
2215 Ga0157380_10967510
2216 Ga0157380_11474836
2217 Ga0157380_11535095
2218 Ga0157380_11713249
2219 Ga0182008_10018727
2220 Ga0182008_10050371
2221 Ga0182008_10098655
2222 Ga0182008_10111392
2223 Ga0157377_11041297
2224 Ga0157379_10001453
2225 Ga0157379_10002672
2226 Ga0157379_10009921
2227 Ga0157379_10217391
2228 Ga0157379_10822840
2229 Ga0157379_10887760
2230 Ga0157376_10003212
2231 Ga0157376_10015114
2232 Ga0157376_10138950
2233 Ga0157376_10232185
2234 Ga0157376_10380523
2235 Ga0157376_10627043
2236 Ga0157376_10658432
2237 Ga0157376_11033266
2238 Ga0182006_1026631
2239 Ga0182007_10000792
2240 Ga0182007_10001246
2241 Ga0182007_10031895
2242 Ga0182007_10075383
2243 Ga0182007_10145516
2244 Ga0182007_10157393
2245 Ga0182005_1085284
2246 Ga0183362_10001
2247 Ga0163161_10031277
2248 Ga0163161_10068966
2249 Ga0163161_10081853
2250 Ga0163161_11059143
2251 Ga0163161_11245395
2252 Ga0163161_11875135
2253 Ga0197907_10551622
2254 Ga0206354_11176714
2255 Ga0206353_10456852
2256 Ga0213872_10372609
2257 Ga0224712_10000345
2258 Ga0228598_1012137
2259 Ga0209435_113861
2260 Ga0209672_100267
2261 Ga0209672_122263
2262 Ga0209258_119958
2263 Ga0209759_1000120
2264 Ga0209129_1010485
2265 Ga0209565_1016199
2266 Ga0209455_1000449
2267 Ga0209673_1001396
2268 Ga0209130_1021741
2269 Ga0209025_1000394
2270 Ga0209564_1000027
2271 Ga0209564_1004085
2272 Ga0209758_1000045
2273 Ga0209758_1000252
2274 Ga0209758_1033518
2275 Ga0209758_1046589
2276 Ga0209050_1001032
2277 Ga0209050_1014128
2278 Ga0209256_1000120
2279 Ga0207426_1000018
2280 Ga0207426_1003365
2281 Ga0209051_1000018
2282 Ga0209257_1000260
2283 Ga0209257_1008085
2284 Ga0209257_1041875
2285 Ga0207697_10016505
2286 Ga0207697_10248339
2287 Ga0207697_10268737
2288 Ga0207656_10131603
2289 Ga0207655_1007702
2290 Ga0207713_1000892
2291 Ga0207713_1016353
2292 Ga0207682_10001857
2293 Ga0207682_10008143
2294 Ga0207682_10060636
2295 Ga0207642_10258044
2296 Ga0207642_10540183
2297 Ga0207642_10894388
2298 Ga0207710_10319141
2299 Ga0207688_10307397
2300 Ga0207688_10448414
2301 Ga0207688_10468896
2302 Ga0207688_10604182
2303 Ga0207680_10000693
2304 Ga0207680_10004179
2305 Ga0207680_10006026
2306 Ga0207647_10000722
2307 Ga0207647_10017131
2308 Ga0207647_10040574
2309 Ga0207647_10143800
2310 Ga0207645_10014790
2311 Ga0207645_10027805
2312 Ga0207645_10055006
2313 Ga0207645_10068284
2314 Ga0207645_10457571
2315 Ga0207643_10018108
2316 Ga0207643_10550892
2317 Ga0207705_10000980
2318 Ga0207705_10311432
2319 Ga0207705_10430846
2320 Ga0207654_10752926
2321 Ga0207707_10015974
2322 Ga0207707_10179574
2323 Ga0207695_10005806
2324 Ga0207695_10099824
2325 Ga0207695_10109888
2326 Ga0207695_10208802
2327 Ga0207695_10227674
2328 Ga0207695_10438586
2329 Ga0207695_10704067
2330 Ga0207671_10124914
2331 Ga0207660_10356226
2332 Ga0207662_10080085
2333 Ga0207657_10122373
2334 Ga0207657_10406625
2335 Ga0207657_10604910
2336 Ga0207649_10015454
2337 Ga0207649_10262173
2338 Ga0207649_10365202
2339 Ga0207649_10449884
2340 Ga0207649_11537253
2341 Ga0207652_10247841
2342 Ga0207652_10344385
2343 Ga0207646_10673882
2344 Ga0207646_10749262
2345 Ga0207681_10003319
2346 Ga0207681_10108532
2347 Ga0207681_10184794
2348 Ga0207681_10216414
2349 Ga0207681_10268155
2350 Ga0207694_10235346
2351 Ga0207694_10280938
2352 Ga0207694_10386615
2353 Ga0207694_10623086
2354 Ga0207650_10016870
2355 Ga0207650_10064404
2356 Ga0207650_10077573
2357 Ga0207650_10395428
2358 Ga0207650_11191954
2359 Ga0207650_11617279
2360 Ga0207659_10002593
2361 Ga0207659_10016636
2362 Ga0207659_10079914
2363 Ga0207659_10252106
2364 Ga0207659_10421828
2365 Ga0207659_10670008
2366 Ga0207659_11670633
2367 Ga0207687_10044264
2368 Ga0207687_10277079
2369 Ga0207687_11019872
2370 Ga0207687_11553368
2371 Ga0207700_10928918
2372 Ga0207644_10000080
2373 Ga0207644_10006260
2374 Ga0207644_10037806
2375 Ga0207644_10116955
2376 Ga0207644_10455384
2377 Ga0207644_10895232
2378 Ga0207644_10923302
2379 Ga0207690_10416346
2380 Ga0207706_10005400
2381 Ga0207706_10018796
2382 Ga0207706_10022986
2383 Ga0207706_10028055
2384 Ga0207706_10080051
2385 Ga0207706_10963276
2386 Ga0207686_10379724
2387 Ga0207709_10000112
2388 Ga0207709_10013548
2389 Ga0207709_10834727
2390 Ga0207670_10003436
2391 Ga0207670_10005570
2392 Ga0207670_10038745
2393 Ga0207669_10008845
2394 Ga0207669_10056465
2395 Ga0207669_10306769
2396 Ga0207669_10576571
2397 Ga0207704_10011663
2398 Ga0207704_10097382
2399 Ga0207704_10125104
2400 Ga0207704_10339386
2401 Ga0207704_10353319
2402 Ga0207704_10497274
2403 Ga0207704_11785862
2404 Ga0207691_10000814
2405 Ga0207691_10019301
2406 Ga0207691_10058201
2407 Ga0207691_10092568
2408 Ga0207691_10095826
2409 Ga0207691_10187620
2410 Ga0207691_10841879
2411 Ga0207711_10001117
2412 Ga0207711_10002270
2413 Ga0207711_10006712
2414 Ga0207711_10114041
2415 Ga0207711_10648262
2416 Ga0207711_10780189
2417 Ga0207689_10006926
2418 Ga0207689_10023656
2419 Ga0207689_10258895
2420 Ga0207689_11519392
2421 Ga0207661_10069974
2422 Ga0207661_10244030
2423 Ga0207661_10344539
2424 Ga0207679_10012324
2425 Ga0207679_10032483
2426 Ga0207679_10168836
2427 Ga0207679_10182044
2428 Ga0207679_10247932
2429 Ga0207679_10251553
2430 Ga0207667_10001900
2431 Ga0207651_10000144
2432 Ga0207651_10045168
2433 Ga0207651_10170057
2434 Ga0207651_10388881
2435 Ga0207651_10444822
2436 Ga0207651_11070911
2437 Ga0207651_11267794
2438 Ga0207712_10136720
2439 Ga0207712_10143511
2440 Ga0207712_10348307
2441 Ga0207668_10035062
2442 Ga0207668_10042223
2443 Ga0207668_10064096
2444 Ga0207668_10323754
2445 Ga0207668_10383712
2446 Ga0207640_10925885
2447 Ga0207640_11161124
2448 Ga0207658_10001163
2449 Ga0207658_10001928
2450 Ga0207658_10006797
2451 Ga0207658_10060167
2452 Ga0207658_10316108
2453 Ga0207658_11049995
2454 Ga0207658_11596239
2455 Ga0207677_10000686
2456 Ga0207677_10086316
2457 Ga0207677_10125707
2458 Ga0207677_11216370
2459 Ga0207703_10000702
2460 Ga0207703_10009199
2461 Ga0207703_10035099
2462 Ga0207703_10262242
2463 Ga0207703_10333350
2464 Ga0207703_10843132
2465 Ga0207639_10583343
2466 Ga0207639_10904484
2467 Ga0207639_11902670
2468 Ga0207678_10010590
2469 Ga0207678_10128514
2470 Ga0207678_10172462
2471 Ga0207678_10202581
2472 Ga0207678_10304781
2473 Ga0207678_10616168
2474 Ga0207678_10705843
2475 Ga0207678_10895209
2476 Ga0207708_10145699
2477 Ga0207708_10276266
2478 Ga0207708_10428084
2479 Ga0207708_10919707
2480 Ga0207702_10280361
2481 Ga0207702_10352781
2482 Ga0207641_10000926
2483 Ga0207641_10016664
2484 Ga0207641_10024608
2485 Ga0207641_10029474
2486 Ga0207641_10100857
2487 Ga0207641_10216887
2488 Ga0207641_11531460
2489 Ga0207641_11751157
2490 Ga0207648_10002833
2491 Ga0207648_10006529
2492 Ga0207648_10017050
2493 Ga0207648_10025610
2494 Ga0207648_10086004
2495 Ga0207648_10102038
2496 Ga0207648_10155576
2497 Ga0207648_10156071
2498 Ga0207648_10287144
2499 Ga0207648_10620448
2500 Ga0207648_10677379
2501 Ga0207676_10000656
2502 Ga0207676_10017506
2503 Ga0207676_10128103
2504 Ga0207676_10681033
2505 Ga0207676_10916896
2506 Ga0207674_10006947
2507 Ga0207674_10015020
2508 Ga0207674_10229216
2509 Ga0207674_10421489
2510 Ga0207674_11151625
2511 Ga0207675_100016912
2512 Ga0207675_100018263
2513 Ga0207675_100071881
2514 Ga0207675_100136890
2515 Ga0207675_100653032
2516 Ga0207675_100787266
2517 Ga0207675_101233782
2518 Ga0207683_10010852
2519 Ga0207683_10065890
2520 Ga0207683_10075327
2521 Ga0207683_10085160
2522 Ga0207683_10090087
2523 Ga0207683_10184951
2524 Ga0207683_10412517
2525 Ga0207683_10565873
2526 Ga0207683_10666940
2527 Ga0207683_10681226
2528 Ga0207698_10575205
2529 Ga0207698_11700327
2530 Ga0209281_1000020
2531 Ga0209281_1000455
2532 Ga0209281_1028254
2533 Ga0209973_1057037
2534 Ga0209813_10031997
2535 Ga0207428_10115761
2536 Ga0207428_10184545
2537 Ga0207428_10744711
2538 Ga0207428_11017070
2539 Ga0268266_10000005
2540 Ga0268266_10004503
2541 Ga0268266_11378564
2542 Ga0268266_11398962
2543 Ga0268266_11689948
2544 Ga0268265_10011002
2545 Ga0268265_10040448
2546 Ga0268265_10305534
2547 Ga0268265_10442039
2548 Ga0268265_10918540
2549 Ga0268264_10000046
2550 Ga0268264_10022682
2551 Ga0268264_10102789
2552 Ga0268264_10574605
2553 Ga0268264_12100554
2554 Ga0307517_10009345
2555 Ga0307517_10422898
2556 Ga0307515_10000722
2557 Ga0307515_10002592
2558 Ga0307515_10029667
2559 Ga0307515_10034932
2560 Ga0307515_10043798
2561 Ga0307515_10054641
2562 Ga0307515_10068092
2563 Ga0307515_10295665
2564 Ga0265338_10191218
2565 Ga0307512_10219233
2566 Ga0307512_10320256
2567 Ga0265332_10035345
2568 Ga0265328_10026618
2569 Ga0265331_10183458
2570 Ga0265327_10028506
2571 Ga0265316_11296286
2572 Ga0307513_10005609
2573 Ga0307513_10322208
2574 Ga0307509_10016410
2575 Ga0307509_10019184
2576 Ga0307509_10041676
2577 Ga0307509_10048077
2578 Ga0307509_10051517
2579 Ga0307509_10290106
2580 Ga0307509_10342052
2581 Ga0307509_10587745
2582 Ga0307408_100014078
2583 Ga0307408_100020103
2584 Ga0307408_100037431
2585 Ga0307408_100044613
2586 Ga0307408_100068764
2587 Ga0307408_100184150
2588 Ga0307408_100308870
2589 Ga0307408_100644049
2590 Ga0307408_100719100
2591 Ga0307408_101455754
2592 Ga0307408_101839818
2593 Ga0307508_10000659
2594 Ga0307508_10001973
2595 Ga0307508_10070300
2596 Ga0307514_10008017
2597 Ga0307514_10175535
2598 Ga0265314_10018888
2599 Ga0265314_10111016
2600 Ga0307516_10003142
2601 Ga0307516_10062726
2602 Ga0307516_10170137
2603 Ga0307516_10348440
2604 Ga0307516_10558733
2605 Ga0307516_10862698
2606 Ga0307405_10056945
2607 Ga0307405_10081180
2608 Ga0307405_10595457
2609 Ga0307405_10686049
2610 Ga0307413_10239523
2611 Ga0307413_10376475
2612 Ga0307413_10401762
2613 Ga0307413_10554929
2614 Ga0307413_10663139
2615 Ga0307413_10997778
2616 Ga0307413_11626169
2617 Ga0307410_10067171
2618 Ga0307410_11023474
2619 Ga0307406_10000971
2620 Ga0307406_10726998
2621 Ga0307406_11344228
2622 Ga0307407_10040614
2623 Ga0307407_10451482
2624 Ga0307407_10504480
2625 Ga0307412_10097649
2626 Ga0307412_10105216
2627 Ga0307412_10106305
2628 Ga0307412_10141151
2629 Ga0307412_10232371
2630 Ga0307412_10412449
2631 Ga0307412_10412637
2632 Ga0307412_10454638
2633 Ga0307412_11389008
2634 Ga0307412_11427041
2635 Ga0307412_11842723
2636 Ga0307409_100137996
2637 Ga0307409_100328491
2638 Ga0307409_101043738
2639 Ga0307409_101062858
2640 Ga0307416_100025231
2641 Ga0307416_100205498
2642 Ga0307416_100911959
2643 Ga0307416_102426847
2644 Ga0307414_10093113
2645 Ga0307414_10101921
2646 Ga0307414_10319004
2647 Ga0307414_10786396
2648 Ga0307414_11179229
2649 Ga0307414_11218204
2650 Ga0307411_10089972
2651 Ga0307411_10124567
2652 Ga0307411_10230864
2653 Ga0307411_10412559
2654 Ga0307411_10532091
2655 Ga0307411_11430635
2656 Ga0307411_11620561
2657 Ga0307415_100802834
2658 Ga0307507_10120827
2659 Ga0307507_10246671
2660 Ga0307507_10315566
2661 Ga0307510_10008860
2662 Ga0307510_10267155
2663 Ga0373928_0125407
2664 Ga0373936_0006785
2665 Ga0373936_0020797
2666 Ga0373956_0155219
2667 Ga0373943_0568338
2668 Ga0373946_0283990
2669 Ga0373955_0016520
2670 Ga0373931_1118482
2671 Ga0373935_1442716
2672 Ga0373927_0137483
2673 Ga0373933_0236278
2674 Ga0373933_0445795
2675 Ga0373947_0402276
2676 Ga0373937_0335188
2677 Ga0373937_0672974
2678 Ga0373937_1036553
2679 Ga0373925_0158603
2680 Ga0373925_0185903
2681 Ga0373925_0378943
2682 Ga0395899_0000521
2683 Ga0395899_0000581
2684 Ga0395899_0002985
2685 Ga0395899_0165992
2686 Ga0395900_0032760
2687 Ga0395900_0246211
2688 Ga0395898_0035761
2689 Ga0395898_0309599
2690 Ga0395898_0339749
2691 Ga0395905_0000029
2692 Ga0395905_0017408
2693 Ga0395905_0087795
2694 Ga0395905_0183254
2695 Ga0395905_0211610
2696 Ga0395905_1000623
2697 Ga0395901_0032991
2698 Ga0395901_0095514
2699 Ga0395901_0427156
2700 Ga0436360_0988630
2701 Ga0436361_0168617
2702 Ga0436361_0209219
2703 Ga0439465_0005707
2704 Ga0451791_1941958
2705 Ga0451793_1513956
2706 Ga0451797_0629150
2707 Ga0451797_1257626
2708 Ga0451795_0135458
2709 Ga0451795_0363756
2710 Ga0451800_1298110
2711 Ga0451802_0323989
2712 Ga0451802_0711155
2713 Ga0451802_1304540
2714 Ga0451807_2074045
2715 Ga0451837_1338186
2716 Ga0451839_1659939
2717 Ga0451845_0303794
2718 Ga0451847_0101710
2719 Ga0451849_0088262
2720 Ga0451843_0405520
2721 Ga0451855_0963016
2722 Ga0439431_0023450
2723 Ga0439442_028403
2724 Ga0439432_018326
2725 Ga0439432_056988
2726 Ga0439449_0002219
2727 Ga0439450_081517
2728 Ga0439452_085163
2729 Ga0439462_0169395
2730 Ga0450914_016197
2731 Ga0450920_057362
2732 Ga0450890_046398
2733 Ga0450894_018669
2734 Ga0450898_151491
2735 Ga0450899_013055
2736 Ga0450904_020330
2737 Ga0450905_056616
2738 Ga0450910_063573
2739 Ga0439446_0030487
2740 Ga0450908_001912
2741 Ga0450918_002326
2742 Ga0450893_0022938
2743 Ga0466969_0000010
2744 Ga0466969_0000531
2745 Ga0466969_0012755
2746 Ga0466969_0049614
2747 Ga0466969_0186316
2748 Ga0466972_0034223
2749 Ga0466972_0054011
2750 Ga0466972_0191190
2751 Ga0466972_0239589
2752 Ga0466982_0059006
2753 Ga0466965_0008841
2754 Ga0466965_0073734
2755 Ga0466965_0181326
2756 Ga0466965_0197374
2757 Ga0466965_0484145
2758 Ga0466966_0001046
2759 Ga0466966_0017788
2760 Ga0466966_0021565
2761 Ga0466961_0001090
2762 Ga0466961_0004702
2763 Ga0466961_0020588
2764 Ga0466961_0051247
2765 Ga0466963_0217615
2766 Ga0466963_0225588
2767 Ga0466963_0717417
2768 Ga0466964_0018775
2769 Ga0466964_0216361
2770 Ga0453684_1024299
2771 Ga0466971_0002065
2772 Ga0466971_0267106
2773 Ga0466968_0179082
2774 Ga0466968_0251625
2775 Ga0466970_0001322
2776 Ga0466970_0008987
2777 Ga0466970_0031328
2778 Ga0466970_0078991
2779 Ga0466957_0001175
2780 Ga0466957_0132372
2781 Ga0466957_0606224
2782 Ga0466957_0725501
2783 Ga0466957_1023343
2784 Ga0466960_0030576
2785 Ga0466960_0267490
2786 Ga0466959_0000206
2787 Ga0466959_0002005
2788 Ga0466959_0004323
2789 Ga0466959_0050021
2790 Ga0466959_0065358
2791 Ga0451576_0033797
2792 Ga0466958_0000881
2793 Ga0466958_0020449
2794 Ga0466958_0186688
2795 Ga0495617_000107
2796 Ga0495603_0001824
2797 Ga0495603_0031354
2798 Ga0495603_0100321
2799 Ga0495603_0123732
2800 Ga0495603_0322516
2801 Ga0495590_0004681
2802 Ga0495590_0011833
2803 Ga0495590_0046439
2804 Ga0495591_142145
2805 Ga0495629_0000015
2806 Ga0495629_0006500
2807 Ga0495629_0056655
2808 Ga0495629_0333449
2809 Ga0495629_0538179
2810 Ga0495638_0003798
2811 Ga0495638_0050177
2812 Ga0495638_0147929
2813 Ga0495638_0403732
2814 Ga0495653_0000305
2815 Ga0495653_0000764
2816 Ga0495653_0082522
2817 Ga0495653_0139477
2818 Ga0495650_0000100
2819 Ga0495650_0000179
2820 Ga0495650_0001583
2821 Ga0495650_0061790
2822 Ga0495650_0070473
2823 Ga0495580_0000682
2824 Ga0495580_0003234
2825 Ga0495580_0011711
2826 Ga0495580_0132594
2827 Ga0495580_0173533
2828 Ga0495580_0236568
2829 Ga0495582_0157078
2830 Ga0495582_0282972
2831 Ga0495582_0383422
2832 Ga0495605_0000098
2833 Ga0495605_0005795
2834 Ga0495605_0008391
2835 Ga0495605_0008882
2836 Ga0495605_0303499
2837 Ga0495639_0018021
2838 Ga0495639_0035691
2839 Ga0495662_0255167
2840 Ga0495664_0055653
2841 Ga0495664_0361855
2842 Ga0495664_0666118
2843 Ga0495584_0098905
2844 Ga0495584_0333587
2845 Ga0495584_0511391
2846 Ga0495584_0543681
2847 Ga0495585_0017777
2848 Ga0495594_0188758
2849 Ga0495596_0017244
2850 Ga0495596_0032675
2851 Ga0495596_0046637
2852 Ga0495607_0005789
2853 Ga0495607_0093899
2854 Ga0495583_0030350
2855 Ga0495583_0050726
2856 Ga0495583_0124817
2857 Ga0495606_0000223
2858 Ga0495606_0001629
2859 Ga0495606_0004296
2860 Ga0495606_0049159
2861 Ga0495606_0141852
2862 Ga0495606_0259201
2863 Ga0495610_0000668
2864 Ga0495616_0010325
2865 Ga0495616_0059117
2866 Ga0495618_0102943
2867 Ga0495620_0001664
2868 Ga0495620_0009834
2869 Ga0495620_0018985
2870 Ga0495620_0088850
2871 Ga0495620_0105994
2872 Ga0495628_0006614
2873 Ga0495628_0096207
2874 Ga0495628_0167939
2875 Ga0495628_0494887
2876 Ga0495630_0048218
2877 Ga0495630_0055261
2878 Ga0495630_0082688
2879 Ga0495630_0085128
2880 Ga0495630_0297701
2881 Ga0495631_0132417
2882 Ga0495632_0012548
2883 Ga0495632_0110693
2884 Ga0495632_0384011
2885 Ga0495643_0097109
2886 Ga0495643_0149712
2887 Ga0495644_0021130
2888 Ga0495648_0046740
2889 Ga0495648_0323126
2890 Ga0495648_0514991
2891 Ga0495666_0012315
2892 Ga0495666_0021388
2893 Ga0495666_0218869
2894 Ga0495642_0002147
2895 Ga0495642_0020756
2896 Ga0495642_0082210
2897 Ga0495642_0104138
2898 Ga0495652_0012080
2899 Ga0495652_0329182
2900 Ga0495652_0399012
2901 Ga0495654_0182143
2902 Ga0495665_0023566
2903 Ga0495665_0072296
2904 Ga0495665_0366771
2905 Ga0495640_0232584
2906 Ga0495640_0484021
2907 Ga0495586_0026649
2908 Ga0495586_0159525
2909 Ga0495586_0345761
2910 Ga0495586_0402611
2911 Ga0495587_0174854
2912 Ga0495598_0168993
2913 Ga0495621_0111138
2914 Ga0495621_0451777
2915 Ga0495597_0014880
2916 Ga0495597_0133370
2917 Ga0495597_0144813
2918 Ga0495597_0362131
2919 Ga0495645_0000828
2920 Ga0495645_0071080
2921 Ga0495645_0224513
2922 Ga0495622_0127207
2923 Ga0495633_0040223
2924 Ga0495633_0268598
2925 Ga0495667_0054299
2926 Ga0495656_0150540
2927 Ga0495656_0297203
2928 Ga0495668_0000286
2929 Ga0495668_0001540
2930 Ga0495668_0218340
2931 Ga0495668_0282230
2932 Ga0495668_0408441
2933 Ga0495611_0052076
2934 Ga0495611_0053471
2935 Ga0495611_0132255
2936 Ga0495611_0345865
2937 Ga0495625_0000052
2938 Ga0495625_0016474
2939 Ga0495625_0018472
2940 Ga0495625_0095074
2941 Ga0495625_0340715
2942 Ga0495625_0371583
2943 Ga0495625_0402574
2944 Ga0495635_0003000
2945 Ga0495635_0405564
2946 Ga0495635_0767973
2947 Ga0495661_0254645
2948 Ga0495588_0033636
2949 Ga0495599_0019631
2950 Ga0495599_0082904
2951 Ga0495599_0136926
2952 Ga0495623_0011726
2953 Ga0495623_0079976
2954 Ga0495646_0004613
2955 Ga0495646_0066210
2956 Ga0495646_0172171
2957 Ga0495658_0059118
2958 Ga0495658_0135353
2959 Ga0495658_0141182
2960 Ga0495669_0028555
2961 Ga0495669_0329173
2962 Ga0495613_0015073
2963 Ga0495613_0244010
2964 Ga0495613_0283876
2965 Ga0495624_0000973
2966 Ga0495624_0001711
2967 Ga0495624_0067091
2968 Ga0495624_0371596
2969 Ga0495624_0629737
2970 Ga0495670_0000022
2971 Ga0495670_0000846
2972 Ga0495670_0039618
2973 Ga0495671_0050658
2974 Ga0495649_0034647
2975 Ga0495649_0106358
2976 Ga0495649_0373096
2977 Ga0495649_0457901
2978 Ga0495589_0004109
2979 Ga0495589_0091240
2980 Ga0495589_0094426
2981 Ga0495589_0169690
2982 Ga0495600_0085491
2983 Ga0495660_0076155
2984 Ga0495581_0003470
2985 Ga0495604_0014295
2986 Ga0495604_0019898
2987 Ga0495604_0028637
2988 Ga0495674_0000529
2989 Ga0495674_0024644
2990 Ga0495674_0120170
2991 Ga0495674_0683939
2992 Ga0495674_1433416
2993 Ga0495672_0012806
2994 Ga0495676_0043008
2995 Ga0495680_0015339
2996 Ga0495680_0145811
2997 Ga0495680_0763067
2998 Ga0495683_0001263
2999 Ga0495683_0059121
3000 Ga0495683_0165830
3001 Ga0495687_023020
3002 Ga0495687_093290
3003 Ga0495675_0042917
3004 Ga0495675_0047428
3005 Ga0495675_0055935
3006 Ga0495677_0164299
3007 Ga0495679_000045
3008 Ga0495679_060283
3009 Ga0495685_059424
3010 Ga0495673_0080335
3011 Ga0495673_0082151
3012 Ga0495673_0151112
3013 Ga0495681_0044114
3014 Ga0495681_0309890
3015 Ga0495684_0301756
3016 Ga0495684_0596202
3017 Ga0495686_0017669
3018 Ga0495686_0034356
3019 Ga0495686_0070368
3020 Ga0495686_0236455
3021 Ga0495593_0004158
3022 Ga0495593_0006841
3023 Ga0495593_0018177
3024 Ga0495593_0118478
3025 Ga0495593_0153095
3026 Ga0495602_0000451
3027 Ga0495602_0051921
3028 Ga0495602_0388114
3029 Ga0495614_0024646
3030 Ga0495626_0056877
3031 Ga0495626_0082558
3032 Ga0495626_0085873
3033 Ga0495626_0096506
3034 Ga0496100_0000149
3035 Ga0496100_0033277
3036 Ga0496100_0041046
3037 Ga0496100_0264530
3038 Ga0496100_0358057
3039 Ga0496101_0000204
3040 Ga0496101_0035408
3041 Ga0496101_0065053
3042 Ga0496101_0071732
3043 Ga0496101_0093750
3044 Ga0496101_0500979
3045 Ga0496101_0897247
3046 Ga0496102_0000298
3047 Ga0496102_0003655
3048 Ga0496102_0006544
3049 Ga0496102_0007864
3050 Ga0496102_0009745
3051 Ga0496102_0154782
3052 Ga0496102_0323893
3053 Ga0496102_0401113
3054 Ga0496102_0540259
3055 Ga0496102_1356304
3056 Ga0496103_0000253
3057 Ga0496103_0017224
3058 Ga0496103_0021495
3059 Ga0496103_0069087
3060 Ga0496104_0015320
3061 Ga0496104_0019627
3062 Ga0496104_0049079
3063 Ga0496104_0057978
3064 Ga0496104_0061505
3065 Ga0496104_0071071
3066 Ga0496104_0139105
3067 Ga0496104_0379489
3068 Ga0496104_0398067
3069 Ga0496104_0552097
3070 Ga0496105_0004996
3071 Ga0496105_0041568
3072 Ga0496105_0045123
3073 Ga0496105_0057930
3074 Ga0496105_0110101
3075 Ga0496105_0238098
3076 Ga0496106_0000032
3077 Ga0496106_0006719
3078 Ga0496106_0007795
3079 Ga0496106_0063916
3080 Ga0496106_0066374
3081 Ga0496106_0180366
3082 Ga0496106_0206439
3083 Ga0496106_1390027
3084 Ga0496107_0030005
3085 Ga0496107_0145813
3086 Ga0496107_0246379
3087 Ga0496107_0296782
3088 Ga0496107_0332851
3089 Ga0496108_0323820
3090 Ga0496108_0353499
3091 Ga0496108_0861419
3092 Ga0496108_0872131
3093 Ga0496108_1252712
3094 Ga0496109_0129267
3095 Ga0496109_0171760
3096 Ga0496109_0333029
3097 Ga0496109_0628005
3098 Ga0496109_1422020
3099 Ga0496109_1547810
3100 Ga0496110_0004145
3101 Ga0496110_0022093
3102 Ga0496110_0053482
3103 Ga0496110_0114337
3104 Ga0496110_0144298
3105 Ga0496110_1375052
3106 Ga0496110_1641845
3107 Ga0496111_0057815
3108 Ga0496111_0076658
3109 Ga0496111_0116895
3110 Ga0496111_0194734
3111 Ga0496111_0409439
3112 Ga0496111_0957551
3113 Ga0496112_0081915
3114 Ga0496112_0107336
3115 Ga0496112_0120672
3116 Ga0496112_0341432
3117 Ga0496113_0001027
3118 Ga0496113_0005040
3119 Ga0496114_0003149
3120 Ga0496114_0008418
3121 Ga0496114_0026734
3122 Ga0496114_0072860
3123 Ga0496114_0090054
3124 Ga0496114_0185758
3125 Ga0496114_0229483
3126 Ga0496114_0674838
3127 Ga0496115_0000844
3128 Ga0496115_0002412
3129 Ga0496115_0051522
3130 Ga0496115_0058192
3131 Ga0496115_0176999
3132 Ga0496115_0905442
3133 Ga0496116_0018763
3134 Ga0496116_0046983
3135 Ga0496116_0087140
3136 Ga0496116_0104014
3137 Ga0496116_0107605
3138 Ga0496117_0000171
3139 Ga0496117_0089273
3140 Ga0496117_0102805
3141 Ga0496117_0220037
3142 Ga0496117_0292987
3143 Ga0496118_0000276
3144 Ga0496118_0000354
3145 Ga0496118_0029441
3146 Ga0496118_0045259
3147 Ga0496118_0127903
3148 Ga0496119_0017495
3149 Ga0496119_0050922
3150 Ga0496120_0257633
3151 Ga0496121_0000141
3152 Ga0496121_0003156
3153 Ga0496121_0003736
3154 Ga0496121_0005380
3155 Ga0496121_0016043
3156 Ga0496121_0112777
3157 Ga0496121_0152653
3158 Ga0496122_0012850
3159 Ga0496122_0068789
3160 Ga0496123_0130883
3161 Ga0496124_0000282
3162 Ga0496124_0056706
3163 Ga0496124_0085211
3164 Ga0496124_0148795
3165 Ga0496124_0288008
3166 Ga0496125_0071926
3167 Ga0496125_0086012
3168 Ga0496125_0172295
3169 Ga0496126_0001351
3170 Ga0496126_0003785
3171 Ga0496126_0004234
3172 Ga0496126_0078962
3173 Ga0496126_0332429
3174 Ga0496126_0875021
3175 Ga0496126_1417230
3176 Ga0495678_013024
3177 Ga0495678_084829
3178 Ga0495682_0037955
3179 Ga0495682_0067637
3180 Ga0495682_0079624
3181 Ga0495682_0177830
3182 Ga0501031_0054357
3183 Ga0501031_0236266
3184 Ga0501032_0065568
3185 Ga0501032_0166614
3186 Ga0501033_0051248
3187 Ga0501033_0063844
3188 Ga0501033_0226356
3189 Ga0501033_0779283
3190 Ga0501034_0163377
3191 Ga0501034_0204748
3192 Ga0501034_0412934
3193 Ga0501034_0473025
3194 Ga0501036_0086051
3195 Ga0501037_0063212
3196 Ga0501037_0701472
3197 Ga0501038_0015812
3198 Ga0501038_0345643
3199 Ga0501039_0167357
3200 Ga0501040_0421083
3201 Ga0501040_1050476
3202 Ga0501041_0097199
3203 Ga0501043_0110685
3204 Ga0501043_0148973
3205 Ga0501043_0234142
3206 Ga0501043_0387597
3207 Ga0501043_0545554
3208 Ga0501043_0580313
3209 Ga0501046_0224994
3210 Ga0501047_0000767
3211 Ga0501047_0047995
3212 Ga0501047_0113015
3213 Ga0501047_0275039
3214 Ga0501047_0641583
3215 Ga0501048_0041574
3216 Ga0501048_0166114
3217 Ga0501068_0083238
3218 Ga0501068_0401870
3219 Ga0501069_0041447
3220 Ga0501070_0036539
3221 Ga0501070_0082455
3222 Ga0501070_0334466
3223 Ga0501070_0443715
3224 Ga0501070_0448025
3225 Ga0501070_0814577
3226 Ga0501071_0123633
3227 Ga0501071_0162122
3228 Ga0501071_0662665
3229 Ga0501072_0175138
3230 Ga0501072_0742313
3231 Ga0501073_0018731
3232 Ga0501073_0092455
3233 Ga0501073_0193696
3234 Ga0501073_0227964
3235 Ga0501073_0961909
3236 Ga0501074_0013400
3237 Ga0501074_0170120
3238 Ga0501074_0187727
3239 Ga0501076_0008169
3240 Ga0501076_0032944
3241 Ga0501077_0791896
3242 Ga0501202_010428
3243 Ga0501230_010201
3244 Ga0501240_043357
3245 Ga0501249_029960
3246 Ga0501253_110990
3247 Ga0501079_0004373
3248 Ga0501079_0086110
3249 Ga0501079_0250664
3250 Ga0501080_0005264
3251 Ga0501080_0005282
3252 Ga0501080_0204010
3253 Ga0501080_1085673
3254 Ga0501081_0202231
3255 Ga0501081_0286665
3256 Ga0501083_0015218
3257 Ga0501083_0364549
3258 Ga0501241_074598
3259 Ga0501262_000018
3260 Ga0501035_0002389
3261 Ga0501035_0007057
3262 Ga0501035_0022406
3263 Ga0501035_0043215
3264 Ga0501035_0048919
3265 Ga0501035_0066424
3266 Ga0501035_0262795
3267 Ga0501035_0304279
3268 Ga0501035_0428886
3269 Ga0501044_0008426
3270 Ga0501044_0015381
3271 Ga0501044_0030021
3272 Ga0501044_0191621
3273 Ga0501044_0272016
3274 Ga0501044_0654710
3275 Ga0501044_0828805
3276 Ga0501044_0832002
3277 Ga0501045_0053177
3278 nmdc:mga03683_177937_c1
3279 nmdc:mga03683_18418_c1
3280 nmdc:mga03683_261517_c1
3281 nmdc:mga03683_302002_c1
3282 nmdc:mga03683_30365_c1
3283 nmdc:mga03683_40018_c1
3284 nmdc:mga03n38_242378_c1
3285 nmdc:mga03n38_4824_c1
3286 nmdc:mga00v17_14257_c1
3287 nmdc:mga0yw44_1012827_c1
3288 nmdc:mga0yw44_105510_c1
3289 nmdc:mga0yw44_4066_c1
3290 nmdc:mga0yw44_49946_c1
3291 nmdc:mga0k408_151171_c1
3292 nmdc:mga0k408_17982_c1
3293 nmdc:mga0k408_26346_c1
3294 nmdc:mga0k408_4257_c1
3295 nmdc:mga0k408_534112_c1
3296 nmdc:mga0k408_773_c1
3297 nmdc:mga0k408_781_c1
3298 nmdc:mga0k408_85857_c1
3299 nmdc:mga06z11_111075_c1
3300 nmdc:mga06z11_13314_c1
3301 nmdc:mga06z11_348575_c1
3302 nmdc:mga06z11_444249_c1
3303 nmdc:mga06z11_57469_c1
3304 nmdc:mga06z11_724228_c1
3305 nmdc:mga04h51_3324_c1
3306 nmdc:mga07m45_185475_c1
3307 nmdc:mga07m45_226359_c1
3308 nmdc:mga07m45_23225_c1
3309 nmdc:mga07m45_37997_c1
3310 nmdc:mga0qj67_10909_c1
3311 nmdc:mga0qj67_81413_c1
3312 nmdc:mga08y16_1342194_c1
3313 nmdc:mga08y16_26645_c1
3314 nmdc:mga08y16_271743_c1
3315 nmdc:mga08y16_709729_c1
3316 nmdc:mga08y16_786418_c1
3317 nmdc:mga08y16_857049_c1
3318 nmdc:mga08y16_99364_c1
3319 nmdc:mga0a205_108416_c1
3320 nmdc:mga0sz30_105712_c1
3321 nmdc:mga0sz30_27582_c1
3322 Ga0500578_0000002
3323 Ga0500644_0001458
3324 Ga0500646_0005532
3325 Ga0500651_0038444
3326 Ga0500651_0077221
3327 Ga0500555_150950
3328 Ga0500591_142302
3329 Ga0500594_0001847
3330 Ga0500608_002001
3331 Ga0500628_002992
3332 Ga0500652_000076
3333 Ga0500655_003466
3334 Ga0500559_0000038
3335 Ga0500559_0405411
3336 Ga0500568_0049523
3337 Ga0500568_0107014
3338 Ga0500577_0023081
3339 Ga0500604_0001378
3340 Ga0500604_0043040
3341 Ga0500619_000367
3342 Ga0500622_0000236
3343 Ga0500622_0001043
3344 Ga0500645_002979
3345 Ga0500587_003821
3346 Ga0501084_0257970
3347 Ga0501084_0315009
3348 Ga0501082_0235260
3349 Ga0501082_0406808
3350 Ga0501082_0407180
3351 Ga0501082_0962972
3352 Ga0466962_0000671
3353 Ga0466962_0026155
3354 2501070363
3355 2501406829
3356 2510247336
3357 2511092901
3358 2511097737
3359 2511109342
3360 2512351164
3361 2513554785
3362 2513565441
3363 2514048330
3364 2515685421
3365 2516022627
3366 2548497973
3367 2563056692
3368 2587733019
3369 2587757295
3370 2600815389
3371 2643991488
3372 2644062434
3373 2644076533
3374 2644159796
3375 2644245725
3376 2644529063
3377 2644646072
3378 2713481299
3379 2719638490
3380 2721028365
3381 2816474857
3382 2819619688
3383 2821446133
3384 2839142828
3385 2842325987
3386 2842351492
3387 2842455309
3388 2856291168
3389 2857364207
3390 2883095724
3391 2885280221
3392 2894656750
3393 2902684627
3394 2921647049
3395 2928111295
3396 2928138097
3397 2928506741
3398 2945947783
3399 2945972510
3400 2990711568
3401 642620405
3402 8003961864

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

4

130

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.9459 1 133
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.939 1 133
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.9369 2 134
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.9267 1 133
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.9201 1 133
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9064 83 132 3.30.720.110
3sk1A02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8742 82 133 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8503 81 132 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8502 83 134 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8484 84 132 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A257KH99-F1-model_v4 Glyoxalase 0.9974 1 133
AF-A0A1H1H8R4-F1-model_v4 Catechol 2,3-dioxygenase 0.9908 1 133 GO:0051213
AF-A0A257KH99-F1-model_v4 Glyoxalase 0.99 1 133
AF-A0A522EC71-F1-model_v4 VOC family protein 0.9882 1 133
AF-A0A0Q8S3J9-F1-model_v4 Glyoxalase 0.9868 2 133

Map