F495293

General Info

Members Datasets Scaffolds Average Seq Length
1676 557 3352 322

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10008453|Ga0105240_100084531
Length 360
Sequence MNRLPPCPACTAPVRSGICRDGRIDRRFPSLPSESGMTARSPYDTLVTVYGGSGFLGRHLVRALAKRHYRIRVAVRRPDLAGHLQPLGRVGQIHAVQANLRNPESVEAAARGADVLINLVGILFERGRQRFDAVHTEGARNVAAAAKAHGARLVHVSAIGADENSTAVYARSKAAAERLVREVMPETMVMRPSIMFGPEDNFFNLFASLARMSPVLPLVGGGHTKFQPVFVGDVAQAIANAVDGQARAGTTYELGGPEVRTFREILEYILATIERRRLLLPMPFLVAKLQASLMQFMPTPLLTPDQVELLRTDNVVSDAAVTQGRTLQGLGIAPTPIEAIVPSYLWRFRKTGQFRAQPTA

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
9 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
10 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
11 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
16 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
17 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
20 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
21 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
22 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
23 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
62 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
63 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
64 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
65 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
73 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
79 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
80 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
81 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
94 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
95 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
96 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
102 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
103 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
104 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
105 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
111 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
112 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
113 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
116 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
121 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
122 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
123 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
124 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
125 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
126 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
127 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
130 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
131 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
132 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
133 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
134 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
136 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
137 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
140 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
141 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
144 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
147 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
148 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
149 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
150 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
151 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
152 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
153 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
154 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
155 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
156 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
157 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
158 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
159 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
160 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
161 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
162 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
163 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
164 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
165 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
167 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
168 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
169 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
171 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
174 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
242 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
243 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
244 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
251 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
255 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
256 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
257 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
258 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
259 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
260 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
261 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
262 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
263 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
264 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
265 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
266 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
267 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
268 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
269 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
270 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
271 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
272 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
273 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
274 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
275 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
276 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
277 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
278 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
279 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
280 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
281 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
282 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
283 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
284 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
285 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
286 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
287 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
288 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
289 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
290 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
291 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
292 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
293 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
294 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
295 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
296 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
297 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
298 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
299 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
300 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
301 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
302 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
303 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
304 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
305 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
306 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
307 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
308 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
309 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
310 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
311 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
312 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
313 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
314 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
315 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
316 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
317 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
318 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
319 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
320 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
321 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
322 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
323 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
324 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
325 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
326 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
327 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
328 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
329 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
330 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
331 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
332 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
333 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
334 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
335 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
336 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
337 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
338 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
339 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
340 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
341 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
342 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
343 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
344 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
345 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
346 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
347 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
348 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
349 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
350 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
351 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
352 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
353 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
354 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
355 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
356 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
357 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
358 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
359 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
360 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
361 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
362 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
363 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
364 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
365 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
366 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
367 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
368 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
369 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
370 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
371 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
372 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
373 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
374 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
375 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
376 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
377 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
378 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
379 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
380 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
381 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
382 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
383 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
384 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
385 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
386 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
387 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
388 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
389 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
390 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
391 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
392 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
393 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
394 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
395 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
396 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
397 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
398 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
399 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
400 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
401 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
402 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
403 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
404 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
405 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
406 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
407 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
408 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
409 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
410 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
411 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
412 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
413 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
414 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
415 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
416 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
417 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
418 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
419 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
420 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
421 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
422 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
423 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
424 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
425 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
426 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
427 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
428 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
429 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
430 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
431 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
432 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
433 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
434 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
435 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
436 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
437 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
438 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
439 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
448 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
449 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
451 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
452 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
453 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
454 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
455 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
456 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
457 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
458 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
459 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
460 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
461 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
462 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
463 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
464 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
465 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
466 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
469 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
470 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
471 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
472 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
473 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
474 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
475 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
476 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
477 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
478 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
479 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
480 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
481 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
482 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
483 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
484 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
485 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
486 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
487 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
488 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
489 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
490 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
491 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
492 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
493 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
494 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
495 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
496 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
497 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
498 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
499 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
500 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
501 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
502 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
503 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
504 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
505 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
506 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
507 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
508 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
509 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
510 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
511 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
512 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
513 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
514 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
515 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
516 2842694124 Methylopila sp. R-72369 Isolate Unclassified
517 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
518 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
519 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
520 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
521 2922368715
522 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
523 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
524 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
525 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
526 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
527 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
528 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
529 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
530 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
531 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
532 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
533 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
534 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
535 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
536 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
537 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
538 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
539 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
540 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
541 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
542 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
543 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
544 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
545 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
546 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
547 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
548 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
549 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
550 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
551 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
552 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
553 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
554 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
555 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
556 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
557 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.96
Metatranscriptomes 0.06
Isolates 2.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.88
Nodule 2.68
Rhizoplane 6.92
Rhizosphere 84.19
Stem 0
Stem Tuber 0
Unclassified 1.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10008453 3300009093 Bacteria 14724
2 2214544912 2209111006 Bacteria 25181
3 ARSoilYngRDRAFT_c00115 3300000042 Bacteria 13696
4 ARcpr5yngRDRAFT_c000138 3300000043 Bacteria 11523
5 ARSoilOldRDRAFT_c000022 3300000044 Bacteria 35130
6 ARCol0oldRDRAFT_c00090 3300000045 Bacteria 7653
7 ARCol0yngRDRAFT_1000298 3300000652 Bacteria 7643
8 JGI24741J21665_1002162 3300001915 Bacteria 5226
9 JGI24752J21851_1000975 3300001976 Bacteria 3903
10 JGI24746J21847_1000142 3300001977 Bacteria 8989
11 JGI24747J21853_1000031 3300001978 Bacteria 5352
12 JGI24740J21852_10017351 3300001979 Bacteria 2577
13 JGI24739J22299_10002500 3300001989 Bacteria 7099
14 JGI24737J22298_10000810 3300001990 Bacteria 11103
15 JGI24737J22298_10004702 3300001990 Bacteria 4746
16 JGI24743J22301_10002841 3300001991 Bacteria 2666
17 JGI24750J21931_1000449 3300002070 Bacteria 6594
18 JGI24750J21931_1000469 3300002070 Bacteria 6441
19 JGI24745J21846_1000493 3300002073 Bacteria 3493
20 JGI24738J21930_10000005 3300002075 Bacteria 42207
21 JGI24738J21930_10011740 3300002075 Bacteria 1922
22 JGI24749J21850_1001021 3300002076 Bacteria 3972
23 JGI24744J21845_10000321 3300002077 Bacteria 8029
24 JGI24035J26624_1000798 3300002126 Bacteria 2968
25 JGI24033J26618_1001439 3300002155 Bacteria 2359
26 JGI24742J22300_10000339 3300002244 Bacteria 6902
27 JGI24751J29686_10001874 3300002459 Bacteria 4306
28 JGI25406J46586_10004567 3300003203 Bacteria 6444
29 rootH1_10079649 3300003323 Bacteria 2374
30 Ga0065716_1001575 3300005277 Bacteria 6023
31 Ga0065712_10070481 3300005290 Bacteria 5969
32 Ga0065715_10099964 3300005293 Bacteria 3342
33 Ga0070658_10005336 3300005327 Bacteria 10435
34 Ga0070658_10084777 3300005327 Bacteria 2605
35 Ga0070658_10088275 3300005327 Bacteria 2553
36 Ga0070658_10214303 3300005327 Bacteria 1627
37 Ga0070676_10006098 3300005328 Bacteria 6436
38 Ga0070683_100000345 3300005329 Bacteria 31885
39 Ga0070683_100081994 3300005329 Bacteria 3020
40 Ga0070690_100007218 3300005330 Bacteria 6356
41 Ga0070690_100007975 3300005330 Bacteria 6078
42 Ga0070690_100020158 3300005330 Bacteria 4059
43 Ga0070690_100023517 3300005330 Bacteria 3779
44 Ga0070690_100025313 3300005330 Bacteria 3654
45 Ga0070690_100168260 3300005330 Bacteria 1507
46 Ga0070670_100000091 3300005331 Bacteria 85664
47 Ga0070670_100016360 3300005331 Bacteria 6370
48 Ga0070670_100093254 3300005331 Bacteria 2590
49 Ga0070670_100396066 3300005331 Bacteria 1218
50 Ga0070670_100445762 3300005331 Bacteria 1147
51 Ga0070677_10000732 3300005333 Bacteria 10937
52 Ga0068869_100001229 3300005334 Bacteria 15086
53 Ga0068869_100021486 3300005334 Bacteria 4440
54 Ga0068869_100231417 3300005334 Bacteria 1469
55 Ga0070666_10118435 3300005335 Bacteria 1835
56 Ga0070666_10131073 3300005335 Bacteria 1742
57 Ga0070680_100013303 3300005336 Bacteria 6408
58 Ga0070680_100023359 3300005336 Bacteria 4931
59 Ga0070680_100114813 3300005336 Bacteria 2243
60 Ga0070680_100156547 3300005336 Bacteria 1914
61 Ga0070680_100202946 3300005336 Bacteria 1672
62 Ga0070680_100212983 3300005336 Bacteria 1630
63 Ga0070680_100267695 3300005336 Bacteria 1447
64 Ga0070682_100007148 3300005337 Bacteria 6288
65 Ga0070682_100096171 3300005337 Bacteria 1946
66 Ga0068868_100000376 3300005338 Bacteria 30404
67 Ga0068868_100281968 3300005338 Bacteria 1406
68 Ga0070660_100001516 3300005339 Bacteria 15921
69 Ga0070660_100008936 3300005339 Bacteria 7026
70 Ga0070660_100084251 3300005339 Bacteria 2498
71 Ga0070689_100005739 3300005340 Bacteria 8509
72 Ga0070689_100030360 3300005340 Bacteria 4102
73 Ga0070691_10019629 3300005341 Bacteria 3120
74 Ga0070687_100001270 3300005343 Bacteria 8796
75 Ga0070692_10001450 3300005345 Bacteria 8616
76 Ga0070692_10170409 3300005345 Bacteria 1254
77 Ga0070668_100007889 3300005347 Bacteria 7903
78 Ga0070668_100134328 3300005347 Bacteria 1988
79 Ga0070668_100189587 3300005347 Bacteria 1683
80 Ga0070668_100207224 3300005347 Bacteria 1611
81 Ga0070669_100000873 3300005353 Bacteria 21980
82 Ga0070669_100011651 3300005353 Bacteria 6237
83 Ga0070669_100053555 3300005353 Bacteria 2954
84 Ga0070675_100010354 3300005354 Bacteria 7282
85 Ga0070675_100015993 3300005354 Bacteria 5945
86 Ga0070675_100033582 3300005354 Bacteria 4161
87 Ga0070675_100098146 3300005354 Bacteria 2463
88 Ga0070675_100146434 3300005354 Bacteria 2022
89 Ga0070671_100003341 3300005355 Bacteria 12514
90 Ga0070671_100045323 3300005355 Bacteria 3655
91 Ga0070671_100220132 3300005355 Bacteria 1610
92 Ga0070671_100258280 3300005355 Bacteria 1480
93 Ga0070674_100003182 3300005356 Bacteria 9151
94 Ga0070673_100010614 3300005364 Bacteria 6243
95 Ga0070673_100054055 3300005364 Bacteria 3157
96 Ga0070673_100349640 3300005364 Bacteria 1312
97 Ga0070688_100006558 3300005365 Bacteria 6228
98 Ga0070688_100017446 3300005365 Bacteria 4120
99 Ga0070688_100030065 3300005365 Bacteria 3257
100 Ga0070688_100043804 3300005365 Bacteria 2759
101 Ga0070659_100006313 3300005366 Bacteria 8562
102 Ga0070659_100032632 3300005366 Bacteria 4040
103 Ga0070659_100156297 3300005366 Bacteria 1862
104 Ga0070667_100011850 3300005367 Bacteria 7210
105 Ga0070667_100055986 3300005367 Bacteria 3330
106 Ga0070703_10032289 3300005406 Bacteria 1589
107 Ga0070703_10064961 3300005406 Bacteria 1203
108 Ga0070709_10002356 3300005434 Bacteria 10237
109 Ga0070709_10003391 3300005434 Bacteria 8559
110 Ga0070709_10028772 3300005434 Bacteria 3317
111 Ga0070709_10122286 3300005434 Bacteria 1766
112 Ga0070714_100000516 3300005435 Bacteria 28020
113 Ga0070714_100009307 3300005435 Bacteria 7718
114 Ga0070714_100032390 3300005435 Bacteria 4362
115 Ga0070714_100058999 3300005435 Bacteria 3289
116 Ga0070714_100252319 3300005435 Bacteria 1632
117 Ga0070714_100287574 3300005435 Bacteria 1529
118 Ga0070713_100000228 3300005436 Bacteria 37335
119 Ga0070713_100004346 3300005436 Bacteria 9507
120 Ga0070713_100025482 3300005436 Bacteria 4624
121 Ga0070713_100104233 3300005436 Bacteria 2462
122 Ga0070710_10000438 3300005437 Bacteria 19522
123 Ga0070710_10003280 3300005437 Bacteria 7674
124 Ga0070710_10080200 3300005437 Bacteria 1903
125 Ga0070701_10003647 3300005438 Bacteria 6128
126 Ga0070711_100000998 3300005439 Bacteria 15007
127 Ga0070711_100060588 3300005439 Bacteria 2631
128 Ga0070711_100153171 3300005439 Bacteria 1740
129 Ga0070711_100168127 3300005439 Bacteria 1669
130 Ga0070711_100187110 3300005439 Bacteria 1589
131 Ga0070711_100317504 3300005439 Bacteria 1244
132 Ga0070705_100009011 3300005440 Bacteria 4952
133 Ga0070705_100049550 3300005440 Bacteria 2439
134 Ga0070705_100094544 3300005440 Bacteria 1871
135 Ga0070705_100297650 3300005440 Unclassified 1155
136 Ga0070700_100015500 3300005441 Bacteria 4323
137 Ga0070700_100017964 3300005441 Bacteria 4057
138 Ga0070700_100080731 3300005441 Bacteria 2099
139 Ga0070694_100000312 3300005444 Bacteria 26105
140 Ga0070694_100008055 3300005444 Bacteria 6436
141 Ga0070708_100072490 3300005445 Bacteria 3103
142 Ga0070663_100008241 3300005455 Bacteria 6401
143 Ga0070663_100043993 3300005455 Bacteria 3145
144 Ga0070663_100092601 3300005455 Bacteria 2241
145 Ga0070678_100001343 3300005456 Bacteria 13090
146 Ga0070678_100036419 3300005456 Bacteria 3444
147 Ga0070678_100047901 3300005456 Bacteria 3074
148 Ga0070678_100077082 3300005456 Bacteria 2513
149 Ga0070662_100007995 3300005457 Bacteria 6881
150 Ga0070662_100025872 3300005457 Bacteria 4057
151 Ga0070662_100091445 3300005457 Bacteria 2285
152 Ga0070681_10005438 3300005458 Bacteria 12303
153 Ga0070681_10012552 3300005458 Bacteria 8408
154 Ga0070681_10023289 3300005458 Bacteria 6228
155 Ga0070681_10132045 3300005458 Bacteria 2429
156 Ga0070681_10133037 3300005458 Bacteria 2419
157 Ga0070681_10259780 3300005458 Bacteria 1649
158 Ga0068867_100022236 3300005459 Bacteria 4532
159 Ga0068867_100371518 3300005459 Bacteria 1199
160 Ga0070685_10000596 3300005466 Bacteria 19988
161 Ga0070685_10024426 3300005466 Bacteria 3319
162 Ga0070707_100213347 3300005468 Bacteria 1881
163 Ga0070699_100490949 3300005518 Unclassified 1115
164 Ga0070679_100005039 3300005530 Bacteria 12191
165 Ga0070679_100020021 3300005530 Bacteria 6519
166 Ga0070679_100066434 3300005530 Bacteria 3595
167 Ga0070679_100177525 3300005530 Bacteria 2103
168 Ga0070679_100206546 3300005530 Bacteria 1928
169 Ga0070679_100298213 3300005530 Bacteria 1563
170 Ga0070684_100001973 3300005535 Bacteria 15079
171 Ga0070684_100039621 3300005535 Bacteria 4054
172 Ga0068853_100007072 3300005539 Bacteria 8975
173 Ga0068853_100031218 3300005539 Bacteria 4505
174 Ga0068853_100034006 3300005539 Bacteria 4325
175 Ga0070672_100005148 3300005543 Bacteria 8635
176 Ga0070672_100030325 3300005543 Bacteria 4062
177 Ga0070672_100031508 3300005543 Bacteria 3991
178 Ga0070672_100208814 3300005543 Unclassified 1635
179 Ga0070686_100006737 3300005544 Bacteria 6394
180 Ga0070686_100015768 3300005544 Bacteria 4385
181 Ga0070686_100050993 3300005544 Bacteria 2632
182 Ga0070686_100057244 3300005544 Bacteria 2504
183 Ga0070686_100262914 3300005544 Bacteria 1265
184 Ga0070695_100008048 3300005545 Bacteria 6249
185 Ga0070695_100020280 3300005545 Bacteria 4057
186 Ga0070696_100016735 3300005546 Bacteria 4945
187 Ga0070696_100068309 3300005546 Bacteria 2495
188 Ga0070693_100003223 3300005547 Bacteria 7572
189 Ga0070693_100015829 3300005547 Bacteria 3892
190 Ga0070693_100156777 3300005547 Bacteria 1446
191 Ga0070665_100007650 3300005548 Bacteria 10984
192 Ga0070665_100120660 3300005548 Bacteria 2623
193 Ga0070665_100166427 3300005548 Bacteria 2207
194 Ga0070665_100370760 3300005548 Bacteria 1438
195 Ga0070665_100494379 3300005548 Bacteria 1234
196 Ga0070704_100001543 3300005549 Bacteria 12427
197 Ga0070704_100005924 3300005549 Bacteria 7162
198 Ga0070704_100023069 3300005549 Bacteria 4057
199 Ga0070704_100419974 3300005549 Bacteria 1145
200 Ga0068855_100032524 3300005563 Bacteria 6227
201 Ga0068855_100066754 3300005563 Bacteria 4194
202 Ga0068855_100118675 3300005563 Bacteria 3029
203 Ga0068855_100121490 3300005563 Bacteria 2989
204 Ga0068855_100123908 3300005563 Bacteria 2956
205 Ga0068855_100146497 3300005563 Bacteria 2687
206 Ga0068855_100311759 3300005563 Bacteria 1740
207 Ga0070664_100014789 3300005564 Bacteria 6372
208 Ga0070664_100054900 3300005564 Bacteria 3381
209 Ga0070664_100217341 3300005564 Bacteria 1709
210 Ga0070664_100480036 3300005564 Bacteria 1144
211 Ga0068857_100013315 3300005577 Bacteria 7162
212 Ga0068857_100180762 3300005577 Bacteria 1920
213 Ga0068857_100215951 3300005577 Bacteria 1751
214 Ga0068854_100001754 3300005578 Bacteria 13210
215 Ga0068854_100016161 3300005578 Bacteria 4967
216 Ga0068854_100096809 3300005578 Bacteria 2205
217 Ga0068856_100021987 3300005614 Bacteria 6201
218 Ga0068856_100032409 3300005614 Bacteria 5115
219 Ga0068856_100117928 3300005614 Bacteria 2655
220 Ga0070702_100000021 3300005615 Bacteria 44632
221 Ga0070702_100010590 3300005615 Bacteria 4549
222 Ga0068852_100013544 3300005616 Bacteria 6243
223 Ga0068852_100024110 3300005616 Bacteria 4912
224 Ga0068852_100028980 3300005616 Bacteria 4540
225 Ga0068852_100139038 3300005616 Bacteria 2246
226 Ga0068859_100053512 3300005617 Bacteria 4060
227 Ga0068859_100461155 3300005617 Unclassified 1367
228 Ga0068864_100001093 3300005618 Bacteria 22722
229 Ga0068864_100029107 3300005618 Bacteria 4674
230 Ga0068864_100046960 3300005618 Bacteria 3707
231 Ga0068864_100310437 3300005618 Bacteria 1478
232 Ga0068866_10002066 3300005718 Bacteria 8348
233 Ga0068866_10033138 3300005718 Bacteria 2503
234 Ga0068866_10102328 3300005718 Bacteria 1582
235 Ga0068866_10157407 3300005718 Bacteria 1321
236 Ga0068861_100007979 3300005719 Bacteria 7287
237 Ga0068861_100033843 3300005719 Bacteria 3773
238 Ga0068861_100148568 3300005719 Bacteria 1920
239 Ga0068851_10049927 3300005834 Bacteria 2124
240 Ga0068851_10165064 3300005834 Bacteria 1219
241 Ga0068870_10000128 3300005840 Bacteria 26100
242 Ga0068870_10066126 3300005840 Bacteria 1958
243 Ga0068863_100020069 3300005841 Bacteria 6393
244 Ga0068863_100022637 3300005841 Bacteria 6001
245 Ga0068863_100127966 3300005841 Bacteria 2424
246 Ga0068858_100019007 3300005842 Bacteria 6429
247 Ga0068858_100019312 3300005842 Bacteria 6372
248 Ga0068858_100132866 3300005842 Bacteria 2334
249 Ga0068858_100235693 3300005842 Bacteria 1735
250 Ga0068858_100381333 3300005842 Unclassified 1353
251 Ga0068860_100037706 3300005843 Bacteria 4626
252 Ga0068860_100040135 3300005843 Bacteria 4475
253 Ga0068860_100048205 3300005843 Bacteria 4060
254 Ga0068860_100307691 3300005843 Bacteria 1553
255 Ga0068862_100005880 3300005844 Bacteria 10218
256 Ga0068862_100038468 3300005844 Bacteria 4057
257 Ga0068862_100165979 3300005844 Bacteria 1974
258 Ga0068862_100219794 3300005844 Bacteria 1719
259 Ga0081455_10000002 3300005937 Bacteria 460472
260 Ga0081455_10001227 3300005937 Bacteria 32059
261 Ga0081455_10013377 3300005937 Bacteria 8115
262 Ga0081455_10035412 3300005937 Bacteria 4461
263 Ga0081455_10212057 3300005937 Bacteria 1442
264 Ga0081538_10002294 3300005981 Bacteria 18899
265 Ga0081538_10102419 3300005981 Bacteria 1436
266 Ga0081540_1000569 3300005983 Bacteria 35803
267 Ga0081540_1002980 3300005983 Bacteria 13569
268 Ga0081540_1008410 3300005983 Bacteria 7214
269 Ga0081540_1013731 3300005983 Bacteria 5249
270 Ga0081539_10004324 3300005985 Bacteria 15850
271 Ga0081539_10011185 3300005985 Bacteria 7145
272 Ga0070717_10001441 3300006028 Bacteria 16389
273 Ga0070717_10001451 3300006028 Bacteria 16359
274 Ga0070717_10136392 3300006028 Bacteria 2114
275 Ga0070717_10178142 3300006028 Bacteria 1852
276 Ga0070717_10290952 3300006028 Bacteria 1450
277 Ga0075365_10098960 3300006038 Bacteria 1995
278 Ga0075368_10003235 3300006042 Bacteria 5423
279 Ga0075363_100002280 3300006048 Bacteria 7777
280 Ga0075363_100002849 3300006048 Bacteria 7198
281 Ga0075363_100058149 3300006048 Bacteria 2076
282 Ga0075364_10005121 3300006051 Bacteria 7597
283 Ga0070715_10006066 3300006163 Bacteria 4080
284 Ga0070715_10037893 3300006163 Bacteria 1998
285 Ga0070715_10059215 3300006163 Bacteria 1674
286 Ga0070715_10153182 3300006163 Bacteria 1132
287 Ga0070716_100002431 3300006173 Bacteria 8578
288 Ga0070716_100012858 3300006173 Bacteria 4254
289 Ga0070712_100004538 3300006175 Bacteria 8570
290 Ga0070712_100022226 3300006175 Bacteria 4175
291 Ga0070712_100033200 3300006175 Bacteria 3490
292 Ga0070712_100329075 3300006175 Bacteria 1244
293 Ga0075362_10002098 3300006177 Bacteria 6585
294 Ga0075367_10004832 3300006178 Bacteria 6640
295 Ga0075367_10030132 3300006178 Bacteria 3108
296 Ga0075367_10042737 3300006178 Bacteria 2653
297 Ga0075367_10111494 3300006178 Bacteria 1679
298 Ga0075367_10132308 3300006178 Bacteria 1542
299 Ga0075367_10145667 3300006178 Bacteria 1469
300 Ga0075369_10003186 3300006186 Bacteria 5951
301 Ga0075427_10003543 3300006194 Bacteria 2161
302 Ga0075366_10002193 3300006195 Bacteria 9968
303 Ga0075366_10056751 3300006195 Bacteria 2326
304 Ga0075366_10110273 3300006195 Bacteria 1655
305 Ga0097621_100000012 3300006237 Bacteria 105108
306 Ga0097621_100077690 3300006237 Bacteria 2756
307 Ga0068871_100000138 3300006358 Bacteria 46912
308 Ga0068871_100003229 3300006358 Bacteria 11175
309 Ga0068871_100066657 3300006358 Bacteria 2952
310 Ga0068871_100129205 3300006358 Bacteria 2141
311 Ga0075428_100003156 3300006844 Bacteria 17997
312 Ga0075428_100035411 3300006844 Bacteria 5503
313 Ga0075428_100186443 3300006844 Bacteria 2245
314 Ga0075430_100000683 3300006846 Bacteria 25908
315 Ga0075430_100043547 3300006846 Bacteria 3794
316 Ga0075431_100003071 3300006847 Bacteria 16171
317 Ga0075431_100056737 3300006847 Bacteria 4039
318 Ga0075431_100079468 3300006847 Bacteria 3385
319 Ga0075431_100481578 3300006847 Bacteria 1234
320 Ga0075433_10000266 3300006852 Bacteria 30624
321 Ga0075433_10096046 3300006852 Bacteria 2623
322 Ga0075433_10109512 3300006852 Bacteria 2450
323 Ga0075433_10113418 3300006852 Bacteria 2404
324 Ga0075433_10189584 3300006852 Bacteria 1829
325 Ga0075433_10248137 3300006852 Bacteria 1580
326 Ga0075433_10258130 3300006852 Bacteria 1545
327 Ga0075434_100000350 3300006871 Bacteria 33385
328 Ga0075434_100004062 3300006871 Bacteria 13123
329 Ga0075434_100025533 3300006871 Bacteria 5780
330 Ga0075434_100164662 3300006871 Bacteria 2237
331 Ga0075434_100233376 3300006871 Bacteria 1859
332 Ga0075434_100325004 3300006871 Bacteria 1559
333 Ga0075429_100002242 3300006880 Bacteria 16171
334 Ga0068865_100002683 3300006881 Bacteria 10556
335 Ga0068865_100004534 3300006881 Bacteria 8383
336 Ga0075436_100001243 3300006914 Bacteria 17319
337 Ga0075436_100047350 3300006914 Bacteria 2966
338 Ga0075436_100051287 3300006914 Bacteria 2847
339 Ga0097620_100053514 3300006931 Bacteria 4060
340 Ga0097620_100461142 3300006931 Unclassified 1367
341 Ga0099825_1026215 3300006941 Bacteria 3135
342 Ga0099823_1073227 3300006944 Bacteria 1473
343 Ga0075435_100000890 3300007076 Bacteria 18780
344 Ga0075435_100159469 3300007076 Bacteria 1899
345 Ga0075435_100166878 3300007076 Bacteria 1856
346 Ga0099794_10032701 3300007265 Bacteria 2443
347 Ga0099794_10102797 3300007265 Bacteria 1427
348 Ga0105251_10020694 3300009011 Bacteria 3451
349 Ga0105240_10000024 3300009093 Bacteria 375919
350 Ga0105240_10046080 3300009093 Bacteria 5527
351 Ga0105240_10062192 3300009093 Bacteria 4649
352 Ga0105240_10253927 3300009093 Bacteria 2032
353 Ga0105240_10399259 3300009093 Bacteria 1549
354 Ga0111539_10000789 3300009094 Bacteria 41240
355 Ga0111539_10010846 3300009094 Bacteria 11469
356 Ga0111539_10024989 3300009094 Bacteria 7320
357 Ga0111539_10068891 3300009094 Bacteria 4177
358 Ga0111539_10090299 3300009094 Bacteria 3600
359 Ga0111539_10096871 3300009094 Bacteria 3465
360 Ga0111539_10104175 3300009094 Bacteria 3329
361 Ga0111539_10249156 3300009094 Bacteria 2068
362 Ga0111539_10334326 3300009094 Bacteria 1763
363 Ga0105245_10000925 3300009098 Bacteria 26651
364 Ga0105245_10002861 3300009098 Bacteria 15501
365 Ga0105245_10073287 3300009098 Bacteria 3113
366 Ga0105245_10086442 3300009098 Bacteria 2876
367 Ga0105245_10663491 3300009098 Bacteria 1074
368 Ga0105247_10010607 3300009101 Bacteria 5565
369 Ga0105247_10057428 3300009101 Bacteria 2406
370 Ga0105247_10339363 3300009101 Unclassified 1053
371 Ga0114129_10000759 3300009147 Bacteria 41109
372 Ga0114129_10000935 3300009147 Bacteria 38153
373 Ga0114129_10002014 3300009147 Bacteria 27856
374 Ga0114129_10038647 3300009147 Bacteria 6730
375 Ga0114129_10062023 3300009147 Bacteria 5223
376 Ga0114129_10119138 3300009147 Bacteria 3636
377 Ga0114129_10175301 3300009147 Bacteria 2920
378 Ga0114129_10196919 3300009147 Bacteria 2731
379 Ga0105243_10012646 3300009148 Bacteria 6375
380 Ga0105243_10021908 3300009148 Bacteria 4853
381 Ga0105243_10103353 3300009148 Bacteria 2369
382 Ga0105243_10210515 3300009148 Bacteria 1712
383 Ga0105243_10520996 3300009148 Unclassified 1131
384 Ga0105241_10004258 3300009174 Bacteria 10578
385 Ga0105241_10074146 3300009174 Bacteria 2650
386 Ga0105241_10089569 3300009174 Bacteria 2424
387 Ga0105242_10005000 3300009176 Bacteria 10253
388 Ga0105242_10028441 3300009176 Bacteria 4451
389 Ga0105242_10158100 3300009176 Bacteria 1981
390 Ga0105242_10392195 3300009176 Bacteria 1293
391 Ga0105242_10435330 3300009176 Bacteria 1232
392 Ga0105248_10006082 3300009177 Bacteria 13247
393 Ga0105248_10027254 3300009177 Bacteria 6358
394 Ga0105248_10107219 3300009177 Bacteria 3150
395 Ga0105248_10283913 3300009177 Bacteria 1864
396 Ga0105248_10317029 3300009177 Bacteria 1756
397 Ga0105237_10002267 3300009545 Bacteria 23930
398 Ga0105237_10070436 3300009545 Bacteria 3493
399 Ga0105237_10177567 3300009545 Bacteria 2130
400 Ga0105238_10022578 3300009551 Bacteria 6412
401 Ga0105238_10025325 3300009551 Bacteria 6048
402 Ga0105238_10029376 3300009551 Bacteria 5600
403 Ga0105238_10050832 3300009551 Bacteria 4172
404 Ga0105249_10004141 3300009553 Bacteria 12523
405 Ga0105249_10018008 3300009553 Bacteria 6278
406 Ga0105249_10018236 3300009553 Bacteria 6238
407 Ga0105249_10235076 3300009553 Bacteria 1809
408 Ga0105249_10359822 3300009553 Bacteria 1476
409 Ga0105249_10416972 3300009553 Bacteria 1376
410 Ga0105249_10637745 3300009553 Bacteria 1122
411 Ga0105239_10001386 3300010375 Bacteria 32493
412 Ga0105239_10058278 3300010375 Bacteria 4238
413 Ga0105239_10115135 3300010375 Bacteria 2983
414 Ga0105239_10315836 3300010375 Bacteria 1761
415 Ga0105239_10437408 3300010375 Bacteria 1483
416 Ga0105239_10504393 3300010375 Bacteria 1376
417 Ga0105246_10008127 3300011119 Bacteria 6441
418 Ga0105246_10106667 3300011119 Bacteria 2050
419 Ga0105246_10219980 3300011119 Bacteria 1488
420 Ga0157336_1000695 3300012477 Unclassified 1578
421 Ga0157342_1003003 3300012507 Bacteria 1418
422 Ga0157338_1000839 3300012515 Bacteria 2004
423 Ga0157338_1001291 3300012515 Bacteria 1758
424 Ga0157373_10022700 3300013100 Bacteria 4551
425 Ga0157373_10028826 3300013100 Bacteria 4003
426 Ga0157373_10075079 3300013100 Unclassified 2385
427 Ga0157371_10008660 3300013102 Bacteria 8082
428 Ga0157371_10238067 3300013102 Bacteria 1309
429 Ga0157370_10000180 3300013104 Bacteria 79428
430 Ga0157370_10015656 3300013104 Bacteria 7703
431 Ga0157370_10093961 3300013104 Bacteria 2814
432 Ga0157369_10017624 3300013105 Bacteria 8028
433 Ga0157374_10001601 3300013296 Bacteria 18992
434 Ga0157374_10013850 3300013296 Bacteria 7046
435 Ga0157378_10002020 3300013297 Bacteria 18147
436 Ga0157378_10045512 3300013297 Bacteria 3899
437 Ga0157378_10076853 3300013297 Bacteria 3009
438 Ga0157378_10410686 3300013297 Bacteria 1336
439 Ga0163162_10020934 3300013306 Bacteria 6433
440 Ga0163162_10021331 3300013306 Bacteria 6378
441 Ga0163162_10134579 3300013306 Bacteria 2582
442 Ga0163162_10351522 3300013306 Bacteria 1607
443 Ga0157372_10111034 3300013307 Bacteria 3141
444 Ga0157372_10141931 3300013307 Bacteria 2768
445 Ga0157372_10506593 3300013307 Bacteria 1407
446 Ga0157375_10001500 3300013308 Bacteria 20055
447 Ga0157375_10096785 3300013308 Bacteria 3025
448 Ga0157375_10210424 3300013308 Bacteria 2102
449 Ga0157375_10748079 3300013308 Bacteria 1129
450 Ga0163163_10019456 3300014325 Bacteria 6377
451 Ga0163163_10019635 3300014325 Bacteria 6348
452 Ga0163163_10134358 3300014325 Bacteria 2514
453 Ga0163163_10202048 3300014325 Bacteria 2036
454 Ga0157380_10006688 3300014326 Bacteria 8141
455 Ga0157380_10058984 3300014326 Bacteria 3061
456 Ga0157380_10116274 3300014326 Bacteria 2257
457 Ga0157377_10001219 3300014745 Bacteria 10969
458 Ga0157377_10004034 3300014745 Bacteria 6701
459 Ga0157379_10046013 3300014968 Bacteria 3895
460 Ga0157379_10058507 3300014968 Bacteria 3446
461 Ga0157379_10082837 3300014968 Bacteria 2875
462 Ga0157376_10001430 3300014969 Bacteria 15703
463 Ga0157376_10136269 3300014969 Bacteria 2197
464 Ga0163161_10001393 3300017792 Bacteria 17843
465 Ga0163161_10041464 3300017792 Bacteria 3307
466 Ga0163161_10112486 3300017792 Bacteria 2037
467 Ga0206354_11266181 3300020081 Bacteria 1247
468 Ga0213876_10004936 3300021384 Bacteria 7383
469 Ga0213875_10000031 3300021388 Bacteria 176367
470 Ga0228598_1000332 3300024227 Bacteria 9268
471 Ga0209677_100837 3300025253 Bacteria 15253
472 Ga0209233_1003871 3300025261 Bacteria 5205
473 Ga0209233_1013175 3300025261 Bacteria 2367
474 Ga0207666_1000163 3300025271 Bacteria 10415
475 Ga0209455_1015801 3300025272 Bacteria 1643
476 Ga0209758_1000634 3300025297 Bacteria 53757
477 Ga0209758_1004442 3300025297 Bacteria 11664
478 Ga0209758_1029772 3300025297 Bacteria 2274
479 Ga0207697_10005022 3300025315 Bacteria 6209
480 Ga0207697_10018719 3300025315 Bacteria 2838
481 Ga0207653_10078965 3300025885 Unclassified 1136
482 Ga0207682_10000064 3300025893 Bacteria 46752
483 Ga0207692_10001996 3300025898 Bacteria 7795
484 Ga0207692_10002828 3300025898 Bacteria 6702
485 Ga0207692_10093833 3300025898 Bacteria 1633
486 Ga0207642_10064958 3300025899 Bacteria 1713
487 Ga0207642_10081206 3300025899 Bacteria 1575
488 Ga0207642_10115202 3300025899 Bacteria 1376
489 Ga0207642_10136785 3300025899 Bacteria 1286
490 Ga0207710_10005111 3300025900 Bacteria 5677
491 Ga0207688_10000659 3300025901 Bacteria 17029
492 Ga0207688_10006579 3300025901 Bacteria 6321
493 Ga0207680_10111632 3300025903 Bacteria 1774
494 Ga0207647_10008358 3300025904 Bacteria 7424
495 Ga0207647_10018502 3300025904 Bacteria 4708
496 Ga0207647_10032237 3300025904 Bacteria 3369
497 Ga0207685_10005621 3300025905 Bacteria 3332
498 Ga0207685_10107120 3300025905 Bacteria 1205
499 Ga0207699_10010235 3300025906 Bacteria 4698
500 Ga0207699_10011012 3300025906 Bacteria 4557
501 Ga0207699_10025399 3300025906 Bacteria 3252
502 Ga0207699_10164655 3300025906 Bacteria 1479
503 Ga0207699_10197781 3300025906 Bacteria 1360
504 Ga0207645_10000040 3300025907 Bacteria 87876
505 Ga0207645_10006029 3300025907 Bacteria 8714
506 Ga0207645_10048545 3300025907 Bacteria 2711
507 Ga0207643_10000072 3300025908 Bacteria 65857
508 Ga0207705_10056668 3300025909 Bacteria 2826
509 Ga0207705_10064919 3300025909 Bacteria 2638
510 Ga0207684_10018395 3300025910 Bacteria 5982
511 Ga0207654_10100886 3300025911 Bacteria 1778
512 Ga0207654_10120835 3300025911 Bacteria 1644
513 Ga0207707_10013269 3300025912 Bacteria 7179
514 Ga0207707_10017843 3300025912 Bacteria 6190
515 Ga0207707_10029037 3300025912 Bacteria 4833
516 Ga0207707_10461227 3300025912 Bacteria 1086
517 Ga0207695_10000036 3300025913 Bacteria 477897
518 Ga0207695_10020001 3300025913 Bacteria 7683
519 Ga0207695_10078328 3300025913 Bacteria 3354
520 Ga0207695_10133015 3300025913 Bacteria 2443
521 Ga0207695_10430576 3300025913 Bacteria 1203
522 Ga0207671_10000191 3300025914 Bacteria 95004
523 Ga0207671_10005373 3300025914 Bacteria 11835
524 Ga0207693_10003700 3300025915 Bacteria 13032
525 Ga0207693_10005910 3300025915 Bacteria 10150
526 Ga0207693_10009265 3300025915 Bacteria 8037
527 Ga0207693_10009447 3300025915 Bacteria 7947
528 Ga0207693_10010740 3300025915 Bacteria 7434
529 Ga0207693_10035352 3300025915 Bacteria 3939
530 Ga0207693_10083946 3300025915 Bacteria 2496
531 Ga0207693_10095942 3300025915 Bacteria 2325
532 Ga0207693_10169440 3300025915 Bacteria 1720
533 Ga0207693_10193953 3300025915 Bacteria 1598
534 Ga0207663_10029576 3300025916 Bacteria 3220
535 Ga0207663_10121899 3300025916 Bacteria 1787
536 Ga0207663_10142145 3300025916 Bacteria 1673
537 Ga0207660_10000501 3300025917 Bacteria 26097
538 Ga0207660_10050112 3300025917 Bacteria 2964
539 Ga0207660_10241393 3300025917 Bacteria 1423
540 Ga0207660_10309826 3300025917 Bacteria 1259
541 Ga0207662_10002825 3300025918 Bacteria 8777
542 Ga0207662_10006747 3300025918 Bacteria 6209
543 Ga0207662_10006755 3300025918 Bacteria 6205
544 Ga0207662_10053843 3300025918 Bacteria 2398
545 Ga0207657_10020092 3300025919 Bacteria 6323
546 Ga0207657_10020692 3300025919 Bacteria 6211
547 Ga0207657_10021548 3300025919 Bacteria 6060
548 Ga0207657_10031123 3300025919 Bacteria 4837
549 Ga0207657_10065767 3300025919 Bacteria 3089
550 Ga0207649_10003387 3300025920 Bacteria 8721
551 Ga0207649_10025473 3300025920 Bacteria 3449
552 Ga0207649_10204018 3300025920 Bacteria 1398
553 Ga0207652_10018767 3300025921 Bacteria 5676
554 Ga0207652_10060283 3300025921 Bacteria 3274
555 Ga0207652_10184023 3300025921 Bacteria 1878
556 Ga0207646_10139946 3300025922 Bacteria 2179
557 Ga0207681_10000539 3300025923 Bacteria 26052
558 Ga0207681_10097483 3300025923 Bacteria 2113
559 Ga0207694_10029108 3300025924 Bacteria 4213
560 Ga0207694_10133104 3300025924 Bacteria 1994
561 Ga0207650_10000415 3300025925 Bacteria 37969
562 Ga0207650_10001724 3300025925 Bacteria 15545
563 Ga0207650_10030779 3300025925 Bacteria 3870
564 Ga0207650_10038239 3300025925 Bacteria 3503
565 Ga0207650_10280441 3300025925 Unclassified 1357
566 Ga0207659_10000444 3300025926 Bacteria 24819
567 Ga0207659_10042773 3300025926 Bacteria 3178
568 Ga0207659_10095486 3300025926 Bacteria 2230
569 Ga0207659_10134336 3300025926 Bacteria 1914
570 Ga0207659_10178803 3300025926 Bacteria 1679
571 Ga0207687_10000144 3300025927 Bacteria 47356
572 Ga0207687_10013684 3300025927 Bacteria 5297
573 Ga0207687_10480554 3300025927 Bacteria 1034
574 Ga0207700_10000458 3300025928 Bacteria 23936
575 Ga0207700_10015033 3300025928 Bacteria 5091
576 Ga0207700_10052748 3300025928 Bacteria 3042
577 Ga0207700_10094978 3300025928 Bacteria 2364
578 Ga0207700_10144937 3300025928 Bacteria 1956
579 Ga0207664_10000692 3300025929 Bacteria 23079
580 Ga0207664_10002435 3300025929 Bacteria 12311
581 Ga0207664_10081446 3300025929 Bacteria 2634
582 Ga0207664_10090775 3300025929 Bacteria 2504
583 Ga0207664_10331276 3300025929 Bacteria 1345
584 Ga0207644_10001694 3300025931 Bacteria 14217
585 Ga0207644_10007950 3300025931 Bacteria 6936
586 Ga0207690_10000086 3300025932 Bacteria 77995
587 Ga0207690_10072373 3300025932 Bacteria 2380
588 Ga0207690_10310675 3300025932 Bacteria 1236
589 Ga0207706_10001993 3300025933 Bacteria 19993
590 Ga0207706_10003068 3300025933 Bacteria 16076
591 Ga0207706_10003497 3300025933 Bacteria 15003
592 Ga0207706_10019399 3300025933 Bacteria 6118
593 Ga0207706_10085984 3300025933 Bacteria 2764
594 Ga0207706_10109552 3300025933 Bacteria 2430
595 Ga0207706_10120845 3300025933 Bacteria 2303
596 Ga0207686_10000973 3300025934 Bacteria 17046
597 Ga0207686_10149733 3300025934 Bacteria 1623
598 Ga0207709_10000431 3300025935 Bacteria 40052
599 Ga0207709_10120544 3300025935 Bacteria 1770
600 Ga0207670_10001153 3300025936 Bacteria 13914
601 Ga0207670_10001643 3300025936 Bacteria 11672
602 Ga0207670_10003991 3300025936 Bacteria 7879
603 Ga0207670_10022367 3300025936 Bacteria 3917
604 Ga0207669_10000228 3300025937 Bacteria 25653
605 Ga0207669_10003549 3300025937 Bacteria 6756
606 Ga0207669_10067393 3300025937 Bacteria 2230
607 Ga0207669_10131214 3300025937 Bacteria 1722
608 Ga0207704_10000107 3300025938 Bacteria 45669
609 Ga0207704_10349102 3300025938 Unclassified 1151
610 Ga0207665_10005548 3300025939 Bacteria 8416
611 Ga0207665_10007482 3300025939 Bacteria 7217
612 Ga0207691_10001173 3300025940 Bacteria 26058
613 Ga0207691_10002332 3300025940 Bacteria 18584
614 Ga0207691_10102780 3300025940 Bacteria 2549
615 Ga0207691_10462469 3300025940 Bacteria 1079
616 Ga0207711_10001611 3300025941 Bacteria 20827
617 Ga0207711_10037079 3300025941 Bacteria 4139
618 Ga0207711_10071891 3300025941 Bacteria 3003
619 Ga0207689_10000115 3300025942 Bacteria 66254
620 Ga0207689_10019975 3300025942 Bacteria 5641
621 Ga0207689_10058235 3300025942 Bacteria 3178
622 Ga0207689_10079235 3300025942 Bacteria 2700
623 Ga0207689_10336150 3300025942 Bacteria 1254
624 Ga0207661_10000427 3300025944 Bacteria 27219
625 Ga0207661_10143082 3300025944 Bacteria 2060
626 Ga0207661_10152722 3300025944 Bacteria 1997
627 Ga0207679_10000025 3300025945 Bacteria 203699
628 Ga0207679_10009981 3300025945 Bacteria 6100
629 Ga0207679_10102337 3300025945 Bacteria 2243
630 Ga0207679_10190077 3300025945 Bacteria 1706
631 Ga0207679_10417118 3300025945 Bacteria 1184
632 Ga0207667_10018931 3300025949 Bacteria 7702
633 Ga0207667_10068500 3300025949 Bacteria 3695
634 Ga0207667_10182532 3300025949 Bacteria 2154
635 Ga0207651_10000081 3300025960 Bacteria 42817
636 Ga0207651_10017679 3300025960 Bacteria 4219
637 Ga0207651_10378181 3300025960 Bacteria 1199
638 Ga0207651_10398565 3300025960 Bacteria 1170
639 Ga0207712_10001191 3300025961 Bacteria 17983
640 Ga0207712_10010168 3300025961 Bacteria 5966
641 Ga0207668_10000171 3300025972 Bacteria 44795
642 Ga0207640_10000631 3300025981 Bacteria 20654
643 Ga0207640_10161933 3300025981 Bacteria 1656
644 Ga0207640_10167234 3300025981 Bacteria 1634
645 Ga0207658_10005655 3300025986 Bacteria 8559
646 Ga0207658_10064999 3300025986 Bacteria 2738
647 Ga0207658_10072350 3300025986 Bacteria 2613
648 Ga0207677_10000447 3300026023 Bacteria 27944
649 Ga0207703_10002461 3300026035 Bacteria 16058
650 Ga0207703_10016409 3300026035 Bacteria 5774
651 Ga0207703_10045609 3300026035 Bacteria 3527
652 Ga0207703_10082095 3300026035 Bacteria 2689
653 Ga0207703_10266990 3300026035 Unclassified 1549
654 Ga0207639_10001124 3300026041 Bacteria 18176
655 Ga0207639_10324804 3300026041 Bacteria 1367
656 Ga0207678_10006341 3300026067 Bacteria 10500
657 Ga0207678_10016727 3300026067 Bacteria 6442
658 Ga0207678_10040686 3300026067 Bacteria 4030
659 Ga0207678_10110966 3300026067 Bacteria 2340
660 Ga0207708_10004257 3300026075 Bacteria 10536
661 Ga0207708_10013006 3300026075 Bacteria 6209
662 Ga0207708_10013024 3300026075 Bacteria 6205
663 Ga0207708_10193573 3300026075 Bacteria 1620
664 Ga0207702_10001906 3300026078 Bacteria 20374
665 Ga0207702_10035301 3300026078 Bacteria 4181
666 Ga0207702_10483841 3300026078 Bacteria 1205
667 Ga0207702_10594234 3300026078 Bacteria 1086
668 Ga0207641_10001385 3300026088 Bacteria 23881
669 Ga0207641_10060666 3300026088 Bacteria 3224
670 Ga0207641_10099338 3300026088 Bacteria 2561
671 Ga0207641_10099376 3300026088 Bacteria 2560
672 Ga0207641_10129430 3300026088 Bacteria 2264
673 Ga0207641_10163454 3300026088 Bacteria 2026
674 Ga0207641_10355597 3300026088 Bacteria 1397
675 Ga0207648_10054328 3300026089 Bacteria 3499
676 Ga0207648_10241375 3300026089 Bacteria 1609
677 Ga0207648_10270036 3300026089 Bacteria 1519
678 Ga0207676_10010826 3300026095 Bacteria 6504
679 Ga0207676_10064322 3300026095 Bacteria 2916
680 Ga0207676_10112109 3300026095 Bacteria 2284
681 Ga0207676_10169321 3300026095 Bacteria 1901
682 Ga0207674_10001963 3300026116 Bacteria 26041
683 Ga0207674_10030777 3300026116 Bacteria 5641
684 Ga0207674_10041706 3300026116 Bacteria 4745
685 Ga0207674_10106752 3300026116 Bacteria 2777
686 Ga0207674_10182274 3300026116 Bacteria 2051
687 Ga0207675_100002006 3300026118 Bacteria 20298
688 Ga0207675_100015436 3300026118 Bacteria 7124
689 Ga0207675_100021400 3300026118 Bacteria 6024
690 Ga0207675_100098921 3300026118 Bacteria 2748
691 Ga0207683_10000001 3300026121 Bacteria 352047
692 Ga0207683_10011391 3300026121 Bacteria 7588
693 Ga0207683_10014385 3300026121 Bacteria 6738
694 Ga0207683_10052773 3300026121 Bacteria 3563
695 Ga0207698_10000531 3300026142 Bacteria 22175
696 Ga0207698_10016679 3300026142 Bacteria 4962
697 Ga0207698_10246809 3300026142 Unclassified 1631
698 Ga0207698_10429227 3300026142 Bacteria 1270
699 Ga0209389_1000153 3300027296 Bacteria 58606
700 Ga0209489_100936 3300027361 Bacteria 58586
701 Ga0209700_100011 3300027363 Bacteria 362159
702 Ga0210002_1007289 3300027617 Bacteria 1674
703 Ga0209588_1045738 3300027671 Bacteria 1416
704 Ga0209971_1015712 3300027682 Unclassified 1794
705 Ga0209966_1000744 3300027695 Bacteria 6780
706 Ga0209966_1004200 3300027695 Bacteria 2437
707 Ga0209998_10005098 3300027717 Bacteria 2759
708 Ga0209998_10011877 3300027717 Bacteria 1808
709 Ga0209974_10005645 3300027876 Bacteria 4392
710 Ga0207428_10000221 3300027907 Bacteria 79234
711 Ga0207428_10000374 3300027907 Bacteria 56990
712 Ga0207428_10000524 3300027907 Bacteria 45818
713 Ga0207428_10091574 3300027907 Bacteria 2360
714 Ga0268266_10022478 3300028379 Bacteria 5374
715 Ga0268266_10095530 3300028379 Bacteria 2610
716 Ga0268266_10125364 3300028379 Bacteria 2291
717 Ga0268266_10485293 3300028379 Unclassified 1178
718 Ga0268265_10002636 3300028380 Bacteria 13322
719 Ga0268265_10230733 3300028380 Bacteria 1627
720 Ga0268264_10000886 3300028381 Bacteria 31552
721 Ga0268264_10007945 3300028381 Bacteria 8829
722 Ga0268264_10255311 3300028381 Bacteria 1630
723 Ga0268264_10545222 3300028381 Bacteria 1137
724 Ga0265337_1002520 3300028556 Bacteria 8352
725 Ga0265318_10012161 3300028577 Bacteria 3673
726 Ga0265338_10034655 3300028800 Bacteria 4874
727 Ga0265330_10026153 3300031235 Bacteria 2642
728 Ga0265330_10033066 3300031235 Bacteria 2316
729 Ga0265330_10065930 3300031235 Bacteria 1571
730 Ga0265330_10067502 3300031235 Bacteria 1550
731 Ga0265320_10008506 3300031240 Bacteria 6276
732 Ga0265325_10000095 3300031241 Bacteria 62028
733 Ga0265325_10000238 3300031241 Bacteria 39199
734 Ga0265325_10010377 3300031241 Bacteria 5397
735 Ga0265325_10017266 3300031241 Bacteria 4012
736 Ga0265325_10022512 3300031241 Bacteria 3451
737 Ga0265325_10035754 3300031241 Bacteria 2636
738 Ga0265325_10093922 3300031241 Bacteria 1475
739 Ga0265329_10021859 3300031242 Bacteria 2145
740 Ga0265340_10015759 3300031247 Bacteria 3922
741 Ga0265339_10000051 3300031249 Bacteria 101716
742 Ga0265339_10014949 3300031249 Bacteria 4667
743 Ga0265339_10016577 3300031249 Bacteria 4389
744 Ga0265339_10073737 3300031249 Bacteria 1814
745 Ga0265339_10110678 3300031249 Bacteria 1421
746 Ga0265331_10010219 3300031250 Bacteria 5205
747 Ga0265331_10054659 3300031250 Bacteria 1901
748 Ga0265331_10124001 3300031250 Bacteria 1180
749 Ga0265316_10055514 3300031344 Bacteria 3097
750 Ga0265316_10184635 3300031344 Bacteria 1552
751 Ga0307509_10151458 3300031507 Bacteria 2234
752 Ga0307408_100072066 3300031548 Bacteria 2557
753 Ga0265313_10000011 3300031595 Bacteria 166182
754 Ga0265313_10001977 3300031595 Bacteria 18509
755 Ga0265313_10007848 3300031595 Bacteria 7199
756 Ga0265313_10020261 3300031595 Bacteria 3674
757 Ga0265313_10084957 3300031595 Bacteria 1431
758 Ga0265313_10101515 3300031595 Bacteria 1276
759 Ga0316579_10002505 3300031691 Bacteria 6949
760 Ga0265314_10001044 3300031711 Bacteria 32301
761 Ga0265314_10019890 3300031711 Bacteria 5191
762 Ga0265314_10221629 3300031711 Bacteria 1103
763 Ga0265342_10000367 3300031712 Bacteria 49629
764 Ga0265342_10005329 3300031712 Bacteria 9842
765 Ga0265342_10019764 3300031712 Bacteria 4334
766 Ga0265342_10136028 3300031712 Bacteria 1373
767 Ga0316578_10048114 3300031728 Bacteria 2489
768 Ga0307409_100080979 3300031995 Bacteria 2623
769 Ga0307416_100431832 3300032002 Bacteria 1365
770 Ga0316583_10001321 3300032133 Bacteria 8194
771 Ga0307510_10226573 3300033180 Bacteria 1376
772 Ga0373930_0002702 3300034816 Bacteria 2763
773 Ga0373948_0000586 3300034817 Bacteria 4656
774 Ga0373948_0004324 3300034817 Bacteria 2239
775 Ga0373950_0002705 3300034818 Bacteria 2466
776 Ga0373950_0004683 3300034818 Bacteria 2012
777 Ga0373959_0000346 3300034820 Bacteria 9428
778 Ga0373938_0000019 3300034957 Bacteria 20929
779 Ga0373938_0000500 3300034957 Bacteria 6335
780 Ga0373926_0022520 3300035083 Bacteria 2185
781 Ga0373926_0064608 3300035083 Bacteria 1337
782 Ga0373928_0000086 3300035084 Bacteria 16168
783 Ga0373929_0002104 3300035085 Bacteria 3699
784 Ga0373934_0038930 3300035086 Unclassified 1873
785 Ga0373940_0000128 3300035088 Bacteria 9663
786 Ga0373940_0015602 3300035088 Bacteria 1871
787 Ga0373940_0017215 3300035088 Bacteria 1800
788 Ga0373944_0000472 3300035089 Bacteria 9345
789 Ga0373944_0001073 3300035089 Bacteria 6771
790 Ga0373944_0012540 3300035089 Bacteria 2338
791 Ga0373949_0001092 3300035090 Bacteria 8253
792 Ga0373949_0001874 3300035090 Bacteria 5709
793 Ga0373951_0002197 3300035091 Bacteria 4963
794 Ga0373952_0000337 3300035092 Bacteria 7938
795 Ga0373952_0017082 3300035092 Bacteria 1485
796 Ga0373923_0034447 3300035111 Bacteria 2055
797 Ga0373923_0096235 3300035111 Bacteria 1301
798 Ga0373932_0000684 3300035112 Bacteria 10250
799 Ga0373932_0011414 3300035112 Bacteria 2170
800 Ga0373936_0002845 3300035113 Bacteria 6456
801 Ga0373936_0021363 3300035113 Bacteria 2517
802 Ga0373936_0119764 3300035113 Bacteria 1124
803 Ga0373939_0000537 3300035114 Bacteria 9521
804 Ga0373939_0012799 3300035114 Bacteria 2146
805 Ga0373939_0016529 3300035114 Bacteria 1947
806 Ga0373941_0000130 3300035115 Bacteria 13172
807 Ga0373941_0009489 3300035115 Bacteria 2453
808 Ga0373941_0019114 3300035115 Bacteria 1902
809 Ga0373945_0001076 3300035116 Bacteria 8213
810 Ga0373945_0015805 3300035116 Bacteria 2542
811 Ga0373945_0072476 3300035116 Bacteria 1306
812 Ga0373945_0075655 3300035116 Bacteria 1282
813 Ga0373953_0001623 3300035117 Bacteria 6583
814 Ga0373953_0014816 3300035117 Bacteria 2812
815 Ga0373953_0050506 3300035117 Bacteria 1680
816 Ga0373954_0010286 3300035118 Bacteria 4127
817 Ga0373954_0052451 3300035118 Bacteria 1916
818 Ga0373954_0105080 3300035118 Bacteria 1363
819 Ga0373956_0031832 3300035119 Bacteria 2313
820 Ga0373956_0031873 3300035119 Bacteria 2311
821 Ga0373956_0046252 3300035119 Bacteria 1943
822 Ga0373957_0019620 3300035120 Bacteria 2382
823 Ga0373957_0053530 3300035120 Bacteria 1548
824 Ga0373957_0090821 3300035120 Bacteria 1214
825 Ga0373960_0022935 3300035121 Bacteria 1677
826 Ga0373943_0012213 3300035170 Bacteria 3866
827 Ga0373943_0025061 3300035170 Bacteria 2785
828 Ga0373943_0028196 3300035170 Bacteria 2644
829 Ga0373943_0042659 3300035170 Bacteria 2199
830 Ga0373943_0058877 3300035170 Bacteria 1913
831 Ga0373943_0064396 3300035170 Bacteria 1841
832 Ga0373943_0151609 3300035170 Bacteria 1256
833 Ga0373946_0009917 3300035171 Bacteria 3521
834 Ga0373946_0020297 3300035171 Bacteria 2567
835 Ga0373946_0030130 3300035171 Bacteria 2164
836 Ga0373946_0030202 3300035171 Bacteria 2162
837 Ga0373946_0093789 3300035171 Bacteria 1334
838 Ga0373946_0103836 3300035171 Bacteria 1278
839 Ga0373955_0001240 3300035172 Bacteria 10837
840 Ga0373955_0004568 3300035172 Bacteria 6133
841 Ga0373955_0004598 3300035172 Bacteria 6115
842 Ga0373955_0124028 3300035172 Bacteria 1503
843 Ga0373942_0000650 3300035207 Bacteria 9743
844 Ga0373942_0002645 3300035207 Bacteria 4306
845 Ga0373942_0077150 3300035207 Bacteria 983
846 Ga0373961_0001156 3300035241 Bacteria 8246
847 Ga0373961_0013154 3300035241 Bacteria 2081
848 Ga0373962_0000281 3300035242 Bacteria 10947
849 Ga0373962_0003190 3300035242 Bacteria 3932
850 Ga0373962_0032757 3300035242 Bacteria 1431
851 Ga0316574_0039340 3300035398 Bacteria 2907
852 Ga0373924_0000635 3300035410 Bacteria 10882
853 Ga0373924_0004146 3300035410 Bacteria 5042
854 Ga0373924_0005822 3300035410 Bacteria 4387
855 Ga0373924_0022743 3300035410 Bacteria 2453
856 Ga0373924_0029106 3300035410 Bacteria 2206
857 Ga0373924_0033888 3300035410 Bacteria 2064
858 Ga0373931_0004016 3300035691 Bacteria 6664
859 Ga0373931_0004777 3300035691 Bacteria 6215
860 Ga0373931_0035877 3300035691 Bacteria 2581
861 Ga0373931_0102290 3300035691 Bacteria 1613
862 Ga0373931_0106433 3300035691 Bacteria 1585
863 Ga0373931_0248280 3300035691 Bacteria 1081
864 Ga0373935_0002667 3300035692 Bacteria 10266
865 Ga0373935_0003893 3300035692 Bacteria 8708
866 Ga0373935_0021979 3300035692 Bacteria 3906
867 Ga0373935_0039012 3300035692 Bacteria 2975
868 Ga0373935_0046689 3300035692 Bacteria 2736
869 Ga0373935_0094775 3300035692 Bacteria 1959
870 Ga0373935_0141185 3300035692 Bacteria 1627
871 Ga0373935_0172953 3300035692 Bacteria 1478
872 Ga0373927_0008477 3300035695 Bacteria 6917
873 Ga0373927_0013111 3300035695 Bacteria 5513
874 Ga0373927_0018038 3300035695 Bacteria 4641
875 Ga0373927_0058352 3300035695 Bacteria 2496
876 Ga0373927_0071247 3300035695 Bacteria 2249
877 Ga0373927_0135461 3300035695 Unclassified 1609
878 Ga0373927_0178451 3300035695 Bacteria 1393
879 Ga0373927_0197380 3300035695 Bacteria 1320
880 Ga0373927_0228883 3300035695 Bacteria 1221
881 Ga0373933_0001633 3300035724 Bacteria 13061
882 Ga0373933_0001683 3300035724 Bacteria 12877
883 Ga0373933_0002774 3300035724 Bacteria 9775
884 Ga0373933_0018474 3300035724 Bacteria 3921
885 Ga0373933_0062962 3300035724 Bacteria 2241
886 Ga0373933_0167235 3300035724 Bacteria 1398
887 Ga0373947_0000169 3300035725 Bacteria 35262
888 Ga0373947_0011727 3300035725 Bacteria 5022
889 Ga0373947_0016872 3300035725 Bacteria 4195
890 Ga0373947_0034868 3300035725 Bacteria 2977
891 Ga0373947_0067004 3300035725 Bacteria 2192
892 Ga0373947_0073998 3300035725 Bacteria 2095
893 Ga0373947_0141490 3300035725 Bacteria 1543
894 Ga0373947_0153081 3300035725 Bacteria 1486
895 Ga0373947_0230202 3300035725 Bacteria 1220
896 Ga0373937_0000075 3300036401 Bacteria 89727
897 Ga0373937_0002452 3300036401 Bacteria 15416
898 Ga0373937_0007161 3300036401 Bacteria 9645
899 Ga0373937_0008142 3300036401 Bacteria 9102
900 Ga0373937_0009623 3300036401 Bacteria 8415
901 Ga0373937_0062499 3300036401 Bacteria 3423
902 Ga0373937_0259048 3300036401 Bacteria 1640
903 Ga0373937_0310407 3300036401 Bacteria 1492
904 Ga0316582_0051301 3300036647 Bacteria 2617
905 Ga0316584_0051145 3300036712 Bacteria 3090
906 Ga0373925_0000159 3300037068 Bacteria 72851
907 Ga0373925_0002536 3300037068 Bacteria 14550
908 Ga0373925_0011850 3300037068 Bacteria 6310
909 Ga0373925_0030508 3300037068 Bacteria 3957
910 Ga0373925_0053580 3300037068 Bacteria 3016
911 Ga0373925_0060582 3300037068 Bacteria 2842
912 Ga0373925_0067035 3300037068 Bacteria 2706
913 Ga0373925_0127140 3300037068 Bacteria 1984
914 Ga0373925_0135420 3300037068 Bacteria 1924
915 Ga0373925_0193802 3300037068 Bacteria 1613
916 Ga0373925_0351132 3300037068 Bacteria 1197
917 Ga0395899_0014324 3300037312 Bacteria 6053
918 Ga0395899_0061279 3300037312 Bacteria 2771
919 Ga0395899_0143330 3300037312 Bacteria 1699
920 Ga0395900_0013523 3300037418 Bacteria 8338
921 Ga0395900_0060104 3300037418 Bacteria 3912
922 Ga0395900_0434002 3300037418 Bacteria 1272
923 Ga0395900_0584945 3300037418 Bacteria 1058
924 Ga0395898_0007764 3300037466 Bacteria 11391
925 Ga0395898_0026676 3300037466 Bacteria 5808
926 Ga0395898_0049193 3300037466 Bacteria 4131
927 Ga0395898_0188870 3300037466 Bacteria 1969
928 Ga0395905_0003532 3300037471 Bacteria 16666
929 Ga0395905_0049932 3300037471 Bacteria 3921
930 Ga0395905_0431940 3300037471 Bacteria 1214
931 Ga0436364_0743503 3300037853 Bacteria 33195
932 Ga0395901_0006371 3300038443 Bacteria 11961
933 Ga0395901_0161252 3300038443 Bacteria 2355
934 Ga0395901_0251165 3300038443 Bacteria 1842
935 Ga0395901_0361685 3300038443 Bacteria 1496
936 Ga0395901_0395919 3300038443 Bacteria 1419
937 Ga0242420_002129 3300038996 Bacteria 2785
938 Ga0400483_253337 3300039062 Bacteria 2322
939 Ga0436365_0208174 3300039437 Bacteria 1054
940 Ga0436365_1154146 3300039437 Bacteria 2937
941 Ga0436365_1691170 3300039437 Bacteria 24758
942 Ga0436365_1739170 3300039437 Bacteria 2563
943 Ga0436360_1037609 3300039438 Bacteria 1698
944 Ga0436361_0155268 3300039447 Bacteria 2458
945 Ga0436361_0422998 3300039447 Bacteria 9063
946 Ga0436361_0871492 3300039447 Bacteria 2871
947 Ga0436363_0274435 3300039450 Bacteria 2101
948 Ga0466972_0000214 3300044658 Bacteria 40946
949 Ga0466965_0194092 3300044683 Bacteria 1075
950 Ga0466966_0000209 3300044684 Bacteria 39062
951 Ga0466966_0066768 3300044684 Bacteria 2260
952 Ga0466961_0093408 3300044693 Bacteria 1898
953 Ga0466963_0041247 3300044694 Bacteria 3027
954 Ga0466963_0070403 3300044694 Bacteria 2353
955 Ga0466963_0088271 3300044694 Bacteria 2109
956 Ga0466963_0199405 3300044694 Bacteria 1400
957 Ga0453684_0027976 3300044712 Bacteria 8063
958 Ga0466957_0017743 3300044842 Bacteria 4174
959 Ga0466957_0160638 3300044842 Bacteria 1459
960 Ga0466957_0213141 3300044842 Bacteria 1272
961 Ga0451576_0003944 3300045051 Bacteria 19801
962 Ga0466958_0028754 3300045836 Bacteria 3297
963 Ga0466967_0332602 3300045976 Bacteria 1467
964 Ga0466967_0335766 3300045976 Bacteria 1460
965 Ga0495617_006346 3300046452 Bacteria 4152
966 Ga0495592_0000392 3300046454 Bacteria 34094
967 Ga0495592_0037845 3300046454 Bacteria 3630
968 Ga0495592_0043951 3300046454 Bacteria 3340
969 Ga0495592_0045235 3300046454 Bacteria 3286
970 Ga0495592_0045416 3300046454 Bacteria 3278
971 Ga0495592_0050180 3300046454 Bacteria 3101
972 Ga0495592_0240685 3300046454 Bacteria 1201
973 Ga0495603_0010692 3300046455 Bacteria 5565
974 Ga0495603_0064972 3300046455 Bacteria 2150
975 Ga0495603_0073240 3300046455 Bacteria 2012
976 Ga0495629_0000230 3300046459 Bacteria 49922
977 Ga0495629_0000948 3300046459 Bacteria 23342
978 Ga0495629_0050112 3300046459 Bacteria 2926
979 Ga0495629_0071692 3300046459 Bacteria 2418
980 Ga0495629_0101703 3300046459 Bacteria 2005
981 Ga0495629_0132443 3300046459 Bacteria 1736
982 Ga0495629_0269188 3300046459 Bacteria 1170
983 Ga0495638_0028884 3300046460 Bacteria 3578
984 Ga0495641_0071447 3300046461 Bacteria 1558
985 Ga0495651_0002849 3300046462 Bacteria 13393
986 Ga0495651_0014204 3300046462 Bacteria 6155
987 Ga0495651_0131250 3300046462 Bacteria 1828
988 Ga0495651_0140040 3300046462 Bacteria 1755
989 Ga0495651_0269236 3300046462 Bacteria 1156
990 Ga0495653_0000036 3300046463 Bacteria 129776
991 Ga0495653_0004021 3300046463 Bacteria 11873
992 Ga0495653_0038647 3300046463 Bacteria 3745
993 Ga0495653_0079395 3300046463 Bacteria 2430
994 Ga0495653_0158689 3300046463 Bacteria 1572
995 Ga0495653_0219880 3300046463 Bacteria 1277
996 Ga0495580_0001068 3300046472 Bacteria 24085
997 Ga0495580_0039737 3300046472 Bacteria 3366
998 Ga0495580_0045082 3300046472 Bacteria 3133
999 Ga0495580_0054321 3300046472 Bacteria 2825
1000 Ga0495582_0005508 3300046473 Bacteria 7052
1001 Ga0495582_0022528 3300046473 Bacteria 3448
1002 Ga0495582_0030243 3300046473 Bacteria 2972
1003 Ga0495582_0076888 3300046473 Bacteria 1851
1004 Ga0495639_0004161 3300046475 Bacteria 6205
1005 Ga0495639_0045698 3300046475 Bacteria 1981
1006 Ga0495662_0005220 3300046476 Bacteria 6511
1007 Ga0495662_0011941 3300046476 Bacteria 4245
1008 Ga0495662_0011970 3300046476 Bacteria 4239
1009 Ga0495662_0016876 3300046476 Bacteria 3533
1010 Ga0495662_0048421 3300046476 Bacteria 2052
1011 Ga0495662_0133172 3300046476 Bacteria 1222
1012 Ga0495664_0000107 3300046477 Bacteria 41420
1013 Ga0495664_0000120 3300046477 Bacteria 39814
1014 Ga0495664_0032517 3300046477 Bacteria 3061
1015 Ga0495664_0057517 3300046477 Bacteria 2314
1016 Ga0495584_0036368 3300046491 Bacteria 2488
1017 Ga0495584_0076333 3300046491 Bacteria 1685
1018 Ga0495584_0117585 3300046491 Bacteria 1346
1019 Ga0495585_0014848 3300046492 Bacteria 4531
1020 Ga0495594_0017109 3300046499 Bacteria 3827
1021 Ga0495594_0056247 3300046499 Bacteria 2170
1022 Ga0495607_0025317 3300046501 Bacteria 3692
1023 Ga0495606_0015828 3300046507 Bacteria 5788
1024 Ga0495606_0033243 3300046507 Bacteria 3560
1025 Ga0495606_0111860 3300046507 Bacteria 1646
1026 Ga0495608_0000006 3300046511 Bacteria 324334
1027 Ga0495608_0006645 3300046511 Bacteria 8209
1028 Ga0495608_0017571 3300046511 Bacteria 4947
1029 Ga0495608_0058209 3300046511 Bacteria 2548
1030 Ga0495608_0138837 3300046511 Bacteria 1552
1031 Ga0495608_0303567 3300046511 Bacteria 988
1032 Ga0495610_0044303 3300046512 Bacteria 2209
1033 Ga0495616_0087390 3300046513 Bacteria 1481
1034 Ga0495618_0000057 3300046514 Bacteria 80298
1035 Ga0495618_0006172 3300046514 Bacteria 7270
1036 Ga0495618_0017945 3300046514 Bacteria 4341
1037 Ga0495618_0037015 3300046514 Bacteria 3063
1038 Ga0495618_0046220 3300046514 Bacteria 2747
1039 Ga0495618_0128275 3300046514 Unclassified 1623
1040 Ga0495628_0000077 3300046516 Bacteria 77338
1041 Ga0495628_0001017 3300046516 Bacteria 25597
1042 Ga0495628_0070137 3300046516 Bacteria 2733
1043 Ga0495628_0073107 3300046516 Bacteria 2671
1044 Ga0495628_0164732 3300046516 Bacteria 1683
1045 Ga0495630_0010058 3300046517 Bacteria 6814
1046 Ga0495630_0023765 3300046517 Bacteria 4530
1047 Ga0495630_0023931 3300046517 Bacteria 4515
1048 Ga0495630_0134099 3300046517 Bacteria 1881
1049 Ga0495630_0262825 3300046517 Bacteria 1318
1050 Ga0495631_0115490 3300046518 Bacteria 1154
1051 Ga0495637_0081291 3300046520 Bacteria 1291
1052 Ga0495644_0001361 3300046523 Bacteria 9986
1053 Ga0495648_0003063 3300046524 Bacteria 14941
1054 Ga0495648_0171813 3300046524 Bacteria 1110
1055 Ga0495666_0005491 3300046526 Bacteria 6387
1056 Ga0495652_0000005 3300046529 Bacteria 524368
1057 Ga0495652_0005022 3300046529 Bacteria 12533
1058 Ga0495652_0006915 3300046529 Bacteria 10499
1059 Ga0495652_0017324 3300046529 Bacteria 6429
1060 Ga0495652_0082543 3300046529 Bacteria 2648
1061 Ga0495652_0098349 3300046529 Bacteria 2378
1062 Ga0495652_0155327 3300046529 Bacteria 1782
1063 Ga0495665_0012704 3300046531 Bacteria 4557
1064 Ga0495665_0030569 3300046531 Bacteria 2883
1065 Ga0495640_0000007 3300046533 Bacteria 265481
1066 Ga0495640_0004278 3300046533 Bacteria 11407
1067 Ga0495640_0004293 3300046533 Bacteria 11379
1068 Ga0495640_0022947 3300046533 Bacteria 4557
1069 Ga0495640_0027919 3300046533 Bacteria 4065
1070 Ga0495640_0109575 3300046533 Bacteria 1805
1071 Ga0495586_0006241 3300046535 Bacteria 6371
1072 Ga0495586_0007424 3300046535 Bacteria 5848
1073 Ga0495586_0097638 3300046535 Bacteria 1628
1074 Ga0495587_0000043 3300046536 Bacteria 109717
1075 Ga0495587_0003087 3300046536 Bacteria 11125
1076 Ga0495587_0019862 3300046536 Bacteria 4152
1077 Ga0495587_0044036 3300046536 Bacteria 2655
1078 Ga0495587_0208000 3300046536 Bacteria 1105
1079 Ga0495609_0069858 3300046538 Bacteria 1544
1080 Ga0495645_0000275 3300046543 Bacteria 37777
1081 Ga0495645_0000755 3300046543 Bacteria 22120
1082 Ga0495645_0007548 3300046543 Bacteria 7565
1083 Ga0495622_0005859 3300046557 Bacteria 5705
1084 Ga0495633_0001157 3300046558 Bacteria 21186
1085 Ga0495667_0000023 3300046559 Bacteria 169343
1086 Ga0495667_0001576 3300046559 Bacteria 15131
1087 Ga0495667_0002302 3300046559 Bacteria 12796
1088 Ga0495667_0053686 3300046559 Bacteria 2653
1089 Ga0495667_0067078 3300046559 Bacteria 2345
1090 Ga0495667_0075895 3300046559 Bacteria 2187
1091 Ga0495667_0088746 3300046559 Bacteria 2004
1092 Ga0495656_0000359 3300046615 Bacteria 15309
1093 Ga0495656_0038258 3300046615 Bacteria 1986
1094 Ga0495634_0000049 3300046642 Bacteria 95428
1095 Ga0495634_0009596 3300046642 Bacteria 7130
1096 Ga0495634_0033367 3300046642 Bacteria 3538
1097 Ga0495634_0054566 3300046642 Bacteria 2674
1098 Ga0495634_0091956 3300046642 Bacteria 1969
1099 Ga0495634_0110347 3300046642 Bacteria 1769
1100 Ga0495634_0156386 3300046642 Bacteria 1439
1101 Ga0495611_0002507 3300046648 Bacteria 8356
1102 Ga0495611_0148129 3300046648 Bacteria 1096
1103 Ga0495625_0087352 3300046660 Bacteria 2162
1104 Ga0495635_0000021 3300046663 Bacteria 164643
1105 Ga0495635_0001668 3300046663 Bacteria 14933
1106 Ga0495635_0011446 3300046663 Bacteria 6221
1107 Ga0495635_0064462 3300046663 Bacteria 2515
1108 Ga0495659_0000813 3300046664 Bacteria 11123
1109 Ga0495588_0011785 3300046674 Bacteria 4112
1110 Ga0495657_0000063 3300046675 Bacteria 94380
1111 Ga0495657_0006384 3300046675 Bacteria 9228
1112 Ga0495657_0016328 3300046675 Bacteria 5410
1113 Ga0495657_0034745 3300046675 Bacteria 3499
1114 Ga0495657_0066003 3300046675 Bacteria 2378
1115 Ga0495657_0124580 3300046675 Bacteria 1620
1116 Ga0495657_0130300 3300046675 Bacteria 1576
1117 Ga0495657_0179701 3300046675 Bacteria 1299
1118 Ga0495599_0000001 3300046678 Bacteria 537563
1119 Ga0495599_0002299 3300046678 Bacteria 11112
1120 Ga0495599_0023249 3300046678 Bacteria 3873
1121 Ga0495599_0174819 3300046678 Bacteria 1324
1122 Ga0495623_0001477 3300046679 Bacteria 15912
1123 Ga0495623_0005062 3300046679 Bacteria 8648
1124 Ga0495623_0008538 3300046679 Bacteria 6653
1125 Ga0495623_0050507 3300046679 Bacteria 2633
1126 Ga0495646_0000007 3300046680 Bacteria 236764
1127 Ga0495646_0003535 3300046680 Bacteria 9733
1128 Ga0495646_0035326 3300046680 Bacteria 3101
1129 Ga0495646_0050753 3300046680 Bacteria 2513
1130 Ga0495647_0004212 3300046681 Bacteria 4657
1131 Ga0495658_0000713 3300046683 Bacteria 17976
1132 Ga0495658_0005516 3300046683 Bacteria 6219
1133 Ga0495658_0200649 3300046683 Bacteria 1243
1134 Ga0495658_0272559 3300046683 Bacteria 1067
1135 Ga0495669_0100425 3300046684 Bacteria 1343
1136 Ga0495613_0037875 3300046689 Bacteria 3574
1137 Ga0495613_0048799 3300046689 Bacteria 3126
1138 Ga0495613_0050643 3300046689 Bacteria 3062
1139 Ga0495613_0071574 3300046689 Bacteria 2527
1140 Ga0495613_0105310 3300046689 Bacteria 2036
1141 Ga0495613_0144087 3300046689 Bacteria 1701
1142 Ga0495613_0229010 3300046689 Bacteria 1302
1143 Ga0495613_0252370 3300046689 Bacteria 1231
1144 Ga0495624_0018677 3300046690 Bacteria 4635
1145 Ga0495624_0021235 3300046690 Bacteria 4308
1146 Ga0495624_0037168 3300046690 Bacteria 3135
1147 Ga0495624_0166695 3300046690 Bacteria 1344
1148 Ga0495624_0171008 3300046690 Bacteria 1325
1149 Ga0495670_0004344 3300046691 Bacteria 6948
1150 Ga0495670_0020357 3300046691 Bacteria 3271
1151 Ga0495671_0111812 3300046692 Bacteria 1334
1152 Ga0495649_0009260 3300046694 Bacteria 5867
1153 Ga0495589_0109610 3300046794 Bacteria 1333
1154 Ga0495600_0000206 3300046809 Bacteria 33920
1155 Ga0495600_0222593 3300046809 Bacteria 1207
1156 Ga0495581_0029390 3300047315 Bacteria 3186
1157 Ga0495581_0039507 3300047315 Bacteria 2732
1158 Ga0495581_0085314 3300047315 Bacteria 1830
1159 Ga0495604_0000014 3300047317 Bacteria 205481
1160 Ga0495604_0001877 3300047317 Bacteria 17074
1161 Ga0495604_0010329 3300047317 Bacteria 7396
1162 Ga0495604_0019348 3300047317 Bacteria 5450
1163 Ga0495604_0034368 3300047317 Bacteria 4010
1164 Ga0495604_0042569 3300047317 Bacteria 3558
1165 Ga0495604_0148821 3300047317 Bacteria 1666
1166 Ga0495604_0177369 3300047317 Bacteria 1493
1167 Ga0495604_0256414 3300047317 Bacteria 1190
1168 Ga0495674_0000014 3300047319 Bacteria 241211
1169 Ga0495674_0001292 3300047319 Bacteria 24333
1170 Ga0495674_0002324 3300047319 Bacteria 18675
1171 Ga0495674_0055130 3300047319 Bacteria 3487
1172 Ga0495674_0060717 3300047319 Bacteria 3297
1173 Ga0495674_0111983 3300047319 Bacteria 2313
1174 Ga0495674_0114693 3300047319 Bacteria 2281
1175 Ga0495674_0126959 3300047319 Bacteria 2151
1176 Ga0495674_0201952 3300047319 Bacteria 1649
1177 Ga0495674_0268196 3300047319 Bacteria 1401
1178 Ga0495674_0279885 3300047319 Bacteria 1367
1179 Ga0495672_0001150 3300047320 Bacteria 26741
1180 Ga0495676_0152147 3300047321 Bacteria 1645
1181 Ga0495676_0201316 3300047321 Bacteria 1383
1182 Ga0495680_0000636 3300047322 Bacteria 39417
1183 Ga0495680_0004579 3300047322 Bacteria 13186
1184 Ga0495680_0008334 3300047322 Bacteria 9428
1185 Ga0495680_0009331 3300047322 Bacteria 8837
1186 Ga0495680_0023694 3300047322 Bacteria 5100
1187 Ga0495680_0045950 3300047322 Bacteria 3446
1188 Ga0495680_0098463 3300047322 Bacteria 2182
1189 Ga0495680_0296975 3300047322 Bacteria 1135
1190 Ga0495675_0000327 3300047444 Bacteria 33708
1191 Ga0495675_0001359 3300047444 Bacteria 14808
1192 Ga0495675_0041954 3300047444 Bacteria 2915
1193 Ga0495677_0022847 3300047445 Bacteria 2270
1194 Ga0495677_0112342 3300047445 Bacteria 1036
1195 Ga0495684_0000272 3300047471 Bacteria 41522
1196 Ga0495684_0006153 3300047471 Bacteria 9341
1197 Ga0495684_0009342 3300047471 Bacteria 7569
1198 Ga0495684_0031447 3300047471 Bacteria 4075
1199 Ga0495684_0057267 3300047471 Bacteria 2970
1200 Ga0495684_0089256 3300047471 Bacteria 2335
1201 Ga0495684_0202170 3300047471 Bacteria 1464
1202 Ga0495686_0038011 3300047472 Bacteria 3081
1203 Ga0495593_0005467 3300047673 Bacteria 7501
1204 Ga0495593_0015589 3300047673 Bacteria 4301
1205 Ga0495593_0015897 3300047673 Bacteria 4251
1206 Ga0495593_0029935 3300047673 Bacteria 2982
1207 Ga0495593_0033866 3300047673 Bacteria 2780
1208 Ga0495593_0093175 3300047673 Bacteria 1550
1209 Ga0495602_0000017 3300048088 Bacteria 184180
1210 Ga0495602_0004680 3300048088 Bacteria 14292
1211 Ga0495602_0004999 3300048088 Bacteria 13897
1212 Ga0495602_0017445 3300048088 Bacteria 7198
1213 Ga0495602_0045757 3300048088 Bacteria 3958
1214 Ga0495626_0085806 3300048091 Unclassified 1392
1215 Ga0496100_0000600 3300048903 Bacteria 16991
1216 Ga0496100_0008700 3300048903 Bacteria 5672
1217 Ga0496100_0029110 3300048903 Bacteria 3413
1218 Ga0496100_0084207 3300048903 Bacteria 2155
1219 Ga0496100_0111425 3300048903 Bacteria 1902
1220 Ga0496100_0122365 3300048903 Bacteria 1822
1221 Ga0496100_0170619 3300048903 Bacteria 1566
1222 Ga0496100_0210005 3300048903 Bacteria 1423
1223 Ga0496100_0273222 3300048903 Bacteria 1257
1224 Ga0496101_0000728 3300048904 Bacteria 19612
1225 Ga0496101_0002748 3300048904 Bacteria 10800
1226 Ga0496101_0008638 3300048904 Bacteria 6659
1227 Ga0496101_0017034 3300048904 Bacteria 4921
1228 Ga0496101_0102046 3300048904 Bacteria 2148
1229 Ga0496101_0170920 3300048904 Bacteria 1671
1230 Ga0496101_0224303 3300048904 Bacteria 1459
1231 Ga0496101_0244644 3300048904 Bacteria 1396
1232 Ga0496102_0031318 3300048905 Bacteria 4770
1233 Ga0496102_0039588 3300048905 Bacteria 4260
1234 Ga0496102_0056005 3300048905 Bacteria 3596
1235 Ga0496103_0026782 3300048906 Bacteria 3489
1236 Ga0496103_0165887 3300048906 Bacteria 1417
1237 Ga0496104_0000232 3300048907 Bacteria 49094
1238 Ga0496104_0006145 3300048907 Bacteria 10542
1239 Ga0496104_0009679 3300048907 Bacteria 8586
1240 Ga0496104_0013139 3300048907 Bacteria 7463
1241 Ga0496104_0013660 3300048907 Bacteria 7321
1242 Ga0496104_0125842 3300048907 Bacteria 2461
1243 Ga0496104_0144069 3300048907 Bacteria 2288
1244 Ga0496104_0196424 3300048907 Bacteria 1929
1245 Ga0496104_0243253 3300048907 Bacteria 1711
1246 Ga0496104_0280481 3300048907 Bacteria 1579
1247 Ga0496104_0395350 3300048907 Bacteria 1294
1248 Ga0496104_0398342 3300048907 Bacteria 1289
1249 Ga0496105_0000238 3300048908 Bacteria 37100
1250 Ga0496105_0026627 3300048908 Bacteria 4720
1251 Ga0496105_0031925 3300048908 Bacteria 4319
1252 Ga0496105_0129240 3300048908 Bacteria 2083
1253 Ga0496105_0139197 3300048908 Bacteria 1998
1254 Ga0496105_0256180 3300048908 Bacteria 1416
1255 Ga0496105_0285595 3300048908 Bacteria 1329
1256 Ga0496106_0000327 3300048909 Bacteria 33634
1257 Ga0496106_0009906 3300048909 Bacteria 7037
1258 Ga0496106_0037629 3300048909 Bacteria 3620
1259 Ga0496106_0270456 3300048909 Bacteria 1360
1260 Ga0496106_0396024 3300048909 Bacteria 1110
1261 Ga0496107_0000143 3300048910 Bacteria 35680
1262 Ga0496107_0020506 3300048910 Bacteria 4669
1263 Ga0496107_0072734 3300048910 Bacteria 2499
1264 Ga0496107_0073616 3300048910 Bacteria 2485
1265 Ga0496107_0130179 3300048910 Bacteria 1857
1266 Ga0496107_0220134 3300048910 Bacteria 1412
1267 Ga0496107_0312198 3300048910 Bacteria 1170
1268 Ga0496108_0005300 3300048911 Bacteria 10408
1269 Ga0496108_0012847 3300048911 Bacteria 6820
1270 Ga0496108_0016193 3300048911 Bacteria 6081
1271 Ga0496108_0039833 3300048911 Bacteria 3916
1272 Ga0496108_0083557 3300048911 Bacteria 2709
1273 Ga0496108_0138029 3300048911 Bacteria 2099
1274 Ga0496108_0164549 3300048911 Bacteria 1918
1275 Ga0496108_0285428 3300048911 Bacteria 1437
1276 Ga0496109_0000372 3300048912 Bacteria 40804
1277 Ga0496109_0003915 3300048912 Bacteria 12438
1278 Ga0496109_0004434 3300048912 Bacteria 11723
1279 Ga0496109_0006984 3300048912 Bacteria 9530
1280 Ga0496109_0070126 3300048912 Bacteria 3216
1281 Ga0496109_0126744 3300048912 Bacteria 2380
1282 Ga0496109_0144816 3300048912 Bacteria 2222
1283 Ga0496109_0210066 3300048912 Bacteria 1830
1284 Ga0496109_0210168 3300048912 Bacteria 1830
1285 Ga0496109_0214737 3300048912 Bacteria 1809
1286 Ga0496109_0291272 3300048912 Bacteria 1539
1287 Ga0496109_0383787 3300048912 Bacteria 1327
1288 Ga0496110_0003733 3300048913 Bacteria 11732
1289 Ga0496110_0008900 3300048913 Bacteria 8092
1290 Ga0496110_0013311 3300048913 Bacteria 6797
1291 Ga0496110_0132493 3300048913 Bacteria 2251
1292 Ga0496110_0136649 3300048913 Bacteria 2215
1293 Ga0496110_0221102 3300048913 Bacteria 1722
1294 Ga0496110_0229669 3300048913 Bacteria 1687
1295 Ga0496110_0234288 3300048913 Bacteria 1670
1296 Ga0496110_0307005 3300048913 Unclassified 1445
1297 Ga0496111_0001479 3300048914 Bacteria 13449
1298 Ga0496111_0004912 3300048914 Bacteria 8491
1299 Ga0496111_0010409 3300048914 Bacteria 6240
1300 Ga0496111_0022166 3300048914 Bacteria 4443
1301 Ga0496111_0024813 3300048914 Bacteria 4228
1302 Ga0496111_0033040 3300048914 Bacteria 3690
1303 Ga0496111_0042274 3300048914 Bacteria 3272
1304 Ga0496111_0098938 3300048914 Bacteria 2142
1305 Ga0496111_0255747 3300048914 Bacteria 1299
1306 Ga0496111_0269618 3300048914 Bacteria 1263
1307 Ga0496112_0002980 3300048915 Bacteria 13812
1308 Ga0496112_0020629 3300048915 Bacteria 6248
1309 Ga0496112_0175132 3300048915 Bacteria 2110
1310 Ga0496112_0206458 3300048915 Bacteria 1922
1311 Ga0496112_0365608 3300048915 Bacteria 1384
1312 Ga0496112_0396274 3300048915 Bacteria 1320
1313 Ga0496112_0426703 3300048915 Bacteria 1264
1314 Ga0496113_0000259 3300048916 Bacteria 25038
1315 Ga0496113_0022480 3300048916 Bacteria 4462
1316 Ga0496113_0120348 3300048916 Bacteria 2052
1317 Ga0496113_0225407 3300048916 Unclassified 1494
1318 Ga0496113_0299520 3300048916 Bacteria 1287
1319 Ga0496114_0004601 3300048917 Bacteria 10714
1320 Ga0496114_0033513 3300048917 Bacteria 4233
1321 Ga0496114_0035727 3300048917 Bacteria 4104
1322 Ga0496114_0063483 3300048917 Bacteria 3092
1323 Ga0496114_0111712 3300048917 Bacteria 2342
1324 Ga0496114_0112697 3300048917 Bacteria 2332
1325 Ga0496115_0000653 3300048918 Bacteria 25881
1326 Ga0496115_0019005 3300048918 Bacteria 5284
1327 Ga0496115_0167412 3300048918 Bacteria 1817
1328 Ga0496115_0232304 3300048918 Bacteria 1521
1329 Ga0496115_0256297 3300048918 Bacteria 1439
1330 Ga0496116_0014048 3300048919 Bacteria 6414
1331 Ga0496116_0074485 3300048919 Bacteria 2135
1332 Ga0496117_0001890 3300048920 Bacteria 28086
1333 Ga0496118_0003649 3300048921 Bacteria 19121
1334 Ga0496118_0037905 3300048921 Bacteria 3871
1335 Ga0496118_0073434 3300048921 Bacteria 2451
1336 Ga0496120_0027659 3300048923 Bacteria 3483
1337 Ga0496121_0002758 3300048924 Bacteria 26081
1338 Ga0496121_0006036 3300048924 Bacteria 15267
1339 Ga0496121_0024819 3300048924 Bacteria 5717
1340 Ga0496121_0061833 3300048924 Bacteria 3070
1341 Ga0496121_0221246 3300048924 Bacteria 1333
1342 Ga0496122_0026905 3300048925 Bacteria 4938
1343 Ga0496122_0072876 3300048925 Bacteria 2439
1344 Ga0496123_0121479 3300048926 Bacteria 1468
1345 Ga0496124_0037633 3300048927 Bacteria 4206
1346 Ga0496125_0008218 3300048928 Bacteria 10971
1347 Ga0496126_0030362 3300048929 Bacteria 5120
1348 Ga0496126_0160180 3300048929 Bacteria 1923
1349 Ga0501031_0025466 3300049568 Bacteria 3857
1350 Ga0501031_0119463 3300049568 Bacteria 1722
1351 Ga0501031_0191432 3300049568 Bacteria 1336
1352 Ga0501032_0000435 3300049569 Bacteria 34412
1353 Ga0501032_0003450 3300049569 Bacteria 12113
1354 Ga0501032_0158663 3300049569 Bacteria 1485
1355 Ga0501032_0178260 3300049569 Bacteria 1392
1356 Ga0501033_0002280 3300049570 Bacteria 16397
1357 Ga0501033_0067598 3300049570 Bacteria 2627
1358 Ga0501033_0268964 3300049570 Bacteria 1205
1359 Ga0501034_0000089 3300049571 Bacteria 165644
1360 Ga0501034_0006067 3300049571 Bacteria 13049
1361 Ga0501034_0010727 3300049571 Bacteria 9516
1362 Ga0501034_0020731 3300049571 Bacteria 6710
1363 Ga0501034_0021328 3300049571 Bacteria 6605
1364 Ga0501034_0052744 3300049571 Bacteria 4097
1365 Ga0501034_0099184 3300049571 Bacteria 2908
1366 Ga0501034_0100761 3300049571 Bacteria 2882
1367 Ga0501034_0113906 3300049571 Bacteria 2693
1368 Ga0501034_0128398 3300049571 Bacteria 2519
1369 Ga0501034_0316647 3300049571 Bacteria 1493
1370 Ga0501034_0448226 3300049571 Bacteria 1208
1371 Ga0501034_0528554 3300049571 Bacteria 1091
1372 Ga0501034_0587642 3300049571 Bacteria 1020
1373 Ga0501036_0007715 3300049572 Bacteria 8791
1374 Ga0501036_0012537 3300049572 Bacteria 7030
1375 Ga0501036_0015870 3300049572 Bacteria 6290
1376 Ga0501036_0101331 3300049572 Bacteria 2436
1377 Ga0501036_0105646 3300049572 Bacteria 2381
1378 Ga0501036_0145030 3300049572 Bacteria 2003
1379 Ga0501037_0018072 3300049573 Bacteria 5193
1380 Ga0501037_0020234 3300049573 Bacteria 4915
1381 Ga0501037_0046381 3300049573 Bacteria 3187
1382 Ga0501037_0090076 3300049573 Bacteria 2219
1383 Ga0501037_0305049 3300049573 Bacteria 1105
1384 Ga0501038_0017332 3300049574 Bacteria 6511
1385 Ga0501038_0056635 3300049574 Bacteria 3366
1386 Ga0501038_0124419 3300049574 Bacteria 2123
1387 Ga0501038_0183370 3300049574 Bacteria 1688
1388 Ga0501038_0286587 3300049574 Bacteria 1295
1389 Ga0501038_0295344 3300049574 Bacteria 1272
1390 Ga0501038_0305636 3300049574 Bacteria 1247
1391 Ga0501039_0016934 3300049575 Bacteria 5587
1392 Ga0501039_0073847 3300049575 Bacteria 2650
1393 Ga0501039_0108483 3300049575 Bacteria 2170
1394 Ga0501043_0002335 3300049579 Bacteria 16074
1395 Ga0501043_0002883 3300049579 Bacteria 14360
1396 Ga0501043_0027922 3300049579 Bacteria 4429
1397 Ga0501043_0042204 3300049579 Bacteria 3584
1398 Ga0501043_0076456 3300049579 Bacteria 2630
1399 Ga0501043_0182072 3300049579 Bacteria 1637
1400 Ga0501043_0229649 3300049579 Bacteria 1434
1401 Ga0501046_0032334 3300049580 Bacteria 4236
1402 Ga0501046_0060006 3300049580 Bacteria 2977
1403 Ga0501046_0302407 3300049580 Bacteria 1168
1404 Ga0501047_0000108 3300049581 Bacteria 101252
1405 Ga0501047_0005210 3300049581 Bacteria 12204
1406 Ga0501047_0005643 3300049581 Bacteria 11790
1407 Ga0501047_0020718 3300049581 Bacteria 6315
1408 Ga0501047_0026864 3300049581 Bacteria 5542
1409 Ga0501047_0035599 3300049581 Bacteria 4809
1410 Ga0501047_0153246 3300049581 Bacteria 2179
1411 Ga0501047_0164624 3300049581 Bacteria 2089
1412 Ga0501047_0205650 3300049581 Bacteria 1828
1413 Ga0501047_0629821 3300049581 Bacteria 893
1414 Ga0501048_0001627 3300049582 Bacteria 17093
1415 Ga0501048_0001786 3300049582 Bacteria 16352
1416 Ga0501048_0249331 3300049582 Bacteria 1260
1417 Ga0501067_0003119 3300049583 Bacteria 9153
1418 Ga0501067_0016484 3300049583 Bacteria 4082
1419 Ga0501068_0018262 3300049584 Bacteria 4062
1420 Ga0501068_0031880 3300049584 Bacteria 3131
1421 Ga0501068_0071311 3300049584 Bacteria 2121
1422 Ga0501068_0128193 3300049584 Bacteria 1585
1423 Ga0501069_0004000 3300049585 Bacteria 7611
1424 Ga0501069_0038216 3300049585 Bacteria 2649
1425 Ga0501069_0039702 3300049585 Bacteria 2600
1426 Ga0501070_0025261 3300049586 Bacteria 4981
1427 Ga0501070_0027267 3300049586 Bacteria 4791
1428 Ga0501070_0039394 3300049586 Bacteria 3942
1429 Ga0501070_0081427 3300049586 Bacteria 2678
1430 Ga0501070_0097377 3300049586 Bacteria 2433
1431 Ga0501070_0386013 3300049586 Bacteria 1134
1432 Ga0501071_0005716 3300049587 Bacteria 8022
1433 Ga0501071_0030857 3300049587 Bacteria 3793
1434 Ga0501072_0002592 3300049588 Bacteria 13556
1435 Ga0501072_0004367 3300049588 Bacteria 10731
1436 Ga0501072_0077680 3300049588 Bacteria 2628
1437 Ga0501072_0186131 3300049588 Bacteria 1656
1438 Ga0501073_0000019 3300049589 Bacteria 144300
1439 Ga0501073_0002379 3300049589 Bacteria 14087
1440 Ga0501073_0046698 3300049589 Bacteria 3044
1441 Ga0501073_0107620 3300049589 Bacteria 1934
1442 Ga0501073_0112921 3300049589 Bacteria 1884
1443 Ga0501073_0182275 3300049589 Bacteria 1453
1444 Ga0501073_0309232 3300049589 Bacteria 1090
1445 Ga0501074_0013871 3300049590 Bacteria 5857
1446 Ga0501074_0016822 3300049590 Bacteria 5307
1447 Ga0501074_0059163 3300049590 Bacteria 2761
1448 Ga0501074_0238044 3300049590 Bacteria 1295
1449 Ga0501075_0279956 3300049591 Bacteria 1271
1450 Ga0501076_0151753 3300049592 Bacteria 1885
1451 Ga0501076_0291531 3300049592 Bacteria 1337
1452 Ga0501077_0000035 3300049593 Bacteria 68535
1453 Ga0501079_0014331 3300049741 Bacteria 6044
1454 Ga0501079_0031812 3300049741 Bacteria 4054
1455 Ga0501079_0039580 3300049741 Bacteria 3636
1456 Ga0501080_0000045 3300049742 Bacteria 79211
1457 Ga0501080_0000655 3300049742 Bacteria 27483
1458 Ga0501080_0035718 3300049742 Bacteria 4639
1459 Ga0501080_0057651 3300049742 Bacteria 3616
1460 Ga0501080_0100394 3300049742 Bacteria 2685
1461 Ga0501080_0107189 3300049742 Bacteria 2589
1462 Ga0501080_0135330 3300049742 Bacteria 2280
1463 Ga0501080_0139150 3300049742 Bacteria 2245
1464 Ga0501080_0293651 3300049742 Bacteria 1475
1465 Ga0501081_0045742 3300049743 Bacteria 3006
1466 Ga0501081_0056833 3300049743 Bacteria 2705
1467 Ga0501081_0214958 3300049743 Bacteria 1397
1468 Ga0501081_0310762 3300049743 Bacteria 1157
1469 Ga0501083_0002606 3300049744 Bacteria 12413
1470 Ga0501083_0005531 3300049744 Bacteria 8954
1471 Ga0501083_0015039 3300049744 Bacteria 5416
1472 Ga0501083_0031690 3300049744 Bacteria 3628
1473 Ga0501083_0070668 3300049744 Bacteria 2321
1474 Ga0501083_0081626 3300049744 Bacteria 2143
1475 Ga0501083_0113452 3300049744 Bacteria 1780
1476 Ga0501083_0114793 3300049744 Bacteria 1768
1477 Ga0501035_0001364 3300049822 Bacteria 25120
1478 Ga0501035_0016145 3300049822 Bacteria 6890
1479 Ga0501035_0018105 3300049822 Bacteria 6491
1480 Ga0501035_0067679 3300049822 Bacteria 3168
1481 Ga0501035_0167683 3300049822 Bacteria 1898
1482 Ga0501035_0213324 3300049822 Bacteria 1651
1483 Ga0501035_0406497 3300049822 Bacteria 1132
1484 Ga0501044_0002199 3300049823 Bacteria 22360
1485 Ga0501044_0002915 3300049823 Bacteria 19480
1486 Ga0501044_0009512 3300049823 Bacteria 10580
1487 Ga0501044_0015174 3300049823 Bacteria 8299
1488 Ga0501044_0019836 3300049823 Bacteria 7181
1489 Ga0501044_0031382 3300049823 Bacteria 5593
1490 Ga0501044_0047827 3300049823 Bacteria 4423
1491 Ga0501044_0084474 3300049823 Bacteria 3209
1492 Ga0501044_0098536 3300049823 Bacteria 2943
1493 Ga0501044_0100872 3300049823 Bacteria 2904
1494 Ga0501044_0141831 3300049823 Bacteria 2391
1495 Ga0501044_0273150 3300049823 Bacteria 1625
1496 Ga0501044_0295854 3300049823 Bacteria 1549
1497 Ga0501044_0524536 3300049823 Bacteria 1084
1498 Ga0501044_0561278 3300049823 Bacteria 1038
1499 Ga0501045_0093339 3300049824 Bacteria 2226
1500 nmdc:mga03683_6131_c1 3300050489 Bacteria 4102
1501 nmdc:mga03n38_4244_c1 3300050490 Bacteria 4716
1502 nmdc:mga03n38_63567_c1 3300050490 Bacteria 1687
1503 nmdc:mga00v17_4458_c1 3300050491 Bacteria 7289
1504 nmdc:mga0yw44_41720_c1 3300050492 Bacteria 2733
1505 nmdc:mga0yw44_4866_c1 3300050492 Bacteria 6244
1506 nmdc:mga0yw44_72156_c1 3300050492 Bacteria 2145
1507 nmdc:mga0k408_2007_c1 3300050493 Bacteria 10922
1508 nmdc:mga0k408_29518_c1 3300050493 Bacteria 3122
1509 nmdc:mga06z11_149781_c1 3300050494 Bacteria 1325
1510 nmdc:mga06z11_159215_c1 3300050494 Bacteria 1289
1511 nmdc:mga06z11_47995_c1 3300050494 Bacteria 2171
1512 nmdc:mga06z11_71921_c1 3300050494 Bacteria 1832
1513 nmdc:mga06z11_9696_c1 3300050494 Bacteria 4066
1514 nmdc:mga05p37_11094_c1 3300050507 Bacteria 10706
1515 nmdc:mga05p37_24149_c1 3300050507 Bacteria 7385
1516 nmdc:mga05p37_24288_c1 3300050507 Bacteria 7365
1517 nmdc:mga05p37_268746_c1 3300050507 Bacteria 2038
1518 nmdc:mga05p37_46633_c1 3300050507 Bacteria 5329
1519 nmdc:mga05p37_80697_c1 3300050507 Bacteria 4007
1520 nmdc:mga09592_196019_c1 3300050508 Bacteria 1748
1521 nmdc:mga09592_8496_c1 3300050508 Bacteria 8351
1522 nmdc:mga0qj67_73155_c1 3300050509 Bacteria 2737
1523 nmdc:mga06r32_316996_c1 3300050510 Bacteria 1545
1524 nmdc:mga06r32_33762_c1 3300050510 Bacteria 4820
1525 nmdc:mga06r32_442293_c1 3300050510 Bacteria 1280
1526 nmdc:mga08y16_114053_c1 3300050511 Bacteria 2813
1527 nmdc:mga08y16_145256_c1 3300050511 Bacteria 2466
1528 nmdc:mga08y16_188752_c1 3300050511 Bacteria 2138
1529 nmdc:mga08y16_3254_c1 3300050511 Bacteria 16811
1530 nmdc:mga08y16_49190_c1 3300050511 Bacteria 4412
1531 nmdc:mga08y16_7494_c1 3300050511 Bacteria 11428
1532 nmdc:mga08y16_83519_c1 3300050511 Bacteria 3329
1533 nmdc:mga0n895_118189_c1 3300050512 Bacteria 2671
1534 nmdc:mga0n895_234151_c1 3300050512 Bacteria 1864
1535 nmdc:mga0n895_31564_c1 3300050512 Bacteria 5074
1536 nmdc:mga0n895_322663_c1 3300050512 Bacteria 1565
1537 nmdc:mga0n895_382360_c1 3300050512 Bacteria 1424
1538 nmdc:mga0n895_39649_c1 3300050512 Bacteria 4571
1539 nmdc:mga0n895_484088_c1 3300050512 Bacteria 1248
1540 nmdc:mga0rr50_178440_c1 3300050513 Bacteria 1735
1541 nmdc:mga0rr50_178847_c1 3300050513 Bacteria 1733
1542 nmdc:mga0rr50_2395_c1 3300050513 Bacteria 10550
1543 nmdc:mga0rr50_26063_c1 3300050513 Bacteria 4073
1544 nmdc:mga0rr50_56554_c1 3300050513 Bacteria 2931
1545 nmdc:mga0rr50_69462_c1 3300050513 Bacteria 2681
1546 nmdc:mga0rr50_79377_c1 3300050513 Bacteria 2527
1547 nmdc:mga0a205_10762_c1 3300050515 Bacteria 8411
1548 nmdc:mga0a205_1434_c1 3300050515 Bacteria 20265
1549 nmdc:mga0a205_148336_c1 3300050515 Bacteria 2245
1550 nmdc:mga0a205_37528_c1 3300050515 Bacteria 4659
1551 nmdc:mga0a205_407287_c1 3300050515 Bacteria 1223
1552 nmdc:mga0sz30_11526_c1 3300050516 Bacteria 3416
1553 nmdc:mga0sz30_2397_c1 3300050516 Bacteria 6690
1554 Ga0495601_0000016 3300053077 Bacteria 207486
1555 Ga0495601_0000114 3300053077 Bacteria 44359
1556 Ga0495601_0000315 3300053077 Bacteria 25650
1557 Ga0495601_0008408 3300053077 Bacteria 6097
1558 Ga0495601_0032962 3300053077 Bacteria 3226
1559 Ga0495601_0049973 3300053077 Bacteria 2637
1560 Ga0495601_0054419 3300053077 Bacteria 2532
1561 Ga0495601_0080604 3300053077 Bacteria 2088
1562 Ga0495601_0092159 3300053077 Bacteria 1952
1563 Ga0495601_0199401 3300053077 Bacteria 1308
1564 Ga0495612_0000056 3300053078 Bacteria 50144
1565 Ga0495612_0000154 3300053078 Bacteria 28798
1566 Ga0495612_0001726 3300053078 Bacteria 8981
1567 Ga0495612_0002268 3300053078 Bacteria 7916
1568 Ga0495612_0004956 3300053078 Bacteria 5512
1569 Ga0495612_0023868 3300053078 Bacteria 2456
1570 Ga0495612_0079755 3300053078 Bacteria 1374
1571 Ga0495612_0101463 3300053078 Bacteria 1225
1572 Ga0495655_0027909 3300053083 Bacteria 1343
1573 Ga0495595_0000032 3300053084 Bacteria 87066
1574 Ga0495595_0005189 3300053084 Bacteria 5261
1575 Ga0495595_0005799 3300053084 Bacteria 4999
1576 Ga0495595_0009928 3300053084 Bacteria 3947
1577 Ga0495595_0011977 3300053084 Bacteria 3636
1578 Ga0495595_0021898 3300053084 Bacteria 2799
1579 Ga0495595_0102244 3300053084 Bacteria 1384
1580 Ga0495619_0000033 3300053085 Bacteria 138925
1581 Ga0495619_0000206 3300053085 Bacteria 42730
1582 Ga0495619_0001397 3300053085 Bacteria 15884
1583 Ga0495619_0002416 3300053085 Bacteria 12258
1584 Ga0495619_0003323 3300053085 Bacteria 10395
1585 Ga0495619_0004683 3300053085 Bacteria 8715
1586 Ga0495619_0004828 3300053085 Bacteria 8559
1587 Ga0495619_0011415 3300053085 Bacteria 5594
1588 Ga0495619_0018328 3300053085 Bacteria 4441
1589 Ga0495619_0023944 3300053085 Bacteria 3916
1590 Ga0500643_000014 3300053087 Bacteria 318249
1591 Ga0500643_008687 3300053087 Bacteria 3966
1592 Ga0500643_021179 3300053087 Bacteria 2111
1593 Ga0500644_0001168 3300053088 Bacteria 7606
1594 Ga0500646_0034154 3300053090 Bacteria 1409
1595 Ga0500651_0203450 3300053093 Bacteria 1167
1596 Ga0500641_0018054 3300053096 Bacteria 2648
1597 Ga0500641_0019245 3300053096 Bacteria 2579
1598 Ga0500592_008051 3300053116 Bacteria 1672
1599 Ga0500593_034271 3300053117 Bacteria 2272
1600 Ga0500595_000001 3300053119 Bacteria 1088438
1601 Ga0500595_014074 3300053119 Bacteria 3046
1602 Ga0500595_031287 3300053119 Bacteria 1786
1603 Ga0500614_007698 3300053123 Bacteria 2275
1604 Ga0500652_000198 3300053131 Bacteria 23141
1605 Ga0500652_008290 3300053131 Bacteria 3456
1606 Ga0500568_0010093 3300053139 Bacteria 4446
1607 Ga0500568_0019795 3300053139 Bacteria 2919
1608 Ga0500568_0042182 3300053139 Bacteria 1829
1609 Ga0500590_000069 3300053148 Bacteria 26240
1610 Ga0500616_0000001 3300053153 Bacteria 1986011
1611 Ga0500616_0029769 3300053153 Bacteria 3002
1612 Ga0500622_0002923 3300053156 Bacteria 11874
1613 Ga0500645_001721 3300053730 Bacteria 10621
1614 Ga0500645_049098 3300053730 Bacteria 1235
1615 Ga0501084_0065110 3300054114 Bacteria 3049
1616 Ga0501084_0116070 3300054114 Bacteria 2250
1617 Ga0501084_0122937 3300054114 Bacteria 2183
1618 Ga0501084_0229387 3300054114 Bacteria 1567
1619 Ga0501082_0000028 3300060353 Bacteria 100580
1620 Ga0501082_0009479 3300060353 Bacteria 8383
1621 Ga0501082_0110937 3300060353 Bacteria 2374
1622 Ga0501082_0154198 3300060353 Bacteria 1996
1623 Ga0501082_0235725 3300060353 Bacteria 1592
1624 Ga0501082_0331571 3300060353 Bacteria 1326
1625 Ga0530510_0011090 3300061734 Bacteria 6323
1626 2524458028 2524023209 Bacteria 6679728
1627 2528851283 2528768022 Bacteria 10457665
1628 2537873416 2537561587 Bacteria 5425293
1629 2585330479 2582581316 Bacteria 7774528
1630 2599604432 2599185210 Bacteria 5624189
1631 2643758072 2643221547 Bacteria 4740017
1632 2824663837 2824661429 Bacteria 9877870
1633 2842299790 2842298080 Bacteria 6123127
1634 2842359688 2842357229 Bacteria 6485165
1635 2842698106 2842694124 Bacteria 4063419
1636 2879085824 2879083081 Bacteria 8587928
1637 2879108643 2879099564 Bacteria 10442239
1638 2899794492 2899792073 Bacteria 4926588
1639 2908776167 2908775508 Bacteria 8092255
1640 2922378711
1641 2932786696 2932784394 Bacteria 9704911
1642 2932812260 2932809354 Bacteria 9135765
1643 2932823251 2932818245 Bacteria 9955613
1644 2932829909 2932828146 Bacteria 9745859
1645 2935618427 2935616580 Bacteria 9032984
1646 2935641175 2935638405 Bacteria 10015038
1647 2935670091 2935665750 Bacteria 9571747
1648 2935680915 2935675223 Bacteria 9928132
1649 2935689930 2935684952 Bacteria 9590419
1650 2935698451 2935694250 Bacteria 9291695
1651 2935707593 2935703347 Bacteria 10242284
1652 2935717449 2935713505 Bacteria 9608509
1653 2935723881 2935722832 Bacteria 9608746
1654 2935740090 2935732158 Bacteria 9706831
1655 2935749353 2935741537 Bacteria 9707219
1656 2935757284 2935750917 Bacteria 9590372
1657 2935763630 2935760218 Bacteria 9817913
1658 2935804019 2935801545 Bacteria 9301974
1659 2935815113 2935810662 Bacteria 9401221
1660 2935830906 2935827899 Bacteria 10038562
1661 2935841516 2935837841 Bacteria 9454360
1662 2935862478 2935855204 Bacteria 9035059
1663 2935866594 2935864058 Bacteria 9784707
1664 2935874901 2935873716 Bacteria 9632195
1665 2935994407 2935992306 Bacteria 9802711
1666 2936004615 2936002035 Bacteria 9362176
1667 2936043180 2936037263 Bacteria 9446081
1668 2940563197 2940556831 Bacteria 9590747
1669 2941543114 2941538514 Bacteria 9402094
1670 3003931568 3003930520 Bacteria 5667563
1671 3005486813 3005483717 Bacteria 7877331
1672 8017058370 8017057580 Bacteria 10023680
1673 8019577331 8019576017 Bacteria 10049540
1674 8019595413 8019586578 Bacteria 10212056
1675 8019612185 8019608314 Bacteria 10042931
1676 8024491736 8024486573 Bacteria 6540512
1677 Ga0105240_10008453
1678 2214544912
1679 ARSoilYngRDRAFT_c00115
1680 ARcpr5yngRDRAFT_c000138
1681 ARSoilOldRDRAFT_c000022
1682 ARCol0oldRDRAFT_c00090
1683 ARCol0yngRDRAFT_1000298
1684 JGI24741J21665_1002162
1685 JGI24752J21851_1000975
1686 JGI24746J21847_1000142
1687 JGI24747J21853_1000031
1688 JGI24740J21852_10017351
1689 JGI24739J22299_10002500
1690 JGI24737J22298_10000810
1691 JGI24737J22298_10004702
1692 JGI24743J22301_10002841
1693 JGI24750J21931_1000449
1694 JGI24750J21931_1000469
1695 JGI24745J21846_1000493
1696 JGI24738J21930_10000005
1697 JGI24738J21930_10011740
1698 JGI24749J21850_1001021
1699 JGI24744J21845_10000321
1700 JGI24035J26624_1000798
1701 JGI24033J26618_1001439
1702 JGI24742J22300_10000339
1703 JGI24751J29686_10001874
1704 JGI25406J46586_10004567
1705 rootH1_10079649
1706 Ga0065716_1001575
1707 Ga0065712_10070481
1708 Ga0065715_10099964
1709 Ga0070658_10005336
1710 Ga0070658_10084777
1711 Ga0070658_10088275
1712 Ga0070658_10214303
1713 Ga0070676_10006098
1714 Ga0070683_100000345
1715 Ga0070683_100081994
1716 Ga0070690_100007218
1717 Ga0070690_100007975
1718 Ga0070690_100020158
1719 Ga0070690_100023517
1720 Ga0070690_100025313
1721 Ga0070690_100168260
1722 Ga0070670_100000091
1723 Ga0070670_100016360
1724 Ga0070670_100093254
1725 Ga0070670_100396066
1726 Ga0070670_100445762
1727 Ga0070677_10000732
1728 Ga0068869_100001229
1729 Ga0068869_100021486
1730 Ga0068869_100231417
1731 Ga0070666_10118435
1732 Ga0070666_10131073
1733 Ga0070680_100013303
1734 Ga0070680_100023359
1735 Ga0070680_100114813
1736 Ga0070680_100156547
1737 Ga0070680_100202946
1738 Ga0070680_100212983
1739 Ga0070680_100267695
1740 Ga0070682_100007148
1741 Ga0070682_100096171
1742 Ga0068868_100000376
1743 Ga0068868_100281968
1744 Ga0070660_100001516
1745 Ga0070660_100008936
1746 Ga0070660_100084251
1747 Ga0070689_100005739
1748 Ga0070689_100030360
1749 Ga0070691_10019629
1750 Ga0070687_100001270
1751 Ga0070692_10001450
1752 Ga0070692_10170409
1753 Ga0070668_100007889
1754 Ga0070668_100134328
1755 Ga0070668_100189587
1756 Ga0070668_100207224
1757 Ga0070669_100000873
1758 Ga0070669_100011651
1759 Ga0070669_100053555
1760 Ga0070675_100010354
1761 Ga0070675_100015993
1762 Ga0070675_100033582
1763 Ga0070675_100098146
1764 Ga0070675_100146434
1765 Ga0070671_100003341
1766 Ga0070671_100045323
1767 Ga0070671_100220132
1768 Ga0070671_100258280
1769 Ga0070674_100003182
1770 Ga0070673_100010614
1771 Ga0070673_100054055
1772 Ga0070673_100349640
1773 Ga0070688_100006558
1774 Ga0070688_100017446
1775 Ga0070688_100030065
1776 Ga0070688_100043804
1777 Ga0070659_100006313
1778 Ga0070659_100032632
1779 Ga0070659_100156297
1780 Ga0070667_100011850
1781 Ga0070667_100055986
1782 Ga0070703_10032289
1783 Ga0070703_10064961
1784 Ga0070709_10002356
1785 Ga0070709_10003391
1786 Ga0070709_10028772
1787 Ga0070709_10122286
1788 Ga0070714_100000516
1789 Ga0070714_100009307
1790 Ga0070714_100032390
1791 Ga0070714_100058999
1792 Ga0070714_100252319
1793 Ga0070714_100287574
1794 Ga0070713_100000228
1795 Ga0070713_100004346
1796 Ga0070713_100025482
1797 Ga0070713_100104233
1798 Ga0070710_10000438
1799 Ga0070710_10003280
1800 Ga0070710_10080200
1801 Ga0070701_10003647
1802 Ga0070711_100000998
1803 Ga0070711_100060588
1804 Ga0070711_100153171
1805 Ga0070711_100168127
1806 Ga0070711_100187110
1807 Ga0070711_100317504
1808 Ga0070705_100009011
1809 Ga0070705_100049550
1810 Ga0070705_100094544
1811 Ga0070705_100297650
1812 Ga0070700_100015500
1813 Ga0070700_100017964
1814 Ga0070700_100080731
1815 Ga0070694_100000312
1816 Ga0070694_100008055
1817 Ga0070708_100072490
1818 Ga0070663_100008241
1819 Ga0070663_100043993
1820 Ga0070663_100092601
1821 Ga0070678_100001343
1822 Ga0070678_100036419
1823 Ga0070678_100047901
1824 Ga0070678_100077082
1825 Ga0070662_100007995
1826 Ga0070662_100025872
1827 Ga0070662_100091445
1828 Ga0070681_10005438
1829 Ga0070681_10012552
1830 Ga0070681_10023289
1831 Ga0070681_10132045
1832 Ga0070681_10133037
1833 Ga0070681_10259780
1834 Ga0068867_100022236
1835 Ga0068867_100371518
1836 Ga0070685_10000596
1837 Ga0070685_10024426
1838 Ga0070707_100213347
1839 Ga0070699_100490949
1840 Ga0070679_100005039
1841 Ga0070679_100020021
1842 Ga0070679_100066434
1843 Ga0070679_100177525
1844 Ga0070679_100206546
1845 Ga0070679_100298213
1846 Ga0070684_100001973
1847 Ga0070684_100039621
1848 Ga0068853_100007072
1849 Ga0068853_100031218
1850 Ga0068853_100034006
1851 Ga0070672_100005148
1852 Ga0070672_100030325
1853 Ga0070672_100031508
1854 Ga0070672_100208814
1855 Ga0070686_100006737
1856 Ga0070686_100015768
1857 Ga0070686_100050993
1858 Ga0070686_100057244
1859 Ga0070686_100262914
1860 Ga0070695_100008048
1861 Ga0070695_100020280
1862 Ga0070696_100016735
1863 Ga0070696_100068309
1864 Ga0070693_100003223
1865 Ga0070693_100015829
1866 Ga0070693_100156777
1867 Ga0070665_100007650
1868 Ga0070665_100120660
1869 Ga0070665_100166427
1870 Ga0070665_100370760
1871 Ga0070665_100494379
1872 Ga0070704_100001543
1873 Ga0070704_100005924
1874 Ga0070704_100023069
1875 Ga0070704_100419974
1876 Ga0068855_100032524
1877 Ga0068855_100066754
1878 Ga0068855_100118675
1879 Ga0068855_100121490
1880 Ga0068855_100123908
1881 Ga0068855_100146497
1882 Ga0068855_100311759
1883 Ga0070664_100014789
1884 Ga0070664_100054900
1885 Ga0070664_100217341
1886 Ga0070664_100480036
1887 Ga0068857_100013315
1888 Ga0068857_100180762
1889 Ga0068857_100215951
1890 Ga0068854_100001754
1891 Ga0068854_100016161
1892 Ga0068854_100096809
1893 Ga0068856_100021987
1894 Ga0068856_100032409
1895 Ga0068856_100117928
1896 Ga0070702_100000021
1897 Ga0070702_100010590
1898 Ga0068852_100013544
1899 Ga0068852_100024110
1900 Ga0068852_100028980
1901 Ga0068852_100139038
1902 Ga0068859_100053512
1903 Ga0068859_100461155
1904 Ga0068864_100001093
1905 Ga0068864_100029107
1906 Ga0068864_100046960
1907 Ga0068864_100310437
1908 Ga0068866_10002066
1909 Ga0068866_10033138
1910 Ga0068866_10102328
1911 Ga0068866_10157407
1912 Ga0068861_100007979
1913 Ga0068861_100033843
1914 Ga0068861_100148568
1915 Ga0068851_10049927
1916 Ga0068851_10165064
1917 Ga0068870_10000128
1918 Ga0068870_10066126
1919 Ga0068863_100020069
1920 Ga0068863_100022637
1921 Ga0068863_100127966
1922 Ga0068858_100019007
1923 Ga0068858_100019312
1924 Ga0068858_100132866
1925 Ga0068858_100235693
1926 Ga0068858_100381333
1927 Ga0068860_100037706
1928 Ga0068860_100040135
1929 Ga0068860_100048205
1930 Ga0068860_100307691
1931 Ga0068862_100005880
1932 Ga0068862_100038468
1933 Ga0068862_100165979
1934 Ga0068862_100219794
1935 Ga0081455_10000002
1936 Ga0081455_10001227
1937 Ga0081455_10013377
1938 Ga0081455_10035412
1939 Ga0081455_10212057
1940 Ga0081538_10002294
1941 Ga0081538_10102419
1942 Ga0081540_1000569
1943 Ga0081540_1002980
1944 Ga0081540_1008410
1945 Ga0081540_1013731
1946 Ga0081539_10004324
1947 Ga0081539_10011185
1948 Ga0070717_10001441
1949 Ga0070717_10001451
1950 Ga0070717_10136392
1951 Ga0070717_10178142
1952 Ga0070717_10290952
1953 Ga0075365_10098960
1954 Ga0075368_10003235
1955 Ga0075363_100002280
1956 Ga0075363_100002849
1957 Ga0075363_100058149
1958 Ga0075364_10005121
1959 Ga0070715_10006066
1960 Ga0070715_10037893
1961 Ga0070715_10059215
1962 Ga0070715_10153182
1963 Ga0070716_100002431
1964 Ga0070716_100012858
1965 Ga0070712_100004538
1966 Ga0070712_100022226
1967 Ga0070712_100033200
1968 Ga0070712_100329075
1969 Ga0075362_10002098
1970 Ga0075367_10004832
1971 Ga0075367_10030132
1972 Ga0075367_10042737
1973 Ga0075367_10111494
1974 Ga0075367_10132308
1975 Ga0075367_10145667
1976 Ga0075369_10003186
1977 Ga0075427_10003543
1978 Ga0075366_10002193
1979 Ga0075366_10056751
1980 Ga0075366_10110273
1981 Ga0097621_100000012
1982 Ga0097621_100077690
1983 Ga0068871_100000138
1984 Ga0068871_100003229
1985 Ga0068871_100066657
1986 Ga0068871_100129205
1987 Ga0075428_100003156
1988 Ga0075428_100035411
1989 Ga0075428_100186443
1990 Ga0075430_100000683
1991 Ga0075430_100043547
1992 Ga0075431_100003071
1993 Ga0075431_100056737
1994 Ga0075431_100079468
1995 Ga0075431_100481578
1996 Ga0075433_10000266
1997 Ga0075433_10096046
1998 Ga0075433_10109512
1999 Ga0075433_10113418
2000 Ga0075433_10189584
2001 Ga0075433_10248137
2002 Ga0075433_10258130
2003 Ga0075434_100000350
2004 Ga0075434_100004062
2005 Ga0075434_100025533
2006 Ga0075434_100164662
2007 Ga0075434_100233376
2008 Ga0075434_100325004
2009 Ga0075429_100002242
2010 Ga0068865_100002683
2011 Ga0068865_100004534
2012 Ga0075436_100001243
2013 Ga0075436_100047350
2014 Ga0075436_100051287
2015 Ga0097620_100053514
2016 Ga0097620_100461142
2017 Ga0099825_1026215
2018 Ga0099823_1073227
2019 Ga0075435_100000890
2020 Ga0075435_100159469
2021 Ga0075435_100166878
2022 Ga0099794_10032701
2023 Ga0099794_10102797
2024 Ga0105251_10020694
2025 Ga0105240_10000024
2026 Ga0105240_10046080
2027 Ga0105240_10062192
2028 Ga0105240_10253927
2029 Ga0105240_10399259
2030 Ga0111539_10000789
2031 Ga0111539_10010846
2032 Ga0111539_10024989
2033 Ga0111539_10068891
2034 Ga0111539_10090299
2035 Ga0111539_10096871
2036 Ga0111539_10104175
2037 Ga0111539_10249156
2038 Ga0111539_10334326
2039 Ga0105245_10000925
2040 Ga0105245_10002861
2041 Ga0105245_10073287
2042 Ga0105245_10086442
2043 Ga0105245_10663491
2044 Ga0105247_10010607
2045 Ga0105247_10057428
2046 Ga0105247_10339363
2047 Ga0114129_10000759
2048 Ga0114129_10000935
2049 Ga0114129_10002014
2050 Ga0114129_10038647
2051 Ga0114129_10062023
2052 Ga0114129_10119138
2053 Ga0114129_10175301
2054 Ga0114129_10196919
2055 Ga0105243_10012646
2056 Ga0105243_10021908
2057 Ga0105243_10103353
2058 Ga0105243_10210515
2059 Ga0105243_10520996
2060 Ga0105241_10004258
2061 Ga0105241_10074146
2062 Ga0105241_10089569
2063 Ga0105242_10005000
2064 Ga0105242_10028441
2065 Ga0105242_10158100
2066 Ga0105242_10392195
2067 Ga0105242_10435330
2068 Ga0105248_10006082
2069 Ga0105248_10027254
2070 Ga0105248_10107219
2071 Ga0105248_10283913
2072 Ga0105248_10317029
2073 Ga0105237_10002267
2074 Ga0105237_10070436
2075 Ga0105237_10177567
2076 Ga0105238_10022578
2077 Ga0105238_10025325
2078 Ga0105238_10029376
2079 Ga0105238_10050832
2080 Ga0105249_10004141
2081 Ga0105249_10018008
2082 Ga0105249_10018236
2083 Ga0105249_10235076
2084 Ga0105249_10359822
2085 Ga0105249_10416972
2086 Ga0105249_10637745
2087 Ga0105239_10001386
2088 Ga0105239_10058278
2089 Ga0105239_10115135
2090 Ga0105239_10315836
2091 Ga0105239_10437408
2092 Ga0105239_10504393
2093 Ga0105246_10008127
2094 Ga0105246_10106667
2095 Ga0105246_10219980
2096 Ga0157336_1000695
2097 Ga0157342_1003003
2098 Ga0157338_1000839
2099 Ga0157338_1001291
2100 Ga0157373_10022700
2101 Ga0157373_10028826
2102 Ga0157373_10075079
2103 Ga0157371_10008660
2104 Ga0157371_10238067
2105 Ga0157370_10000180
2106 Ga0157370_10015656
2107 Ga0157370_10093961
2108 Ga0157369_10017624
2109 Ga0157374_10001601
2110 Ga0157374_10013850
2111 Ga0157378_10002020
2112 Ga0157378_10045512
2113 Ga0157378_10076853
2114 Ga0157378_10410686
2115 Ga0163162_10020934
2116 Ga0163162_10021331
2117 Ga0163162_10134579
2118 Ga0163162_10351522
2119 Ga0157372_10111034
2120 Ga0157372_10141931
2121 Ga0157372_10506593
2122 Ga0157375_10001500
2123 Ga0157375_10096785
2124 Ga0157375_10210424
2125 Ga0157375_10748079
2126 Ga0163163_10019456
2127 Ga0163163_10019635
2128 Ga0163163_10134358
2129 Ga0163163_10202048
2130 Ga0157380_10006688
2131 Ga0157380_10058984
2132 Ga0157380_10116274
2133 Ga0157377_10001219
2134 Ga0157377_10004034
2135 Ga0157379_10046013
2136 Ga0157379_10058507
2137 Ga0157379_10082837
2138 Ga0157376_10001430
2139 Ga0157376_10136269
2140 Ga0163161_10001393
2141 Ga0163161_10041464
2142 Ga0163161_10112486
2143 Ga0206354_11266181
2144 Ga0213876_10004936
2145 Ga0213875_10000031
2146 Ga0228598_1000332
2147 Ga0209677_100837
2148 Ga0209233_1003871
2149 Ga0209233_1013175
2150 Ga0207666_1000163
2151 Ga0209455_1015801
2152 Ga0209758_1000634
2153 Ga0209758_1004442
2154 Ga0209758_1029772
2155 Ga0207697_10005022
2156 Ga0207697_10018719
2157 Ga0207653_10078965
2158 Ga0207682_10000064
2159 Ga0207692_10001996
2160 Ga0207692_10002828
2161 Ga0207692_10093833
2162 Ga0207642_10064958
2163 Ga0207642_10081206
2164 Ga0207642_10115202
2165 Ga0207642_10136785
2166 Ga0207710_10005111
2167 Ga0207688_10000659
2168 Ga0207688_10006579
2169 Ga0207680_10111632
2170 Ga0207647_10008358
2171 Ga0207647_10018502
2172 Ga0207647_10032237
2173 Ga0207685_10005621
2174 Ga0207685_10107120
2175 Ga0207699_10010235
2176 Ga0207699_10011012
2177 Ga0207699_10025399
2178 Ga0207699_10164655
2179 Ga0207699_10197781
2180 Ga0207645_10000040
2181 Ga0207645_10006029
2182 Ga0207645_10048545
2183 Ga0207643_10000072
2184 Ga0207705_10056668
2185 Ga0207705_10064919
2186 Ga0207684_10018395
2187 Ga0207654_10100886
2188 Ga0207654_10120835
2189 Ga0207707_10013269
2190 Ga0207707_10017843
2191 Ga0207707_10029037
2192 Ga0207707_10461227
2193 Ga0207695_10000036
2194 Ga0207695_10020001
2195 Ga0207695_10078328
2196 Ga0207695_10133015
2197 Ga0207695_10430576
2198 Ga0207671_10000191
2199 Ga0207671_10005373
2200 Ga0207693_10003700
2201 Ga0207693_10005910
2202 Ga0207693_10009265
2203 Ga0207693_10009447
2204 Ga0207693_10010740
2205 Ga0207693_10035352
2206 Ga0207693_10083946
2207 Ga0207693_10095942
2208 Ga0207693_10169440
2209 Ga0207693_10193953
2210 Ga0207663_10029576
2211 Ga0207663_10121899
2212 Ga0207663_10142145
2213 Ga0207660_10000501
2214 Ga0207660_10050112
2215 Ga0207660_10241393
2216 Ga0207660_10309826
2217 Ga0207662_10002825
2218 Ga0207662_10006747
2219 Ga0207662_10006755
2220 Ga0207662_10053843
2221 Ga0207657_10020092
2222 Ga0207657_10020692
2223 Ga0207657_10021548
2224 Ga0207657_10031123
2225 Ga0207657_10065767
2226 Ga0207649_10003387
2227 Ga0207649_10025473
2228 Ga0207649_10204018
2229 Ga0207652_10018767
2230 Ga0207652_10060283
2231 Ga0207652_10184023
2232 Ga0207646_10139946
2233 Ga0207681_10000539
2234 Ga0207681_10097483
2235 Ga0207694_10029108
2236 Ga0207694_10133104
2237 Ga0207650_10000415
2238 Ga0207650_10001724
2239 Ga0207650_10030779
2240 Ga0207650_10038239
2241 Ga0207650_10280441
2242 Ga0207659_10000444
2243 Ga0207659_10042773
2244 Ga0207659_10095486
2245 Ga0207659_10134336
2246 Ga0207659_10178803
2247 Ga0207687_10000144
2248 Ga0207687_10013684
2249 Ga0207687_10480554
2250 Ga0207700_10000458
2251 Ga0207700_10015033
2252 Ga0207700_10052748
2253 Ga0207700_10094978
2254 Ga0207700_10144937
2255 Ga0207664_10000692
2256 Ga0207664_10002435
2257 Ga0207664_10081446
2258 Ga0207664_10090775
2259 Ga0207664_10331276
2260 Ga0207644_10001694
2261 Ga0207644_10007950
2262 Ga0207690_10000086
2263 Ga0207690_10072373
2264 Ga0207690_10310675
2265 Ga0207706_10001993
2266 Ga0207706_10003068
2267 Ga0207706_10003497
2268 Ga0207706_10019399
2269 Ga0207706_10085984
2270 Ga0207706_10109552
2271 Ga0207706_10120845
2272 Ga0207686_10000973
2273 Ga0207686_10149733
2274 Ga0207709_10000431
2275 Ga0207709_10120544
2276 Ga0207670_10001153
2277 Ga0207670_10001643
2278 Ga0207670_10003991
2279 Ga0207670_10022367
2280 Ga0207669_10000228
2281 Ga0207669_10003549
2282 Ga0207669_10067393
2283 Ga0207669_10131214
2284 Ga0207704_10000107
2285 Ga0207704_10349102
2286 Ga0207665_10005548
2287 Ga0207665_10007482
2288 Ga0207691_10001173
2289 Ga0207691_10002332
2290 Ga0207691_10102780
2291 Ga0207691_10462469
2292 Ga0207711_10001611
2293 Ga0207711_10037079
2294 Ga0207711_10071891
2295 Ga0207689_10000115
2296 Ga0207689_10019975
2297 Ga0207689_10058235
2298 Ga0207689_10079235
2299 Ga0207689_10336150
2300 Ga0207661_10000427
2301 Ga0207661_10143082
2302 Ga0207661_10152722
2303 Ga0207679_10000025
2304 Ga0207679_10009981
2305 Ga0207679_10102337
2306 Ga0207679_10190077
2307 Ga0207679_10417118
2308 Ga0207667_10018931
2309 Ga0207667_10068500
2310 Ga0207667_10182532
2311 Ga0207651_10000081
2312 Ga0207651_10017679
2313 Ga0207651_10378181
2314 Ga0207651_10398565
2315 Ga0207712_10001191
2316 Ga0207712_10010168
2317 Ga0207668_10000171
2318 Ga0207640_10000631
2319 Ga0207640_10161933
2320 Ga0207640_10167234
2321 Ga0207658_10005655
2322 Ga0207658_10064999
2323 Ga0207658_10072350
2324 Ga0207677_10000447
2325 Ga0207703_10002461
2326 Ga0207703_10016409
2327 Ga0207703_10045609
2328 Ga0207703_10082095
2329 Ga0207703_10266990
2330 Ga0207639_10001124
2331 Ga0207639_10324804
2332 Ga0207678_10006341
2333 Ga0207678_10016727
2334 Ga0207678_10040686
2335 Ga0207678_10110966
2336 Ga0207708_10004257
2337 Ga0207708_10013006
2338 Ga0207708_10013024
2339 Ga0207708_10193573
2340 Ga0207702_10001906
2341 Ga0207702_10035301
2342 Ga0207702_10483841
2343 Ga0207702_10594234
2344 Ga0207641_10001385
2345 Ga0207641_10060666
2346 Ga0207641_10099338
2347 Ga0207641_10099376
2348 Ga0207641_10129430
2349 Ga0207641_10163454
2350 Ga0207641_10355597
2351 Ga0207648_10054328
2352 Ga0207648_10241375
2353 Ga0207648_10270036
2354 Ga0207676_10010826
2355 Ga0207676_10064322
2356 Ga0207676_10112109
2357 Ga0207676_10169321
2358 Ga0207674_10001963
2359 Ga0207674_10030777
2360 Ga0207674_10041706
2361 Ga0207674_10106752
2362 Ga0207674_10182274
2363 Ga0207675_100002006
2364 Ga0207675_100015436
2365 Ga0207675_100021400
2366 Ga0207675_100098921
2367 Ga0207683_10000001
2368 Ga0207683_10011391
2369 Ga0207683_10014385
2370 Ga0207683_10052773
2371 Ga0207698_10000531
2372 Ga0207698_10016679
2373 Ga0207698_10246809
2374 Ga0207698_10429227
2375 Ga0209389_1000153
2376 Ga0209489_100936
2377 Ga0209700_100011
2378 Ga0210002_1007289
2379 Ga0209588_1045738
2380 Ga0209971_1015712
2381 Ga0209966_1000744
2382 Ga0209966_1004200
2383 Ga0209998_10005098
2384 Ga0209998_10011877
2385 Ga0209974_10005645
2386 Ga0207428_10000221
2387 Ga0207428_10000374
2388 Ga0207428_10000524
2389 Ga0207428_10091574
2390 Ga0268266_10022478
2391 Ga0268266_10095530
2392 Ga0268266_10125364
2393 Ga0268266_10485293
2394 Ga0268265_10002636
2395 Ga0268265_10230733
2396 Ga0268264_10000886
2397 Ga0268264_10007945
2398 Ga0268264_10255311
2399 Ga0268264_10545222
2400 Ga0265337_1002520
2401 Ga0265318_10012161
2402 Ga0265338_10034655
2403 Ga0265330_10026153
2404 Ga0265330_10033066
2405 Ga0265330_10065930
2406 Ga0265330_10067502
2407 Ga0265320_10008506
2408 Ga0265325_10000095
2409 Ga0265325_10000238
2410 Ga0265325_10010377
2411 Ga0265325_10017266
2412 Ga0265325_10022512
2413 Ga0265325_10035754
2414 Ga0265325_10093922
2415 Ga0265329_10021859
2416 Ga0265340_10015759
2417 Ga0265339_10000051
2418 Ga0265339_10014949
2419 Ga0265339_10016577
2420 Ga0265339_10073737
2421 Ga0265339_10110678
2422 Ga0265331_10010219
2423 Ga0265331_10054659
2424 Ga0265331_10124001
2425 Ga0265316_10055514
2426 Ga0265316_10184635
2427 Ga0307509_10151458
2428 Ga0307408_100072066
2429 Ga0265313_10000011
2430 Ga0265313_10001977
2431 Ga0265313_10007848
2432 Ga0265313_10020261
2433 Ga0265313_10084957
2434 Ga0265313_10101515
2435 Ga0316579_10002505
2436 Ga0265314_10001044
2437 Ga0265314_10019890
2438 Ga0265314_10221629
2439 Ga0265342_10000367
2440 Ga0265342_10005329
2441 Ga0265342_10019764
2442 Ga0265342_10136028
2443 Ga0316578_10048114
2444 Ga0307409_100080979
2445 Ga0307416_100431832
2446 Ga0316583_10001321
2447 Ga0307510_10226573
2448 Ga0373930_0002702
2449 Ga0373948_0000586
2450 Ga0373948_0004324
2451 Ga0373950_0002705
2452 Ga0373950_0004683
2453 Ga0373959_0000346
2454 Ga0373938_0000019
2455 Ga0373938_0000500
2456 Ga0373926_0022520
2457 Ga0373926_0064608
2458 Ga0373928_0000086
2459 Ga0373929_0002104
2460 Ga0373934_0038930
2461 Ga0373940_0000128
2462 Ga0373940_0015602
2463 Ga0373940_0017215
2464 Ga0373944_0000472
2465 Ga0373944_0001073
2466 Ga0373944_0012540
2467 Ga0373949_0001092
2468 Ga0373949_0001874
2469 Ga0373951_0002197
2470 Ga0373952_0000337
2471 Ga0373952_0017082
2472 Ga0373923_0034447
2473 Ga0373923_0096235
2474 Ga0373932_0000684
2475 Ga0373932_0011414
2476 Ga0373936_0002845
2477 Ga0373936_0021363
2478 Ga0373936_0119764
2479 Ga0373939_0000537
2480 Ga0373939_0012799
2481 Ga0373939_0016529
2482 Ga0373941_0000130
2483 Ga0373941_0009489
2484 Ga0373941_0019114
2485 Ga0373945_0001076
2486 Ga0373945_0015805
2487 Ga0373945_0072476
2488 Ga0373945_0075655
2489 Ga0373953_0001623
2490 Ga0373953_0014816
2491 Ga0373953_0050506
2492 Ga0373954_0010286
2493 Ga0373954_0052451
2494 Ga0373954_0105080
2495 Ga0373956_0031832
2496 Ga0373956_0031873
2497 Ga0373956_0046252
2498 Ga0373957_0019620
2499 Ga0373957_0053530
2500 Ga0373957_0090821
2501 Ga0373960_0022935
2502 Ga0373943_0012213
2503 Ga0373943_0025061
2504 Ga0373943_0028196
2505 Ga0373943_0042659
2506 Ga0373943_0058877
2507 Ga0373943_0064396
2508 Ga0373943_0151609
2509 Ga0373946_0009917
2510 Ga0373946_0020297
2511 Ga0373946_0030130
2512 Ga0373946_0030202
2513 Ga0373946_0093789
2514 Ga0373946_0103836
2515 Ga0373955_0001240
2516 Ga0373955_0004568
2517 Ga0373955_0004598
2518 Ga0373955_0124028
2519 Ga0373942_0000650
2520 Ga0373942_0002645
2521 Ga0373942_0077150
2522 Ga0373961_0001156
2523 Ga0373961_0013154
2524 Ga0373962_0000281
2525 Ga0373962_0003190
2526 Ga0373962_0032757
2527 Ga0316574_0039340
2528 Ga0373924_0000635
2529 Ga0373924_0004146
2530 Ga0373924_0005822
2531 Ga0373924_0022743
2532 Ga0373924_0029106
2533 Ga0373924_0033888
2534 Ga0373931_0004016
2535 Ga0373931_0004777
2536 Ga0373931_0035877
2537 Ga0373931_0102290
2538 Ga0373931_0106433
2539 Ga0373931_0248280
2540 Ga0373935_0002667
2541 Ga0373935_0003893
2542 Ga0373935_0021979
2543 Ga0373935_0039012
2544 Ga0373935_0046689
2545 Ga0373935_0094775
2546 Ga0373935_0141185
2547 Ga0373935_0172953
2548 Ga0373927_0008477
2549 Ga0373927_0013111
2550 Ga0373927_0018038
2551 Ga0373927_0058352
2552 Ga0373927_0071247
2553 Ga0373927_0135461
2554 Ga0373927_0178451
2555 Ga0373927_0197380
2556 Ga0373927_0228883
2557 Ga0373933_0001633
2558 Ga0373933_0001683
2559 Ga0373933_0002774
2560 Ga0373933_0018474
2561 Ga0373933_0062962
2562 Ga0373933_0167235
2563 Ga0373947_0000169
2564 Ga0373947_0011727
2565 Ga0373947_0016872
2566 Ga0373947_0034868
2567 Ga0373947_0067004
2568 Ga0373947_0073998
2569 Ga0373947_0141490
2570 Ga0373947_0153081
2571 Ga0373947_0230202
2572 Ga0373937_0000075
2573 Ga0373937_0002452
2574 Ga0373937_0007161
2575 Ga0373937_0008142
2576 Ga0373937_0009623
2577 Ga0373937_0062499
2578 Ga0373937_0259048
2579 Ga0373937_0310407
2580 Ga0316582_0051301
2581 Ga0316584_0051145
2582 Ga0373925_0000159
2583 Ga0373925_0002536
2584 Ga0373925_0011850
2585 Ga0373925_0030508
2586 Ga0373925_0053580
2587 Ga0373925_0060582
2588 Ga0373925_0067035
2589 Ga0373925_0127140
2590 Ga0373925_0135420
2591 Ga0373925_0193802
2592 Ga0373925_0351132
2593 Ga0395899_0014324
2594 Ga0395899_0061279
2595 Ga0395899_0143330
2596 Ga0395900_0013523
2597 Ga0395900_0060104
2598 Ga0395900_0434002
2599 Ga0395900_0584945
2600 Ga0395898_0007764
2601 Ga0395898_0026676
2602 Ga0395898_0049193
2603 Ga0395898_0188870
2604 Ga0395905_0003532
2605 Ga0395905_0049932
2606 Ga0395905_0431940
2607 Ga0436364_0743503
2608 Ga0395901_0006371
2609 Ga0395901_0161252
2610 Ga0395901_0251165
2611 Ga0395901_0361685
2612 Ga0395901_0395919
2613 Ga0242420_002129
2614 Ga0400483_253337
2615 Ga0436365_0208174
2616 Ga0436365_1154146
2617 Ga0436365_1691170
2618 Ga0436365_1739170
2619 Ga0436360_1037609
2620 Ga0436361_0155268
2621 Ga0436361_0422998
2622 Ga0436361_0871492
2623 Ga0436363_0274435
2624 Ga0466972_0000214
2625 Ga0466965_0194092
2626 Ga0466966_0000209
2627 Ga0466966_0066768
2628 Ga0466961_0093408
2629 Ga0466963_0041247
2630 Ga0466963_0070403
2631 Ga0466963_0088271
2632 Ga0466963_0199405
2633 Ga0453684_0027976
2634 Ga0466957_0017743
2635 Ga0466957_0160638
2636 Ga0466957_0213141
2637 Ga0451576_0003944
2638 Ga0466958_0028754
2639 Ga0466967_0332602
2640 Ga0466967_0335766
2641 Ga0495617_006346
2642 Ga0495592_0000392
2643 Ga0495592_0037845
2644 Ga0495592_0043951
2645 Ga0495592_0045235
2646 Ga0495592_0045416
2647 Ga0495592_0050180
2648 Ga0495592_0240685
2649 Ga0495603_0010692
2650 Ga0495603_0064972
2651 Ga0495603_0073240
2652 Ga0495629_0000230
2653 Ga0495629_0000948
2654 Ga0495629_0050112
2655 Ga0495629_0071692
2656 Ga0495629_0101703
2657 Ga0495629_0132443
2658 Ga0495629_0269188
2659 Ga0495638_0028884
2660 Ga0495641_0071447
2661 Ga0495651_0002849
2662 Ga0495651_0014204
2663 Ga0495651_0131250
2664 Ga0495651_0140040
2665 Ga0495651_0269236
2666 Ga0495653_0000036
2667 Ga0495653_0004021
2668 Ga0495653_0038647
2669 Ga0495653_0079395
2670 Ga0495653_0158689
2671 Ga0495653_0219880
2672 Ga0495580_0001068
2673 Ga0495580_0039737
2674 Ga0495580_0045082
2675 Ga0495580_0054321
2676 Ga0495582_0005508
2677 Ga0495582_0022528
2678 Ga0495582_0030243
2679 Ga0495582_0076888
2680 Ga0495639_0004161
2681 Ga0495639_0045698
2682 Ga0495662_0005220
2683 Ga0495662_0011941
2684 Ga0495662_0011970
2685 Ga0495662_0016876
2686 Ga0495662_0048421
2687 Ga0495662_0133172
2688 Ga0495664_0000107
2689 Ga0495664_0000120
2690 Ga0495664_0032517
2691 Ga0495664_0057517
2692 Ga0495584_0036368
2693 Ga0495584_0076333
2694 Ga0495584_0117585
2695 Ga0495585_0014848
2696 Ga0495594_0017109
2697 Ga0495594_0056247
2698 Ga0495607_0025317
2699 Ga0495606_0015828
2700 Ga0495606_0033243
2701 Ga0495606_0111860
2702 Ga0495608_0000006
2703 Ga0495608_0006645
2704 Ga0495608_0017571
2705 Ga0495608_0058209
2706 Ga0495608_0138837
2707 Ga0495608_0303567
2708 Ga0495610_0044303
2709 Ga0495616_0087390
2710 Ga0495618_0000057
2711 Ga0495618_0006172
2712 Ga0495618_0017945
2713 Ga0495618_0037015
2714 Ga0495618_0046220
2715 Ga0495618_0128275
2716 Ga0495628_0000077
2717 Ga0495628_0001017
2718 Ga0495628_0070137
2719 Ga0495628_0073107
2720 Ga0495628_0164732
2721 Ga0495630_0010058
2722 Ga0495630_0023765
2723 Ga0495630_0023931
2724 Ga0495630_0134099
2725 Ga0495630_0262825
2726 Ga0495631_0115490
2727 Ga0495637_0081291
2728 Ga0495644_0001361
2729 Ga0495648_0003063
2730 Ga0495648_0171813
2731 Ga0495666_0005491
2732 Ga0495652_0000005
2733 Ga0495652_0005022
2734 Ga0495652_0006915
2735 Ga0495652_0017324
2736 Ga0495652_0082543
2737 Ga0495652_0098349
2738 Ga0495652_0155327
2739 Ga0495665_0012704
2740 Ga0495665_0030569
2741 Ga0495640_0000007
2742 Ga0495640_0004278
2743 Ga0495640_0004293
2744 Ga0495640_0022947
2745 Ga0495640_0027919
2746 Ga0495640_0109575
2747 Ga0495586_0006241
2748 Ga0495586_0007424
2749 Ga0495586_0097638
2750 Ga0495587_0000043
2751 Ga0495587_0003087
2752 Ga0495587_0019862
2753 Ga0495587_0044036
2754 Ga0495587_0208000
2755 Ga0495609_0069858
2756 Ga0495645_0000275
2757 Ga0495645_0000755
2758 Ga0495645_0007548
2759 Ga0495622_0005859
2760 Ga0495633_0001157
2761 Ga0495667_0000023
2762 Ga0495667_0001576
2763 Ga0495667_0002302
2764 Ga0495667_0053686
2765 Ga0495667_0067078
2766 Ga0495667_0075895
2767 Ga0495667_0088746
2768 Ga0495656_0000359
2769 Ga0495656_0038258
2770 Ga0495634_0000049
2771 Ga0495634_0009596
2772 Ga0495634_0033367
2773 Ga0495634_0054566
2774 Ga0495634_0091956
2775 Ga0495634_0110347
2776 Ga0495634_0156386
2777 Ga0495611_0002507
2778 Ga0495611_0148129
2779 Ga0495625_0087352
2780 Ga0495635_0000021
2781 Ga0495635_0001668
2782 Ga0495635_0011446
2783 Ga0495635_0064462
2784 Ga0495659_0000813
2785 Ga0495588_0011785
2786 Ga0495657_0000063
2787 Ga0495657_0006384
2788 Ga0495657_0016328
2789 Ga0495657_0034745
2790 Ga0495657_0066003
2791 Ga0495657_0124580
2792 Ga0495657_0130300
2793 Ga0495657_0179701
2794 Ga0495599_0000001
2795 Ga0495599_0002299
2796 Ga0495599_0023249
2797 Ga0495599_0174819
2798 Ga0495623_0001477
2799 Ga0495623_0005062
2800 Ga0495623_0008538
2801 Ga0495623_0050507
2802 Ga0495646_0000007
2803 Ga0495646_0003535
2804 Ga0495646_0035326
2805 Ga0495646_0050753
2806 Ga0495647_0004212
2807 Ga0495658_0000713
2808 Ga0495658_0005516
2809 Ga0495658_0200649
2810 Ga0495658_0272559
2811 Ga0495669_0100425
2812 Ga0495613_0037875
2813 Ga0495613_0048799
2814 Ga0495613_0050643
2815 Ga0495613_0071574
2816 Ga0495613_0105310
2817 Ga0495613_0144087
2818 Ga0495613_0229010
2819 Ga0495613_0252370
2820 Ga0495624_0018677
2821 Ga0495624_0021235
2822 Ga0495624_0037168
2823 Ga0495624_0166695
2824 Ga0495624_0171008
2825 Ga0495670_0004344
2826 Ga0495670_0020357
2827 Ga0495671_0111812
2828 Ga0495649_0009260
2829 Ga0495589_0109610
2830 Ga0495600_0000206
2831 Ga0495600_0222593
2832 Ga0495581_0029390
2833 Ga0495581_0039507
2834 Ga0495581_0085314
2835 Ga0495604_0000014
2836 Ga0495604_0001877
2837 Ga0495604_0010329
2838 Ga0495604_0019348
2839 Ga0495604_0034368
2840 Ga0495604_0042569
2841 Ga0495604_0148821
2842 Ga0495604_0177369
2843 Ga0495604_0256414
2844 Ga0495674_0000014
2845 Ga0495674_0001292
2846 Ga0495674_0002324
2847 Ga0495674_0055130
2848 Ga0495674_0060717
2849 Ga0495674_0111983
2850 Ga0495674_0114693
2851 Ga0495674_0126959
2852 Ga0495674_0201952
2853 Ga0495674_0268196
2854 Ga0495674_0279885
2855 Ga0495672_0001150
2856 Ga0495676_0152147
2857 Ga0495676_0201316
2858 Ga0495680_0000636
2859 Ga0495680_0004579
2860 Ga0495680_0008334
2861 Ga0495680_0009331
2862 Ga0495680_0023694
2863 Ga0495680_0045950
2864 Ga0495680_0098463
2865 Ga0495680_0296975
2866 Ga0495675_0000327
2867 Ga0495675_0001359
2868 Ga0495675_0041954
2869 Ga0495677_0022847
2870 Ga0495677_0112342
2871 Ga0495684_0000272
2872 Ga0495684_0006153
2873 Ga0495684_0009342
2874 Ga0495684_0031447
2875 Ga0495684_0057267
2876 Ga0495684_0089256
2877 Ga0495684_0202170
2878 Ga0495686_0038011
2879 Ga0495593_0005467
2880 Ga0495593_0015589
2881 Ga0495593_0015897
2882 Ga0495593_0029935
2883 Ga0495593_0033866
2884 Ga0495593_0093175
2885 Ga0495602_0000017
2886 Ga0495602_0004680
2887 Ga0495602_0004999
2888 Ga0495602_0017445
2889 Ga0495602_0045757
2890 Ga0495626_0085806
2891 Ga0496100_0000600
2892 Ga0496100_0008700
2893 Ga0496100_0029110
2894 Ga0496100_0084207
2895 Ga0496100_0111425
2896 Ga0496100_0122365
2897 Ga0496100_0170619
2898 Ga0496100_0210005
2899 Ga0496100_0273222
2900 Ga0496101_0000728
2901 Ga0496101_0002748
2902 Ga0496101_0008638
2903 Ga0496101_0017034
2904 Ga0496101_0102046
2905 Ga0496101_0170920
2906 Ga0496101_0224303
2907 Ga0496101_0244644
2908 Ga0496102_0031318
2909 Ga0496102_0039588
2910 Ga0496102_0056005
2911 Ga0496103_0026782
2912 Ga0496103_0165887
2913 Ga0496104_0000232
2914 Ga0496104_0006145
2915 Ga0496104_0009679
2916 Ga0496104_0013139
2917 Ga0496104_0013660
2918 Ga0496104_0125842
2919 Ga0496104_0144069
2920 Ga0496104_0196424
2921 Ga0496104_0243253
2922 Ga0496104_0280481
2923 Ga0496104_0395350
2924 Ga0496104_0398342
2925 Ga0496105_0000238
2926 Ga0496105_0026627
2927 Ga0496105_0031925
2928 Ga0496105_0129240
2929 Ga0496105_0139197
2930 Ga0496105_0256180
2931 Ga0496105_0285595
2932 Ga0496106_0000327
2933 Ga0496106_0009906
2934 Ga0496106_0037629
2935 Ga0496106_0270456
2936 Ga0496106_0396024
2937 Ga0496107_0000143
2938 Ga0496107_0020506
2939 Ga0496107_0072734
2940 Ga0496107_0073616
2941 Ga0496107_0130179
2942 Ga0496107_0220134
2943 Ga0496107_0312198
2944 Ga0496108_0005300
2945 Ga0496108_0012847
2946 Ga0496108_0016193
2947 Ga0496108_0039833
2948 Ga0496108_0083557
2949 Ga0496108_0138029
2950 Ga0496108_0164549
2951 Ga0496108_0285428
2952 Ga0496109_0000372
2953 Ga0496109_0003915
2954 Ga0496109_0004434
2955 Ga0496109_0006984
2956 Ga0496109_0070126
2957 Ga0496109_0126744
2958 Ga0496109_0144816
2959 Ga0496109_0210066
2960 Ga0496109_0210168
2961 Ga0496109_0214737
2962 Ga0496109_0291272
2963 Ga0496109_0383787
2964 Ga0496110_0003733
2965 Ga0496110_0008900
2966 Ga0496110_0013311
2967 Ga0496110_0132493
2968 Ga0496110_0136649
2969 Ga0496110_0221102
2970 Ga0496110_0229669
2971 Ga0496110_0234288
2972 Ga0496110_0307005
2973 Ga0496111_0001479
2974 Ga0496111_0004912
2975 Ga0496111_0010409
2976 Ga0496111_0022166
2977 Ga0496111_0024813
2978 Ga0496111_0033040
2979 Ga0496111_0042274
2980 Ga0496111_0098938
2981 Ga0496111_0255747
2982 Ga0496111_0269618
2983 Ga0496112_0002980
2984 Ga0496112_0020629
2985 Ga0496112_0175132
2986 Ga0496112_0206458
2987 Ga0496112_0365608
2988 Ga0496112_0396274
2989 Ga0496112_0426703
2990 Ga0496113_0000259
2991 Ga0496113_0022480
2992 Ga0496113_0120348
2993 Ga0496113_0225407
2994 Ga0496113_0299520
2995 Ga0496114_0004601
2996 Ga0496114_0033513
2997 Ga0496114_0035727
2998 Ga0496114_0063483
2999 Ga0496114_0111712
3000 Ga0496114_0112697
3001 Ga0496115_0000653
3002 Ga0496115_0019005
3003 Ga0496115_0167412
3004 Ga0496115_0232304
3005 Ga0496115_0256297
3006 Ga0496116_0014048
3007 Ga0496116_0074485
3008 Ga0496117_0001890
3009 Ga0496118_0003649
3010 Ga0496118_0037905
3011 Ga0496118_0073434
3012 Ga0496120_0027659
3013 Ga0496121_0002758
3014 Ga0496121_0006036
3015 Ga0496121_0024819
3016 Ga0496121_0061833
3017 Ga0496121_0221246
3018 Ga0496122_0026905
3019 Ga0496122_0072876
3020 Ga0496123_0121479
3021 Ga0496124_0037633
3022 Ga0496125_0008218
3023 Ga0496126_0030362
3024 Ga0496126_0160180
3025 Ga0501031_0025466
3026 Ga0501031_0119463
3027 Ga0501031_0191432
3028 Ga0501032_0000435
3029 Ga0501032_0003450
3030 Ga0501032_0158663
3031 Ga0501032_0178260
3032 Ga0501033_0002280
3033 Ga0501033_0067598
3034 Ga0501033_0268964
3035 Ga0501034_0000089
3036 Ga0501034_0006067
3037 Ga0501034_0010727
3038 Ga0501034_0020731
3039 Ga0501034_0021328
3040 Ga0501034_0052744
3041 Ga0501034_0099184
3042 Ga0501034_0100761
3043 Ga0501034_0113906
3044 Ga0501034_0128398
3045 Ga0501034_0316647
3046 Ga0501034_0448226
3047 Ga0501034_0528554
3048 Ga0501034_0587642
3049 Ga0501036_0007715
3050 Ga0501036_0012537
3051 Ga0501036_0015870
3052 Ga0501036_0101331
3053 Ga0501036_0105646
3054 Ga0501036_0145030
3055 Ga0501037_0018072
3056 Ga0501037_0020234
3057 Ga0501037_0046381
3058 Ga0501037_0090076
3059 Ga0501037_0305049
3060 Ga0501038_0017332
3061 Ga0501038_0056635
3062 Ga0501038_0124419
3063 Ga0501038_0183370
3064 Ga0501038_0286587
3065 Ga0501038_0295344
3066 Ga0501038_0305636
3067 Ga0501039_0016934
3068 Ga0501039_0073847
3069 Ga0501039_0108483
3070 Ga0501043_0002335
3071 Ga0501043_0002883
3072 Ga0501043_0027922
3073 Ga0501043_0042204
3074 Ga0501043_0076456
3075 Ga0501043_0182072
3076 Ga0501043_0229649
3077 Ga0501046_0032334
3078 Ga0501046_0060006
3079 Ga0501046_0302407
3080 Ga0501047_0000108
3081 Ga0501047_0005210
3082 Ga0501047_0005643
3083 Ga0501047_0020718
3084 Ga0501047_0026864
3085 Ga0501047_0035599
3086 Ga0501047_0153246
3087 Ga0501047_0164624
3088 Ga0501047_0205650
3089 Ga0501047_0629821
3090 Ga0501048_0001627
3091 Ga0501048_0001786
3092 Ga0501048_0249331
3093 Ga0501067_0003119
3094 Ga0501067_0016484
3095 Ga0501068_0018262
3096 Ga0501068_0031880
3097 Ga0501068_0071311
3098 Ga0501068_0128193
3099 Ga0501069_0004000
3100 Ga0501069_0038216
3101 Ga0501069_0039702
3102 Ga0501070_0025261
3103 Ga0501070_0027267
3104 Ga0501070_0039394
3105 Ga0501070_0081427
3106 Ga0501070_0097377
3107 Ga0501070_0386013
3108 Ga0501071_0005716
3109 Ga0501071_0030857
3110 Ga0501072_0002592
3111 Ga0501072_0004367
3112 Ga0501072_0077680
3113 Ga0501072_0186131
3114 Ga0501073_0000019
3115 Ga0501073_0002379
3116 Ga0501073_0046698
3117 Ga0501073_0107620
3118 Ga0501073_0112921
3119 Ga0501073_0182275
3120 Ga0501073_0309232
3121 Ga0501074_0013871
3122 Ga0501074_0016822
3123 Ga0501074_0059163
3124 Ga0501074_0238044
3125 Ga0501075_0279956
3126 Ga0501076_0151753
3127 Ga0501076_0291531
3128 Ga0501077_0000035
3129 Ga0501079_0014331
3130 Ga0501079_0031812
3131 Ga0501079_0039580
3132 Ga0501080_0000045
3133 Ga0501080_0000655
3134 Ga0501080_0035718
3135 Ga0501080_0057651
3136 Ga0501080_0100394
3137 Ga0501080_0107189
3138 Ga0501080_0135330
3139 Ga0501080_0139150
3140 Ga0501080_0293651
3141 Ga0501081_0045742
3142 Ga0501081_0056833
3143 Ga0501081_0214958
3144 Ga0501081_0310762
3145 Ga0501083_0002606
3146 Ga0501083_0005531
3147 Ga0501083_0015039
3148 Ga0501083_0031690
3149 Ga0501083_0070668
3150 Ga0501083_0081626
3151 Ga0501083_0113452
3152 Ga0501083_0114793
3153 Ga0501035_0001364
3154 Ga0501035_0016145
3155 Ga0501035_0018105
3156 Ga0501035_0067679
3157 Ga0501035_0167683
3158 Ga0501035_0213324
3159 Ga0501035_0406497
3160 Ga0501044_0002199
3161 Ga0501044_0002915
3162 Ga0501044_0009512
3163 Ga0501044_0015174
3164 Ga0501044_0019836
3165 Ga0501044_0031382
3166 Ga0501044_0047827
3167 Ga0501044_0084474
3168 Ga0501044_0098536
3169 Ga0501044_0100872
3170 Ga0501044_0141831
3171 Ga0501044_0273150
3172 Ga0501044_0295854
3173 Ga0501044_0524536
3174 Ga0501044_0561278
3175 Ga0501045_0093339
3176 nmdc:mga03683_6131_c1
3177 nmdc:mga03n38_4244_c1
3178 nmdc:mga03n38_63567_c1
3179 nmdc:mga00v17_4458_c1
3180 nmdc:mga0yw44_41720_c1
3181 nmdc:mga0yw44_4866_c1
3182 nmdc:mga0yw44_72156_c1
3183 nmdc:mga0k408_2007_c1
3184 nmdc:mga0k408_29518_c1
3185 nmdc:mga06z11_149781_c1
3186 nmdc:mga06z11_159215_c1
3187 nmdc:mga06z11_47995_c1
3188 nmdc:mga06z11_71921_c1
3189 nmdc:mga06z11_9696_c1
3190 nmdc:mga05p37_11094_c1
3191 nmdc:mga05p37_24149_c1
3192 nmdc:mga05p37_24288_c1
3193 nmdc:mga05p37_268746_c1
3194 nmdc:mga05p37_46633_c1
3195 nmdc:mga05p37_80697_c1
3196 nmdc:mga09592_196019_c1
3197 nmdc:mga09592_8496_c1
3198 nmdc:mga0qj67_73155_c1
3199 nmdc:mga06r32_316996_c1
3200 nmdc:mga06r32_33762_c1
3201 nmdc:mga06r32_442293_c1
3202 nmdc:mga08y16_114053_c1
3203 nmdc:mga08y16_145256_c1
3204 nmdc:mga08y16_188752_c1
3205 nmdc:mga08y16_3254_c1
3206 nmdc:mga08y16_49190_c1
3207 nmdc:mga08y16_7494_c1
3208 nmdc:mga08y16_83519_c1
3209 nmdc:mga0n895_118189_c1
3210 nmdc:mga0n895_234151_c1
3211 nmdc:mga0n895_31564_c1
3212 nmdc:mga0n895_322663_c1
3213 nmdc:mga0n895_382360_c1
3214 nmdc:mga0n895_39649_c1
3215 nmdc:mga0n895_484088_c1
3216 nmdc:mga0rr50_178440_c1
3217 nmdc:mga0rr50_178847_c1
3218 nmdc:mga0rr50_2395_c1
3219 nmdc:mga0rr50_26063_c1
3220 nmdc:mga0rr50_56554_c1
3221 nmdc:mga0rr50_69462_c1
3222 nmdc:mga0rr50_79377_c1
3223 nmdc:mga0a205_10762_c1
3224 nmdc:mga0a205_1434_c1
3225 nmdc:mga0a205_148336_c1
3226 nmdc:mga0a205_37528_c1
3227 nmdc:mga0a205_407287_c1
3228 nmdc:mga0sz30_11526_c1
3229 nmdc:mga0sz30_2397_c1
3230 Ga0495601_0000016
3231 Ga0495601_0000114
3232 Ga0495601_0000315
3233 Ga0495601_0008408
3234 Ga0495601_0032962
3235 Ga0495601_0049973
3236 Ga0495601_0054419
3237 Ga0495601_0080604
3238 Ga0495601_0092159
3239 Ga0495601_0199401
3240 Ga0495612_0000056
3241 Ga0495612_0000154
3242 Ga0495612_0001726
3243 Ga0495612_0002268
3244 Ga0495612_0004956
3245 Ga0495612_0023868
3246 Ga0495612_0079755
3247 Ga0495612_0101463
3248 Ga0495655_0027909
3249 Ga0495595_0000032
3250 Ga0495595_0005189
3251 Ga0495595_0005799
3252 Ga0495595_0009928
3253 Ga0495595_0011977
3254 Ga0495595_0021898
3255 Ga0495595_0102244
3256 Ga0495619_0000033
3257 Ga0495619_0000206
3258 Ga0495619_0001397
3259 Ga0495619_0002416
3260 Ga0495619_0003323
3261 Ga0495619_0004683
3262 Ga0495619_0004828
3263 Ga0495619_0011415
3264 Ga0495619_0018328
3265 Ga0495619_0023944
3266 Ga0500643_000014
3267 Ga0500643_008687
3268 Ga0500643_021179
3269 Ga0500644_0001168
3270 Ga0500646_0034154
3271 Ga0500651_0203450
3272 Ga0500641_0018054
3273 Ga0500641_0019245
3274 Ga0500592_008051
3275 Ga0500593_034271
3276 Ga0500595_000001
3277 Ga0500595_014074
3278 Ga0500595_031287
3279 Ga0500614_007698
3280 Ga0500652_000198
3281 Ga0500652_008290
3282 Ga0500568_0010093
3283 Ga0500568_0019795
3284 Ga0500568_0042182
3285 Ga0500590_000069
3286 Ga0500616_0000001
3287 Ga0500616_0029769
3288 Ga0500622_0002923
3289 Ga0500645_001721
3290 Ga0500645_049098
3291 Ga0501084_0065110
3292 Ga0501084_0116070
3293 Ga0501084_0122937
3294 Ga0501084_0229387
3295 Ga0501082_0000028
3296 Ga0501082_0009479
3297 Ga0501082_0110937
3298 Ga0501082_0154198
3299 Ga0501082_0235725
3300 Ga0501082_0331571
3301 Ga0530510_0011090
3302 2524458028
3303 2528851283
3304 2537873416
3305 2585330479
3306 2599604432
3307 2643758072
3308 2824663837
3309 2842299790
3310 2842359688
3311 2842698106
3312 2879085824
3313 2879108643
3314 2899794492
3315 2908776167
3316 2922378711
3317 2932786696
3318 2932812260
3319 2932823251
3320 2932829909
3321 2935618427
3322 2935641175
3323 2935670091
3324 2935680915
3325 2935689930
3326 2935698451
3327 2935707593
3328 2935717449
3329 2935723881
3330 2935740090
3331 2935749353
3332 2935757284
3333 2935763630
3334 2935804019
3335 2935815113
3336 2935830906
3337 2935841516
3338 2935862478
3339 2935866594
3340 2935874901
3341 2935994407
3342 2936004615
3343 2936043180
3344 2940563197
3345 2941543114
3346 3003931568
3347 3005486813
3348 8017058370
3349 8019577331
3350 8019595413
3351 8019612185
3352 8024491736

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

45

319

0.85

PF05368

NmrA

NmrA-like family

47

298

0.84

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

48

256

0.83

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

47

255

0.83

PF13460

NAD_binding_10

NAD(P)H-binding

51

201

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e73-assembly1.cif.gz_A9 vigna radiata supercomplex i+iii2 (full bridge) 0.95 9 314
7r4f-assembly1.cif.gz_P bovine complex i in the presence of im1761092, slack class i (composite map) 0.9463 9 313
7r41-assembly1.cif.gz_P bovine complex i in the presence of im1761092, active class i (composite map) 0.9457 9 314
6zkg-assembly1.cif.gz_d complex i with nadh, closed 0.9457 9 314
5xtb-assembly1.cif.gz_J cryo-em structure of human respiratory complex i matrix arm 0.9431 9 314
ID Description Score Start End Superfamily
af_Q9SK66_71_329_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9653 12 260 3.40.50.720
af_Q559Z0_43_331_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9542 13 301 3.40.50.720
af_Q9DC69_47_264_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9524 9 215 3.40.50.720
af_Q559Z0_43_331_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9445 13 301 3.40.50.720
af_Q4DU32_30_254_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9371 9 219 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4V3KSF4-F1-model_v4 Complex I NDUFA9 subunit family protein 0.9928 60 156 GO:0044877
GO:1901006
AF-A0A2N3CM24-F1-model_v4 Complex I NDUFA9 subunit family protein 0.992 9 151 GO:0044877
GO:1901006
AF-A0A355VXT9-F1-model_v4 Complex I NDUFA9 subunit family protein 0.9819 8 313 GO:0044877
GO:1901006
AF-A0A4Q3YF92-F1-model_v4 Complex I NDUFA9 subunit family protein 0.9779 9 241 GO:0044877
GO:1901006
AF-C0F8L7-F1-model_v4 deleted 0.9754 9 200

Map