F495293
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1676 | 557 | 3352 | 322 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10008453|Ga0105240_100084531 |
| Length | 360 |
| Sequence | MNRLPPCPACTAPVRSGICRDGRIDRRFPSLPSESGMTARSPYDTLVTVYGGSGFLGRHLVRALAKRHYRIRVAVRRPDLAGHLQPLGRVGQIHAVQANLRNPESVEAAARGADVLINLVGILFERGRQRFDAVHTEGARNVAAAAKAHGARLVHVSAIGADENSTAVYARSKAAAERLVREVMPETMVMRPSIMFGPEDNFFNLFASLARMSPVLPLVGGGHTKFQPVFVGDVAQAIANAVDGQARAGTTYELGGPEVRTFREILEYILATIERRRLLLPMPFLVAKLQASLMQFMPTPLLTPDQVELLRTDNVVSDAAVTQGRTLQGLGIAPTPIEAIVPSYLWRFRKTGQFRAQPTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 9 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 10 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 11 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 12 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 16 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 17 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 18 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 19 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 20 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 21 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 22 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 23 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 26 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 27 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 77 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 85 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 88 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 89 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 91 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 92 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 93 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 94 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 95 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 96 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 102 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 103 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 104 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 105 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 107 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 108 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 109 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 110 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 114 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 115 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 116 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 117 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 118 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 120 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 121 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 122 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 123 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 124 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 125 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 126 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 127 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 130 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 131 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 132 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 133 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 148 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 149 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 150 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 167 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 168 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 169 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 242 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 243 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 244 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 251 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 255 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 256 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 257 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 258 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 259 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 260 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 261 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 262 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 263 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 264 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 265 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 266 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 267 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 268 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 269 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 270 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 271 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 272 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 273 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 274 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 275 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 276 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 277 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 278 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 279 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 280 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 281 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 282 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 283 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 284 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 285 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 286 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 287 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 288 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 289 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 290 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 291 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 292 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 293 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 294 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 295 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 296 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 297 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 298 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 299 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 300 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 301 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 302 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 303 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 304 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 305 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 306 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 307 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 308 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 309 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 310 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 311 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 312 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 313 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 314 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 315 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 316 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 317 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 318 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 319 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 320 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 321 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 322 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 323 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 324 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 325 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 326 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 327 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 328 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 329 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 330 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 331 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 332 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 333 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 334 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 335 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 336 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 337 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 338 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 339 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 340 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 415 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 416 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 417 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 418 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 419 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 420 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 421 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 423 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 424 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 425 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 426 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 427 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 428 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 429 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 430 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 431 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 432 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 433 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 434 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 435 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 436 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 437 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 438 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 439 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 470 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 471 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 472 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 473 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 474 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 475 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 484 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 490 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 491 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 492 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 493 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 494 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 495 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 496 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 497 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 498 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 499 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 500 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 501 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 502 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 503 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 504 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 505 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 506 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 507 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 508 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 509 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 510 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 511 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 512 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 513 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 514 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 515 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 516 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 517 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 518 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 519 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 520 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 521 | 2922368715 | |||
| 522 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 523 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 524 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 525 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 526 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 527 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 528 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 529 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 530 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 531 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 532 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 533 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 534 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 535 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 536 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 537 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 538 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 539 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 540 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 541 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 542 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 543 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 544 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 545 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 546 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 547 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 548 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 549 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 550 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 551 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 552 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 553 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 554 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 555 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 556 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 557 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.96 |
| Metatranscriptomes | 0.06 |
| Isolates | 2.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.88 |
| Nodule | 2.68 |
| Rhizoplane | 6.92 |
| Rhizosphere | 84.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105240_10008453 | 3300009093 | Bacteria | 14724 |
| 2 | 2214544912 | 2209111006 | Bacteria | 25181 |
| 3 | ARSoilYngRDRAFT_c00115 | 3300000042 | Bacteria | 13696 |
| 4 | ARcpr5yngRDRAFT_c000138 | 3300000043 | Bacteria | 11523 |
| 5 | ARSoilOldRDRAFT_c000022 | 3300000044 | Bacteria | 35130 |
| 6 | ARCol0oldRDRAFT_c00090 | 3300000045 | Bacteria | 7653 |
| 7 | ARCol0yngRDRAFT_1000298 | 3300000652 | Bacteria | 7643 |
| 8 | JGI24741J21665_1002162 | 3300001915 | Bacteria | 5226 |
| 9 | JGI24752J21851_1000975 | 3300001976 | Bacteria | 3903 |
| 10 | JGI24746J21847_1000142 | 3300001977 | Bacteria | 8989 |
| 11 | JGI24747J21853_1000031 | 3300001978 | Bacteria | 5352 |
| 12 | JGI24740J21852_10017351 | 3300001979 | Bacteria | 2577 |
| 13 | JGI24739J22299_10002500 | 3300001989 | Bacteria | 7099 |
| 14 | JGI24737J22298_10000810 | 3300001990 | Bacteria | 11103 |
| 15 | JGI24737J22298_10004702 | 3300001990 | Bacteria | 4746 |
| 16 | JGI24743J22301_10002841 | 3300001991 | Bacteria | 2666 |
| 17 | JGI24750J21931_1000449 | 3300002070 | Bacteria | 6594 |
| 18 | JGI24750J21931_1000469 | 3300002070 | Bacteria | 6441 |
| 19 | JGI24745J21846_1000493 | 3300002073 | Bacteria | 3493 |
| 20 | JGI24738J21930_10000005 | 3300002075 | Bacteria | 42207 |
| 21 | JGI24738J21930_10011740 | 3300002075 | Bacteria | 1922 |
| 22 | JGI24749J21850_1001021 | 3300002076 | Bacteria | 3972 |
| 23 | JGI24744J21845_10000321 | 3300002077 | Bacteria | 8029 |
| 24 | JGI24035J26624_1000798 | 3300002126 | Bacteria | 2968 |
| 25 | JGI24033J26618_1001439 | 3300002155 | Bacteria | 2359 |
| 26 | JGI24742J22300_10000339 | 3300002244 | Bacteria | 6902 |
| 27 | JGI24751J29686_10001874 | 3300002459 | Bacteria | 4306 |
| 28 | JGI25406J46586_10004567 | 3300003203 | Bacteria | 6444 |
| 29 | rootH1_10079649 | 3300003323 | Bacteria | 2374 |
| 30 | Ga0065716_1001575 | 3300005277 | Bacteria | 6023 |
| 31 | Ga0065712_10070481 | 3300005290 | Bacteria | 5969 |
| 32 | Ga0065715_10099964 | 3300005293 | Bacteria | 3342 |
| 33 | Ga0070658_10005336 | 3300005327 | Bacteria | 10435 |
| 34 | Ga0070658_10084777 | 3300005327 | Bacteria | 2605 |
| 35 | Ga0070658_10088275 | 3300005327 | Bacteria | 2553 |
| 36 | Ga0070658_10214303 | 3300005327 | Bacteria | 1627 |
| 37 | Ga0070676_10006098 | 3300005328 | Bacteria | 6436 |
| 38 | Ga0070683_100000345 | 3300005329 | Bacteria | 31885 |
| 39 | Ga0070683_100081994 | 3300005329 | Bacteria | 3020 |
| 40 | Ga0070690_100007218 | 3300005330 | Bacteria | 6356 |
| 41 | Ga0070690_100007975 | 3300005330 | Bacteria | 6078 |
| 42 | Ga0070690_100020158 | 3300005330 | Bacteria | 4059 |
| 43 | Ga0070690_100023517 | 3300005330 | Bacteria | 3779 |
| 44 | Ga0070690_100025313 | 3300005330 | Bacteria | 3654 |
| 45 | Ga0070690_100168260 | 3300005330 | Bacteria | 1507 |
| 46 | Ga0070670_100000091 | 3300005331 | Bacteria | 85664 |
| 47 | Ga0070670_100016360 | 3300005331 | Bacteria | 6370 |
| 48 | Ga0070670_100093254 | 3300005331 | Bacteria | 2590 |
| 49 | Ga0070670_100396066 | 3300005331 | Bacteria | 1218 |
| 50 | Ga0070670_100445762 | 3300005331 | Bacteria | 1147 |
| 51 | Ga0070677_10000732 | 3300005333 | Bacteria | 10937 |
| 52 | Ga0068869_100001229 | 3300005334 | Bacteria | 15086 |
| 53 | Ga0068869_100021486 | 3300005334 | Bacteria | 4440 |
| 54 | Ga0068869_100231417 | 3300005334 | Bacteria | 1469 |
| 55 | Ga0070666_10118435 | 3300005335 | Bacteria | 1835 |
| 56 | Ga0070666_10131073 | 3300005335 | Bacteria | 1742 |
| 57 | Ga0070680_100013303 | 3300005336 | Bacteria | 6408 |
| 58 | Ga0070680_100023359 | 3300005336 | Bacteria | 4931 |
| 59 | Ga0070680_100114813 | 3300005336 | Bacteria | 2243 |
| 60 | Ga0070680_100156547 | 3300005336 | Bacteria | 1914 |
| 61 | Ga0070680_100202946 | 3300005336 | Bacteria | 1672 |
| 62 | Ga0070680_100212983 | 3300005336 | Bacteria | 1630 |
| 63 | Ga0070680_100267695 | 3300005336 | Bacteria | 1447 |
| 64 | Ga0070682_100007148 | 3300005337 | Bacteria | 6288 |
| 65 | Ga0070682_100096171 | 3300005337 | Bacteria | 1946 |
| 66 | Ga0068868_100000376 | 3300005338 | Bacteria | 30404 |
| 67 | Ga0068868_100281968 | 3300005338 | Bacteria | 1406 |
| 68 | Ga0070660_100001516 | 3300005339 | Bacteria | 15921 |
| 69 | Ga0070660_100008936 | 3300005339 | Bacteria | 7026 |
| 70 | Ga0070660_100084251 | 3300005339 | Bacteria | 2498 |
| 71 | Ga0070689_100005739 | 3300005340 | Bacteria | 8509 |
| 72 | Ga0070689_100030360 | 3300005340 | Bacteria | 4102 |
| 73 | Ga0070691_10019629 | 3300005341 | Bacteria | 3120 |
| 74 | Ga0070687_100001270 | 3300005343 | Bacteria | 8796 |
| 75 | Ga0070692_10001450 | 3300005345 | Bacteria | 8616 |
| 76 | Ga0070692_10170409 | 3300005345 | Bacteria | 1254 |
| 77 | Ga0070668_100007889 | 3300005347 | Bacteria | 7903 |
| 78 | Ga0070668_100134328 | 3300005347 | Bacteria | 1988 |
| 79 | Ga0070668_100189587 | 3300005347 | Bacteria | 1683 |
| 80 | Ga0070668_100207224 | 3300005347 | Bacteria | 1611 |
| 81 | Ga0070669_100000873 | 3300005353 | Bacteria | 21980 |
| 82 | Ga0070669_100011651 | 3300005353 | Bacteria | 6237 |
| 83 | Ga0070669_100053555 | 3300005353 | Bacteria | 2954 |
| 84 | Ga0070675_100010354 | 3300005354 | Bacteria | 7282 |
| 85 | Ga0070675_100015993 | 3300005354 | Bacteria | 5945 |
| 86 | Ga0070675_100033582 | 3300005354 | Bacteria | 4161 |
| 87 | Ga0070675_100098146 | 3300005354 | Bacteria | 2463 |
| 88 | Ga0070675_100146434 | 3300005354 | Bacteria | 2022 |
| 89 | Ga0070671_100003341 | 3300005355 | Bacteria | 12514 |
| 90 | Ga0070671_100045323 | 3300005355 | Bacteria | 3655 |
| 91 | Ga0070671_100220132 | 3300005355 | Bacteria | 1610 |
| 92 | Ga0070671_100258280 | 3300005355 | Bacteria | 1480 |
| 93 | Ga0070674_100003182 | 3300005356 | Bacteria | 9151 |
| 94 | Ga0070673_100010614 | 3300005364 | Bacteria | 6243 |
| 95 | Ga0070673_100054055 | 3300005364 | Bacteria | 3157 |
| 96 | Ga0070673_100349640 | 3300005364 | Bacteria | 1312 |
| 97 | Ga0070688_100006558 | 3300005365 | Bacteria | 6228 |
| 98 | Ga0070688_100017446 | 3300005365 | Bacteria | 4120 |
| 99 | Ga0070688_100030065 | 3300005365 | Bacteria | 3257 |
| 100 | Ga0070688_100043804 | 3300005365 | Bacteria | 2759 |
| 101 | Ga0070659_100006313 | 3300005366 | Bacteria | 8562 |
| 102 | Ga0070659_100032632 | 3300005366 | Bacteria | 4040 |
| 103 | Ga0070659_100156297 | 3300005366 | Bacteria | 1862 |
| 104 | Ga0070667_100011850 | 3300005367 | Bacteria | 7210 |
| 105 | Ga0070667_100055986 | 3300005367 | Bacteria | 3330 |
| 106 | Ga0070703_10032289 | 3300005406 | Bacteria | 1589 |
| 107 | Ga0070703_10064961 | 3300005406 | Bacteria | 1203 |
| 108 | Ga0070709_10002356 | 3300005434 | Bacteria | 10237 |
| 109 | Ga0070709_10003391 | 3300005434 | Bacteria | 8559 |
| 110 | Ga0070709_10028772 | 3300005434 | Bacteria | 3317 |
| 111 | Ga0070709_10122286 | 3300005434 | Bacteria | 1766 |
| 112 | Ga0070714_100000516 | 3300005435 | Bacteria | 28020 |
| 113 | Ga0070714_100009307 | 3300005435 | Bacteria | 7718 |
| 114 | Ga0070714_100032390 | 3300005435 | Bacteria | 4362 |
| 115 | Ga0070714_100058999 | 3300005435 | Bacteria | 3289 |
| 116 | Ga0070714_100252319 | 3300005435 | Bacteria | 1632 |
| 117 | Ga0070714_100287574 | 3300005435 | Bacteria | 1529 |
| 118 | Ga0070713_100000228 | 3300005436 | Bacteria | 37335 |
| 119 | Ga0070713_100004346 | 3300005436 | Bacteria | 9507 |
| 120 | Ga0070713_100025482 | 3300005436 | Bacteria | 4624 |
| 121 | Ga0070713_100104233 | 3300005436 | Bacteria | 2462 |
| 122 | Ga0070710_10000438 | 3300005437 | Bacteria | 19522 |
| 123 | Ga0070710_10003280 | 3300005437 | Bacteria | 7674 |
| 124 | Ga0070710_10080200 | 3300005437 | Bacteria | 1903 |
| 125 | Ga0070701_10003647 | 3300005438 | Bacteria | 6128 |
| 126 | Ga0070711_100000998 | 3300005439 | Bacteria | 15007 |
| 127 | Ga0070711_100060588 | 3300005439 | Bacteria | 2631 |
| 128 | Ga0070711_100153171 | 3300005439 | Bacteria | 1740 |
| 129 | Ga0070711_100168127 | 3300005439 | Bacteria | 1669 |
| 130 | Ga0070711_100187110 | 3300005439 | Bacteria | 1589 |
| 131 | Ga0070711_100317504 | 3300005439 | Bacteria | 1244 |
| 132 | Ga0070705_100009011 | 3300005440 | Bacteria | 4952 |
| 133 | Ga0070705_100049550 | 3300005440 | Bacteria | 2439 |
| 134 | Ga0070705_100094544 | 3300005440 | Bacteria | 1871 |
| 135 | Ga0070705_100297650 | 3300005440 | Unclassified | 1155 |
| 136 | Ga0070700_100015500 | 3300005441 | Bacteria | 4323 |
| 137 | Ga0070700_100017964 | 3300005441 | Bacteria | 4057 |
| 138 | Ga0070700_100080731 | 3300005441 | Bacteria | 2099 |
| 139 | Ga0070694_100000312 | 3300005444 | Bacteria | 26105 |
| 140 | Ga0070694_100008055 | 3300005444 | Bacteria | 6436 |
| 141 | Ga0070708_100072490 | 3300005445 | Bacteria | 3103 |
| 142 | Ga0070663_100008241 | 3300005455 | Bacteria | 6401 |
| 143 | Ga0070663_100043993 | 3300005455 | Bacteria | 3145 |
| 144 | Ga0070663_100092601 | 3300005455 | Bacteria | 2241 |
| 145 | Ga0070678_100001343 | 3300005456 | Bacteria | 13090 |
| 146 | Ga0070678_100036419 | 3300005456 | Bacteria | 3444 |
| 147 | Ga0070678_100047901 | 3300005456 | Bacteria | 3074 |
| 148 | Ga0070678_100077082 | 3300005456 | Bacteria | 2513 |
| 149 | Ga0070662_100007995 | 3300005457 | Bacteria | 6881 |
| 150 | Ga0070662_100025872 | 3300005457 | Bacteria | 4057 |
| 151 | Ga0070662_100091445 | 3300005457 | Bacteria | 2285 |
| 152 | Ga0070681_10005438 | 3300005458 | Bacteria | 12303 |
| 153 | Ga0070681_10012552 | 3300005458 | Bacteria | 8408 |
| 154 | Ga0070681_10023289 | 3300005458 | Bacteria | 6228 |
| 155 | Ga0070681_10132045 | 3300005458 | Bacteria | 2429 |
| 156 | Ga0070681_10133037 | 3300005458 | Bacteria | 2419 |
| 157 | Ga0070681_10259780 | 3300005458 | Bacteria | 1649 |
| 158 | Ga0068867_100022236 | 3300005459 | Bacteria | 4532 |
| 159 | Ga0068867_100371518 | 3300005459 | Bacteria | 1199 |
| 160 | Ga0070685_10000596 | 3300005466 | Bacteria | 19988 |
| 161 | Ga0070685_10024426 | 3300005466 | Bacteria | 3319 |
| 162 | Ga0070707_100213347 | 3300005468 | Bacteria | 1881 |
| 163 | Ga0070699_100490949 | 3300005518 | Unclassified | 1115 |
| 164 | Ga0070679_100005039 | 3300005530 | Bacteria | 12191 |
| 165 | Ga0070679_100020021 | 3300005530 | Bacteria | 6519 |
| 166 | Ga0070679_100066434 | 3300005530 | Bacteria | 3595 |
| 167 | Ga0070679_100177525 | 3300005530 | Bacteria | 2103 |
| 168 | Ga0070679_100206546 | 3300005530 | Bacteria | 1928 |
| 169 | Ga0070679_100298213 | 3300005530 | Bacteria | 1563 |
| 170 | Ga0070684_100001973 | 3300005535 | Bacteria | 15079 |
| 171 | Ga0070684_100039621 | 3300005535 | Bacteria | 4054 |
| 172 | Ga0068853_100007072 | 3300005539 | Bacteria | 8975 |
| 173 | Ga0068853_100031218 | 3300005539 | Bacteria | 4505 |
| 174 | Ga0068853_100034006 | 3300005539 | Bacteria | 4325 |
| 175 | Ga0070672_100005148 | 3300005543 | Bacteria | 8635 |
| 176 | Ga0070672_100030325 | 3300005543 | Bacteria | 4062 |
| 177 | Ga0070672_100031508 | 3300005543 | Bacteria | 3991 |
| 178 | Ga0070672_100208814 | 3300005543 | Unclassified | 1635 |
| 179 | Ga0070686_100006737 | 3300005544 | Bacteria | 6394 |
| 180 | Ga0070686_100015768 | 3300005544 | Bacteria | 4385 |
| 181 | Ga0070686_100050993 | 3300005544 | Bacteria | 2632 |
| 182 | Ga0070686_100057244 | 3300005544 | Bacteria | 2504 |
| 183 | Ga0070686_100262914 | 3300005544 | Bacteria | 1265 |
| 184 | Ga0070695_100008048 | 3300005545 | Bacteria | 6249 |
| 185 | Ga0070695_100020280 | 3300005545 | Bacteria | 4057 |
| 186 | Ga0070696_100016735 | 3300005546 | Bacteria | 4945 |
| 187 | Ga0070696_100068309 | 3300005546 | Bacteria | 2495 |
| 188 | Ga0070693_100003223 | 3300005547 | Bacteria | 7572 |
| 189 | Ga0070693_100015829 | 3300005547 | Bacteria | 3892 |
| 190 | Ga0070693_100156777 | 3300005547 | Bacteria | 1446 |
| 191 | Ga0070665_100007650 | 3300005548 | Bacteria | 10984 |
| 192 | Ga0070665_100120660 | 3300005548 | Bacteria | 2623 |
| 193 | Ga0070665_100166427 | 3300005548 | Bacteria | 2207 |
| 194 | Ga0070665_100370760 | 3300005548 | Bacteria | 1438 |
| 195 | Ga0070665_100494379 | 3300005548 | Bacteria | 1234 |
| 196 | Ga0070704_100001543 | 3300005549 | Bacteria | 12427 |
| 197 | Ga0070704_100005924 | 3300005549 | Bacteria | 7162 |
| 198 | Ga0070704_100023069 | 3300005549 | Bacteria | 4057 |
| 199 | Ga0070704_100419974 | 3300005549 | Bacteria | 1145 |
| 200 | Ga0068855_100032524 | 3300005563 | Bacteria | 6227 |
| 201 | Ga0068855_100066754 | 3300005563 | Bacteria | 4194 |
| 202 | Ga0068855_100118675 | 3300005563 | Bacteria | 3029 |
| 203 | Ga0068855_100121490 | 3300005563 | Bacteria | 2989 |
| 204 | Ga0068855_100123908 | 3300005563 | Bacteria | 2956 |
| 205 | Ga0068855_100146497 | 3300005563 | Bacteria | 2687 |
| 206 | Ga0068855_100311759 | 3300005563 | Bacteria | 1740 |
| 207 | Ga0070664_100014789 | 3300005564 | Bacteria | 6372 |
| 208 | Ga0070664_100054900 | 3300005564 | Bacteria | 3381 |
| 209 | Ga0070664_100217341 | 3300005564 | Bacteria | 1709 |
| 210 | Ga0070664_100480036 | 3300005564 | Bacteria | 1144 |
| 211 | Ga0068857_100013315 | 3300005577 | Bacteria | 7162 |
| 212 | Ga0068857_100180762 | 3300005577 | Bacteria | 1920 |
| 213 | Ga0068857_100215951 | 3300005577 | Bacteria | 1751 |
| 214 | Ga0068854_100001754 | 3300005578 | Bacteria | 13210 |
| 215 | Ga0068854_100016161 | 3300005578 | Bacteria | 4967 |
| 216 | Ga0068854_100096809 | 3300005578 | Bacteria | 2205 |
| 217 | Ga0068856_100021987 | 3300005614 | Bacteria | 6201 |
| 218 | Ga0068856_100032409 | 3300005614 | Bacteria | 5115 |
| 219 | Ga0068856_100117928 | 3300005614 | Bacteria | 2655 |
| 220 | Ga0070702_100000021 | 3300005615 | Bacteria | 44632 |
| 221 | Ga0070702_100010590 | 3300005615 | Bacteria | 4549 |
| 222 | Ga0068852_100013544 | 3300005616 | Bacteria | 6243 |
| 223 | Ga0068852_100024110 | 3300005616 | Bacteria | 4912 |
| 224 | Ga0068852_100028980 | 3300005616 | Bacteria | 4540 |
| 225 | Ga0068852_100139038 | 3300005616 | Bacteria | 2246 |
| 226 | Ga0068859_100053512 | 3300005617 | Bacteria | 4060 |
| 227 | Ga0068859_100461155 | 3300005617 | Unclassified | 1367 |
| 228 | Ga0068864_100001093 | 3300005618 | Bacteria | 22722 |
| 229 | Ga0068864_100029107 | 3300005618 | Bacteria | 4674 |
| 230 | Ga0068864_100046960 | 3300005618 | Bacteria | 3707 |
| 231 | Ga0068864_100310437 | 3300005618 | Bacteria | 1478 |
| 232 | Ga0068866_10002066 | 3300005718 | Bacteria | 8348 |
| 233 | Ga0068866_10033138 | 3300005718 | Bacteria | 2503 |
| 234 | Ga0068866_10102328 | 3300005718 | Bacteria | 1582 |
| 235 | Ga0068866_10157407 | 3300005718 | Bacteria | 1321 |
| 236 | Ga0068861_100007979 | 3300005719 | Bacteria | 7287 |
| 237 | Ga0068861_100033843 | 3300005719 | Bacteria | 3773 |
| 238 | Ga0068861_100148568 | 3300005719 | Bacteria | 1920 |
| 239 | Ga0068851_10049927 | 3300005834 | Bacteria | 2124 |
| 240 | Ga0068851_10165064 | 3300005834 | Bacteria | 1219 |
| 241 | Ga0068870_10000128 | 3300005840 | Bacteria | 26100 |
| 242 | Ga0068870_10066126 | 3300005840 | Bacteria | 1958 |
| 243 | Ga0068863_100020069 | 3300005841 | Bacteria | 6393 |
| 244 | Ga0068863_100022637 | 3300005841 | Bacteria | 6001 |
| 245 | Ga0068863_100127966 | 3300005841 | Bacteria | 2424 |
| 246 | Ga0068858_100019007 | 3300005842 | Bacteria | 6429 |
| 247 | Ga0068858_100019312 | 3300005842 | Bacteria | 6372 |
| 248 | Ga0068858_100132866 | 3300005842 | Bacteria | 2334 |
| 249 | Ga0068858_100235693 | 3300005842 | Bacteria | 1735 |
| 250 | Ga0068858_100381333 | 3300005842 | Unclassified | 1353 |
| 251 | Ga0068860_100037706 | 3300005843 | Bacteria | 4626 |
| 252 | Ga0068860_100040135 | 3300005843 | Bacteria | 4475 |
| 253 | Ga0068860_100048205 | 3300005843 | Bacteria | 4060 |
| 254 | Ga0068860_100307691 | 3300005843 | Bacteria | 1553 |
| 255 | Ga0068862_100005880 | 3300005844 | Bacteria | 10218 |
| 256 | Ga0068862_100038468 | 3300005844 | Bacteria | 4057 |
| 257 | Ga0068862_100165979 | 3300005844 | Bacteria | 1974 |
| 258 | Ga0068862_100219794 | 3300005844 | Bacteria | 1719 |
| 259 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 260 | Ga0081455_10001227 | 3300005937 | Bacteria | 32059 |
| 261 | Ga0081455_10013377 | 3300005937 | Bacteria | 8115 |
| 262 | Ga0081455_10035412 | 3300005937 | Bacteria | 4461 |
| 263 | Ga0081455_10212057 | 3300005937 | Bacteria | 1442 |
| 264 | Ga0081538_10002294 | 3300005981 | Bacteria | 18899 |
| 265 | Ga0081538_10102419 | 3300005981 | Bacteria | 1436 |
| 266 | Ga0081540_1000569 | 3300005983 | Bacteria | 35803 |
| 267 | Ga0081540_1002980 | 3300005983 | Bacteria | 13569 |
| 268 | Ga0081540_1008410 | 3300005983 | Bacteria | 7214 |
| 269 | Ga0081540_1013731 | 3300005983 | Bacteria | 5249 |
| 270 | Ga0081539_10004324 | 3300005985 | Bacteria | 15850 |
| 271 | Ga0081539_10011185 | 3300005985 | Bacteria | 7145 |
| 272 | Ga0070717_10001441 | 3300006028 | Bacteria | 16389 |
| 273 | Ga0070717_10001451 | 3300006028 | Bacteria | 16359 |
| 274 | Ga0070717_10136392 | 3300006028 | Bacteria | 2114 |
| 275 | Ga0070717_10178142 | 3300006028 | Bacteria | 1852 |
| 276 | Ga0070717_10290952 | 3300006028 | Bacteria | 1450 |
| 277 | Ga0075365_10098960 | 3300006038 | Bacteria | 1995 |
| 278 | Ga0075368_10003235 | 3300006042 | Bacteria | 5423 |
| 279 | Ga0075363_100002280 | 3300006048 | Bacteria | 7777 |
| 280 | Ga0075363_100002849 | 3300006048 | Bacteria | 7198 |
| 281 | Ga0075363_100058149 | 3300006048 | Bacteria | 2076 |
| 282 | Ga0075364_10005121 | 3300006051 | Bacteria | 7597 |
| 283 | Ga0070715_10006066 | 3300006163 | Bacteria | 4080 |
| 284 | Ga0070715_10037893 | 3300006163 | Bacteria | 1998 |
| 285 | Ga0070715_10059215 | 3300006163 | Bacteria | 1674 |
| 286 | Ga0070715_10153182 | 3300006163 | Bacteria | 1132 |
| 287 | Ga0070716_100002431 | 3300006173 | Bacteria | 8578 |
| 288 | Ga0070716_100012858 | 3300006173 | Bacteria | 4254 |
| 289 | Ga0070712_100004538 | 3300006175 | Bacteria | 8570 |
| 290 | Ga0070712_100022226 | 3300006175 | Bacteria | 4175 |
| 291 | Ga0070712_100033200 | 3300006175 | Bacteria | 3490 |
| 292 | Ga0070712_100329075 | 3300006175 | Bacteria | 1244 |
| 293 | Ga0075362_10002098 | 3300006177 | Bacteria | 6585 |
| 294 | Ga0075367_10004832 | 3300006178 | Bacteria | 6640 |
| 295 | Ga0075367_10030132 | 3300006178 | Bacteria | 3108 |
| 296 | Ga0075367_10042737 | 3300006178 | Bacteria | 2653 |
| 297 | Ga0075367_10111494 | 3300006178 | Bacteria | 1679 |
| 298 | Ga0075367_10132308 | 3300006178 | Bacteria | 1542 |
| 299 | Ga0075367_10145667 | 3300006178 | Bacteria | 1469 |
| 300 | Ga0075369_10003186 | 3300006186 | Bacteria | 5951 |
| 301 | Ga0075427_10003543 | 3300006194 | Bacteria | 2161 |
| 302 | Ga0075366_10002193 | 3300006195 | Bacteria | 9968 |
| 303 | Ga0075366_10056751 | 3300006195 | Bacteria | 2326 |
| 304 | Ga0075366_10110273 | 3300006195 | Bacteria | 1655 |
| 305 | Ga0097621_100000012 | 3300006237 | Bacteria | 105108 |
| 306 | Ga0097621_100077690 | 3300006237 | Bacteria | 2756 |
| 307 | Ga0068871_100000138 | 3300006358 | Bacteria | 46912 |
| 308 | Ga0068871_100003229 | 3300006358 | Bacteria | 11175 |
| 309 | Ga0068871_100066657 | 3300006358 | Bacteria | 2952 |
| 310 | Ga0068871_100129205 | 3300006358 | Bacteria | 2141 |
| 311 | Ga0075428_100003156 | 3300006844 | Bacteria | 17997 |
| 312 | Ga0075428_100035411 | 3300006844 | Bacteria | 5503 |
| 313 | Ga0075428_100186443 | 3300006844 | Bacteria | 2245 |
| 314 | Ga0075430_100000683 | 3300006846 | Bacteria | 25908 |
| 315 | Ga0075430_100043547 | 3300006846 | Bacteria | 3794 |
| 316 | Ga0075431_100003071 | 3300006847 | Bacteria | 16171 |
| 317 | Ga0075431_100056737 | 3300006847 | Bacteria | 4039 |
| 318 | Ga0075431_100079468 | 3300006847 | Bacteria | 3385 |
| 319 | Ga0075431_100481578 | 3300006847 | Bacteria | 1234 |
| 320 | Ga0075433_10000266 | 3300006852 | Bacteria | 30624 |
| 321 | Ga0075433_10096046 | 3300006852 | Bacteria | 2623 |
| 322 | Ga0075433_10109512 | 3300006852 | Bacteria | 2450 |
| 323 | Ga0075433_10113418 | 3300006852 | Bacteria | 2404 |
| 324 | Ga0075433_10189584 | 3300006852 | Bacteria | 1829 |
| 325 | Ga0075433_10248137 | 3300006852 | Bacteria | 1580 |
| 326 | Ga0075433_10258130 | 3300006852 | Bacteria | 1545 |
| 327 | Ga0075434_100000350 | 3300006871 | Bacteria | 33385 |
| 328 | Ga0075434_100004062 | 3300006871 | Bacteria | 13123 |
| 329 | Ga0075434_100025533 | 3300006871 | Bacteria | 5780 |
| 330 | Ga0075434_100164662 | 3300006871 | Bacteria | 2237 |
| 331 | Ga0075434_100233376 | 3300006871 | Bacteria | 1859 |
| 332 | Ga0075434_100325004 | 3300006871 | Bacteria | 1559 |
| 333 | Ga0075429_100002242 | 3300006880 | Bacteria | 16171 |
| 334 | Ga0068865_100002683 | 3300006881 | Bacteria | 10556 |
| 335 | Ga0068865_100004534 | 3300006881 | Bacteria | 8383 |
| 336 | Ga0075436_100001243 | 3300006914 | Bacteria | 17319 |
| 337 | Ga0075436_100047350 | 3300006914 | Bacteria | 2966 |
| 338 | Ga0075436_100051287 | 3300006914 | Bacteria | 2847 |
| 339 | Ga0097620_100053514 | 3300006931 | Bacteria | 4060 |
| 340 | Ga0097620_100461142 | 3300006931 | Unclassified | 1367 |
| 341 | Ga0099825_1026215 | 3300006941 | Bacteria | 3135 |
| 342 | Ga0099823_1073227 | 3300006944 | Bacteria | 1473 |
| 343 | Ga0075435_100000890 | 3300007076 | Bacteria | 18780 |
| 344 | Ga0075435_100159469 | 3300007076 | Bacteria | 1899 |
| 345 | Ga0075435_100166878 | 3300007076 | Bacteria | 1856 |
| 346 | Ga0099794_10032701 | 3300007265 | Bacteria | 2443 |
| 347 | Ga0099794_10102797 | 3300007265 | Bacteria | 1427 |
| 348 | Ga0105251_10020694 | 3300009011 | Bacteria | 3451 |
| 349 | Ga0105240_10000024 | 3300009093 | Bacteria | 375919 |
| 350 | Ga0105240_10046080 | 3300009093 | Bacteria | 5527 |
| 351 | Ga0105240_10062192 | 3300009093 | Bacteria | 4649 |
| 352 | Ga0105240_10253927 | 3300009093 | Bacteria | 2032 |
| 353 | Ga0105240_10399259 | 3300009093 | Bacteria | 1549 |
| 354 | Ga0111539_10000789 | 3300009094 | Bacteria | 41240 |
| 355 | Ga0111539_10010846 | 3300009094 | Bacteria | 11469 |
| 356 | Ga0111539_10024989 | 3300009094 | Bacteria | 7320 |
| 357 | Ga0111539_10068891 | 3300009094 | Bacteria | 4177 |
| 358 | Ga0111539_10090299 | 3300009094 | Bacteria | 3600 |
| 359 | Ga0111539_10096871 | 3300009094 | Bacteria | 3465 |
| 360 | Ga0111539_10104175 | 3300009094 | Bacteria | 3329 |
| 361 | Ga0111539_10249156 | 3300009094 | Bacteria | 2068 |
| 362 | Ga0111539_10334326 | 3300009094 | Bacteria | 1763 |
| 363 | Ga0105245_10000925 | 3300009098 | Bacteria | 26651 |
| 364 | Ga0105245_10002861 | 3300009098 | Bacteria | 15501 |
| 365 | Ga0105245_10073287 | 3300009098 | Bacteria | 3113 |
| 366 | Ga0105245_10086442 | 3300009098 | Bacteria | 2876 |
| 367 | Ga0105245_10663491 | 3300009098 | Bacteria | 1074 |
| 368 | Ga0105247_10010607 | 3300009101 | Bacteria | 5565 |
| 369 | Ga0105247_10057428 | 3300009101 | Bacteria | 2406 |
| 370 | Ga0105247_10339363 | 3300009101 | Unclassified | 1053 |
| 371 | Ga0114129_10000759 | 3300009147 | Bacteria | 41109 |
| 372 | Ga0114129_10000935 | 3300009147 | Bacteria | 38153 |
| 373 | Ga0114129_10002014 | 3300009147 | Bacteria | 27856 |
| 374 | Ga0114129_10038647 | 3300009147 | Bacteria | 6730 |
| 375 | Ga0114129_10062023 | 3300009147 | Bacteria | 5223 |
| 376 | Ga0114129_10119138 | 3300009147 | Bacteria | 3636 |
| 377 | Ga0114129_10175301 | 3300009147 | Bacteria | 2920 |
| 378 | Ga0114129_10196919 | 3300009147 | Bacteria | 2731 |
| 379 | Ga0105243_10012646 | 3300009148 | Bacteria | 6375 |
| 380 | Ga0105243_10021908 | 3300009148 | Bacteria | 4853 |
| 381 | Ga0105243_10103353 | 3300009148 | Bacteria | 2369 |
| 382 | Ga0105243_10210515 | 3300009148 | Bacteria | 1712 |
| 383 | Ga0105243_10520996 | 3300009148 | Unclassified | 1131 |
| 384 | Ga0105241_10004258 | 3300009174 | Bacteria | 10578 |
| 385 | Ga0105241_10074146 | 3300009174 | Bacteria | 2650 |
| 386 | Ga0105241_10089569 | 3300009174 | Bacteria | 2424 |
| 387 | Ga0105242_10005000 | 3300009176 | Bacteria | 10253 |
| 388 | Ga0105242_10028441 | 3300009176 | Bacteria | 4451 |
| 389 | Ga0105242_10158100 | 3300009176 | Bacteria | 1981 |
| 390 | Ga0105242_10392195 | 3300009176 | Bacteria | 1293 |
| 391 | Ga0105242_10435330 | 3300009176 | Bacteria | 1232 |
| 392 | Ga0105248_10006082 | 3300009177 | Bacteria | 13247 |
| 393 | Ga0105248_10027254 | 3300009177 | Bacteria | 6358 |
| 394 | Ga0105248_10107219 | 3300009177 | Bacteria | 3150 |
| 395 | Ga0105248_10283913 | 3300009177 | Bacteria | 1864 |
| 396 | Ga0105248_10317029 | 3300009177 | Bacteria | 1756 |
| 397 | Ga0105237_10002267 | 3300009545 | Bacteria | 23930 |
| 398 | Ga0105237_10070436 | 3300009545 | Bacteria | 3493 |
| 399 | Ga0105237_10177567 | 3300009545 | Bacteria | 2130 |
| 400 | Ga0105238_10022578 | 3300009551 | Bacteria | 6412 |
| 401 | Ga0105238_10025325 | 3300009551 | Bacteria | 6048 |
| 402 | Ga0105238_10029376 | 3300009551 | Bacteria | 5600 |
| 403 | Ga0105238_10050832 | 3300009551 | Bacteria | 4172 |
| 404 | Ga0105249_10004141 | 3300009553 | Bacteria | 12523 |
| 405 | Ga0105249_10018008 | 3300009553 | Bacteria | 6278 |
| 406 | Ga0105249_10018236 | 3300009553 | Bacteria | 6238 |
| 407 | Ga0105249_10235076 | 3300009553 | Bacteria | 1809 |
| 408 | Ga0105249_10359822 | 3300009553 | Bacteria | 1476 |
| 409 | Ga0105249_10416972 | 3300009553 | Bacteria | 1376 |
| 410 | Ga0105249_10637745 | 3300009553 | Bacteria | 1122 |
| 411 | Ga0105239_10001386 | 3300010375 | Bacteria | 32493 |
| 412 | Ga0105239_10058278 | 3300010375 | Bacteria | 4238 |
| 413 | Ga0105239_10115135 | 3300010375 | Bacteria | 2983 |
| 414 | Ga0105239_10315836 | 3300010375 | Bacteria | 1761 |
| 415 | Ga0105239_10437408 | 3300010375 | Bacteria | 1483 |
| 416 | Ga0105239_10504393 | 3300010375 | Bacteria | 1376 |
| 417 | Ga0105246_10008127 | 3300011119 | Bacteria | 6441 |
| 418 | Ga0105246_10106667 | 3300011119 | Bacteria | 2050 |
| 419 | Ga0105246_10219980 | 3300011119 | Bacteria | 1488 |
| 420 | Ga0157336_1000695 | 3300012477 | Unclassified | 1578 |
| 421 | Ga0157342_1003003 | 3300012507 | Bacteria | 1418 |
| 422 | Ga0157338_1000839 | 3300012515 | Bacteria | 2004 |
| 423 | Ga0157338_1001291 | 3300012515 | Bacteria | 1758 |
| 424 | Ga0157373_10022700 | 3300013100 | Bacteria | 4551 |
| 425 | Ga0157373_10028826 | 3300013100 | Bacteria | 4003 |
| 426 | Ga0157373_10075079 | 3300013100 | Unclassified | 2385 |
| 427 | Ga0157371_10008660 | 3300013102 | Bacteria | 8082 |
| 428 | Ga0157371_10238067 | 3300013102 | Bacteria | 1309 |
| 429 | Ga0157370_10000180 | 3300013104 | Bacteria | 79428 |
| 430 | Ga0157370_10015656 | 3300013104 | Bacteria | 7703 |
| 431 | Ga0157370_10093961 | 3300013104 | Bacteria | 2814 |
| 432 | Ga0157369_10017624 | 3300013105 | Bacteria | 8028 |
| 433 | Ga0157374_10001601 | 3300013296 | Bacteria | 18992 |
| 434 | Ga0157374_10013850 | 3300013296 | Bacteria | 7046 |
| 435 | Ga0157378_10002020 | 3300013297 | Bacteria | 18147 |
| 436 | Ga0157378_10045512 | 3300013297 | Bacteria | 3899 |
| 437 | Ga0157378_10076853 | 3300013297 | Bacteria | 3009 |
| 438 | Ga0157378_10410686 | 3300013297 | Bacteria | 1336 |
| 439 | Ga0163162_10020934 | 3300013306 | Bacteria | 6433 |
| 440 | Ga0163162_10021331 | 3300013306 | Bacteria | 6378 |
| 441 | Ga0163162_10134579 | 3300013306 | Bacteria | 2582 |
| 442 | Ga0163162_10351522 | 3300013306 | Bacteria | 1607 |
| 443 | Ga0157372_10111034 | 3300013307 | Bacteria | 3141 |
| 444 | Ga0157372_10141931 | 3300013307 | Bacteria | 2768 |
| 445 | Ga0157372_10506593 | 3300013307 | Bacteria | 1407 |
| 446 | Ga0157375_10001500 | 3300013308 | Bacteria | 20055 |
| 447 | Ga0157375_10096785 | 3300013308 | Bacteria | 3025 |
| 448 | Ga0157375_10210424 | 3300013308 | Bacteria | 2102 |
| 449 | Ga0157375_10748079 | 3300013308 | Bacteria | 1129 |
| 450 | Ga0163163_10019456 | 3300014325 | Bacteria | 6377 |
| 451 | Ga0163163_10019635 | 3300014325 | Bacteria | 6348 |
| 452 | Ga0163163_10134358 | 3300014325 | Bacteria | 2514 |
| 453 | Ga0163163_10202048 | 3300014325 | Bacteria | 2036 |
| 454 | Ga0157380_10006688 | 3300014326 | Bacteria | 8141 |
| 455 | Ga0157380_10058984 | 3300014326 | Bacteria | 3061 |
| 456 | Ga0157380_10116274 | 3300014326 | Bacteria | 2257 |
| 457 | Ga0157377_10001219 | 3300014745 | Bacteria | 10969 |
| 458 | Ga0157377_10004034 | 3300014745 | Bacteria | 6701 |
| 459 | Ga0157379_10046013 | 3300014968 | Bacteria | 3895 |
| 460 | Ga0157379_10058507 | 3300014968 | Bacteria | 3446 |
| 461 | Ga0157379_10082837 | 3300014968 | Bacteria | 2875 |
| 462 | Ga0157376_10001430 | 3300014969 | Bacteria | 15703 |
| 463 | Ga0157376_10136269 | 3300014969 | Bacteria | 2197 |
| 464 | Ga0163161_10001393 | 3300017792 | Bacteria | 17843 |
| 465 | Ga0163161_10041464 | 3300017792 | Bacteria | 3307 |
| 466 | Ga0163161_10112486 | 3300017792 | Bacteria | 2037 |
| 467 | Ga0206354_11266181 | 3300020081 | Bacteria | 1247 |
| 468 | Ga0213876_10004936 | 3300021384 | Bacteria | 7383 |
| 469 | Ga0213875_10000031 | 3300021388 | Bacteria | 176367 |
| 470 | Ga0228598_1000332 | 3300024227 | Bacteria | 9268 |
| 471 | Ga0209677_100837 | 3300025253 | Bacteria | 15253 |
| 472 | Ga0209233_1003871 | 3300025261 | Bacteria | 5205 |
| 473 | Ga0209233_1013175 | 3300025261 | Bacteria | 2367 |
| 474 | Ga0207666_1000163 | 3300025271 | Bacteria | 10415 |
| 475 | Ga0209455_1015801 | 3300025272 | Bacteria | 1643 |
| 476 | Ga0209758_1000634 | 3300025297 | Bacteria | 53757 |
| 477 | Ga0209758_1004442 | 3300025297 | Bacteria | 11664 |
| 478 | Ga0209758_1029772 | 3300025297 | Bacteria | 2274 |
| 479 | Ga0207697_10005022 | 3300025315 | Bacteria | 6209 |
| 480 | Ga0207697_10018719 | 3300025315 | Bacteria | 2838 |
| 481 | Ga0207653_10078965 | 3300025885 | Unclassified | 1136 |
| 482 | Ga0207682_10000064 | 3300025893 | Bacteria | 46752 |
| 483 | Ga0207692_10001996 | 3300025898 | Bacteria | 7795 |
| 484 | Ga0207692_10002828 | 3300025898 | Bacteria | 6702 |
| 485 | Ga0207692_10093833 | 3300025898 | Bacteria | 1633 |
| 486 | Ga0207642_10064958 | 3300025899 | Bacteria | 1713 |
| 487 | Ga0207642_10081206 | 3300025899 | Bacteria | 1575 |
| 488 | Ga0207642_10115202 | 3300025899 | Bacteria | 1376 |
| 489 | Ga0207642_10136785 | 3300025899 | Bacteria | 1286 |
| 490 | Ga0207710_10005111 | 3300025900 | Bacteria | 5677 |
| 491 | Ga0207688_10000659 | 3300025901 | Bacteria | 17029 |
| 492 | Ga0207688_10006579 | 3300025901 | Bacteria | 6321 |
| 493 | Ga0207680_10111632 | 3300025903 | Bacteria | 1774 |
| 494 | Ga0207647_10008358 | 3300025904 | Bacteria | 7424 |
| 495 | Ga0207647_10018502 | 3300025904 | Bacteria | 4708 |
| 496 | Ga0207647_10032237 | 3300025904 | Bacteria | 3369 |
| 497 | Ga0207685_10005621 | 3300025905 | Bacteria | 3332 |
| 498 | Ga0207685_10107120 | 3300025905 | Bacteria | 1205 |
| 499 | Ga0207699_10010235 | 3300025906 | Bacteria | 4698 |
| 500 | Ga0207699_10011012 | 3300025906 | Bacteria | 4557 |
| 501 | Ga0207699_10025399 | 3300025906 | Bacteria | 3252 |
| 502 | Ga0207699_10164655 | 3300025906 | Bacteria | 1479 |
| 503 | Ga0207699_10197781 | 3300025906 | Bacteria | 1360 |
| 504 | Ga0207645_10000040 | 3300025907 | Bacteria | 87876 |
| 505 | Ga0207645_10006029 | 3300025907 | Bacteria | 8714 |
| 506 | Ga0207645_10048545 | 3300025907 | Bacteria | 2711 |
| 507 | Ga0207643_10000072 | 3300025908 | Bacteria | 65857 |
| 508 | Ga0207705_10056668 | 3300025909 | Bacteria | 2826 |
| 509 | Ga0207705_10064919 | 3300025909 | Bacteria | 2638 |
| 510 | Ga0207684_10018395 | 3300025910 | Bacteria | 5982 |
| 511 | Ga0207654_10100886 | 3300025911 | Bacteria | 1778 |
| 512 | Ga0207654_10120835 | 3300025911 | Bacteria | 1644 |
| 513 | Ga0207707_10013269 | 3300025912 | Bacteria | 7179 |
| 514 | Ga0207707_10017843 | 3300025912 | Bacteria | 6190 |
| 515 | Ga0207707_10029037 | 3300025912 | Bacteria | 4833 |
| 516 | Ga0207707_10461227 | 3300025912 | Bacteria | 1086 |
| 517 | Ga0207695_10000036 | 3300025913 | Bacteria | 477897 |
| 518 | Ga0207695_10020001 | 3300025913 | Bacteria | 7683 |
| 519 | Ga0207695_10078328 | 3300025913 | Bacteria | 3354 |
| 520 | Ga0207695_10133015 | 3300025913 | Bacteria | 2443 |
| 521 | Ga0207695_10430576 | 3300025913 | Bacteria | 1203 |
| 522 | Ga0207671_10000191 | 3300025914 | Bacteria | 95004 |
| 523 | Ga0207671_10005373 | 3300025914 | Bacteria | 11835 |
| 524 | Ga0207693_10003700 | 3300025915 | Bacteria | 13032 |
| 525 | Ga0207693_10005910 | 3300025915 | Bacteria | 10150 |
| 526 | Ga0207693_10009265 | 3300025915 | Bacteria | 8037 |
| 527 | Ga0207693_10009447 | 3300025915 | Bacteria | 7947 |
| 528 | Ga0207693_10010740 | 3300025915 | Bacteria | 7434 |
| 529 | Ga0207693_10035352 | 3300025915 | Bacteria | 3939 |
| 530 | Ga0207693_10083946 | 3300025915 | Bacteria | 2496 |
| 531 | Ga0207693_10095942 | 3300025915 | Bacteria | 2325 |
| 532 | Ga0207693_10169440 | 3300025915 | Bacteria | 1720 |
| 533 | Ga0207693_10193953 | 3300025915 | Bacteria | 1598 |
| 534 | Ga0207663_10029576 | 3300025916 | Bacteria | 3220 |
| 535 | Ga0207663_10121899 | 3300025916 | Bacteria | 1787 |
| 536 | Ga0207663_10142145 | 3300025916 | Bacteria | 1673 |
| 537 | Ga0207660_10000501 | 3300025917 | Bacteria | 26097 |
| 538 | Ga0207660_10050112 | 3300025917 | Bacteria | 2964 |
| 539 | Ga0207660_10241393 | 3300025917 | Bacteria | 1423 |
| 540 | Ga0207660_10309826 | 3300025917 | Bacteria | 1259 |
| 541 | Ga0207662_10002825 | 3300025918 | Bacteria | 8777 |
| 542 | Ga0207662_10006747 | 3300025918 | Bacteria | 6209 |
| 543 | Ga0207662_10006755 | 3300025918 | Bacteria | 6205 |
| 544 | Ga0207662_10053843 | 3300025918 | Bacteria | 2398 |
| 545 | Ga0207657_10020092 | 3300025919 | Bacteria | 6323 |
| 546 | Ga0207657_10020692 | 3300025919 | Bacteria | 6211 |
| 547 | Ga0207657_10021548 | 3300025919 | Bacteria | 6060 |
| 548 | Ga0207657_10031123 | 3300025919 | Bacteria | 4837 |
| 549 | Ga0207657_10065767 | 3300025919 | Bacteria | 3089 |
| 550 | Ga0207649_10003387 | 3300025920 | Bacteria | 8721 |
| 551 | Ga0207649_10025473 | 3300025920 | Bacteria | 3449 |
| 552 | Ga0207649_10204018 | 3300025920 | Bacteria | 1398 |
| 553 | Ga0207652_10018767 | 3300025921 | Bacteria | 5676 |
| 554 | Ga0207652_10060283 | 3300025921 | Bacteria | 3274 |
| 555 | Ga0207652_10184023 | 3300025921 | Bacteria | 1878 |
| 556 | Ga0207646_10139946 | 3300025922 | Bacteria | 2179 |
| 557 | Ga0207681_10000539 | 3300025923 | Bacteria | 26052 |
| 558 | Ga0207681_10097483 | 3300025923 | Bacteria | 2113 |
| 559 | Ga0207694_10029108 | 3300025924 | Bacteria | 4213 |
| 560 | Ga0207694_10133104 | 3300025924 | Bacteria | 1994 |
| 561 | Ga0207650_10000415 | 3300025925 | Bacteria | 37969 |
| 562 | Ga0207650_10001724 | 3300025925 | Bacteria | 15545 |
| 563 | Ga0207650_10030779 | 3300025925 | Bacteria | 3870 |
| 564 | Ga0207650_10038239 | 3300025925 | Bacteria | 3503 |
| 565 | Ga0207650_10280441 | 3300025925 | Unclassified | 1357 |
| 566 | Ga0207659_10000444 | 3300025926 | Bacteria | 24819 |
| 567 | Ga0207659_10042773 | 3300025926 | Bacteria | 3178 |
| 568 | Ga0207659_10095486 | 3300025926 | Bacteria | 2230 |
| 569 | Ga0207659_10134336 | 3300025926 | Bacteria | 1914 |
| 570 | Ga0207659_10178803 | 3300025926 | Bacteria | 1679 |
| 571 | Ga0207687_10000144 | 3300025927 | Bacteria | 47356 |
| 572 | Ga0207687_10013684 | 3300025927 | Bacteria | 5297 |
| 573 | Ga0207687_10480554 | 3300025927 | Bacteria | 1034 |
| 574 | Ga0207700_10000458 | 3300025928 | Bacteria | 23936 |
| 575 | Ga0207700_10015033 | 3300025928 | Bacteria | 5091 |
| 576 | Ga0207700_10052748 | 3300025928 | Bacteria | 3042 |
| 577 | Ga0207700_10094978 | 3300025928 | Bacteria | 2364 |
| 578 | Ga0207700_10144937 | 3300025928 | Bacteria | 1956 |
| 579 | Ga0207664_10000692 | 3300025929 | Bacteria | 23079 |
| 580 | Ga0207664_10002435 | 3300025929 | Bacteria | 12311 |
| 581 | Ga0207664_10081446 | 3300025929 | Bacteria | 2634 |
| 582 | Ga0207664_10090775 | 3300025929 | Bacteria | 2504 |
| 583 | Ga0207664_10331276 | 3300025929 | Bacteria | 1345 |
| 584 | Ga0207644_10001694 | 3300025931 | Bacteria | 14217 |
| 585 | Ga0207644_10007950 | 3300025931 | Bacteria | 6936 |
| 586 | Ga0207690_10000086 | 3300025932 | Bacteria | 77995 |
| 587 | Ga0207690_10072373 | 3300025932 | Bacteria | 2380 |
| 588 | Ga0207690_10310675 | 3300025932 | Bacteria | 1236 |
| 589 | Ga0207706_10001993 | 3300025933 | Bacteria | 19993 |
| 590 | Ga0207706_10003068 | 3300025933 | Bacteria | 16076 |
| 591 | Ga0207706_10003497 | 3300025933 | Bacteria | 15003 |
| 592 | Ga0207706_10019399 | 3300025933 | Bacteria | 6118 |
| 593 | Ga0207706_10085984 | 3300025933 | Bacteria | 2764 |
| 594 | Ga0207706_10109552 | 3300025933 | Bacteria | 2430 |
| 595 | Ga0207706_10120845 | 3300025933 | Bacteria | 2303 |
| 596 | Ga0207686_10000973 | 3300025934 | Bacteria | 17046 |
| 597 | Ga0207686_10149733 | 3300025934 | Bacteria | 1623 |
| 598 | Ga0207709_10000431 | 3300025935 | Bacteria | 40052 |
| 599 | Ga0207709_10120544 | 3300025935 | Bacteria | 1770 |
| 600 | Ga0207670_10001153 | 3300025936 | Bacteria | 13914 |
| 601 | Ga0207670_10001643 | 3300025936 | Bacteria | 11672 |
| 602 | Ga0207670_10003991 | 3300025936 | Bacteria | 7879 |
| 603 | Ga0207670_10022367 | 3300025936 | Bacteria | 3917 |
| 604 | Ga0207669_10000228 | 3300025937 | Bacteria | 25653 |
| 605 | Ga0207669_10003549 | 3300025937 | Bacteria | 6756 |
| 606 | Ga0207669_10067393 | 3300025937 | Bacteria | 2230 |
| 607 | Ga0207669_10131214 | 3300025937 | Bacteria | 1722 |
| 608 | Ga0207704_10000107 | 3300025938 | Bacteria | 45669 |
| 609 | Ga0207704_10349102 | 3300025938 | Unclassified | 1151 |
| 610 | Ga0207665_10005548 | 3300025939 | Bacteria | 8416 |
| 611 | Ga0207665_10007482 | 3300025939 | Bacteria | 7217 |
| 612 | Ga0207691_10001173 | 3300025940 | Bacteria | 26058 |
| 613 | Ga0207691_10002332 | 3300025940 | Bacteria | 18584 |
| 614 | Ga0207691_10102780 | 3300025940 | Bacteria | 2549 |
| 615 | Ga0207691_10462469 | 3300025940 | Bacteria | 1079 |
| 616 | Ga0207711_10001611 | 3300025941 | Bacteria | 20827 |
| 617 | Ga0207711_10037079 | 3300025941 | Bacteria | 4139 |
| 618 | Ga0207711_10071891 | 3300025941 | Bacteria | 3003 |
| 619 | Ga0207689_10000115 | 3300025942 | Bacteria | 66254 |
| 620 | Ga0207689_10019975 | 3300025942 | Bacteria | 5641 |
| 621 | Ga0207689_10058235 | 3300025942 | Bacteria | 3178 |
| 622 | Ga0207689_10079235 | 3300025942 | Bacteria | 2700 |
| 623 | Ga0207689_10336150 | 3300025942 | Bacteria | 1254 |
| 624 | Ga0207661_10000427 | 3300025944 | Bacteria | 27219 |
| 625 | Ga0207661_10143082 | 3300025944 | Bacteria | 2060 |
| 626 | Ga0207661_10152722 | 3300025944 | Bacteria | 1997 |
| 627 | Ga0207679_10000025 | 3300025945 | Bacteria | 203699 |
| 628 | Ga0207679_10009981 | 3300025945 | Bacteria | 6100 |
| 629 | Ga0207679_10102337 | 3300025945 | Bacteria | 2243 |
| 630 | Ga0207679_10190077 | 3300025945 | Bacteria | 1706 |
| 631 | Ga0207679_10417118 | 3300025945 | Bacteria | 1184 |
| 632 | Ga0207667_10018931 | 3300025949 | Bacteria | 7702 |
| 633 | Ga0207667_10068500 | 3300025949 | Bacteria | 3695 |
| 634 | Ga0207667_10182532 | 3300025949 | Bacteria | 2154 |
| 635 | Ga0207651_10000081 | 3300025960 | Bacteria | 42817 |
| 636 | Ga0207651_10017679 | 3300025960 | Bacteria | 4219 |
| 637 | Ga0207651_10378181 | 3300025960 | Bacteria | 1199 |
| 638 | Ga0207651_10398565 | 3300025960 | Bacteria | 1170 |
| 639 | Ga0207712_10001191 | 3300025961 | Bacteria | 17983 |
| 640 | Ga0207712_10010168 | 3300025961 | Bacteria | 5966 |
| 641 | Ga0207668_10000171 | 3300025972 | Bacteria | 44795 |
| 642 | Ga0207640_10000631 | 3300025981 | Bacteria | 20654 |
| 643 | Ga0207640_10161933 | 3300025981 | Bacteria | 1656 |
| 644 | Ga0207640_10167234 | 3300025981 | Bacteria | 1634 |
| 645 | Ga0207658_10005655 | 3300025986 | Bacteria | 8559 |
| 646 | Ga0207658_10064999 | 3300025986 | Bacteria | 2738 |
| 647 | Ga0207658_10072350 | 3300025986 | Bacteria | 2613 |
| 648 | Ga0207677_10000447 | 3300026023 | Bacteria | 27944 |
| 649 | Ga0207703_10002461 | 3300026035 | Bacteria | 16058 |
| 650 | Ga0207703_10016409 | 3300026035 | Bacteria | 5774 |
| 651 | Ga0207703_10045609 | 3300026035 | Bacteria | 3527 |
| 652 | Ga0207703_10082095 | 3300026035 | Bacteria | 2689 |
| 653 | Ga0207703_10266990 | 3300026035 | Unclassified | 1549 |
| 654 | Ga0207639_10001124 | 3300026041 | Bacteria | 18176 |
| 655 | Ga0207639_10324804 | 3300026041 | Bacteria | 1367 |
| 656 | Ga0207678_10006341 | 3300026067 | Bacteria | 10500 |
| 657 | Ga0207678_10016727 | 3300026067 | Bacteria | 6442 |
| 658 | Ga0207678_10040686 | 3300026067 | Bacteria | 4030 |
| 659 | Ga0207678_10110966 | 3300026067 | Bacteria | 2340 |
| 660 | Ga0207708_10004257 | 3300026075 | Bacteria | 10536 |
| 661 | Ga0207708_10013006 | 3300026075 | Bacteria | 6209 |
| 662 | Ga0207708_10013024 | 3300026075 | Bacteria | 6205 |
| 663 | Ga0207708_10193573 | 3300026075 | Bacteria | 1620 |
| 664 | Ga0207702_10001906 | 3300026078 | Bacteria | 20374 |
| 665 | Ga0207702_10035301 | 3300026078 | Bacteria | 4181 |
| 666 | Ga0207702_10483841 | 3300026078 | Bacteria | 1205 |
| 667 | Ga0207702_10594234 | 3300026078 | Bacteria | 1086 |
| 668 | Ga0207641_10001385 | 3300026088 | Bacteria | 23881 |
| 669 | Ga0207641_10060666 | 3300026088 | Bacteria | 3224 |
| 670 | Ga0207641_10099338 | 3300026088 | Bacteria | 2561 |
| 671 | Ga0207641_10099376 | 3300026088 | Bacteria | 2560 |
| 672 | Ga0207641_10129430 | 3300026088 | Bacteria | 2264 |
| 673 | Ga0207641_10163454 | 3300026088 | Bacteria | 2026 |
| 674 | Ga0207641_10355597 | 3300026088 | Bacteria | 1397 |
| 675 | Ga0207648_10054328 | 3300026089 | Bacteria | 3499 |
| 676 | Ga0207648_10241375 | 3300026089 | Bacteria | 1609 |
| 677 | Ga0207648_10270036 | 3300026089 | Bacteria | 1519 |
| 678 | Ga0207676_10010826 | 3300026095 | Bacteria | 6504 |
| 679 | Ga0207676_10064322 | 3300026095 | Bacteria | 2916 |
| 680 | Ga0207676_10112109 | 3300026095 | Bacteria | 2284 |
| 681 | Ga0207676_10169321 | 3300026095 | Bacteria | 1901 |
| 682 | Ga0207674_10001963 | 3300026116 | Bacteria | 26041 |
| 683 | Ga0207674_10030777 | 3300026116 | Bacteria | 5641 |
| 684 | Ga0207674_10041706 | 3300026116 | Bacteria | 4745 |
| 685 | Ga0207674_10106752 | 3300026116 | Bacteria | 2777 |
| 686 | Ga0207674_10182274 | 3300026116 | Bacteria | 2051 |
| 687 | Ga0207675_100002006 | 3300026118 | Bacteria | 20298 |
| 688 | Ga0207675_100015436 | 3300026118 | Bacteria | 7124 |
| 689 | Ga0207675_100021400 | 3300026118 | Bacteria | 6024 |
| 690 | Ga0207675_100098921 | 3300026118 | Bacteria | 2748 |
| 691 | Ga0207683_10000001 | 3300026121 | Bacteria | 352047 |
| 692 | Ga0207683_10011391 | 3300026121 | Bacteria | 7588 |
| 693 | Ga0207683_10014385 | 3300026121 | Bacteria | 6738 |
| 694 | Ga0207683_10052773 | 3300026121 | Bacteria | 3563 |
| 695 | Ga0207698_10000531 | 3300026142 | Bacteria | 22175 |
| 696 | Ga0207698_10016679 | 3300026142 | Bacteria | 4962 |
| 697 | Ga0207698_10246809 | 3300026142 | Unclassified | 1631 |
| 698 | Ga0207698_10429227 | 3300026142 | Bacteria | 1270 |
| 699 | Ga0209389_1000153 | 3300027296 | Bacteria | 58606 |
| 700 | Ga0209489_100936 | 3300027361 | Bacteria | 58586 |
| 701 | Ga0209700_100011 | 3300027363 | Bacteria | 362159 |
| 702 | Ga0210002_1007289 | 3300027617 | Bacteria | 1674 |
| 703 | Ga0209588_1045738 | 3300027671 | Bacteria | 1416 |
| 704 | Ga0209971_1015712 | 3300027682 | Unclassified | 1794 |
| 705 | Ga0209966_1000744 | 3300027695 | Bacteria | 6780 |
| 706 | Ga0209966_1004200 | 3300027695 | Bacteria | 2437 |
| 707 | Ga0209998_10005098 | 3300027717 | Bacteria | 2759 |
| 708 | Ga0209998_10011877 | 3300027717 | Bacteria | 1808 |
| 709 | Ga0209974_10005645 | 3300027876 | Bacteria | 4392 |
| 710 | Ga0207428_10000221 | 3300027907 | Bacteria | 79234 |
| 711 | Ga0207428_10000374 | 3300027907 | Bacteria | 56990 |
| 712 | Ga0207428_10000524 | 3300027907 | Bacteria | 45818 |
| 713 | Ga0207428_10091574 | 3300027907 | Bacteria | 2360 |
| 714 | Ga0268266_10022478 | 3300028379 | Bacteria | 5374 |
| 715 | Ga0268266_10095530 | 3300028379 | Bacteria | 2610 |
| 716 | Ga0268266_10125364 | 3300028379 | Bacteria | 2291 |
| 717 | Ga0268266_10485293 | 3300028379 | Unclassified | 1178 |
| 718 | Ga0268265_10002636 | 3300028380 | Bacteria | 13322 |
| 719 | Ga0268265_10230733 | 3300028380 | Bacteria | 1627 |
| 720 | Ga0268264_10000886 | 3300028381 | Bacteria | 31552 |
| 721 | Ga0268264_10007945 | 3300028381 | Bacteria | 8829 |
| 722 | Ga0268264_10255311 | 3300028381 | Bacteria | 1630 |
| 723 | Ga0268264_10545222 | 3300028381 | Bacteria | 1137 |
| 724 | Ga0265337_1002520 | 3300028556 | Bacteria | 8352 |
| 725 | Ga0265318_10012161 | 3300028577 | Bacteria | 3673 |
| 726 | Ga0265338_10034655 | 3300028800 | Bacteria | 4874 |
| 727 | Ga0265330_10026153 | 3300031235 | Bacteria | 2642 |
| 728 | Ga0265330_10033066 | 3300031235 | Bacteria | 2316 |
| 729 | Ga0265330_10065930 | 3300031235 | Bacteria | 1571 |
| 730 | Ga0265330_10067502 | 3300031235 | Bacteria | 1550 |
| 731 | Ga0265320_10008506 | 3300031240 | Bacteria | 6276 |
| 732 | Ga0265325_10000095 | 3300031241 | Bacteria | 62028 |
| 733 | Ga0265325_10000238 | 3300031241 | Bacteria | 39199 |
| 734 | Ga0265325_10010377 | 3300031241 | Bacteria | 5397 |
| 735 | Ga0265325_10017266 | 3300031241 | Bacteria | 4012 |
| 736 | Ga0265325_10022512 | 3300031241 | Bacteria | 3451 |
| 737 | Ga0265325_10035754 | 3300031241 | Bacteria | 2636 |
| 738 | Ga0265325_10093922 | 3300031241 | Bacteria | 1475 |
| 739 | Ga0265329_10021859 | 3300031242 | Bacteria | 2145 |
| 740 | Ga0265340_10015759 | 3300031247 | Bacteria | 3922 |
| 741 | Ga0265339_10000051 | 3300031249 | Bacteria | 101716 |
| 742 | Ga0265339_10014949 | 3300031249 | Bacteria | 4667 |
| 743 | Ga0265339_10016577 | 3300031249 | Bacteria | 4389 |
| 744 | Ga0265339_10073737 | 3300031249 | Bacteria | 1814 |
| 745 | Ga0265339_10110678 | 3300031249 | Bacteria | 1421 |
| 746 | Ga0265331_10010219 | 3300031250 | Bacteria | 5205 |
| 747 | Ga0265331_10054659 | 3300031250 | Bacteria | 1901 |
| 748 | Ga0265331_10124001 | 3300031250 | Bacteria | 1180 |
| 749 | Ga0265316_10055514 | 3300031344 | Bacteria | 3097 |
| 750 | Ga0265316_10184635 | 3300031344 | Bacteria | 1552 |
| 751 | Ga0307509_10151458 | 3300031507 | Bacteria | 2234 |
| 752 | Ga0307408_100072066 | 3300031548 | Bacteria | 2557 |
| 753 | Ga0265313_10000011 | 3300031595 | Bacteria | 166182 |
| 754 | Ga0265313_10001977 | 3300031595 | Bacteria | 18509 |
| 755 | Ga0265313_10007848 | 3300031595 | Bacteria | 7199 |
| 756 | Ga0265313_10020261 | 3300031595 | Bacteria | 3674 |
| 757 | Ga0265313_10084957 | 3300031595 | Bacteria | 1431 |
| 758 | Ga0265313_10101515 | 3300031595 | Bacteria | 1276 |
| 759 | Ga0316579_10002505 | 3300031691 | Bacteria | 6949 |
| 760 | Ga0265314_10001044 | 3300031711 | Bacteria | 32301 |
| 761 | Ga0265314_10019890 | 3300031711 | Bacteria | 5191 |
| 762 | Ga0265314_10221629 | 3300031711 | Bacteria | 1103 |
| 763 | Ga0265342_10000367 | 3300031712 | Bacteria | 49629 |
| 764 | Ga0265342_10005329 | 3300031712 | Bacteria | 9842 |
| 765 | Ga0265342_10019764 | 3300031712 | Bacteria | 4334 |
| 766 | Ga0265342_10136028 | 3300031712 | Bacteria | 1373 |
| 767 | Ga0316578_10048114 | 3300031728 | Bacteria | 2489 |
| 768 | Ga0307409_100080979 | 3300031995 | Bacteria | 2623 |
| 769 | Ga0307416_100431832 | 3300032002 | Bacteria | 1365 |
| 770 | Ga0316583_10001321 | 3300032133 | Bacteria | 8194 |
| 771 | Ga0307510_10226573 | 3300033180 | Bacteria | 1376 |
| 772 | Ga0373930_0002702 | 3300034816 | Bacteria | 2763 |
| 773 | Ga0373948_0000586 | 3300034817 | Bacteria | 4656 |
| 774 | Ga0373948_0004324 | 3300034817 | Bacteria | 2239 |
| 775 | Ga0373950_0002705 | 3300034818 | Bacteria | 2466 |
| 776 | Ga0373950_0004683 | 3300034818 | Bacteria | 2012 |
| 777 | Ga0373959_0000346 | 3300034820 | Bacteria | 9428 |
| 778 | Ga0373938_0000019 | 3300034957 | Bacteria | 20929 |
| 779 | Ga0373938_0000500 | 3300034957 | Bacteria | 6335 |
| 780 | Ga0373926_0022520 | 3300035083 | Bacteria | 2185 |
| 781 | Ga0373926_0064608 | 3300035083 | Bacteria | 1337 |
| 782 | Ga0373928_0000086 | 3300035084 | Bacteria | 16168 |
| 783 | Ga0373929_0002104 | 3300035085 | Bacteria | 3699 |
| 784 | Ga0373934_0038930 | 3300035086 | Unclassified | 1873 |
| 785 | Ga0373940_0000128 | 3300035088 | Bacteria | 9663 |
| 786 | Ga0373940_0015602 | 3300035088 | Bacteria | 1871 |
| 787 | Ga0373940_0017215 | 3300035088 | Bacteria | 1800 |
| 788 | Ga0373944_0000472 | 3300035089 | Bacteria | 9345 |
| 789 | Ga0373944_0001073 | 3300035089 | Bacteria | 6771 |
| 790 | Ga0373944_0012540 | 3300035089 | Bacteria | 2338 |
| 791 | Ga0373949_0001092 | 3300035090 | Bacteria | 8253 |
| 792 | Ga0373949_0001874 | 3300035090 | Bacteria | 5709 |
| 793 | Ga0373951_0002197 | 3300035091 | Bacteria | 4963 |
| 794 | Ga0373952_0000337 | 3300035092 | Bacteria | 7938 |
| 795 | Ga0373952_0017082 | 3300035092 | Bacteria | 1485 |
| 796 | Ga0373923_0034447 | 3300035111 | Bacteria | 2055 |
| 797 | Ga0373923_0096235 | 3300035111 | Bacteria | 1301 |
| 798 | Ga0373932_0000684 | 3300035112 | Bacteria | 10250 |
| 799 | Ga0373932_0011414 | 3300035112 | Bacteria | 2170 |
| 800 | Ga0373936_0002845 | 3300035113 | Bacteria | 6456 |
| 801 | Ga0373936_0021363 | 3300035113 | Bacteria | 2517 |
| 802 | Ga0373936_0119764 | 3300035113 | Bacteria | 1124 |
| 803 | Ga0373939_0000537 | 3300035114 | Bacteria | 9521 |
| 804 | Ga0373939_0012799 | 3300035114 | Bacteria | 2146 |
| 805 | Ga0373939_0016529 | 3300035114 | Bacteria | 1947 |
| 806 | Ga0373941_0000130 | 3300035115 | Bacteria | 13172 |
| 807 | Ga0373941_0009489 | 3300035115 | Bacteria | 2453 |
| 808 | Ga0373941_0019114 | 3300035115 | Bacteria | 1902 |
| 809 | Ga0373945_0001076 | 3300035116 | Bacteria | 8213 |
| 810 | Ga0373945_0015805 | 3300035116 | Bacteria | 2542 |
| 811 | Ga0373945_0072476 | 3300035116 | Bacteria | 1306 |
| 812 | Ga0373945_0075655 | 3300035116 | Bacteria | 1282 |
| 813 | Ga0373953_0001623 | 3300035117 | Bacteria | 6583 |
| 814 | Ga0373953_0014816 | 3300035117 | Bacteria | 2812 |
| 815 | Ga0373953_0050506 | 3300035117 | Bacteria | 1680 |
| 816 | Ga0373954_0010286 | 3300035118 | Bacteria | 4127 |
| 817 | Ga0373954_0052451 | 3300035118 | Bacteria | 1916 |
| 818 | Ga0373954_0105080 | 3300035118 | Bacteria | 1363 |
| 819 | Ga0373956_0031832 | 3300035119 | Bacteria | 2313 |
| 820 | Ga0373956_0031873 | 3300035119 | Bacteria | 2311 |
| 821 | Ga0373956_0046252 | 3300035119 | Bacteria | 1943 |
| 822 | Ga0373957_0019620 | 3300035120 | Bacteria | 2382 |
| 823 | Ga0373957_0053530 | 3300035120 | Bacteria | 1548 |
| 824 | Ga0373957_0090821 | 3300035120 | Bacteria | 1214 |
| 825 | Ga0373960_0022935 | 3300035121 | Bacteria | 1677 |
| 826 | Ga0373943_0012213 | 3300035170 | Bacteria | 3866 |
| 827 | Ga0373943_0025061 | 3300035170 | Bacteria | 2785 |
| 828 | Ga0373943_0028196 | 3300035170 | Bacteria | 2644 |
| 829 | Ga0373943_0042659 | 3300035170 | Bacteria | 2199 |
| 830 | Ga0373943_0058877 | 3300035170 | Bacteria | 1913 |
| 831 | Ga0373943_0064396 | 3300035170 | Bacteria | 1841 |
| 832 | Ga0373943_0151609 | 3300035170 | Bacteria | 1256 |
| 833 | Ga0373946_0009917 | 3300035171 | Bacteria | 3521 |
| 834 | Ga0373946_0020297 | 3300035171 | Bacteria | 2567 |
| 835 | Ga0373946_0030130 | 3300035171 | Bacteria | 2164 |
| 836 | Ga0373946_0030202 | 3300035171 | Bacteria | 2162 |
| 837 | Ga0373946_0093789 | 3300035171 | Bacteria | 1334 |
| 838 | Ga0373946_0103836 | 3300035171 | Bacteria | 1278 |
| 839 | Ga0373955_0001240 | 3300035172 | Bacteria | 10837 |
| 840 | Ga0373955_0004568 | 3300035172 | Bacteria | 6133 |
| 841 | Ga0373955_0004598 | 3300035172 | Bacteria | 6115 |
| 842 | Ga0373955_0124028 | 3300035172 | Bacteria | 1503 |
| 843 | Ga0373942_0000650 | 3300035207 | Bacteria | 9743 |
| 844 | Ga0373942_0002645 | 3300035207 | Bacteria | 4306 |
| 845 | Ga0373942_0077150 | 3300035207 | Bacteria | 983 |
| 846 | Ga0373961_0001156 | 3300035241 | Bacteria | 8246 |
| 847 | Ga0373961_0013154 | 3300035241 | Bacteria | 2081 |
| 848 | Ga0373962_0000281 | 3300035242 | Bacteria | 10947 |
| 849 | Ga0373962_0003190 | 3300035242 | Bacteria | 3932 |
| 850 | Ga0373962_0032757 | 3300035242 | Bacteria | 1431 |
| 851 | Ga0316574_0039340 | 3300035398 | Bacteria | 2907 |
| 852 | Ga0373924_0000635 | 3300035410 | Bacteria | 10882 |
| 853 | Ga0373924_0004146 | 3300035410 | Bacteria | 5042 |
| 854 | Ga0373924_0005822 | 3300035410 | Bacteria | 4387 |
| 855 | Ga0373924_0022743 | 3300035410 | Bacteria | 2453 |
| 856 | Ga0373924_0029106 | 3300035410 | Bacteria | 2206 |
| 857 | Ga0373924_0033888 | 3300035410 | Bacteria | 2064 |
| 858 | Ga0373931_0004016 | 3300035691 | Bacteria | 6664 |
| 859 | Ga0373931_0004777 | 3300035691 | Bacteria | 6215 |
| 860 | Ga0373931_0035877 | 3300035691 | Bacteria | 2581 |
| 861 | Ga0373931_0102290 | 3300035691 | Bacteria | 1613 |
| 862 | Ga0373931_0106433 | 3300035691 | Bacteria | 1585 |
| 863 | Ga0373931_0248280 | 3300035691 | Bacteria | 1081 |
| 864 | Ga0373935_0002667 | 3300035692 | Bacteria | 10266 |
| 865 | Ga0373935_0003893 | 3300035692 | Bacteria | 8708 |
| 866 | Ga0373935_0021979 | 3300035692 | Bacteria | 3906 |
| 867 | Ga0373935_0039012 | 3300035692 | Bacteria | 2975 |
| 868 | Ga0373935_0046689 | 3300035692 | Bacteria | 2736 |
| 869 | Ga0373935_0094775 | 3300035692 | Bacteria | 1959 |
| 870 | Ga0373935_0141185 | 3300035692 | Bacteria | 1627 |
| 871 | Ga0373935_0172953 | 3300035692 | Bacteria | 1478 |
| 872 | Ga0373927_0008477 | 3300035695 | Bacteria | 6917 |
| 873 | Ga0373927_0013111 | 3300035695 | Bacteria | 5513 |
| 874 | Ga0373927_0018038 | 3300035695 | Bacteria | 4641 |
| 875 | Ga0373927_0058352 | 3300035695 | Bacteria | 2496 |
| 876 | Ga0373927_0071247 | 3300035695 | Bacteria | 2249 |
| 877 | Ga0373927_0135461 | 3300035695 | Unclassified | 1609 |
| 878 | Ga0373927_0178451 | 3300035695 | Bacteria | 1393 |
| 879 | Ga0373927_0197380 | 3300035695 | Bacteria | 1320 |
| 880 | Ga0373927_0228883 | 3300035695 | Bacteria | 1221 |
| 881 | Ga0373933_0001633 | 3300035724 | Bacteria | 13061 |
| 882 | Ga0373933_0001683 | 3300035724 | Bacteria | 12877 |
| 883 | Ga0373933_0002774 | 3300035724 | Bacteria | 9775 |
| 884 | Ga0373933_0018474 | 3300035724 | Bacteria | 3921 |
| 885 | Ga0373933_0062962 | 3300035724 | Bacteria | 2241 |
| 886 | Ga0373933_0167235 | 3300035724 | Bacteria | 1398 |
| 887 | Ga0373947_0000169 | 3300035725 | Bacteria | 35262 |
| 888 | Ga0373947_0011727 | 3300035725 | Bacteria | 5022 |
| 889 | Ga0373947_0016872 | 3300035725 | Bacteria | 4195 |
| 890 | Ga0373947_0034868 | 3300035725 | Bacteria | 2977 |
| 891 | Ga0373947_0067004 | 3300035725 | Bacteria | 2192 |
| 892 | Ga0373947_0073998 | 3300035725 | Bacteria | 2095 |
| 893 | Ga0373947_0141490 | 3300035725 | Bacteria | 1543 |
| 894 | Ga0373947_0153081 | 3300035725 | Bacteria | 1486 |
| 895 | Ga0373947_0230202 | 3300035725 | Bacteria | 1220 |
| 896 | Ga0373937_0000075 | 3300036401 | Bacteria | 89727 |
| 897 | Ga0373937_0002452 | 3300036401 | Bacteria | 15416 |
| 898 | Ga0373937_0007161 | 3300036401 | Bacteria | 9645 |
| 899 | Ga0373937_0008142 | 3300036401 | Bacteria | 9102 |
| 900 | Ga0373937_0009623 | 3300036401 | Bacteria | 8415 |
| 901 | Ga0373937_0062499 | 3300036401 | Bacteria | 3423 |
| 902 | Ga0373937_0259048 | 3300036401 | Bacteria | 1640 |
| 903 | Ga0373937_0310407 | 3300036401 | Bacteria | 1492 |
| 904 | Ga0316582_0051301 | 3300036647 | Bacteria | 2617 |
| 905 | Ga0316584_0051145 | 3300036712 | Bacteria | 3090 |
| 906 | Ga0373925_0000159 | 3300037068 | Bacteria | 72851 |
| 907 | Ga0373925_0002536 | 3300037068 | Bacteria | 14550 |
| 908 | Ga0373925_0011850 | 3300037068 | Bacteria | 6310 |
| 909 | Ga0373925_0030508 | 3300037068 | Bacteria | 3957 |
| 910 | Ga0373925_0053580 | 3300037068 | Bacteria | 3016 |
| 911 | Ga0373925_0060582 | 3300037068 | Bacteria | 2842 |
| 912 | Ga0373925_0067035 | 3300037068 | Bacteria | 2706 |
| 913 | Ga0373925_0127140 | 3300037068 | Bacteria | 1984 |
| 914 | Ga0373925_0135420 | 3300037068 | Bacteria | 1924 |
| 915 | Ga0373925_0193802 | 3300037068 | Bacteria | 1613 |
| 916 | Ga0373925_0351132 | 3300037068 | Bacteria | 1197 |
| 917 | Ga0395899_0014324 | 3300037312 | Bacteria | 6053 |
| 918 | Ga0395899_0061279 | 3300037312 | Bacteria | 2771 |
| 919 | Ga0395899_0143330 | 3300037312 | Bacteria | 1699 |
| 920 | Ga0395900_0013523 | 3300037418 | Bacteria | 8338 |
| 921 | Ga0395900_0060104 | 3300037418 | Bacteria | 3912 |
| 922 | Ga0395900_0434002 | 3300037418 | Bacteria | 1272 |
| 923 | Ga0395900_0584945 | 3300037418 | Bacteria | 1058 |
| 924 | Ga0395898_0007764 | 3300037466 | Bacteria | 11391 |
| 925 | Ga0395898_0026676 | 3300037466 | Bacteria | 5808 |
| 926 | Ga0395898_0049193 | 3300037466 | Bacteria | 4131 |
| 927 | Ga0395898_0188870 | 3300037466 | Bacteria | 1969 |
| 928 | Ga0395905_0003532 | 3300037471 | Bacteria | 16666 |
| 929 | Ga0395905_0049932 | 3300037471 | Bacteria | 3921 |
| 930 | Ga0395905_0431940 | 3300037471 | Bacteria | 1214 |
| 931 | Ga0436364_0743503 | 3300037853 | Bacteria | 33195 |
| 932 | Ga0395901_0006371 | 3300038443 | Bacteria | 11961 |
| 933 | Ga0395901_0161252 | 3300038443 | Bacteria | 2355 |
| 934 | Ga0395901_0251165 | 3300038443 | Bacteria | 1842 |
| 935 | Ga0395901_0361685 | 3300038443 | Bacteria | 1496 |
| 936 | Ga0395901_0395919 | 3300038443 | Bacteria | 1419 |
| 937 | Ga0242420_002129 | 3300038996 | Bacteria | 2785 |
| 938 | Ga0400483_253337 | 3300039062 | Bacteria | 2322 |
| 939 | Ga0436365_0208174 | 3300039437 | Bacteria | 1054 |
| 940 | Ga0436365_1154146 | 3300039437 | Bacteria | 2937 |
| 941 | Ga0436365_1691170 | 3300039437 | Bacteria | 24758 |
| 942 | Ga0436365_1739170 | 3300039437 | Bacteria | 2563 |
| 943 | Ga0436360_1037609 | 3300039438 | Bacteria | 1698 |
| 944 | Ga0436361_0155268 | 3300039447 | Bacteria | 2458 |
| 945 | Ga0436361_0422998 | 3300039447 | Bacteria | 9063 |
| 946 | Ga0436361_0871492 | 3300039447 | Bacteria | 2871 |
| 947 | Ga0436363_0274435 | 3300039450 | Bacteria | 2101 |
| 948 | Ga0466972_0000214 | 3300044658 | Bacteria | 40946 |
| 949 | Ga0466965_0194092 | 3300044683 | Bacteria | 1075 |
| 950 | Ga0466966_0000209 | 3300044684 | Bacteria | 39062 |
| 951 | Ga0466966_0066768 | 3300044684 | Bacteria | 2260 |
| 952 | Ga0466961_0093408 | 3300044693 | Bacteria | 1898 |
| 953 | Ga0466963_0041247 | 3300044694 | Bacteria | 3027 |
| 954 | Ga0466963_0070403 | 3300044694 | Bacteria | 2353 |
| 955 | Ga0466963_0088271 | 3300044694 | Bacteria | 2109 |
| 956 | Ga0466963_0199405 | 3300044694 | Bacteria | 1400 |
| 957 | Ga0453684_0027976 | 3300044712 | Bacteria | 8063 |
| 958 | Ga0466957_0017743 | 3300044842 | Bacteria | 4174 |
| 959 | Ga0466957_0160638 | 3300044842 | Bacteria | 1459 |
| 960 | Ga0466957_0213141 | 3300044842 | Bacteria | 1272 |
| 961 | Ga0451576_0003944 | 3300045051 | Bacteria | 19801 |
| 962 | Ga0466958_0028754 | 3300045836 | Bacteria | 3297 |
| 963 | Ga0466967_0332602 | 3300045976 | Bacteria | 1467 |
| 964 | Ga0466967_0335766 | 3300045976 | Bacteria | 1460 |
| 965 | Ga0495617_006346 | 3300046452 | Bacteria | 4152 |
| 966 | Ga0495592_0000392 | 3300046454 | Bacteria | 34094 |
| 967 | Ga0495592_0037845 | 3300046454 | Bacteria | 3630 |
| 968 | Ga0495592_0043951 | 3300046454 | Bacteria | 3340 |
| 969 | Ga0495592_0045235 | 3300046454 | Bacteria | 3286 |
| 970 | Ga0495592_0045416 | 3300046454 | Bacteria | 3278 |
| 971 | Ga0495592_0050180 | 3300046454 | Bacteria | 3101 |
| 972 | Ga0495592_0240685 | 3300046454 | Bacteria | 1201 |
| 973 | Ga0495603_0010692 | 3300046455 | Bacteria | 5565 |
| 974 | Ga0495603_0064972 | 3300046455 | Bacteria | 2150 |
| 975 | Ga0495603_0073240 | 3300046455 | Bacteria | 2012 |
| 976 | Ga0495629_0000230 | 3300046459 | Bacteria | 49922 |
| 977 | Ga0495629_0000948 | 3300046459 | Bacteria | 23342 |
| 978 | Ga0495629_0050112 | 3300046459 | Bacteria | 2926 |
| 979 | Ga0495629_0071692 | 3300046459 | Bacteria | 2418 |
| 980 | Ga0495629_0101703 | 3300046459 | Bacteria | 2005 |
| 981 | Ga0495629_0132443 | 3300046459 | Bacteria | 1736 |
| 982 | Ga0495629_0269188 | 3300046459 | Bacteria | 1170 |
| 983 | Ga0495638_0028884 | 3300046460 | Bacteria | 3578 |
| 984 | Ga0495641_0071447 | 3300046461 | Bacteria | 1558 |
| 985 | Ga0495651_0002849 | 3300046462 | Bacteria | 13393 |
| 986 | Ga0495651_0014204 | 3300046462 | Bacteria | 6155 |
| 987 | Ga0495651_0131250 | 3300046462 | Bacteria | 1828 |
| 988 | Ga0495651_0140040 | 3300046462 | Bacteria | 1755 |
| 989 | Ga0495651_0269236 | 3300046462 | Bacteria | 1156 |
| 990 | Ga0495653_0000036 | 3300046463 | Bacteria | 129776 |
| 991 | Ga0495653_0004021 | 3300046463 | Bacteria | 11873 |
| 992 | Ga0495653_0038647 | 3300046463 | Bacteria | 3745 |
| 993 | Ga0495653_0079395 | 3300046463 | Bacteria | 2430 |
| 994 | Ga0495653_0158689 | 3300046463 | Bacteria | 1572 |
| 995 | Ga0495653_0219880 | 3300046463 | Bacteria | 1277 |
| 996 | Ga0495580_0001068 | 3300046472 | Bacteria | 24085 |
| 997 | Ga0495580_0039737 | 3300046472 | Bacteria | 3366 |
| 998 | Ga0495580_0045082 | 3300046472 | Bacteria | 3133 |
| 999 | Ga0495580_0054321 | 3300046472 | Bacteria | 2825 |
| 1000 | Ga0495582_0005508 | 3300046473 | Bacteria | 7052 |
| 1001 | Ga0495582_0022528 | 3300046473 | Bacteria | 3448 |
| 1002 | Ga0495582_0030243 | 3300046473 | Bacteria | 2972 |
| 1003 | Ga0495582_0076888 | 3300046473 | Bacteria | 1851 |
| 1004 | Ga0495639_0004161 | 3300046475 | Bacteria | 6205 |
| 1005 | Ga0495639_0045698 | 3300046475 | Bacteria | 1981 |
| 1006 | Ga0495662_0005220 | 3300046476 | Bacteria | 6511 |
| 1007 | Ga0495662_0011941 | 3300046476 | Bacteria | 4245 |
| 1008 | Ga0495662_0011970 | 3300046476 | Bacteria | 4239 |
| 1009 | Ga0495662_0016876 | 3300046476 | Bacteria | 3533 |
| 1010 | Ga0495662_0048421 | 3300046476 | Bacteria | 2052 |
| 1011 | Ga0495662_0133172 | 3300046476 | Bacteria | 1222 |
| 1012 | Ga0495664_0000107 | 3300046477 | Bacteria | 41420 |
| 1013 | Ga0495664_0000120 | 3300046477 | Bacteria | 39814 |
| 1014 | Ga0495664_0032517 | 3300046477 | Bacteria | 3061 |
| 1015 | Ga0495664_0057517 | 3300046477 | Bacteria | 2314 |
| 1016 | Ga0495584_0036368 | 3300046491 | Bacteria | 2488 |
| 1017 | Ga0495584_0076333 | 3300046491 | Bacteria | 1685 |
| 1018 | Ga0495584_0117585 | 3300046491 | Bacteria | 1346 |
| 1019 | Ga0495585_0014848 | 3300046492 | Bacteria | 4531 |
| 1020 | Ga0495594_0017109 | 3300046499 | Bacteria | 3827 |
| 1021 | Ga0495594_0056247 | 3300046499 | Bacteria | 2170 |
| 1022 | Ga0495607_0025317 | 3300046501 | Bacteria | 3692 |
| 1023 | Ga0495606_0015828 | 3300046507 | Bacteria | 5788 |
| 1024 | Ga0495606_0033243 | 3300046507 | Bacteria | 3560 |
| 1025 | Ga0495606_0111860 | 3300046507 | Bacteria | 1646 |
| 1026 | Ga0495608_0000006 | 3300046511 | Bacteria | 324334 |
| 1027 | Ga0495608_0006645 | 3300046511 | Bacteria | 8209 |
| 1028 | Ga0495608_0017571 | 3300046511 | Bacteria | 4947 |
| 1029 | Ga0495608_0058209 | 3300046511 | Bacteria | 2548 |
| 1030 | Ga0495608_0138837 | 3300046511 | Bacteria | 1552 |
| 1031 | Ga0495608_0303567 | 3300046511 | Bacteria | 988 |
| 1032 | Ga0495610_0044303 | 3300046512 | Bacteria | 2209 |
| 1033 | Ga0495616_0087390 | 3300046513 | Bacteria | 1481 |
| 1034 | Ga0495618_0000057 | 3300046514 | Bacteria | 80298 |
| 1035 | Ga0495618_0006172 | 3300046514 | Bacteria | 7270 |
| 1036 | Ga0495618_0017945 | 3300046514 | Bacteria | 4341 |
| 1037 | Ga0495618_0037015 | 3300046514 | Bacteria | 3063 |
| 1038 | Ga0495618_0046220 | 3300046514 | Bacteria | 2747 |
| 1039 | Ga0495618_0128275 | 3300046514 | Unclassified | 1623 |
| 1040 | Ga0495628_0000077 | 3300046516 | Bacteria | 77338 |
| 1041 | Ga0495628_0001017 | 3300046516 | Bacteria | 25597 |
| 1042 | Ga0495628_0070137 | 3300046516 | Bacteria | 2733 |
| 1043 | Ga0495628_0073107 | 3300046516 | Bacteria | 2671 |
| 1044 | Ga0495628_0164732 | 3300046516 | Bacteria | 1683 |
| 1045 | Ga0495630_0010058 | 3300046517 | Bacteria | 6814 |
| 1046 | Ga0495630_0023765 | 3300046517 | Bacteria | 4530 |
| 1047 | Ga0495630_0023931 | 3300046517 | Bacteria | 4515 |
| 1048 | Ga0495630_0134099 | 3300046517 | Bacteria | 1881 |
| 1049 | Ga0495630_0262825 | 3300046517 | Bacteria | 1318 |
| 1050 | Ga0495631_0115490 | 3300046518 | Bacteria | 1154 |
| 1051 | Ga0495637_0081291 | 3300046520 | Bacteria | 1291 |
| 1052 | Ga0495644_0001361 | 3300046523 | Bacteria | 9986 |
| 1053 | Ga0495648_0003063 | 3300046524 | Bacteria | 14941 |
| 1054 | Ga0495648_0171813 | 3300046524 | Bacteria | 1110 |
| 1055 | Ga0495666_0005491 | 3300046526 | Bacteria | 6387 |
| 1056 | Ga0495652_0000005 | 3300046529 | Bacteria | 524368 |
| 1057 | Ga0495652_0005022 | 3300046529 | Bacteria | 12533 |
| 1058 | Ga0495652_0006915 | 3300046529 | Bacteria | 10499 |
| 1059 | Ga0495652_0017324 | 3300046529 | Bacteria | 6429 |
| 1060 | Ga0495652_0082543 | 3300046529 | Bacteria | 2648 |
| 1061 | Ga0495652_0098349 | 3300046529 | Bacteria | 2378 |
| 1062 | Ga0495652_0155327 | 3300046529 | Bacteria | 1782 |
| 1063 | Ga0495665_0012704 | 3300046531 | Bacteria | 4557 |
| 1064 | Ga0495665_0030569 | 3300046531 | Bacteria | 2883 |
| 1065 | Ga0495640_0000007 | 3300046533 | Bacteria | 265481 |
| 1066 | Ga0495640_0004278 | 3300046533 | Bacteria | 11407 |
| 1067 | Ga0495640_0004293 | 3300046533 | Bacteria | 11379 |
| 1068 | Ga0495640_0022947 | 3300046533 | Bacteria | 4557 |
| 1069 | Ga0495640_0027919 | 3300046533 | Bacteria | 4065 |
| 1070 | Ga0495640_0109575 | 3300046533 | Bacteria | 1805 |
| 1071 | Ga0495586_0006241 | 3300046535 | Bacteria | 6371 |
| 1072 | Ga0495586_0007424 | 3300046535 | Bacteria | 5848 |
| 1073 | Ga0495586_0097638 | 3300046535 | Bacteria | 1628 |
| 1074 | Ga0495587_0000043 | 3300046536 | Bacteria | 109717 |
| 1075 | Ga0495587_0003087 | 3300046536 | Bacteria | 11125 |
| 1076 | Ga0495587_0019862 | 3300046536 | Bacteria | 4152 |
| 1077 | Ga0495587_0044036 | 3300046536 | Bacteria | 2655 |
| 1078 | Ga0495587_0208000 | 3300046536 | Bacteria | 1105 |
| 1079 | Ga0495609_0069858 | 3300046538 | Bacteria | 1544 |
| 1080 | Ga0495645_0000275 | 3300046543 | Bacteria | 37777 |
| 1081 | Ga0495645_0000755 | 3300046543 | Bacteria | 22120 |
| 1082 | Ga0495645_0007548 | 3300046543 | Bacteria | 7565 |
| 1083 | Ga0495622_0005859 | 3300046557 | Bacteria | 5705 |
| 1084 | Ga0495633_0001157 | 3300046558 | Bacteria | 21186 |
| 1085 | Ga0495667_0000023 | 3300046559 | Bacteria | 169343 |
| 1086 | Ga0495667_0001576 | 3300046559 | Bacteria | 15131 |
| 1087 | Ga0495667_0002302 | 3300046559 | Bacteria | 12796 |
| 1088 | Ga0495667_0053686 | 3300046559 | Bacteria | 2653 |
| 1089 | Ga0495667_0067078 | 3300046559 | Bacteria | 2345 |
| 1090 | Ga0495667_0075895 | 3300046559 | Bacteria | 2187 |
| 1091 | Ga0495667_0088746 | 3300046559 | Bacteria | 2004 |
| 1092 | Ga0495656_0000359 | 3300046615 | Bacteria | 15309 |
| 1093 | Ga0495656_0038258 | 3300046615 | Bacteria | 1986 |
| 1094 | Ga0495634_0000049 | 3300046642 | Bacteria | 95428 |
| 1095 | Ga0495634_0009596 | 3300046642 | Bacteria | 7130 |
| 1096 | Ga0495634_0033367 | 3300046642 | Bacteria | 3538 |
| 1097 | Ga0495634_0054566 | 3300046642 | Bacteria | 2674 |
| 1098 | Ga0495634_0091956 | 3300046642 | Bacteria | 1969 |
| 1099 | Ga0495634_0110347 | 3300046642 | Bacteria | 1769 |
| 1100 | Ga0495634_0156386 | 3300046642 | Bacteria | 1439 |
| 1101 | Ga0495611_0002507 | 3300046648 | Bacteria | 8356 |
| 1102 | Ga0495611_0148129 | 3300046648 | Bacteria | 1096 |
| 1103 | Ga0495625_0087352 | 3300046660 | Bacteria | 2162 |
| 1104 | Ga0495635_0000021 | 3300046663 | Bacteria | 164643 |
| 1105 | Ga0495635_0001668 | 3300046663 | Bacteria | 14933 |
| 1106 | Ga0495635_0011446 | 3300046663 | Bacteria | 6221 |
| 1107 | Ga0495635_0064462 | 3300046663 | Bacteria | 2515 |
| 1108 | Ga0495659_0000813 | 3300046664 | Bacteria | 11123 |
| 1109 | Ga0495588_0011785 | 3300046674 | Bacteria | 4112 |
| 1110 | Ga0495657_0000063 | 3300046675 | Bacteria | 94380 |
| 1111 | Ga0495657_0006384 | 3300046675 | Bacteria | 9228 |
| 1112 | Ga0495657_0016328 | 3300046675 | Bacteria | 5410 |
| 1113 | Ga0495657_0034745 | 3300046675 | Bacteria | 3499 |
| 1114 | Ga0495657_0066003 | 3300046675 | Bacteria | 2378 |
| 1115 | Ga0495657_0124580 | 3300046675 | Bacteria | 1620 |
| 1116 | Ga0495657_0130300 | 3300046675 | Bacteria | 1576 |
| 1117 | Ga0495657_0179701 | 3300046675 | Bacteria | 1299 |
| 1118 | Ga0495599_0000001 | 3300046678 | Bacteria | 537563 |
| 1119 | Ga0495599_0002299 | 3300046678 | Bacteria | 11112 |
| 1120 | Ga0495599_0023249 | 3300046678 | Bacteria | 3873 |
| 1121 | Ga0495599_0174819 | 3300046678 | Bacteria | 1324 |
| 1122 | Ga0495623_0001477 | 3300046679 | Bacteria | 15912 |
| 1123 | Ga0495623_0005062 | 3300046679 | Bacteria | 8648 |
| 1124 | Ga0495623_0008538 | 3300046679 | Bacteria | 6653 |
| 1125 | Ga0495623_0050507 | 3300046679 | Bacteria | 2633 |
| 1126 | Ga0495646_0000007 | 3300046680 | Bacteria | 236764 |
| 1127 | Ga0495646_0003535 | 3300046680 | Bacteria | 9733 |
| 1128 | Ga0495646_0035326 | 3300046680 | Bacteria | 3101 |
| 1129 | Ga0495646_0050753 | 3300046680 | Bacteria | 2513 |
| 1130 | Ga0495647_0004212 | 3300046681 | Bacteria | 4657 |
| 1131 | Ga0495658_0000713 | 3300046683 | Bacteria | 17976 |
| 1132 | Ga0495658_0005516 | 3300046683 | Bacteria | 6219 |
| 1133 | Ga0495658_0200649 | 3300046683 | Bacteria | 1243 |
| 1134 | Ga0495658_0272559 | 3300046683 | Bacteria | 1067 |
| 1135 | Ga0495669_0100425 | 3300046684 | Bacteria | 1343 |
| 1136 | Ga0495613_0037875 | 3300046689 | Bacteria | 3574 |
| 1137 | Ga0495613_0048799 | 3300046689 | Bacteria | 3126 |
| 1138 | Ga0495613_0050643 | 3300046689 | Bacteria | 3062 |
| 1139 | Ga0495613_0071574 | 3300046689 | Bacteria | 2527 |
| 1140 | Ga0495613_0105310 | 3300046689 | Bacteria | 2036 |
| 1141 | Ga0495613_0144087 | 3300046689 | Bacteria | 1701 |
| 1142 | Ga0495613_0229010 | 3300046689 | Bacteria | 1302 |
| 1143 | Ga0495613_0252370 | 3300046689 | Bacteria | 1231 |
| 1144 | Ga0495624_0018677 | 3300046690 | Bacteria | 4635 |
| 1145 | Ga0495624_0021235 | 3300046690 | Bacteria | 4308 |
| 1146 | Ga0495624_0037168 | 3300046690 | Bacteria | 3135 |
| 1147 | Ga0495624_0166695 | 3300046690 | Bacteria | 1344 |
| 1148 | Ga0495624_0171008 | 3300046690 | Bacteria | 1325 |
| 1149 | Ga0495670_0004344 | 3300046691 | Bacteria | 6948 |
| 1150 | Ga0495670_0020357 | 3300046691 | Bacteria | 3271 |
| 1151 | Ga0495671_0111812 | 3300046692 | Bacteria | 1334 |
| 1152 | Ga0495649_0009260 | 3300046694 | Bacteria | 5867 |
| 1153 | Ga0495589_0109610 | 3300046794 | Bacteria | 1333 |
| 1154 | Ga0495600_0000206 | 3300046809 | Bacteria | 33920 |
| 1155 | Ga0495600_0222593 | 3300046809 | Bacteria | 1207 |
| 1156 | Ga0495581_0029390 | 3300047315 | Bacteria | 3186 |
| 1157 | Ga0495581_0039507 | 3300047315 | Bacteria | 2732 |
| 1158 | Ga0495581_0085314 | 3300047315 | Bacteria | 1830 |
| 1159 | Ga0495604_0000014 | 3300047317 | Bacteria | 205481 |
| 1160 | Ga0495604_0001877 | 3300047317 | Bacteria | 17074 |
| 1161 | Ga0495604_0010329 | 3300047317 | Bacteria | 7396 |
| 1162 | Ga0495604_0019348 | 3300047317 | Bacteria | 5450 |
| 1163 | Ga0495604_0034368 | 3300047317 | Bacteria | 4010 |
| 1164 | Ga0495604_0042569 | 3300047317 | Bacteria | 3558 |
| 1165 | Ga0495604_0148821 | 3300047317 | Bacteria | 1666 |
| 1166 | Ga0495604_0177369 | 3300047317 | Bacteria | 1493 |
| 1167 | Ga0495604_0256414 | 3300047317 | Bacteria | 1190 |
| 1168 | Ga0495674_0000014 | 3300047319 | Bacteria | 241211 |
| 1169 | Ga0495674_0001292 | 3300047319 | Bacteria | 24333 |
| 1170 | Ga0495674_0002324 | 3300047319 | Bacteria | 18675 |
| 1171 | Ga0495674_0055130 | 3300047319 | Bacteria | 3487 |
| 1172 | Ga0495674_0060717 | 3300047319 | Bacteria | 3297 |
| 1173 | Ga0495674_0111983 | 3300047319 | Bacteria | 2313 |
| 1174 | Ga0495674_0114693 | 3300047319 | Bacteria | 2281 |
| 1175 | Ga0495674_0126959 | 3300047319 | Bacteria | 2151 |
| 1176 | Ga0495674_0201952 | 3300047319 | Bacteria | 1649 |
| 1177 | Ga0495674_0268196 | 3300047319 | Bacteria | 1401 |
| 1178 | Ga0495674_0279885 | 3300047319 | Bacteria | 1367 |
| 1179 | Ga0495672_0001150 | 3300047320 | Bacteria | 26741 |
| 1180 | Ga0495676_0152147 | 3300047321 | Bacteria | 1645 |
| 1181 | Ga0495676_0201316 | 3300047321 | Bacteria | 1383 |
| 1182 | Ga0495680_0000636 | 3300047322 | Bacteria | 39417 |
| 1183 | Ga0495680_0004579 | 3300047322 | Bacteria | 13186 |
| 1184 | Ga0495680_0008334 | 3300047322 | Bacteria | 9428 |
| 1185 | Ga0495680_0009331 | 3300047322 | Bacteria | 8837 |
| 1186 | Ga0495680_0023694 | 3300047322 | Bacteria | 5100 |
| 1187 | Ga0495680_0045950 | 3300047322 | Bacteria | 3446 |
| 1188 | Ga0495680_0098463 | 3300047322 | Bacteria | 2182 |
| 1189 | Ga0495680_0296975 | 3300047322 | Bacteria | 1135 |
| 1190 | Ga0495675_0000327 | 3300047444 | Bacteria | 33708 |
| 1191 | Ga0495675_0001359 | 3300047444 | Bacteria | 14808 |
| 1192 | Ga0495675_0041954 | 3300047444 | Bacteria | 2915 |
| 1193 | Ga0495677_0022847 | 3300047445 | Bacteria | 2270 |
| 1194 | Ga0495677_0112342 | 3300047445 | Bacteria | 1036 |
| 1195 | Ga0495684_0000272 | 3300047471 | Bacteria | 41522 |
| 1196 | Ga0495684_0006153 | 3300047471 | Bacteria | 9341 |
| 1197 | Ga0495684_0009342 | 3300047471 | Bacteria | 7569 |
| 1198 | Ga0495684_0031447 | 3300047471 | Bacteria | 4075 |
| 1199 | Ga0495684_0057267 | 3300047471 | Bacteria | 2970 |
| 1200 | Ga0495684_0089256 | 3300047471 | Bacteria | 2335 |
| 1201 | Ga0495684_0202170 | 3300047471 | Bacteria | 1464 |
| 1202 | Ga0495686_0038011 | 3300047472 | Bacteria | 3081 |
| 1203 | Ga0495593_0005467 | 3300047673 | Bacteria | 7501 |
| 1204 | Ga0495593_0015589 | 3300047673 | Bacteria | 4301 |
| 1205 | Ga0495593_0015897 | 3300047673 | Bacteria | 4251 |
| 1206 | Ga0495593_0029935 | 3300047673 | Bacteria | 2982 |
| 1207 | Ga0495593_0033866 | 3300047673 | Bacteria | 2780 |
| 1208 | Ga0495593_0093175 | 3300047673 | Bacteria | 1550 |
| 1209 | Ga0495602_0000017 | 3300048088 | Bacteria | 184180 |
| 1210 | Ga0495602_0004680 | 3300048088 | Bacteria | 14292 |
| 1211 | Ga0495602_0004999 | 3300048088 | Bacteria | 13897 |
| 1212 | Ga0495602_0017445 | 3300048088 | Bacteria | 7198 |
| 1213 | Ga0495602_0045757 | 3300048088 | Bacteria | 3958 |
| 1214 | Ga0495626_0085806 | 3300048091 | Unclassified | 1392 |
| 1215 | Ga0496100_0000600 | 3300048903 | Bacteria | 16991 |
| 1216 | Ga0496100_0008700 | 3300048903 | Bacteria | 5672 |
| 1217 | Ga0496100_0029110 | 3300048903 | Bacteria | 3413 |
| 1218 | Ga0496100_0084207 | 3300048903 | Bacteria | 2155 |
| 1219 | Ga0496100_0111425 | 3300048903 | Bacteria | 1902 |
| 1220 | Ga0496100_0122365 | 3300048903 | Bacteria | 1822 |
| 1221 | Ga0496100_0170619 | 3300048903 | Bacteria | 1566 |
| 1222 | Ga0496100_0210005 | 3300048903 | Bacteria | 1423 |
| 1223 | Ga0496100_0273222 | 3300048903 | Bacteria | 1257 |
| 1224 | Ga0496101_0000728 | 3300048904 | Bacteria | 19612 |
| 1225 | Ga0496101_0002748 | 3300048904 | Bacteria | 10800 |
| 1226 | Ga0496101_0008638 | 3300048904 | Bacteria | 6659 |
| 1227 | Ga0496101_0017034 | 3300048904 | Bacteria | 4921 |
| 1228 | Ga0496101_0102046 | 3300048904 | Bacteria | 2148 |
| 1229 | Ga0496101_0170920 | 3300048904 | Bacteria | 1671 |
| 1230 | Ga0496101_0224303 | 3300048904 | Bacteria | 1459 |
| 1231 | Ga0496101_0244644 | 3300048904 | Bacteria | 1396 |
| 1232 | Ga0496102_0031318 | 3300048905 | Bacteria | 4770 |
| 1233 | Ga0496102_0039588 | 3300048905 | Bacteria | 4260 |
| 1234 | Ga0496102_0056005 | 3300048905 | Bacteria | 3596 |
| 1235 | Ga0496103_0026782 | 3300048906 | Bacteria | 3489 |
| 1236 | Ga0496103_0165887 | 3300048906 | Bacteria | 1417 |
| 1237 | Ga0496104_0000232 | 3300048907 | Bacteria | 49094 |
| 1238 | Ga0496104_0006145 | 3300048907 | Bacteria | 10542 |
| 1239 | Ga0496104_0009679 | 3300048907 | Bacteria | 8586 |
| 1240 | Ga0496104_0013139 | 3300048907 | Bacteria | 7463 |
| 1241 | Ga0496104_0013660 | 3300048907 | Bacteria | 7321 |
| 1242 | Ga0496104_0125842 | 3300048907 | Bacteria | 2461 |
| 1243 | Ga0496104_0144069 | 3300048907 | Bacteria | 2288 |
| 1244 | Ga0496104_0196424 | 3300048907 | Bacteria | 1929 |
| 1245 | Ga0496104_0243253 | 3300048907 | Bacteria | 1711 |
| 1246 | Ga0496104_0280481 | 3300048907 | Bacteria | 1579 |
| 1247 | Ga0496104_0395350 | 3300048907 | Bacteria | 1294 |
| 1248 | Ga0496104_0398342 | 3300048907 | Bacteria | 1289 |
| 1249 | Ga0496105_0000238 | 3300048908 | Bacteria | 37100 |
| 1250 | Ga0496105_0026627 | 3300048908 | Bacteria | 4720 |
| 1251 | Ga0496105_0031925 | 3300048908 | Bacteria | 4319 |
| 1252 | Ga0496105_0129240 | 3300048908 | Bacteria | 2083 |
| 1253 | Ga0496105_0139197 | 3300048908 | Bacteria | 1998 |
| 1254 | Ga0496105_0256180 | 3300048908 | Bacteria | 1416 |
| 1255 | Ga0496105_0285595 | 3300048908 | Bacteria | 1329 |
| 1256 | Ga0496106_0000327 | 3300048909 | Bacteria | 33634 |
| 1257 | Ga0496106_0009906 | 3300048909 | Bacteria | 7037 |
| 1258 | Ga0496106_0037629 | 3300048909 | Bacteria | 3620 |
| 1259 | Ga0496106_0270456 | 3300048909 | Bacteria | 1360 |
| 1260 | Ga0496106_0396024 | 3300048909 | Bacteria | 1110 |
| 1261 | Ga0496107_0000143 | 3300048910 | Bacteria | 35680 |
| 1262 | Ga0496107_0020506 | 3300048910 | Bacteria | 4669 |
| 1263 | Ga0496107_0072734 | 3300048910 | Bacteria | 2499 |
| 1264 | Ga0496107_0073616 | 3300048910 | Bacteria | 2485 |
| 1265 | Ga0496107_0130179 | 3300048910 | Bacteria | 1857 |
| 1266 | Ga0496107_0220134 | 3300048910 | Bacteria | 1412 |
| 1267 | Ga0496107_0312198 | 3300048910 | Bacteria | 1170 |
| 1268 | Ga0496108_0005300 | 3300048911 | Bacteria | 10408 |
| 1269 | Ga0496108_0012847 | 3300048911 | Bacteria | 6820 |
| 1270 | Ga0496108_0016193 | 3300048911 | Bacteria | 6081 |
| 1271 | Ga0496108_0039833 | 3300048911 | Bacteria | 3916 |
| 1272 | Ga0496108_0083557 | 3300048911 | Bacteria | 2709 |
| 1273 | Ga0496108_0138029 | 3300048911 | Bacteria | 2099 |
| 1274 | Ga0496108_0164549 | 3300048911 | Bacteria | 1918 |
| 1275 | Ga0496108_0285428 | 3300048911 | Bacteria | 1437 |
| 1276 | Ga0496109_0000372 | 3300048912 | Bacteria | 40804 |
| 1277 | Ga0496109_0003915 | 3300048912 | Bacteria | 12438 |
| 1278 | Ga0496109_0004434 | 3300048912 | Bacteria | 11723 |
| 1279 | Ga0496109_0006984 | 3300048912 | Bacteria | 9530 |
| 1280 | Ga0496109_0070126 | 3300048912 | Bacteria | 3216 |
| 1281 | Ga0496109_0126744 | 3300048912 | Bacteria | 2380 |
| 1282 | Ga0496109_0144816 | 3300048912 | Bacteria | 2222 |
| 1283 | Ga0496109_0210066 | 3300048912 | Bacteria | 1830 |
| 1284 | Ga0496109_0210168 | 3300048912 | Bacteria | 1830 |
| 1285 | Ga0496109_0214737 | 3300048912 | Bacteria | 1809 |
| 1286 | Ga0496109_0291272 | 3300048912 | Bacteria | 1539 |
| 1287 | Ga0496109_0383787 | 3300048912 | Bacteria | 1327 |
| 1288 | Ga0496110_0003733 | 3300048913 | Bacteria | 11732 |
| 1289 | Ga0496110_0008900 | 3300048913 | Bacteria | 8092 |
| 1290 | Ga0496110_0013311 | 3300048913 | Bacteria | 6797 |
| 1291 | Ga0496110_0132493 | 3300048913 | Bacteria | 2251 |
| 1292 | Ga0496110_0136649 | 3300048913 | Bacteria | 2215 |
| 1293 | Ga0496110_0221102 | 3300048913 | Bacteria | 1722 |
| 1294 | Ga0496110_0229669 | 3300048913 | Bacteria | 1687 |
| 1295 | Ga0496110_0234288 | 3300048913 | Bacteria | 1670 |
| 1296 | Ga0496110_0307005 | 3300048913 | Unclassified | 1445 |
| 1297 | Ga0496111_0001479 | 3300048914 | Bacteria | 13449 |
| 1298 | Ga0496111_0004912 | 3300048914 | Bacteria | 8491 |
| 1299 | Ga0496111_0010409 | 3300048914 | Bacteria | 6240 |
| 1300 | Ga0496111_0022166 | 3300048914 | Bacteria | 4443 |
| 1301 | Ga0496111_0024813 | 3300048914 | Bacteria | 4228 |
| 1302 | Ga0496111_0033040 | 3300048914 | Bacteria | 3690 |
| 1303 | Ga0496111_0042274 | 3300048914 | Bacteria | 3272 |
| 1304 | Ga0496111_0098938 | 3300048914 | Bacteria | 2142 |
| 1305 | Ga0496111_0255747 | 3300048914 | Bacteria | 1299 |
| 1306 | Ga0496111_0269618 | 3300048914 | Bacteria | 1263 |
| 1307 | Ga0496112_0002980 | 3300048915 | Bacteria | 13812 |
| 1308 | Ga0496112_0020629 | 3300048915 | Bacteria | 6248 |
| 1309 | Ga0496112_0175132 | 3300048915 | Bacteria | 2110 |
| 1310 | Ga0496112_0206458 | 3300048915 | Bacteria | 1922 |
| 1311 | Ga0496112_0365608 | 3300048915 | Bacteria | 1384 |
| 1312 | Ga0496112_0396274 | 3300048915 | Bacteria | 1320 |
| 1313 | Ga0496112_0426703 | 3300048915 | Bacteria | 1264 |
| 1314 | Ga0496113_0000259 | 3300048916 | Bacteria | 25038 |
| 1315 | Ga0496113_0022480 | 3300048916 | Bacteria | 4462 |
| 1316 | Ga0496113_0120348 | 3300048916 | Bacteria | 2052 |
| 1317 | Ga0496113_0225407 | 3300048916 | Unclassified | 1494 |
| 1318 | Ga0496113_0299520 | 3300048916 | Bacteria | 1287 |
| 1319 | Ga0496114_0004601 | 3300048917 | Bacteria | 10714 |
| 1320 | Ga0496114_0033513 | 3300048917 | Bacteria | 4233 |
| 1321 | Ga0496114_0035727 | 3300048917 | Bacteria | 4104 |
| 1322 | Ga0496114_0063483 | 3300048917 | Bacteria | 3092 |
| 1323 | Ga0496114_0111712 | 3300048917 | Bacteria | 2342 |
| 1324 | Ga0496114_0112697 | 3300048917 | Bacteria | 2332 |
| 1325 | Ga0496115_0000653 | 3300048918 | Bacteria | 25881 |
| 1326 | Ga0496115_0019005 | 3300048918 | Bacteria | 5284 |
| 1327 | Ga0496115_0167412 | 3300048918 | Bacteria | 1817 |
| 1328 | Ga0496115_0232304 | 3300048918 | Bacteria | 1521 |
| 1329 | Ga0496115_0256297 | 3300048918 | Bacteria | 1439 |
| 1330 | Ga0496116_0014048 | 3300048919 | Bacteria | 6414 |
| 1331 | Ga0496116_0074485 | 3300048919 | Bacteria | 2135 |
| 1332 | Ga0496117_0001890 | 3300048920 | Bacteria | 28086 |
| 1333 | Ga0496118_0003649 | 3300048921 | Bacteria | 19121 |
| 1334 | Ga0496118_0037905 | 3300048921 | Bacteria | 3871 |
| 1335 | Ga0496118_0073434 | 3300048921 | Bacteria | 2451 |
| 1336 | Ga0496120_0027659 | 3300048923 | Bacteria | 3483 |
| 1337 | Ga0496121_0002758 | 3300048924 | Bacteria | 26081 |
| 1338 | Ga0496121_0006036 | 3300048924 | Bacteria | 15267 |
| 1339 | Ga0496121_0024819 | 3300048924 | Bacteria | 5717 |
| 1340 | Ga0496121_0061833 | 3300048924 | Bacteria | 3070 |
| 1341 | Ga0496121_0221246 | 3300048924 | Bacteria | 1333 |
| 1342 | Ga0496122_0026905 | 3300048925 | Bacteria | 4938 |
| 1343 | Ga0496122_0072876 | 3300048925 | Bacteria | 2439 |
| 1344 | Ga0496123_0121479 | 3300048926 | Bacteria | 1468 |
| 1345 | Ga0496124_0037633 | 3300048927 | Bacteria | 4206 |
| 1346 | Ga0496125_0008218 | 3300048928 | Bacteria | 10971 |
| 1347 | Ga0496126_0030362 | 3300048929 | Bacteria | 5120 |
| 1348 | Ga0496126_0160180 | 3300048929 | Bacteria | 1923 |
| 1349 | Ga0501031_0025466 | 3300049568 | Bacteria | 3857 |
| 1350 | Ga0501031_0119463 | 3300049568 | Bacteria | 1722 |
| 1351 | Ga0501031_0191432 | 3300049568 | Bacteria | 1336 |
| 1352 | Ga0501032_0000435 | 3300049569 | Bacteria | 34412 |
| 1353 | Ga0501032_0003450 | 3300049569 | Bacteria | 12113 |
| 1354 | Ga0501032_0158663 | 3300049569 | Bacteria | 1485 |
| 1355 | Ga0501032_0178260 | 3300049569 | Bacteria | 1392 |
| 1356 | Ga0501033_0002280 | 3300049570 | Bacteria | 16397 |
| 1357 | Ga0501033_0067598 | 3300049570 | Bacteria | 2627 |
| 1358 | Ga0501033_0268964 | 3300049570 | Bacteria | 1205 |
| 1359 | Ga0501034_0000089 | 3300049571 | Bacteria | 165644 |
| 1360 | Ga0501034_0006067 | 3300049571 | Bacteria | 13049 |
| 1361 | Ga0501034_0010727 | 3300049571 | Bacteria | 9516 |
| 1362 | Ga0501034_0020731 | 3300049571 | Bacteria | 6710 |
| 1363 | Ga0501034_0021328 | 3300049571 | Bacteria | 6605 |
| 1364 | Ga0501034_0052744 | 3300049571 | Bacteria | 4097 |
| 1365 | Ga0501034_0099184 | 3300049571 | Bacteria | 2908 |
| 1366 | Ga0501034_0100761 | 3300049571 | Bacteria | 2882 |
| 1367 | Ga0501034_0113906 | 3300049571 | Bacteria | 2693 |
| 1368 | Ga0501034_0128398 | 3300049571 | Bacteria | 2519 |
| 1369 | Ga0501034_0316647 | 3300049571 | Bacteria | 1493 |
| 1370 | Ga0501034_0448226 | 3300049571 | Bacteria | 1208 |
| 1371 | Ga0501034_0528554 | 3300049571 | Bacteria | 1091 |
| 1372 | Ga0501034_0587642 | 3300049571 | Bacteria | 1020 |
| 1373 | Ga0501036_0007715 | 3300049572 | Bacteria | 8791 |
| 1374 | Ga0501036_0012537 | 3300049572 | Bacteria | 7030 |
| 1375 | Ga0501036_0015870 | 3300049572 | Bacteria | 6290 |
| 1376 | Ga0501036_0101331 | 3300049572 | Bacteria | 2436 |
| 1377 | Ga0501036_0105646 | 3300049572 | Bacteria | 2381 |
| 1378 | Ga0501036_0145030 | 3300049572 | Bacteria | 2003 |
| 1379 | Ga0501037_0018072 | 3300049573 | Bacteria | 5193 |
| 1380 | Ga0501037_0020234 | 3300049573 | Bacteria | 4915 |
| 1381 | Ga0501037_0046381 | 3300049573 | Bacteria | 3187 |
| 1382 | Ga0501037_0090076 | 3300049573 | Bacteria | 2219 |
| 1383 | Ga0501037_0305049 | 3300049573 | Bacteria | 1105 |
| 1384 | Ga0501038_0017332 | 3300049574 | Bacteria | 6511 |
| 1385 | Ga0501038_0056635 | 3300049574 | Bacteria | 3366 |
| 1386 | Ga0501038_0124419 | 3300049574 | Bacteria | 2123 |
| 1387 | Ga0501038_0183370 | 3300049574 | Bacteria | 1688 |
| 1388 | Ga0501038_0286587 | 3300049574 | Bacteria | 1295 |
| 1389 | Ga0501038_0295344 | 3300049574 | Bacteria | 1272 |
| 1390 | Ga0501038_0305636 | 3300049574 | Bacteria | 1247 |
| 1391 | Ga0501039_0016934 | 3300049575 | Bacteria | 5587 |
| 1392 | Ga0501039_0073847 | 3300049575 | Bacteria | 2650 |
| 1393 | Ga0501039_0108483 | 3300049575 | Bacteria | 2170 |
| 1394 | Ga0501043_0002335 | 3300049579 | Bacteria | 16074 |
| 1395 | Ga0501043_0002883 | 3300049579 | Bacteria | 14360 |
| 1396 | Ga0501043_0027922 | 3300049579 | Bacteria | 4429 |
| 1397 | Ga0501043_0042204 | 3300049579 | Bacteria | 3584 |
| 1398 | Ga0501043_0076456 | 3300049579 | Bacteria | 2630 |
| 1399 | Ga0501043_0182072 | 3300049579 | Bacteria | 1637 |
| 1400 | Ga0501043_0229649 | 3300049579 | Bacteria | 1434 |
| 1401 | Ga0501046_0032334 | 3300049580 | Bacteria | 4236 |
| 1402 | Ga0501046_0060006 | 3300049580 | Bacteria | 2977 |
| 1403 | Ga0501046_0302407 | 3300049580 | Bacteria | 1168 |
| 1404 | Ga0501047_0000108 | 3300049581 | Bacteria | 101252 |
| 1405 | Ga0501047_0005210 | 3300049581 | Bacteria | 12204 |
| 1406 | Ga0501047_0005643 | 3300049581 | Bacteria | 11790 |
| 1407 | Ga0501047_0020718 | 3300049581 | Bacteria | 6315 |
| 1408 | Ga0501047_0026864 | 3300049581 | Bacteria | 5542 |
| 1409 | Ga0501047_0035599 | 3300049581 | Bacteria | 4809 |
| 1410 | Ga0501047_0153246 | 3300049581 | Bacteria | 2179 |
| 1411 | Ga0501047_0164624 | 3300049581 | Bacteria | 2089 |
| 1412 | Ga0501047_0205650 | 3300049581 | Bacteria | 1828 |
| 1413 | Ga0501047_0629821 | 3300049581 | Bacteria | 893 |
| 1414 | Ga0501048_0001627 | 3300049582 | Bacteria | 17093 |
| 1415 | Ga0501048_0001786 | 3300049582 | Bacteria | 16352 |
| 1416 | Ga0501048_0249331 | 3300049582 | Bacteria | 1260 |
| 1417 | Ga0501067_0003119 | 3300049583 | Bacteria | 9153 |
| 1418 | Ga0501067_0016484 | 3300049583 | Bacteria | 4082 |
| 1419 | Ga0501068_0018262 | 3300049584 | Bacteria | 4062 |
| 1420 | Ga0501068_0031880 | 3300049584 | Bacteria | 3131 |
| 1421 | Ga0501068_0071311 | 3300049584 | Bacteria | 2121 |
| 1422 | Ga0501068_0128193 | 3300049584 | Bacteria | 1585 |
| 1423 | Ga0501069_0004000 | 3300049585 | Bacteria | 7611 |
| 1424 | Ga0501069_0038216 | 3300049585 | Bacteria | 2649 |
| 1425 | Ga0501069_0039702 | 3300049585 | Bacteria | 2600 |
| 1426 | Ga0501070_0025261 | 3300049586 | Bacteria | 4981 |
| 1427 | Ga0501070_0027267 | 3300049586 | Bacteria | 4791 |
| 1428 | Ga0501070_0039394 | 3300049586 | Bacteria | 3942 |
| 1429 | Ga0501070_0081427 | 3300049586 | Bacteria | 2678 |
| 1430 | Ga0501070_0097377 | 3300049586 | Bacteria | 2433 |
| 1431 | Ga0501070_0386013 | 3300049586 | Bacteria | 1134 |
| 1432 | Ga0501071_0005716 | 3300049587 | Bacteria | 8022 |
| 1433 | Ga0501071_0030857 | 3300049587 | Bacteria | 3793 |
| 1434 | Ga0501072_0002592 | 3300049588 | Bacteria | 13556 |
| 1435 | Ga0501072_0004367 | 3300049588 | Bacteria | 10731 |
| 1436 | Ga0501072_0077680 | 3300049588 | Bacteria | 2628 |
| 1437 | Ga0501072_0186131 | 3300049588 | Bacteria | 1656 |
| 1438 | Ga0501073_0000019 | 3300049589 | Bacteria | 144300 |
| 1439 | Ga0501073_0002379 | 3300049589 | Bacteria | 14087 |
| 1440 | Ga0501073_0046698 | 3300049589 | Bacteria | 3044 |
| 1441 | Ga0501073_0107620 | 3300049589 | Bacteria | 1934 |
| 1442 | Ga0501073_0112921 | 3300049589 | Bacteria | 1884 |
| 1443 | Ga0501073_0182275 | 3300049589 | Bacteria | 1453 |
| 1444 | Ga0501073_0309232 | 3300049589 | Bacteria | 1090 |
| 1445 | Ga0501074_0013871 | 3300049590 | Bacteria | 5857 |
| 1446 | Ga0501074_0016822 | 3300049590 | Bacteria | 5307 |
| 1447 | Ga0501074_0059163 | 3300049590 | Bacteria | 2761 |
| 1448 | Ga0501074_0238044 | 3300049590 | Bacteria | 1295 |
| 1449 | Ga0501075_0279956 | 3300049591 | Bacteria | 1271 |
| 1450 | Ga0501076_0151753 | 3300049592 | Bacteria | 1885 |
| 1451 | Ga0501076_0291531 | 3300049592 | Bacteria | 1337 |
| 1452 | Ga0501077_0000035 | 3300049593 | Bacteria | 68535 |
| 1453 | Ga0501079_0014331 | 3300049741 | Bacteria | 6044 |
| 1454 | Ga0501079_0031812 | 3300049741 | Bacteria | 4054 |
| 1455 | Ga0501079_0039580 | 3300049741 | Bacteria | 3636 |
| 1456 | Ga0501080_0000045 | 3300049742 | Bacteria | 79211 |
| 1457 | Ga0501080_0000655 | 3300049742 | Bacteria | 27483 |
| 1458 | Ga0501080_0035718 | 3300049742 | Bacteria | 4639 |
| 1459 | Ga0501080_0057651 | 3300049742 | Bacteria | 3616 |
| 1460 | Ga0501080_0100394 | 3300049742 | Bacteria | 2685 |
| 1461 | Ga0501080_0107189 | 3300049742 | Bacteria | 2589 |
| 1462 | Ga0501080_0135330 | 3300049742 | Bacteria | 2280 |
| 1463 | Ga0501080_0139150 | 3300049742 | Bacteria | 2245 |
| 1464 | Ga0501080_0293651 | 3300049742 | Bacteria | 1475 |
| 1465 | Ga0501081_0045742 | 3300049743 | Bacteria | 3006 |
| 1466 | Ga0501081_0056833 | 3300049743 | Bacteria | 2705 |
| 1467 | Ga0501081_0214958 | 3300049743 | Bacteria | 1397 |
| 1468 | Ga0501081_0310762 | 3300049743 | Bacteria | 1157 |
| 1469 | Ga0501083_0002606 | 3300049744 | Bacteria | 12413 |
| 1470 | Ga0501083_0005531 | 3300049744 | Bacteria | 8954 |
| 1471 | Ga0501083_0015039 | 3300049744 | Bacteria | 5416 |
| 1472 | Ga0501083_0031690 | 3300049744 | Bacteria | 3628 |
| 1473 | Ga0501083_0070668 | 3300049744 | Bacteria | 2321 |
| 1474 | Ga0501083_0081626 | 3300049744 | Bacteria | 2143 |
| 1475 | Ga0501083_0113452 | 3300049744 | Bacteria | 1780 |
| 1476 | Ga0501083_0114793 | 3300049744 | Bacteria | 1768 |
| 1477 | Ga0501035_0001364 | 3300049822 | Bacteria | 25120 |
| 1478 | Ga0501035_0016145 | 3300049822 | Bacteria | 6890 |
| 1479 | Ga0501035_0018105 | 3300049822 | Bacteria | 6491 |
| 1480 | Ga0501035_0067679 | 3300049822 | Bacteria | 3168 |
| 1481 | Ga0501035_0167683 | 3300049822 | Bacteria | 1898 |
| 1482 | Ga0501035_0213324 | 3300049822 | Bacteria | 1651 |
| 1483 | Ga0501035_0406497 | 3300049822 | Bacteria | 1132 |
| 1484 | Ga0501044_0002199 | 3300049823 | Bacteria | 22360 |
| 1485 | Ga0501044_0002915 | 3300049823 | Bacteria | 19480 |
| 1486 | Ga0501044_0009512 | 3300049823 | Bacteria | 10580 |
| 1487 | Ga0501044_0015174 | 3300049823 | Bacteria | 8299 |
| 1488 | Ga0501044_0019836 | 3300049823 | Bacteria | 7181 |
| 1489 | Ga0501044_0031382 | 3300049823 | Bacteria | 5593 |
| 1490 | Ga0501044_0047827 | 3300049823 | Bacteria | 4423 |
| 1491 | Ga0501044_0084474 | 3300049823 | Bacteria | 3209 |
| 1492 | Ga0501044_0098536 | 3300049823 | Bacteria | 2943 |
| 1493 | Ga0501044_0100872 | 3300049823 | Bacteria | 2904 |
| 1494 | Ga0501044_0141831 | 3300049823 | Bacteria | 2391 |
| 1495 | Ga0501044_0273150 | 3300049823 | Bacteria | 1625 |
| 1496 | Ga0501044_0295854 | 3300049823 | Bacteria | 1549 |
| 1497 | Ga0501044_0524536 | 3300049823 | Bacteria | 1084 |
| 1498 | Ga0501044_0561278 | 3300049823 | Bacteria | 1038 |
| 1499 | Ga0501045_0093339 | 3300049824 | Bacteria | 2226 |
| 1500 | nmdc:mga03683_6131_c1 | 3300050489 | Bacteria | 4102 |
| 1501 | nmdc:mga03n38_4244_c1 | 3300050490 | Bacteria | 4716 |
| 1502 | nmdc:mga03n38_63567_c1 | 3300050490 | Bacteria | 1687 |
| 1503 | nmdc:mga00v17_4458_c1 | 3300050491 | Bacteria | 7289 |
| 1504 | nmdc:mga0yw44_41720_c1 | 3300050492 | Bacteria | 2733 |
| 1505 | nmdc:mga0yw44_4866_c1 | 3300050492 | Bacteria | 6244 |
| 1506 | nmdc:mga0yw44_72156_c1 | 3300050492 | Bacteria | 2145 |
| 1507 | nmdc:mga0k408_2007_c1 | 3300050493 | Bacteria | 10922 |
| 1508 | nmdc:mga0k408_29518_c1 | 3300050493 | Bacteria | 3122 |
| 1509 | nmdc:mga06z11_149781_c1 | 3300050494 | Bacteria | 1325 |
| 1510 | nmdc:mga06z11_159215_c1 | 3300050494 | Bacteria | 1289 |
| 1511 | nmdc:mga06z11_47995_c1 | 3300050494 | Bacteria | 2171 |
| 1512 | nmdc:mga06z11_71921_c1 | 3300050494 | Bacteria | 1832 |
| 1513 | nmdc:mga06z11_9696_c1 | 3300050494 | Bacteria | 4066 |
| 1514 | nmdc:mga05p37_11094_c1 | 3300050507 | Bacteria | 10706 |
| 1515 | nmdc:mga05p37_24149_c1 | 3300050507 | Bacteria | 7385 |
| 1516 | nmdc:mga05p37_24288_c1 | 3300050507 | Bacteria | 7365 |
| 1517 | nmdc:mga05p37_268746_c1 | 3300050507 | Bacteria | 2038 |
| 1518 | nmdc:mga05p37_46633_c1 | 3300050507 | Bacteria | 5329 |
| 1519 | nmdc:mga05p37_80697_c1 | 3300050507 | Bacteria | 4007 |
| 1520 | nmdc:mga09592_196019_c1 | 3300050508 | Bacteria | 1748 |
| 1521 | nmdc:mga09592_8496_c1 | 3300050508 | Bacteria | 8351 |
| 1522 | nmdc:mga0qj67_73155_c1 | 3300050509 | Bacteria | 2737 |
| 1523 | nmdc:mga06r32_316996_c1 | 3300050510 | Bacteria | 1545 |
| 1524 | nmdc:mga06r32_33762_c1 | 3300050510 | Bacteria | 4820 |
| 1525 | nmdc:mga06r32_442293_c1 | 3300050510 | Bacteria | 1280 |
| 1526 | nmdc:mga08y16_114053_c1 | 3300050511 | Bacteria | 2813 |
| 1527 | nmdc:mga08y16_145256_c1 | 3300050511 | Bacteria | 2466 |
| 1528 | nmdc:mga08y16_188752_c1 | 3300050511 | Bacteria | 2138 |
| 1529 | nmdc:mga08y16_3254_c1 | 3300050511 | Bacteria | 16811 |
| 1530 | nmdc:mga08y16_49190_c1 | 3300050511 | Bacteria | 4412 |
| 1531 | nmdc:mga08y16_7494_c1 | 3300050511 | Bacteria | 11428 |
| 1532 | nmdc:mga08y16_83519_c1 | 3300050511 | Bacteria | 3329 |
| 1533 | nmdc:mga0n895_118189_c1 | 3300050512 | Bacteria | 2671 |
| 1534 | nmdc:mga0n895_234151_c1 | 3300050512 | Bacteria | 1864 |
| 1535 | nmdc:mga0n895_31564_c1 | 3300050512 | Bacteria | 5074 |
| 1536 | nmdc:mga0n895_322663_c1 | 3300050512 | Bacteria | 1565 |
| 1537 | nmdc:mga0n895_382360_c1 | 3300050512 | Bacteria | 1424 |
| 1538 | nmdc:mga0n895_39649_c1 | 3300050512 | Bacteria | 4571 |
| 1539 | nmdc:mga0n895_484088_c1 | 3300050512 | Bacteria | 1248 |
| 1540 | nmdc:mga0rr50_178440_c1 | 3300050513 | Bacteria | 1735 |
| 1541 | nmdc:mga0rr50_178847_c1 | 3300050513 | Bacteria | 1733 |
| 1542 | nmdc:mga0rr50_2395_c1 | 3300050513 | Bacteria | 10550 |
| 1543 | nmdc:mga0rr50_26063_c1 | 3300050513 | Bacteria | 4073 |
| 1544 | nmdc:mga0rr50_56554_c1 | 3300050513 | Bacteria | 2931 |
| 1545 | nmdc:mga0rr50_69462_c1 | 3300050513 | Bacteria | 2681 |
| 1546 | nmdc:mga0rr50_79377_c1 | 3300050513 | Bacteria | 2527 |
| 1547 | nmdc:mga0a205_10762_c1 | 3300050515 | Bacteria | 8411 |
| 1548 | nmdc:mga0a205_1434_c1 | 3300050515 | Bacteria | 20265 |
| 1549 | nmdc:mga0a205_148336_c1 | 3300050515 | Bacteria | 2245 |
| 1550 | nmdc:mga0a205_37528_c1 | 3300050515 | Bacteria | 4659 |
| 1551 | nmdc:mga0a205_407287_c1 | 3300050515 | Bacteria | 1223 |
| 1552 | nmdc:mga0sz30_11526_c1 | 3300050516 | Bacteria | 3416 |
| 1553 | nmdc:mga0sz30_2397_c1 | 3300050516 | Bacteria | 6690 |
| 1554 | Ga0495601_0000016 | 3300053077 | Bacteria | 207486 |
| 1555 | Ga0495601_0000114 | 3300053077 | Bacteria | 44359 |
| 1556 | Ga0495601_0000315 | 3300053077 | Bacteria | 25650 |
| 1557 | Ga0495601_0008408 | 3300053077 | Bacteria | 6097 |
| 1558 | Ga0495601_0032962 | 3300053077 | Bacteria | 3226 |
| 1559 | Ga0495601_0049973 | 3300053077 | Bacteria | 2637 |
| 1560 | Ga0495601_0054419 | 3300053077 | Bacteria | 2532 |
| 1561 | Ga0495601_0080604 | 3300053077 | Bacteria | 2088 |
| 1562 | Ga0495601_0092159 | 3300053077 | Bacteria | 1952 |
| 1563 | Ga0495601_0199401 | 3300053077 | Bacteria | 1308 |
| 1564 | Ga0495612_0000056 | 3300053078 | Bacteria | 50144 |
| 1565 | Ga0495612_0000154 | 3300053078 | Bacteria | 28798 |
| 1566 | Ga0495612_0001726 | 3300053078 | Bacteria | 8981 |
| 1567 | Ga0495612_0002268 | 3300053078 | Bacteria | 7916 |
| 1568 | Ga0495612_0004956 | 3300053078 | Bacteria | 5512 |
| 1569 | Ga0495612_0023868 | 3300053078 | Bacteria | 2456 |
| 1570 | Ga0495612_0079755 | 3300053078 | Bacteria | 1374 |
| 1571 | Ga0495612_0101463 | 3300053078 | Bacteria | 1225 |
| 1572 | Ga0495655_0027909 | 3300053083 | Bacteria | 1343 |
| 1573 | Ga0495595_0000032 | 3300053084 | Bacteria | 87066 |
| 1574 | Ga0495595_0005189 | 3300053084 | Bacteria | 5261 |
| 1575 | Ga0495595_0005799 | 3300053084 | Bacteria | 4999 |
| 1576 | Ga0495595_0009928 | 3300053084 | Bacteria | 3947 |
| 1577 | Ga0495595_0011977 | 3300053084 | Bacteria | 3636 |
| 1578 | Ga0495595_0021898 | 3300053084 | Bacteria | 2799 |
| 1579 | Ga0495595_0102244 | 3300053084 | Bacteria | 1384 |
| 1580 | Ga0495619_0000033 | 3300053085 | Bacteria | 138925 |
| 1581 | Ga0495619_0000206 | 3300053085 | Bacteria | 42730 |
| 1582 | Ga0495619_0001397 | 3300053085 | Bacteria | 15884 |
| 1583 | Ga0495619_0002416 | 3300053085 | Bacteria | 12258 |
| 1584 | Ga0495619_0003323 | 3300053085 | Bacteria | 10395 |
| 1585 | Ga0495619_0004683 | 3300053085 | Bacteria | 8715 |
| 1586 | Ga0495619_0004828 | 3300053085 | Bacteria | 8559 |
| 1587 | Ga0495619_0011415 | 3300053085 | Bacteria | 5594 |
| 1588 | Ga0495619_0018328 | 3300053085 | Bacteria | 4441 |
| 1589 | Ga0495619_0023944 | 3300053085 | Bacteria | 3916 |
| 1590 | Ga0500643_000014 | 3300053087 | Bacteria | 318249 |
| 1591 | Ga0500643_008687 | 3300053087 | Bacteria | 3966 |
| 1592 | Ga0500643_021179 | 3300053087 | Bacteria | 2111 |
| 1593 | Ga0500644_0001168 | 3300053088 | Bacteria | 7606 |
| 1594 | Ga0500646_0034154 | 3300053090 | Bacteria | 1409 |
| 1595 | Ga0500651_0203450 | 3300053093 | Bacteria | 1167 |
| 1596 | Ga0500641_0018054 | 3300053096 | Bacteria | 2648 |
| 1597 | Ga0500641_0019245 | 3300053096 | Bacteria | 2579 |
| 1598 | Ga0500592_008051 | 3300053116 | Bacteria | 1672 |
| 1599 | Ga0500593_034271 | 3300053117 | Bacteria | 2272 |
| 1600 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 1601 | Ga0500595_014074 | 3300053119 | Bacteria | 3046 |
| 1602 | Ga0500595_031287 | 3300053119 | Bacteria | 1786 |
| 1603 | Ga0500614_007698 | 3300053123 | Bacteria | 2275 |
| 1604 | Ga0500652_000198 | 3300053131 | Bacteria | 23141 |
| 1605 | Ga0500652_008290 | 3300053131 | Bacteria | 3456 |
| 1606 | Ga0500568_0010093 | 3300053139 | Bacteria | 4446 |
| 1607 | Ga0500568_0019795 | 3300053139 | Bacteria | 2919 |
| 1608 | Ga0500568_0042182 | 3300053139 | Bacteria | 1829 |
| 1609 | Ga0500590_000069 | 3300053148 | Bacteria | 26240 |
| 1610 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1611 | Ga0500616_0029769 | 3300053153 | Bacteria | 3002 |
| 1612 | Ga0500622_0002923 | 3300053156 | Bacteria | 11874 |
| 1613 | Ga0500645_001721 | 3300053730 | Bacteria | 10621 |
| 1614 | Ga0500645_049098 | 3300053730 | Bacteria | 1235 |
| 1615 | Ga0501084_0065110 | 3300054114 | Bacteria | 3049 |
| 1616 | Ga0501084_0116070 | 3300054114 | Bacteria | 2250 |
| 1617 | Ga0501084_0122937 | 3300054114 | Bacteria | 2183 |
| 1618 | Ga0501084_0229387 | 3300054114 | Bacteria | 1567 |
| 1619 | Ga0501082_0000028 | 3300060353 | Bacteria | 100580 |
| 1620 | Ga0501082_0009479 | 3300060353 | Bacteria | 8383 |
| 1621 | Ga0501082_0110937 | 3300060353 | Bacteria | 2374 |
| 1622 | Ga0501082_0154198 | 3300060353 | Bacteria | 1996 |
| 1623 | Ga0501082_0235725 | 3300060353 | Bacteria | 1592 |
| 1624 | Ga0501082_0331571 | 3300060353 | Bacteria | 1326 |
| 1625 | Ga0530510_0011090 | 3300061734 | Bacteria | 6323 |
| 1626 | 2524458028 | 2524023209 | Bacteria | 6679728 |
| 1627 | 2528851283 | 2528768022 | Bacteria | 10457665 |
| 1628 | 2537873416 | 2537561587 | Bacteria | 5425293 |
| 1629 | 2585330479 | 2582581316 | Bacteria | 7774528 |
| 1630 | 2599604432 | 2599185210 | Bacteria | 5624189 |
| 1631 | 2643758072 | 2643221547 | Bacteria | 4740017 |
| 1632 | 2824663837 | 2824661429 | Bacteria | 9877870 |
| 1633 | 2842299790 | 2842298080 | Bacteria | 6123127 |
| 1634 | 2842359688 | 2842357229 | Bacteria | 6485165 |
| 1635 | 2842698106 | 2842694124 | Bacteria | 4063419 |
| 1636 | 2879085824 | 2879083081 | Bacteria | 8587928 |
| 1637 | 2879108643 | 2879099564 | Bacteria | 10442239 |
| 1638 | 2899794492 | 2899792073 | Bacteria | 4926588 |
| 1639 | 2908776167 | 2908775508 | Bacteria | 8092255 |
| 1640 | 2922378711 | |||
| 1641 | 2932786696 | 2932784394 | Bacteria | 9704911 |
| 1642 | 2932812260 | 2932809354 | Bacteria | 9135765 |
| 1643 | 2932823251 | 2932818245 | Bacteria | 9955613 |
| 1644 | 2932829909 | 2932828146 | Bacteria | 9745859 |
| 1645 | 2935618427 | 2935616580 | Bacteria | 9032984 |
| 1646 | 2935641175 | 2935638405 | Bacteria | 10015038 |
| 1647 | 2935670091 | 2935665750 | Bacteria | 9571747 |
| 1648 | 2935680915 | 2935675223 | Bacteria | 9928132 |
| 1649 | 2935689930 | 2935684952 | Bacteria | 9590419 |
| 1650 | 2935698451 | 2935694250 | Bacteria | 9291695 |
| 1651 | 2935707593 | 2935703347 | Bacteria | 10242284 |
| 1652 | 2935717449 | 2935713505 | Bacteria | 9608509 |
| 1653 | 2935723881 | 2935722832 | Bacteria | 9608746 |
| 1654 | 2935740090 | 2935732158 | Bacteria | 9706831 |
| 1655 | 2935749353 | 2935741537 | Bacteria | 9707219 |
| 1656 | 2935757284 | 2935750917 | Bacteria | 9590372 |
| 1657 | 2935763630 | 2935760218 | Bacteria | 9817913 |
| 1658 | 2935804019 | 2935801545 | Bacteria | 9301974 |
| 1659 | 2935815113 | 2935810662 | Bacteria | 9401221 |
| 1660 | 2935830906 | 2935827899 | Bacteria | 10038562 |
| 1661 | 2935841516 | 2935837841 | Bacteria | 9454360 |
| 1662 | 2935862478 | 2935855204 | Bacteria | 9035059 |
| 1663 | 2935866594 | 2935864058 | Bacteria | 9784707 |
| 1664 | 2935874901 | 2935873716 | Bacteria | 9632195 |
| 1665 | 2935994407 | 2935992306 | Bacteria | 9802711 |
| 1666 | 2936004615 | 2936002035 | Bacteria | 9362176 |
| 1667 | 2936043180 | 2936037263 | Bacteria | 9446081 |
| 1668 | 2940563197 | 2940556831 | Bacteria | 9590747 |
| 1669 | 2941543114 | 2941538514 | Bacteria | 9402094 |
| 1670 | 3003931568 | 3003930520 | Bacteria | 5667563 |
| 1671 | 3005486813 | 3005483717 | Bacteria | 7877331 |
| 1672 | 8017058370 | 8017057580 | Bacteria | 10023680 |
| 1673 | 8019577331 | 8019576017 | Bacteria | 10049540 |
| 1674 | 8019595413 | 8019586578 | Bacteria | 10212056 |
| 1675 | 8019612185 | 8019608314 | Bacteria | 10042931 |
| 1676 | 8024491736 | 8024486573 | Bacteria | 6540512 |
| 1677 | Ga0105240_10008453 | |||
| 1678 | 2214544912 | |||
| 1679 | ARSoilYngRDRAFT_c00115 | |||
| 1680 | ARcpr5yngRDRAFT_c000138 | |||
| 1681 | ARSoilOldRDRAFT_c000022 | |||
| 1682 | ARCol0oldRDRAFT_c00090 | |||
| 1683 | ARCol0yngRDRAFT_1000298 | |||
| 1684 | JGI24741J21665_1002162 | |||
| 1685 | JGI24752J21851_1000975 | |||
| 1686 | JGI24746J21847_1000142 | |||
| 1687 | JGI24747J21853_1000031 | |||
| 1688 | JGI24740J21852_10017351 | |||
| 1689 | JGI24739J22299_10002500 | |||
| 1690 | JGI24737J22298_10000810 | |||
| 1691 | JGI24737J22298_10004702 | |||
| 1692 | JGI24743J22301_10002841 | |||
| 1693 | JGI24750J21931_1000449 | |||
| 1694 | JGI24750J21931_1000469 | |||
| 1695 | JGI24745J21846_1000493 | |||
| 1696 | JGI24738J21930_10000005 | |||
| 1697 | JGI24738J21930_10011740 | |||
| 1698 | JGI24749J21850_1001021 | |||
| 1699 | JGI24744J21845_10000321 | |||
| 1700 | JGI24035J26624_1000798 | |||
| 1701 | JGI24033J26618_1001439 | |||
| 1702 | JGI24742J22300_10000339 | |||
| 1703 | JGI24751J29686_10001874 | |||
| 1704 | JGI25406J46586_10004567 | |||
| 1705 | rootH1_10079649 | |||
| 1706 | Ga0065716_1001575 | |||
| 1707 | Ga0065712_10070481 | |||
| 1708 | Ga0065715_10099964 | |||
| 1709 | Ga0070658_10005336 | |||
| 1710 | Ga0070658_10084777 | |||
| 1711 | Ga0070658_10088275 | |||
| 1712 | Ga0070658_10214303 | |||
| 1713 | Ga0070676_10006098 | |||
| 1714 | Ga0070683_100000345 | |||
| 1715 | Ga0070683_100081994 | |||
| 1716 | Ga0070690_100007218 | |||
| 1717 | Ga0070690_100007975 | |||
| 1718 | Ga0070690_100020158 | |||
| 1719 | Ga0070690_100023517 | |||
| 1720 | Ga0070690_100025313 | |||
| 1721 | Ga0070690_100168260 | |||
| 1722 | Ga0070670_100000091 | |||
| 1723 | Ga0070670_100016360 | |||
| 1724 | Ga0070670_100093254 | |||
| 1725 | Ga0070670_100396066 | |||
| 1726 | Ga0070670_100445762 | |||
| 1727 | Ga0070677_10000732 | |||
| 1728 | Ga0068869_100001229 | |||
| 1729 | Ga0068869_100021486 | |||
| 1730 | Ga0068869_100231417 | |||
| 1731 | Ga0070666_10118435 | |||
| 1732 | Ga0070666_10131073 | |||
| 1733 | Ga0070680_100013303 | |||
| 1734 | Ga0070680_100023359 | |||
| 1735 | Ga0070680_100114813 | |||
| 1736 | Ga0070680_100156547 | |||
| 1737 | Ga0070680_100202946 | |||
| 1738 | Ga0070680_100212983 | |||
| 1739 | Ga0070680_100267695 | |||
| 1740 | Ga0070682_100007148 | |||
| 1741 | Ga0070682_100096171 | |||
| 1742 | Ga0068868_100000376 | |||
| 1743 | Ga0068868_100281968 | |||
| 1744 | Ga0070660_100001516 | |||
| 1745 | Ga0070660_100008936 | |||
| 1746 | Ga0070660_100084251 | |||
| 1747 | Ga0070689_100005739 | |||
| 1748 | Ga0070689_100030360 | |||
| 1749 | Ga0070691_10019629 | |||
| 1750 | Ga0070687_100001270 | |||
| 1751 | Ga0070692_10001450 | |||
| 1752 | Ga0070692_10170409 | |||
| 1753 | Ga0070668_100007889 | |||
| 1754 | Ga0070668_100134328 | |||
| 1755 | Ga0070668_100189587 | |||
| 1756 | Ga0070668_100207224 | |||
| 1757 | Ga0070669_100000873 | |||
| 1758 | Ga0070669_100011651 | |||
| 1759 | Ga0070669_100053555 | |||
| 1760 | Ga0070675_100010354 | |||
| 1761 | Ga0070675_100015993 | |||
| 1762 | Ga0070675_100033582 | |||
| 1763 | Ga0070675_100098146 | |||
| 1764 | Ga0070675_100146434 | |||
| 1765 | Ga0070671_100003341 | |||
| 1766 | Ga0070671_100045323 | |||
| 1767 | Ga0070671_100220132 | |||
| 1768 | Ga0070671_100258280 | |||
| 1769 | Ga0070674_100003182 | |||
| 1770 | Ga0070673_100010614 | |||
| 1771 | Ga0070673_100054055 | |||
| 1772 | Ga0070673_100349640 | |||
| 1773 | Ga0070688_100006558 | |||
| 1774 | Ga0070688_100017446 | |||
| 1775 | Ga0070688_100030065 | |||
| 1776 | Ga0070688_100043804 | |||
| 1777 | Ga0070659_100006313 | |||
| 1778 | Ga0070659_100032632 | |||
| 1779 | Ga0070659_100156297 | |||
| 1780 | Ga0070667_100011850 | |||
| 1781 | Ga0070667_100055986 | |||
| 1782 | Ga0070703_10032289 | |||
| 1783 | Ga0070703_10064961 | |||
| 1784 | Ga0070709_10002356 | |||
| 1785 | Ga0070709_10003391 | |||
| 1786 | Ga0070709_10028772 | |||
| 1787 | Ga0070709_10122286 | |||
| 1788 | Ga0070714_100000516 | |||
| 1789 | Ga0070714_100009307 | |||
| 1790 | Ga0070714_100032390 | |||
| 1791 | Ga0070714_100058999 | |||
| 1792 | Ga0070714_100252319 | |||
| 1793 | Ga0070714_100287574 | |||
| 1794 | Ga0070713_100000228 | |||
| 1795 | Ga0070713_100004346 | |||
| 1796 | Ga0070713_100025482 | |||
| 1797 | Ga0070713_100104233 | |||
| 1798 | Ga0070710_10000438 | |||
| 1799 | Ga0070710_10003280 | |||
| 1800 | Ga0070710_10080200 | |||
| 1801 | Ga0070701_10003647 | |||
| 1802 | Ga0070711_100000998 | |||
| 1803 | Ga0070711_100060588 | |||
| 1804 | Ga0070711_100153171 | |||
| 1805 | Ga0070711_100168127 | |||
| 1806 | Ga0070711_100187110 | |||
| 1807 | Ga0070711_100317504 | |||
| 1808 | Ga0070705_100009011 | |||
| 1809 | Ga0070705_100049550 | |||
| 1810 | Ga0070705_100094544 | |||
| 1811 | Ga0070705_100297650 | |||
| 1812 | Ga0070700_100015500 | |||
| 1813 | Ga0070700_100017964 | |||
| 1814 | Ga0070700_100080731 | |||
| 1815 | Ga0070694_100000312 | |||
| 1816 | Ga0070694_100008055 | |||
| 1817 | Ga0070708_100072490 | |||
| 1818 | Ga0070663_100008241 | |||
| 1819 | Ga0070663_100043993 | |||
| 1820 | Ga0070663_100092601 | |||
| 1821 | Ga0070678_100001343 | |||
| 1822 | Ga0070678_100036419 | |||
| 1823 | Ga0070678_100047901 | |||
| 1824 | Ga0070678_100077082 | |||
| 1825 | Ga0070662_100007995 | |||
| 1826 | Ga0070662_100025872 | |||
| 1827 | Ga0070662_100091445 | |||
| 1828 | Ga0070681_10005438 | |||
| 1829 | Ga0070681_10012552 | |||
| 1830 | Ga0070681_10023289 | |||
| 1831 | Ga0070681_10132045 | |||
| 1832 | Ga0070681_10133037 | |||
| 1833 | Ga0070681_10259780 | |||
| 1834 | Ga0068867_100022236 | |||
| 1835 | Ga0068867_100371518 | |||
| 1836 | Ga0070685_10000596 | |||
| 1837 | Ga0070685_10024426 | |||
| 1838 | Ga0070707_100213347 | |||
| 1839 | Ga0070699_100490949 | |||
| 1840 | Ga0070679_100005039 | |||
| 1841 | Ga0070679_100020021 | |||
| 1842 | Ga0070679_100066434 | |||
| 1843 | Ga0070679_100177525 | |||
| 1844 | Ga0070679_100206546 | |||
| 1845 | Ga0070679_100298213 | |||
| 1846 | Ga0070684_100001973 | |||
| 1847 | Ga0070684_100039621 | |||
| 1848 | Ga0068853_100007072 | |||
| 1849 | Ga0068853_100031218 | |||
| 1850 | Ga0068853_100034006 | |||
| 1851 | Ga0070672_100005148 | |||
| 1852 | Ga0070672_100030325 | |||
| 1853 | Ga0070672_100031508 | |||
| 1854 | Ga0070672_100208814 | |||
| 1855 | Ga0070686_100006737 | |||
| 1856 | Ga0070686_100015768 | |||
| 1857 | Ga0070686_100050993 | |||
| 1858 | Ga0070686_100057244 | |||
| 1859 | Ga0070686_100262914 | |||
| 1860 | Ga0070695_100008048 | |||
| 1861 | Ga0070695_100020280 | |||
| 1862 | Ga0070696_100016735 | |||
| 1863 | Ga0070696_100068309 | |||
| 1864 | Ga0070693_100003223 | |||
| 1865 | Ga0070693_100015829 | |||
| 1866 | Ga0070693_100156777 | |||
| 1867 | Ga0070665_100007650 | |||
| 1868 | Ga0070665_100120660 | |||
| 1869 | Ga0070665_100166427 | |||
| 1870 | Ga0070665_100370760 | |||
| 1871 | Ga0070665_100494379 | |||
| 1872 | Ga0070704_100001543 | |||
| 1873 | Ga0070704_100005924 | |||
| 1874 | Ga0070704_100023069 | |||
| 1875 | Ga0070704_100419974 | |||
| 1876 | Ga0068855_100032524 | |||
| 1877 | Ga0068855_100066754 | |||
| 1878 | Ga0068855_100118675 | |||
| 1879 | Ga0068855_100121490 | |||
| 1880 | Ga0068855_100123908 | |||
| 1881 | Ga0068855_100146497 | |||
| 1882 | Ga0068855_100311759 | |||
| 1883 | Ga0070664_100014789 | |||
| 1884 | Ga0070664_100054900 | |||
| 1885 | Ga0070664_100217341 | |||
| 1886 | Ga0070664_100480036 | |||
| 1887 | Ga0068857_100013315 | |||
| 1888 | Ga0068857_100180762 | |||
| 1889 | Ga0068857_100215951 | |||
| 1890 | Ga0068854_100001754 | |||
| 1891 | Ga0068854_100016161 | |||
| 1892 | Ga0068854_100096809 | |||
| 1893 | Ga0068856_100021987 | |||
| 1894 | Ga0068856_100032409 | |||
| 1895 | Ga0068856_100117928 | |||
| 1896 | Ga0070702_100000021 | |||
| 1897 | Ga0070702_100010590 | |||
| 1898 | Ga0068852_100013544 | |||
| 1899 | Ga0068852_100024110 | |||
| 1900 | Ga0068852_100028980 | |||
| 1901 | Ga0068852_100139038 | |||
| 1902 | Ga0068859_100053512 | |||
| 1903 | Ga0068859_100461155 | |||
| 1904 | Ga0068864_100001093 | |||
| 1905 | Ga0068864_100029107 | |||
| 1906 | Ga0068864_100046960 | |||
| 1907 | Ga0068864_100310437 | |||
| 1908 | Ga0068866_10002066 | |||
| 1909 | Ga0068866_10033138 | |||
| 1910 | Ga0068866_10102328 | |||
| 1911 | Ga0068866_10157407 | |||
| 1912 | Ga0068861_100007979 | |||
| 1913 | Ga0068861_100033843 | |||
| 1914 | Ga0068861_100148568 | |||
| 1915 | Ga0068851_10049927 | |||
| 1916 | Ga0068851_10165064 | |||
| 1917 | Ga0068870_10000128 | |||
| 1918 | Ga0068870_10066126 | |||
| 1919 | Ga0068863_100020069 | |||
| 1920 | Ga0068863_100022637 | |||
| 1921 | Ga0068863_100127966 | |||
| 1922 | Ga0068858_100019007 | |||
| 1923 | Ga0068858_100019312 | |||
| 1924 | Ga0068858_100132866 | |||
| 1925 | Ga0068858_100235693 | |||
| 1926 | Ga0068858_100381333 | |||
| 1927 | Ga0068860_100037706 | |||
| 1928 | Ga0068860_100040135 | |||
| 1929 | Ga0068860_100048205 | |||
| 1930 | Ga0068860_100307691 | |||
| 1931 | Ga0068862_100005880 | |||
| 1932 | Ga0068862_100038468 | |||
| 1933 | Ga0068862_100165979 | |||
| 1934 | Ga0068862_100219794 | |||
| 1935 | Ga0081455_10000002 | |||
| 1936 | Ga0081455_10001227 | |||
| 1937 | Ga0081455_10013377 | |||
| 1938 | Ga0081455_10035412 | |||
| 1939 | Ga0081455_10212057 | |||
| 1940 | Ga0081538_10002294 | |||
| 1941 | Ga0081538_10102419 | |||
| 1942 | Ga0081540_1000569 | |||
| 1943 | Ga0081540_1002980 | |||
| 1944 | Ga0081540_1008410 | |||
| 1945 | Ga0081540_1013731 | |||
| 1946 | Ga0081539_10004324 | |||
| 1947 | Ga0081539_10011185 | |||
| 1948 | Ga0070717_10001441 | |||
| 1949 | Ga0070717_10001451 | |||
| 1950 | Ga0070717_10136392 | |||
| 1951 | Ga0070717_10178142 | |||
| 1952 | Ga0070717_10290952 | |||
| 1953 | Ga0075365_10098960 | |||
| 1954 | Ga0075368_10003235 | |||
| 1955 | Ga0075363_100002280 | |||
| 1956 | Ga0075363_100002849 | |||
| 1957 | Ga0075363_100058149 | |||
| 1958 | Ga0075364_10005121 | |||
| 1959 | Ga0070715_10006066 | |||
| 1960 | Ga0070715_10037893 | |||
| 1961 | Ga0070715_10059215 | |||
| 1962 | Ga0070715_10153182 | |||
| 1963 | Ga0070716_100002431 | |||
| 1964 | Ga0070716_100012858 | |||
| 1965 | Ga0070712_100004538 | |||
| 1966 | Ga0070712_100022226 | |||
| 1967 | Ga0070712_100033200 | |||
| 1968 | Ga0070712_100329075 | |||
| 1969 | Ga0075362_10002098 | |||
| 1970 | Ga0075367_10004832 | |||
| 1971 | Ga0075367_10030132 | |||
| 1972 | Ga0075367_10042737 | |||
| 1973 | Ga0075367_10111494 | |||
| 1974 | Ga0075367_10132308 | |||
| 1975 | Ga0075367_10145667 | |||
| 1976 | Ga0075369_10003186 | |||
| 1977 | Ga0075427_10003543 | |||
| 1978 | Ga0075366_10002193 | |||
| 1979 | Ga0075366_10056751 | |||
| 1980 | Ga0075366_10110273 | |||
| 1981 | Ga0097621_100000012 | |||
| 1982 | Ga0097621_100077690 | |||
| 1983 | Ga0068871_100000138 | |||
| 1984 | Ga0068871_100003229 | |||
| 1985 | Ga0068871_100066657 | |||
| 1986 | Ga0068871_100129205 | |||
| 1987 | Ga0075428_100003156 | |||
| 1988 | Ga0075428_100035411 | |||
| 1989 | Ga0075428_100186443 | |||
| 1990 | Ga0075430_100000683 | |||
| 1991 | Ga0075430_100043547 | |||
| 1992 | Ga0075431_100003071 | |||
| 1993 | Ga0075431_100056737 | |||
| 1994 | Ga0075431_100079468 | |||
| 1995 | Ga0075431_100481578 | |||
| 1996 | Ga0075433_10000266 | |||
| 1997 | Ga0075433_10096046 | |||
| 1998 | Ga0075433_10109512 | |||
| 1999 | Ga0075433_10113418 | |||
| 2000 | Ga0075433_10189584 | |||
| 2001 | Ga0075433_10248137 | |||
| 2002 | Ga0075433_10258130 | |||
| 2003 | Ga0075434_100000350 | |||
| 2004 | Ga0075434_100004062 | |||
| 2005 | Ga0075434_100025533 | |||
| 2006 | Ga0075434_100164662 | |||
| 2007 | Ga0075434_100233376 | |||
| 2008 | Ga0075434_100325004 | |||
| 2009 | Ga0075429_100002242 | |||
| 2010 | Ga0068865_100002683 | |||
| 2011 | Ga0068865_100004534 | |||
| 2012 | Ga0075436_100001243 | |||
| 2013 | Ga0075436_100047350 | |||
| 2014 | Ga0075436_100051287 | |||
| 2015 | Ga0097620_100053514 | |||
| 2016 | Ga0097620_100461142 | |||
| 2017 | Ga0099825_1026215 | |||
| 2018 | Ga0099823_1073227 | |||
| 2019 | Ga0075435_100000890 | |||
| 2020 | Ga0075435_100159469 | |||
| 2021 | Ga0075435_100166878 | |||
| 2022 | Ga0099794_10032701 | |||
| 2023 | Ga0099794_10102797 | |||
| 2024 | Ga0105251_10020694 | |||
| 2025 | Ga0105240_10000024 | |||
| 2026 | Ga0105240_10046080 | |||
| 2027 | Ga0105240_10062192 | |||
| 2028 | Ga0105240_10253927 | |||
| 2029 | Ga0105240_10399259 | |||
| 2030 | Ga0111539_10000789 | |||
| 2031 | Ga0111539_10010846 | |||
| 2032 | Ga0111539_10024989 | |||
| 2033 | Ga0111539_10068891 | |||
| 2034 | Ga0111539_10090299 | |||
| 2035 | Ga0111539_10096871 | |||
| 2036 | Ga0111539_10104175 | |||
| 2037 | Ga0111539_10249156 | |||
| 2038 | Ga0111539_10334326 | |||
| 2039 | Ga0105245_10000925 | |||
| 2040 | Ga0105245_10002861 | |||
| 2041 | Ga0105245_10073287 | |||
| 2042 | Ga0105245_10086442 | |||
| 2043 | Ga0105245_10663491 | |||
| 2044 | Ga0105247_10010607 | |||
| 2045 | Ga0105247_10057428 | |||
| 2046 | Ga0105247_10339363 | |||
| 2047 | Ga0114129_10000759 | |||
| 2048 | Ga0114129_10000935 | |||
| 2049 | Ga0114129_10002014 | |||
| 2050 | Ga0114129_10038647 | |||
| 2051 | Ga0114129_10062023 | |||
| 2052 | Ga0114129_10119138 | |||
| 2053 | Ga0114129_10175301 | |||
| 2054 | Ga0114129_10196919 | |||
| 2055 | Ga0105243_10012646 | |||
| 2056 | Ga0105243_10021908 | |||
| 2057 | Ga0105243_10103353 | |||
| 2058 | Ga0105243_10210515 | |||
| 2059 | Ga0105243_10520996 | |||
| 2060 | Ga0105241_10004258 | |||
| 2061 | Ga0105241_10074146 | |||
| 2062 | Ga0105241_10089569 | |||
| 2063 | Ga0105242_10005000 | |||
| 2064 | Ga0105242_10028441 | |||
| 2065 | Ga0105242_10158100 | |||
| 2066 | Ga0105242_10392195 | |||
| 2067 | Ga0105242_10435330 | |||
| 2068 | Ga0105248_10006082 | |||
| 2069 | Ga0105248_10027254 | |||
| 2070 | Ga0105248_10107219 | |||
| 2071 | Ga0105248_10283913 | |||
| 2072 | Ga0105248_10317029 | |||
| 2073 | Ga0105237_10002267 | |||
| 2074 | Ga0105237_10070436 | |||
| 2075 | Ga0105237_10177567 | |||
| 2076 | Ga0105238_10022578 | |||
| 2077 | Ga0105238_10025325 | |||
| 2078 | Ga0105238_10029376 | |||
| 2079 | Ga0105238_10050832 | |||
| 2080 | Ga0105249_10004141 | |||
| 2081 | Ga0105249_10018008 | |||
| 2082 | Ga0105249_10018236 | |||
| 2083 | Ga0105249_10235076 | |||
| 2084 | Ga0105249_10359822 | |||
| 2085 | Ga0105249_10416972 | |||
| 2086 | Ga0105249_10637745 | |||
| 2087 | Ga0105239_10001386 | |||
| 2088 | Ga0105239_10058278 | |||
| 2089 | Ga0105239_10115135 | |||
| 2090 | Ga0105239_10315836 | |||
| 2091 | Ga0105239_10437408 | |||
| 2092 | Ga0105239_10504393 | |||
| 2093 | Ga0105246_10008127 | |||
| 2094 | Ga0105246_10106667 | |||
| 2095 | Ga0105246_10219980 | |||
| 2096 | Ga0157336_1000695 | |||
| 2097 | Ga0157342_1003003 | |||
| 2098 | Ga0157338_1000839 | |||
| 2099 | Ga0157338_1001291 | |||
| 2100 | Ga0157373_10022700 | |||
| 2101 | Ga0157373_10028826 | |||
| 2102 | Ga0157373_10075079 | |||
| 2103 | Ga0157371_10008660 | |||
| 2104 | Ga0157371_10238067 | |||
| 2105 | Ga0157370_10000180 | |||
| 2106 | Ga0157370_10015656 | |||
| 2107 | Ga0157370_10093961 | |||
| 2108 | Ga0157369_10017624 | |||
| 2109 | Ga0157374_10001601 | |||
| 2110 | Ga0157374_10013850 | |||
| 2111 | Ga0157378_10002020 | |||
| 2112 | Ga0157378_10045512 | |||
| 2113 | Ga0157378_10076853 | |||
| 2114 | Ga0157378_10410686 | |||
| 2115 | Ga0163162_10020934 | |||
| 2116 | Ga0163162_10021331 | |||
| 2117 | Ga0163162_10134579 | |||
| 2118 | Ga0163162_10351522 | |||
| 2119 | Ga0157372_10111034 | |||
| 2120 | Ga0157372_10141931 | |||
| 2121 | Ga0157372_10506593 | |||
| 2122 | Ga0157375_10001500 | |||
| 2123 | Ga0157375_10096785 | |||
| 2124 | Ga0157375_10210424 | |||
| 2125 | Ga0157375_10748079 | |||
| 2126 | Ga0163163_10019456 | |||
| 2127 | Ga0163163_10019635 | |||
| 2128 | Ga0163163_10134358 | |||
| 2129 | Ga0163163_10202048 | |||
| 2130 | Ga0157380_10006688 | |||
| 2131 | Ga0157380_10058984 | |||
| 2132 | Ga0157380_10116274 | |||
| 2133 | Ga0157377_10001219 | |||
| 2134 | Ga0157377_10004034 | |||
| 2135 | Ga0157379_10046013 | |||
| 2136 | Ga0157379_10058507 | |||
| 2137 | Ga0157379_10082837 | |||
| 2138 | Ga0157376_10001430 | |||
| 2139 | Ga0157376_10136269 | |||
| 2140 | Ga0163161_10001393 | |||
| 2141 | Ga0163161_10041464 | |||
| 2142 | Ga0163161_10112486 | |||
| 2143 | Ga0206354_11266181 | |||
| 2144 | Ga0213876_10004936 | |||
| 2145 | Ga0213875_10000031 | |||
| 2146 | Ga0228598_1000332 | |||
| 2147 | Ga0209677_100837 | |||
| 2148 | Ga0209233_1003871 | |||
| 2149 | Ga0209233_1013175 | |||
| 2150 | Ga0207666_1000163 | |||
| 2151 | Ga0209455_1015801 | |||
| 2152 | Ga0209758_1000634 | |||
| 2153 | Ga0209758_1004442 | |||
| 2154 | Ga0209758_1029772 | |||
| 2155 | Ga0207697_10005022 | |||
| 2156 | Ga0207697_10018719 | |||
| 2157 | Ga0207653_10078965 | |||
| 2158 | Ga0207682_10000064 | |||
| 2159 | Ga0207692_10001996 | |||
| 2160 | Ga0207692_10002828 | |||
| 2161 | Ga0207692_10093833 | |||
| 2162 | Ga0207642_10064958 | |||
| 2163 | Ga0207642_10081206 | |||
| 2164 | Ga0207642_10115202 | |||
| 2165 | Ga0207642_10136785 | |||
| 2166 | Ga0207710_10005111 | |||
| 2167 | Ga0207688_10000659 | |||
| 2168 | Ga0207688_10006579 | |||
| 2169 | Ga0207680_10111632 | |||
| 2170 | Ga0207647_10008358 | |||
| 2171 | Ga0207647_10018502 | |||
| 2172 | Ga0207647_10032237 | |||
| 2173 | Ga0207685_10005621 | |||
| 2174 | Ga0207685_10107120 | |||
| 2175 | Ga0207699_10010235 | |||
| 2176 | Ga0207699_10011012 | |||
| 2177 | Ga0207699_10025399 | |||
| 2178 | Ga0207699_10164655 | |||
| 2179 | Ga0207699_10197781 | |||
| 2180 | Ga0207645_10000040 | |||
| 2181 | Ga0207645_10006029 | |||
| 2182 | Ga0207645_10048545 | |||
| 2183 | Ga0207643_10000072 | |||
| 2184 | Ga0207705_10056668 | |||
| 2185 | Ga0207705_10064919 | |||
| 2186 | Ga0207684_10018395 | |||
| 2187 | Ga0207654_10100886 | |||
| 2188 | Ga0207654_10120835 | |||
| 2189 | Ga0207707_10013269 | |||
| 2190 | Ga0207707_10017843 | |||
| 2191 | Ga0207707_10029037 | |||
| 2192 | Ga0207707_10461227 | |||
| 2193 | Ga0207695_10000036 | |||
| 2194 | Ga0207695_10020001 | |||
| 2195 | Ga0207695_10078328 | |||
| 2196 | Ga0207695_10133015 | |||
| 2197 | Ga0207695_10430576 | |||
| 2198 | Ga0207671_10000191 | |||
| 2199 | Ga0207671_10005373 | |||
| 2200 | Ga0207693_10003700 | |||
| 2201 | Ga0207693_10005910 | |||
| 2202 | Ga0207693_10009265 | |||
| 2203 | Ga0207693_10009447 | |||
| 2204 | Ga0207693_10010740 | |||
| 2205 | Ga0207693_10035352 | |||
| 2206 | Ga0207693_10083946 | |||
| 2207 | Ga0207693_10095942 | |||
| 2208 | Ga0207693_10169440 | |||
| 2209 | Ga0207693_10193953 | |||
| 2210 | Ga0207663_10029576 | |||
| 2211 | Ga0207663_10121899 | |||
| 2212 | Ga0207663_10142145 | |||
| 2213 | Ga0207660_10000501 | |||
| 2214 | Ga0207660_10050112 | |||
| 2215 | Ga0207660_10241393 | |||
| 2216 | Ga0207660_10309826 | |||
| 2217 | Ga0207662_10002825 | |||
| 2218 | Ga0207662_10006747 | |||
| 2219 | Ga0207662_10006755 | |||
| 2220 | Ga0207662_10053843 | |||
| 2221 | Ga0207657_10020092 | |||
| 2222 | Ga0207657_10020692 | |||
| 2223 | Ga0207657_10021548 | |||
| 2224 | Ga0207657_10031123 | |||
| 2225 | Ga0207657_10065767 | |||
| 2226 | Ga0207649_10003387 | |||
| 2227 | Ga0207649_10025473 | |||
| 2228 | Ga0207649_10204018 | |||
| 2229 | Ga0207652_10018767 | |||
| 2230 | Ga0207652_10060283 | |||
| 2231 | Ga0207652_10184023 | |||
| 2232 | Ga0207646_10139946 | |||
| 2233 | Ga0207681_10000539 | |||
| 2234 | Ga0207681_10097483 | |||
| 2235 | Ga0207694_10029108 | |||
| 2236 | Ga0207694_10133104 | |||
| 2237 | Ga0207650_10000415 | |||
| 2238 | Ga0207650_10001724 | |||
| 2239 | Ga0207650_10030779 | |||
| 2240 | Ga0207650_10038239 | |||
| 2241 | Ga0207650_10280441 | |||
| 2242 | Ga0207659_10000444 | |||
| 2243 | Ga0207659_10042773 | |||
| 2244 | Ga0207659_10095486 | |||
| 2245 | Ga0207659_10134336 | |||
| 2246 | Ga0207659_10178803 | |||
| 2247 | Ga0207687_10000144 | |||
| 2248 | Ga0207687_10013684 | |||
| 2249 | Ga0207687_10480554 | |||
| 2250 | Ga0207700_10000458 | |||
| 2251 | Ga0207700_10015033 | |||
| 2252 | Ga0207700_10052748 | |||
| 2253 | Ga0207700_10094978 | |||
| 2254 | Ga0207700_10144937 | |||
| 2255 | Ga0207664_10000692 | |||
| 2256 | Ga0207664_10002435 | |||
| 2257 | Ga0207664_10081446 | |||
| 2258 | Ga0207664_10090775 | |||
| 2259 | Ga0207664_10331276 | |||
| 2260 | Ga0207644_10001694 | |||
| 2261 | Ga0207644_10007950 | |||
| 2262 | Ga0207690_10000086 | |||
| 2263 | Ga0207690_10072373 | |||
| 2264 | Ga0207690_10310675 | |||
| 2265 | Ga0207706_10001993 | |||
| 2266 | Ga0207706_10003068 | |||
| 2267 | Ga0207706_10003497 | |||
| 2268 | Ga0207706_10019399 | |||
| 2269 | Ga0207706_10085984 | |||
| 2270 | Ga0207706_10109552 | |||
| 2271 | Ga0207706_10120845 | |||
| 2272 | Ga0207686_10000973 | |||
| 2273 | Ga0207686_10149733 | |||
| 2274 | Ga0207709_10000431 | |||
| 2275 | Ga0207709_10120544 | |||
| 2276 | Ga0207670_10001153 | |||
| 2277 | Ga0207670_10001643 | |||
| 2278 | Ga0207670_10003991 | |||
| 2279 | Ga0207670_10022367 | |||
| 2280 | Ga0207669_10000228 | |||
| 2281 | Ga0207669_10003549 | |||
| 2282 | Ga0207669_10067393 | |||
| 2283 | Ga0207669_10131214 | |||
| 2284 | Ga0207704_10000107 | |||
| 2285 | Ga0207704_10349102 | |||
| 2286 | Ga0207665_10005548 | |||
| 2287 | Ga0207665_10007482 | |||
| 2288 | Ga0207691_10001173 | |||
| 2289 | Ga0207691_10002332 | |||
| 2290 | Ga0207691_10102780 | |||
| 2291 | Ga0207691_10462469 | |||
| 2292 | Ga0207711_10001611 | |||
| 2293 | Ga0207711_10037079 | |||
| 2294 | Ga0207711_10071891 | |||
| 2295 | Ga0207689_10000115 | |||
| 2296 | Ga0207689_10019975 | |||
| 2297 | Ga0207689_10058235 | |||
| 2298 | Ga0207689_10079235 | |||
| 2299 | Ga0207689_10336150 | |||
| 2300 | Ga0207661_10000427 | |||
| 2301 | Ga0207661_10143082 | |||
| 2302 | Ga0207661_10152722 | |||
| 2303 | Ga0207679_10000025 | |||
| 2304 | Ga0207679_10009981 | |||
| 2305 | Ga0207679_10102337 | |||
| 2306 | Ga0207679_10190077 | |||
| 2307 | Ga0207679_10417118 | |||
| 2308 | Ga0207667_10018931 | |||
| 2309 | Ga0207667_10068500 | |||
| 2310 | Ga0207667_10182532 | |||
| 2311 | Ga0207651_10000081 | |||
| 2312 | Ga0207651_10017679 | |||
| 2313 | Ga0207651_10378181 | |||
| 2314 | Ga0207651_10398565 | |||
| 2315 | Ga0207712_10001191 | |||
| 2316 | Ga0207712_10010168 | |||
| 2317 | Ga0207668_10000171 | |||
| 2318 | Ga0207640_10000631 | |||
| 2319 | Ga0207640_10161933 | |||
| 2320 | Ga0207640_10167234 | |||
| 2321 | Ga0207658_10005655 | |||
| 2322 | Ga0207658_10064999 | |||
| 2323 | Ga0207658_10072350 | |||
| 2324 | Ga0207677_10000447 | |||
| 2325 | Ga0207703_10002461 | |||
| 2326 | Ga0207703_10016409 | |||
| 2327 | Ga0207703_10045609 | |||
| 2328 | Ga0207703_10082095 | |||
| 2329 | Ga0207703_10266990 | |||
| 2330 | Ga0207639_10001124 | |||
| 2331 | Ga0207639_10324804 | |||
| 2332 | Ga0207678_10006341 | |||
| 2333 | Ga0207678_10016727 | |||
| 2334 | Ga0207678_10040686 | |||
| 2335 | Ga0207678_10110966 | |||
| 2336 | Ga0207708_10004257 | |||
| 2337 | Ga0207708_10013006 | |||
| 2338 | Ga0207708_10013024 | |||
| 2339 | Ga0207708_10193573 | |||
| 2340 | Ga0207702_10001906 | |||
| 2341 | Ga0207702_10035301 | |||
| 2342 | Ga0207702_10483841 | |||
| 2343 | Ga0207702_10594234 | |||
| 2344 | Ga0207641_10001385 | |||
| 2345 | Ga0207641_10060666 | |||
| 2346 | Ga0207641_10099338 | |||
| 2347 | Ga0207641_10099376 | |||
| 2348 | Ga0207641_10129430 | |||
| 2349 | Ga0207641_10163454 | |||
| 2350 | Ga0207641_10355597 | |||
| 2351 | Ga0207648_10054328 | |||
| 2352 | Ga0207648_10241375 | |||
| 2353 | Ga0207648_10270036 | |||
| 2354 | Ga0207676_10010826 | |||
| 2355 | Ga0207676_10064322 | |||
| 2356 | Ga0207676_10112109 | |||
| 2357 | Ga0207676_10169321 | |||
| 2358 | Ga0207674_10001963 | |||
| 2359 | Ga0207674_10030777 | |||
| 2360 | Ga0207674_10041706 | |||
| 2361 | Ga0207674_10106752 | |||
| 2362 | Ga0207674_10182274 | |||
| 2363 | Ga0207675_100002006 | |||
| 2364 | Ga0207675_100015436 | |||
| 2365 | Ga0207675_100021400 | |||
| 2366 | Ga0207675_100098921 | |||
| 2367 | Ga0207683_10000001 | |||
| 2368 | Ga0207683_10011391 | |||
| 2369 | Ga0207683_10014385 | |||
| 2370 | Ga0207683_10052773 | |||
| 2371 | Ga0207698_10000531 | |||
| 2372 | Ga0207698_10016679 | |||
| 2373 | Ga0207698_10246809 | |||
| 2374 | Ga0207698_10429227 | |||
| 2375 | Ga0209389_1000153 | |||
| 2376 | Ga0209489_100936 | |||
| 2377 | Ga0209700_100011 | |||
| 2378 | Ga0210002_1007289 | |||
| 2379 | Ga0209588_1045738 | |||
| 2380 | Ga0209971_1015712 | |||
| 2381 | Ga0209966_1000744 | |||
| 2382 | Ga0209966_1004200 | |||
| 2383 | Ga0209998_10005098 | |||
| 2384 | Ga0209998_10011877 | |||
| 2385 | Ga0209974_10005645 | |||
| 2386 | Ga0207428_10000221 | |||
| 2387 | Ga0207428_10000374 | |||
| 2388 | Ga0207428_10000524 | |||
| 2389 | Ga0207428_10091574 | |||
| 2390 | Ga0268266_10022478 | |||
| 2391 | Ga0268266_10095530 | |||
| 2392 | Ga0268266_10125364 | |||
| 2393 | Ga0268266_10485293 | |||
| 2394 | Ga0268265_10002636 | |||
| 2395 | Ga0268265_10230733 | |||
| 2396 | Ga0268264_10000886 | |||
| 2397 | Ga0268264_10007945 | |||
| 2398 | Ga0268264_10255311 | |||
| 2399 | Ga0268264_10545222 | |||
| 2400 | Ga0265337_1002520 | |||
| 2401 | Ga0265318_10012161 | |||
| 2402 | Ga0265338_10034655 | |||
| 2403 | Ga0265330_10026153 | |||
| 2404 | Ga0265330_10033066 | |||
| 2405 | Ga0265330_10065930 | |||
| 2406 | Ga0265330_10067502 | |||
| 2407 | Ga0265320_10008506 | |||
| 2408 | Ga0265325_10000095 | |||
| 2409 | Ga0265325_10000238 | |||
| 2410 | Ga0265325_10010377 | |||
| 2411 | Ga0265325_10017266 | |||
| 2412 | Ga0265325_10022512 | |||
| 2413 | Ga0265325_10035754 | |||
| 2414 | Ga0265325_10093922 | |||
| 2415 | Ga0265329_10021859 | |||
| 2416 | Ga0265340_10015759 | |||
| 2417 | Ga0265339_10000051 | |||
| 2418 | Ga0265339_10014949 | |||
| 2419 | Ga0265339_10016577 | |||
| 2420 | Ga0265339_10073737 | |||
| 2421 | Ga0265339_10110678 | |||
| 2422 | Ga0265331_10010219 | |||
| 2423 | Ga0265331_10054659 | |||
| 2424 | Ga0265331_10124001 | |||
| 2425 | Ga0265316_10055514 | |||
| 2426 | Ga0265316_10184635 | |||
| 2427 | Ga0307509_10151458 | |||
| 2428 | Ga0307408_100072066 | |||
| 2429 | Ga0265313_10000011 | |||
| 2430 | Ga0265313_10001977 | |||
| 2431 | Ga0265313_10007848 | |||
| 2432 | Ga0265313_10020261 | |||
| 2433 | Ga0265313_10084957 | |||
| 2434 | Ga0265313_10101515 | |||
| 2435 | Ga0316579_10002505 | |||
| 2436 | Ga0265314_10001044 | |||
| 2437 | Ga0265314_10019890 | |||
| 2438 | Ga0265314_10221629 | |||
| 2439 | Ga0265342_10000367 | |||
| 2440 | Ga0265342_10005329 | |||
| 2441 | Ga0265342_10019764 | |||
| 2442 | Ga0265342_10136028 | |||
| 2443 | Ga0316578_10048114 | |||
| 2444 | Ga0307409_100080979 | |||
| 2445 | Ga0307416_100431832 | |||
| 2446 | Ga0316583_10001321 | |||
| 2447 | Ga0307510_10226573 | |||
| 2448 | Ga0373930_0002702 | |||
| 2449 | Ga0373948_0000586 | |||
| 2450 | Ga0373948_0004324 | |||
| 2451 | Ga0373950_0002705 | |||
| 2452 | Ga0373950_0004683 | |||
| 2453 | Ga0373959_0000346 | |||
| 2454 | Ga0373938_0000019 | |||
| 2455 | Ga0373938_0000500 | |||
| 2456 | Ga0373926_0022520 | |||
| 2457 | Ga0373926_0064608 | |||
| 2458 | Ga0373928_0000086 | |||
| 2459 | Ga0373929_0002104 | |||
| 2460 | Ga0373934_0038930 | |||
| 2461 | Ga0373940_0000128 | |||
| 2462 | Ga0373940_0015602 | |||
| 2463 | Ga0373940_0017215 | |||
| 2464 | Ga0373944_0000472 | |||
| 2465 | Ga0373944_0001073 | |||
| 2466 | Ga0373944_0012540 | |||
| 2467 | Ga0373949_0001092 | |||
| 2468 | Ga0373949_0001874 | |||
| 2469 | Ga0373951_0002197 | |||
| 2470 | Ga0373952_0000337 | |||
| 2471 | Ga0373952_0017082 | |||
| 2472 | Ga0373923_0034447 | |||
| 2473 | Ga0373923_0096235 | |||
| 2474 | Ga0373932_0000684 | |||
| 2475 | Ga0373932_0011414 | |||
| 2476 | Ga0373936_0002845 | |||
| 2477 | Ga0373936_0021363 | |||
| 2478 | Ga0373936_0119764 | |||
| 2479 | Ga0373939_0000537 | |||
| 2480 | Ga0373939_0012799 | |||
| 2481 | Ga0373939_0016529 | |||
| 2482 | Ga0373941_0000130 | |||
| 2483 | Ga0373941_0009489 | |||
| 2484 | Ga0373941_0019114 | |||
| 2485 | Ga0373945_0001076 | |||
| 2486 | Ga0373945_0015805 | |||
| 2487 | Ga0373945_0072476 | |||
| 2488 | Ga0373945_0075655 | |||
| 2489 | Ga0373953_0001623 | |||
| 2490 | Ga0373953_0014816 | |||
| 2491 | Ga0373953_0050506 | |||
| 2492 | Ga0373954_0010286 | |||
| 2493 | Ga0373954_0052451 | |||
| 2494 | Ga0373954_0105080 | |||
| 2495 | Ga0373956_0031832 | |||
| 2496 | Ga0373956_0031873 | |||
| 2497 | Ga0373956_0046252 | |||
| 2498 | Ga0373957_0019620 | |||
| 2499 | Ga0373957_0053530 | |||
| 2500 | Ga0373957_0090821 | |||
| 2501 | Ga0373960_0022935 | |||
| 2502 | Ga0373943_0012213 | |||
| 2503 | Ga0373943_0025061 | |||
| 2504 | Ga0373943_0028196 | |||
| 2505 | Ga0373943_0042659 | |||
| 2506 | Ga0373943_0058877 | |||
| 2507 | Ga0373943_0064396 | |||
| 2508 | Ga0373943_0151609 | |||
| 2509 | Ga0373946_0009917 | |||
| 2510 | Ga0373946_0020297 | |||
| 2511 | Ga0373946_0030130 | |||
| 2512 | Ga0373946_0030202 | |||
| 2513 | Ga0373946_0093789 | |||
| 2514 | Ga0373946_0103836 | |||
| 2515 | Ga0373955_0001240 | |||
| 2516 | Ga0373955_0004568 | |||
| 2517 | Ga0373955_0004598 | |||
| 2518 | Ga0373955_0124028 | |||
| 2519 | Ga0373942_0000650 | |||
| 2520 | Ga0373942_0002645 | |||
| 2521 | Ga0373942_0077150 | |||
| 2522 | Ga0373961_0001156 | |||
| 2523 | Ga0373961_0013154 | |||
| 2524 | Ga0373962_0000281 | |||
| 2525 | Ga0373962_0003190 | |||
| 2526 | Ga0373962_0032757 | |||
| 2527 | Ga0316574_0039340 | |||
| 2528 | Ga0373924_0000635 | |||
| 2529 | Ga0373924_0004146 | |||
| 2530 | Ga0373924_0005822 | |||
| 2531 | Ga0373924_0022743 | |||
| 2532 | Ga0373924_0029106 | |||
| 2533 | Ga0373924_0033888 | |||
| 2534 | Ga0373931_0004016 | |||
| 2535 | Ga0373931_0004777 | |||
| 2536 | Ga0373931_0035877 | |||
| 2537 | Ga0373931_0102290 | |||
| 2538 | Ga0373931_0106433 | |||
| 2539 | Ga0373931_0248280 | |||
| 2540 | Ga0373935_0002667 | |||
| 2541 | Ga0373935_0003893 | |||
| 2542 | Ga0373935_0021979 | |||
| 2543 | Ga0373935_0039012 | |||
| 2544 | Ga0373935_0046689 | |||
| 2545 | Ga0373935_0094775 | |||
| 2546 | Ga0373935_0141185 | |||
| 2547 | Ga0373935_0172953 | |||
| 2548 | Ga0373927_0008477 | |||
| 2549 | Ga0373927_0013111 | |||
| 2550 | Ga0373927_0018038 | |||
| 2551 | Ga0373927_0058352 | |||
| 2552 | Ga0373927_0071247 | |||
| 2553 | Ga0373927_0135461 | |||
| 2554 | Ga0373927_0178451 | |||
| 2555 | Ga0373927_0197380 | |||
| 2556 | Ga0373927_0228883 | |||
| 2557 | Ga0373933_0001633 | |||
| 2558 | Ga0373933_0001683 | |||
| 2559 | Ga0373933_0002774 | |||
| 2560 | Ga0373933_0018474 | |||
| 2561 | Ga0373933_0062962 | |||
| 2562 | Ga0373933_0167235 | |||
| 2563 | Ga0373947_0000169 | |||
| 2564 | Ga0373947_0011727 | |||
| 2565 | Ga0373947_0016872 | |||
| 2566 | Ga0373947_0034868 | |||
| 2567 | Ga0373947_0067004 | |||
| 2568 | Ga0373947_0073998 | |||
| 2569 | Ga0373947_0141490 | |||
| 2570 | Ga0373947_0153081 | |||
| 2571 | Ga0373947_0230202 | |||
| 2572 | Ga0373937_0000075 | |||
| 2573 | Ga0373937_0002452 | |||
| 2574 | Ga0373937_0007161 | |||
| 2575 | Ga0373937_0008142 | |||
| 2576 | Ga0373937_0009623 | |||
| 2577 | Ga0373937_0062499 | |||
| 2578 | Ga0373937_0259048 | |||
| 2579 | Ga0373937_0310407 | |||
| 2580 | Ga0316582_0051301 | |||
| 2581 | Ga0316584_0051145 | |||
| 2582 | Ga0373925_0000159 | |||
| 2583 | Ga0373925_0002536 | |||
| 2584 | Ga0373925_0011850 | |||
| 2585 | Ga0373925_0030508 | |||
| 2586 | Ga0373925_0053580 | |||
| 2587 | Ga0373925_0060582 | |||
| 2588 | Ga0373925_0067035 | |||
| 2589 | Ga0373925_0127140 | |||
| 2590 | Ga0373925_0135420 | |||
| 2591 | Ga0373925_0193802 | |||
| 2592 | Ga0373925_0351132 | |||
| 2593 | Ga0395899_0014324 | |||
| 2594 | Ga0395899_0061279 | |||
| 2595 | Ga0395899_0143330 | |||
| 2596 | Ga0395900_0013523 | |||
| 2597 | Ga0395900_0060104 | |||
| 2598 | Ga0395900_0434002 | |||
| 2599 | Ga0395900_0584945 | |||
| 2600 | Ga0395898_0007764 | |||
| 2601 | Ga0395898_0026676 | |||
| 2602 | Ga0395898_0049193 | |||
| 2603 | Ga0395898_0188870 | |||
| 2604 | Ga0395905_0003532 | |||
| 2605 | Ga0395905_0049932 | |||
| 2606 | Ga0395905_0431940 | |||
| 2607 | Ga0436364_0743503 | |||
| 2608 | Ga0395901_0006371 | |||
| 2609 | Ga0395901_0161252 | |||
| 2610 | Ga0395901_0251165 | |||
| 2611 | Ga0395901_0361685 | |||
| 2612 | Ga0395901_0395919 | |||
| 2613 | Ga0242420_002129 | |||
| 2614 | Ga0400483_253337 | |||
| 2615 | Ga0436365_0208174 | |||
| 2616 | Ga0436365_1154146 | |||
| 2617 | Ga0436365_1691170 | |||
| 2618 | Ga0436365_1739170 | |||
| 2619 | Ga0436360_1037609 | |||
| 2620 | Ga0436361_0155268 | |||
| 2621 | Ga0436361_0422998 | |||
| 2622 | Ga0436361_0871492 | |||
| 2623 | Ga0436363_0274435 | |||
| 2624 | Ga0466972_0000214 | |||
| 2625 | Ga0466965_0194092 | |||
| 2626 | Ga0466966_0000209 | |||
| 2627 | Ga0466966_0066768 | |||
| 2628 | Ga0466961_0093408 | |||
| 2629 | Ga0466963_0041247 | |||
| 2630 | Ga0466963_0070403 | |||
| 2631 | Ga0466963_0088271 | |||
| 2632 | Ga0466963_0199405 | |||
| 2633 | Ga0453684_0027976 | |||
| 2634 | Ga0466957_0017743 | |||
| 2635 | Ga0466957_0160638 | |||
| 2636 | Ga0466957_0213141 | |||
| 2637 | Ga0451576_0003944 | |||
| 2638 | Ga0466958_0028754 | |||
| 2639 | Ga0466967_0332602 | |||
| 2640 | Ga0466967_0335766 | |||
| 2641 | Ga0495617_006346 | |||
| 2642 | Ga0495592_0000392 | |||
| 2643 | Ga0495592_0037845 | |||
| 2644 | Ga0495592_0043951 | |||
| 2645 | Ga0495592_0045235 | |||
| 2646 | Ga0495592_0045416 | |||
| 2647 | Ga0495592_0050180 | |||
| 2648 | Ga0495592_0240685 | |||
| 2649 | Ga0495603_0010692 | |||
| 2650 | Ga0495603_0064972 | |||
| 2651 | Ga0495603_0073240 | |||
| 2652 | Ga0495629_0000230 | |||
| 2653 | Ga0495629_0000948 | |||
| 2654 | Ga0495629_0050112 | |||
| 2655 | Ga0495629_0071692 | |||
| 2656 | Ga0495629_0101703 | |||
| 2657 | Ga0495629_0132443 | |||
| 2658 | Ga0495629_0269188 | |||
| 2659 | Ga0495638_0028884 | |||
| 2660 | Ga0495641_0071447 | |||
| 2661 | Ga0495651_0002849 | |||
| 2662 | Ga0495651_0014204 | |||
| 2663 | Ga0495651_0131250 | |||
| 2664 | Ga0495651_0140040 | |||
| 2665 | Ga0495651_0269236 | |||
| 2666 | Ga0495653_0000036 | |||
| 2667 | Ga0495653_0004021 | |||
| 2668 | Ga0495653_0038647 | |||
| 2669 | Ga0495653_0079395 | |||
| 2670 | Ga0495653_0158689 | |||
| 2671 | Ga0495653_0219880 | |||
| 2672 | Ga0495580_0001068 | |||
| 2673 | Ga0495580_0039737 | |||
| 2674 | Ga0495580_0045082 | |||
| 2675 | Ga0495580_0054321 | |||
| 2676 | Ga0495582_0005508 | |||
| 2677 | Ga0495582_0022528 | |||
| 2678 | Ga0495582_0030243 | |||
| 2679 | Ga0495582_0076888 | |||
| 2680 | Ga0495639_0004161 | |||
| 2681 | Ga0495639_0045698 | |||
| 2682 | Ga0495662_0005220 | |||
| 2683 | Ga0495662_0011941 | |||
| 2684 | Ga0495662_0011970 | |||
| 2685 | Ga0495662_0016876 | |||
| 2686 | Ga0495662_0048421 | |||
| 2687 | Ga0495662_0133172 | |||
| 2688 | Ga0495664_0000107 | |||
| 2689 | Ga0495664_0000120 | |||
| 2690 | Ga0495664_0032517 | |||
| 2691 | Ga0495664_0057517 | |||
| 2692 | Ga0495584_0036368 | |||
| 2693 | Ga0495584_0076333 | |||
| 2694 | Ga0495584_0117585 | |||
| 2695 | Ga0495585_0014848 | |||
| 2696 | Ga0495594_0017109 | |||
| 2697 | Ga0495594_0056247 | |||
| 2698 | Ga0495607_0025317 | |||
| 2699 | Ga0495606_0015828 | |||
| 2700 | Ga0495606_0033243 | |||
| 2701 | Ga0495606_0111860 | |||
| 2702 | Ga0495608_0000006 | |||
| 2703 | Ga0495608_0006645 | |||
| 2704 | Ga0495608_0017571 | |||
| 2705 | Ga0495608_0058209 | |||
| 2706 | Ga0495608_0138837 | |||
| 2707 | Ga0495608_0303567 | |||
| 2708 | Ga0495610_0044303 | |||
| 2709 | Ga0495616_0087390 | |||
| 2710 | Ga0495618_0000057 | |||
| 2711 | Ga0495618_0006172 | |||
| 2712 | Ga0495618_0017945 | |||
| 2713 | Ga0495618_0037015 | |||
| 2714 | Ga0495618_0046220 | |||
| 2715 | Ga0495618_0128275 | |||
| 2716 | Ga0495628_0000077 | |||
| 2717 | Ga0495628_0001017 | |||
| 2718 | Ga0495628_0070137 | |||
| 2719 | Ga0495628_0073107 | |||
| 2720 | Ga0495628_0164732 | |||
| 2721 | Ga0495630_0010058 | |||
| 2722 | Ga0495630_0023765 | |||
| 2723 | Ga0495630_0023931 | |||
| 2724 | Ga0495630_0134099 | |||
| 2725 | Ga0495630_0262825 | |||
| 2726 | Ga0495631_0115490 | |||
| 2727 | Ga0495637_0081291 | |||
| 2728 | Ga0495644_0001361 | |||
| 2729 | Ga0495648_0003063 | |||
| 2730 | Ga0495648_0171813 | |||
| 2731 | Ga0495666_0005491 | |||
| 2732 | Ga0495652_0000005 | |||
| 2733 | Ga0495652_0005022 | |||
| 2734 | Ga0495652_0006915 | |||
| 2735 | Ga0495652_0017324 | |||
| 2736 | Ga0495652_0082543 | |||
| 2737 | Ga0495652_0098349 | |||
| 2738 | Ga0495652_0155327 | |||
| 2739 | Ga0495665_0012704 | |||
| 2740 | Ga0495665_0030569 | |||
| 2741 | Ga0495640_0000007 | |||
| 2742 | Ga0495640_0004278 | |||
| 2743 | Ga0495640_0004293 | |||
| 2744 | Ga0495640_0022947 | |||
| 2745 | Ga0495640_0027919 | |||
| 2746 | Ga0495640_0109575 | |||
| 2747 | Ga0495586_0006241 | |||
| 2748 | Ga0495586_0007424 | |||
| 2749 | Ga0495586_0097638 | |||
| 2750 | Ga0495587_0000043 | |||
| 2751 | Ga0495587_0003087 | |||
| 2752 | Ga0495587_0019862 | |||
| 2753 | Ga0495587_0044036 | |||
| 2754 | Ga0495587_0208000 | |||
| 2755 | Ga0495609_0069858 | |||
| 2756 | Ga0495645_0000275 | |||
| 2757 | Ga0495645_0000755 | |||
| 2758 | Ga0495645_0007548 | |||
| 2759 | Ga0495622_0005859 | |||
| 2760 | Ga0495633_0001157 | |||
| 2761 | Ga0495667_0000023 | |||
| 2762 | Ga0495667_0001576 | |||
| 2763 | Ga0495667_0002302 | |||
| 2764 | Ga0495667_0053686 | |||
| 2765 | Ga0495667_0067078 | |||
| 2766 | Ga0495667_0075895 | |||
| 2767 | Ga0495667_0088746 | |||
| 2768 | Ga0495656_0000359 | |||
| 2769 | Ga0495656_0038258 | |||
| 2770 | Ga0495634_0000049 | |||
| 2771 | Ga0495634_0009596 | |||
| 2772 | Ga0495634_0033367 | |||
| 2773 | Ga0495634_0054566 | |||
| 2774 | Ga0495634_0091956 | |||
| 2775 | Ga0495634_0110347 | |||
| 2776 | Ga0495634_0156386 | |||
| 2777 | Ga0495611_0002507 | |||
| 2778 | Ga0495611_0148129 | |||
| 2779 | Ga0495625_0087352 | |||
| 2780 | Ga0495635_0000021 | |||
| 2781 | Ga0495635_0001668 | |||
| 2782 | Ga0495635_0011446 | |||
| 2783 | Ga0495635_0064462 | |||
| 2784 | Ga0495659_0000813 | |||
| 2785 | Ga0495588_0011785 | |||
| 2786 | Ga0495657_0000063 | |||
| 2787 | Ga0495657_0006384 | |||
| 2788 | Ga0495657_0016328 | |||
| 2789 | Ga0495657_0034745 | |||
| 2790 | Ga0495657_0066003 | |||
| 2791 | Ga0495657_0124580 | |||
| 2792 | Ga0495657_0130300 | |||
| 2793 | Ga0495657_0179701 | |||
| 2794 | Ga0495599_0000001 | |||
| 2795 | Ga0495599_0002299 | |||
| 2796 | Ga0495599_0023249 | |||
| 2797 | Ga0495599_0174819 | |||
| 2798 | Ga0495623_0001477 | |||
| 2799 | Ga0495623_0005062 | |||
| 2800 | Ga0495623_0008538 | |||
| 2801 | Ga0495623_0050507 | |||
| 2802 | Ga0495646_0000007 | |||
| 2803 | Ga0495646_0003535 | |||
| 2804 | Ga0495646_0035326 | |||
| 2805 | Ga0495646_0050753 | |||
| 2806 | Ga0495647_0004212 | |||
| 2807 | Ga0495658_0000713 | |||
| 2808 | Ga0495658_0005516 | |||
| 2809 | Ga0495658_0200649 | |||
| 2810 | Ga0495658_0272559 | |||
| 2811 | Ga0495669_0100425 | |||
| 2812 | Ga0495613_0037875 | |||
| 2813 | Ga0495613_0048799 | |||
| 2814 | Ga0495613_0050643 | |||
| 2815 | Ga0495613_0071574 | |||
| 2816 | Ga0495613_0105310 | |||
| 2817 | Ga0495613_0144087 | |||
| 2818 | Ga0495613_0229010 | |||
| 2819 | Ga0495613_0252370 | |||
| 2820 | Ga0495624_0018677 | |||
| 2821 | Ga0495624_0021235 | |||
| 2822 | Ga0495624_0037168 | |||
| 2823 | Ga0495624_0166695 | |||
| 2824 | Ga0495624_0171008 | |||
| 2825 | Ga0495670_0004344 | |||
| 2826 | Ga0495670_0020357 | |||
| 2827 | Ga0495671_0111812 | |||
| 2828 | Ga0495649_0009260 | |||
| 2829 | Ga0495589_0109610 | |||
| 2830 | Ga0495600_0000206 | |||
| 2831 | Ga0495600_0222593 | |||
| 2832 | Ga0495581_0029390 | |||
| 2833 | Ga0495581_0039507 | |||
| 2834 | Ga0495581_0085314 | |||
| 2835 | Ga0495604_0000014 | |||
| 2836 | Ga0495604_0001877 | |||
| 2837 | Ga0495604_0010329 | |||
| 2838 | Ga0495604_0019348 | |||
| 2839 | Ga0495604_0034368 | |||
| 2840 | Ga0495604_0042569 | |||
| 2841 | Ga0495604_0148821 | |||
| 2842 | Ga0495604_0177369 | |||
| 2843 | Ga0495604_0256414 | |||
| 2844 | Ga0495674_0000014 | |||
| 2845 | Ga0495674_0001292 | |||
| 2846 | Ga0495674_0002324 | |||
| 2847 | Ga0495674_0055130 | |||
| 2848 | Ga0495674_0060717 | |||
| 2849 | Ga0495674_0111983 | |||
| 2850 | Ga0495674_0114693 | |||
| 2851 | Ga0495674_0126959 | |||
| 2852 | Ga0495674_0201952 | |||
| 2853 | Ga0495674_0268196 | |||
| 2854 | Ga0495674_0279885 | |||
| 2855 | Ga0495672_0001150 | |||
| 2856 | Ga0495676_0152147 | |||
| 2857 | Ga0495676_0201316 | |||
| 2858 | Ga0495680_0000636 | |||
| 2859 | Ga0495680_0004579 | |||
| 2860 | Ga0495680_0008334 | |||
| 2861 | Ga0495680_0009331 | |||
| 2862 | Ga0495680_0023694 | |||
| 2863 | Ga0495680_0045950 | |||
| 2864 | Ga0495680_0098463 | |||
| 2865 | Ga0495680_0296975 | |||
| 2866 | Ga0495675_0000327 | |||
| 2867 | Ga0495675_0001359 | |||
| 2868 | Ga0495675_0041954 | |||
| 2869 | Ga0495677_0022847 | |||
| 2870 | Ga0495677_0112342 | |||
| 2871 | Ga0495684_0000272 | |||
| 2872 | Ga0495684_0006153 | |||
| 2873 | Ga0495684_0009342 | |||
| 2874 | Ga0495684_0031447 | |||
| 2875 | Ga0495684_0057267 | |||
| 2876 | Ga0495684_0089256 | |||
| 2877 | Ga0495684_0202170 | |||
| 2878 | Ga0495686_0038011 | |||
| 2879 | Ga0495593_0005467 | |||
| 2880 | Ga0495593_0015589 | |||
| 2881 | Ga0495593_0015897 | |||
| 2882 | Ga0495593_0029935 | |||
| 2883 | Ga0495593_0033866 | |||
| 2884 | Ga0495593_0093175 | |||
| 2885 | Ga0495602_0000017 | |||
| 2886 | Ga0495602_0004680 | |||
| 2887 | Ga0495602_0004999 | |||
| 2888 | Ga0495602_0017445 | |||
| 2889 | Ga0495602_0045757 | |||
| 2890 | Ga0495626_0085806 | |||
| 2891 | Ga0496100_0000600 | |||
| 2892 | Ga0496100_0008700 | |||
| 2893 | Ga0496100_0029110 | |||
| 2894 | Ga0496100_0084207 | |||
| 2895 | Ga0496100_0111425 | |||
| 2896 | Ga0496100_0122365 | |||
| 2897 | Ga0496100_0170619 | |||
| 2898 | Ga0496100_0210005 | |||
| 2899 | Ga0496100_0273222 | |||
| 2900 | Ga0496101_0000728 | |||
| 2901 | Ga0496101_0002748 | |||
| 2902 | Ga0496101_0008638 | |||
| 2903 | Ga0496101_0017034 | |||
| 2904 | Ga0496101_0102046 | |||
| 2905 | Ga0496101_0170920 | |||
| 2906 | Ga0496101_0224303 | |||
| 2907 | Ga0496101_0244644 | |||
| 2908 | Ga0496102_0031318 | |||
| 2909 | Ga0496102_0039588 | |||
| 2910 | Ga0496102_0056005 | |||
| 2911 | Ga0496103_0026782 | |||
| 2912 | Ga0496103_0165887 | |||
| 2913 | Ga0496104_0000232 | |||
| 2914 | Ga0496104_0006145 | |||
| 2915 | Ga0496104_0009679 | |||
| 2916 | Ga0496104_0013139 | |||
| 2917 | Ga0496104_0013660 | |||
| 2918 | Ga0496104_0125842 | |||
| 2919 | Ga0496104_0144069 | |||
| 2920 | Ga0496104_0196424 | |||
| 2921 | Ga0496104_0243253 | |||
| 2922 | Ga0496104_0280481 | |||
| 2923 | Ga0496104_0395350 | |||
| 2924 | Ga0496104_0398342 | |||
| 2925 | Ga0496105_0000238 | |||
| 2926 | Ga0496105_0026627 | |||
| 2927 | Ga0496105_0031925 | |||
| 2928 | Ga0496105_0129240 | |||
| 2929 | Ga0496105_0139197 | |||
| 2930 | Ga0496105_0256180 | |||
| 2931 | Ga0496105_0285595 | |||
| 2932 | Ga0496106_0000327 | |||
| 2933 | Ga0496106_0009906 | |||
| 2934 | Ga0496106_0037629 | |||
| 2935 | Ga0496106_0270456 | |||
| 2936 | Ga0496106_0396024 | |||
| 2937 | Ga0496107_0000143 | |||
| 2938 | Ga0496107_0020506 | |||
| 2939 | Ga0496107_0072734 | |||
| 2940 | Ga0496107_0073616 | |||
| 2941 | Ga0496107_0130179 | |||
| 2942 | Ga0496107_0220134 | |||
| 2943 | Ga0496107_0312198 | |||
| 2944 | Ga0496108_0005300 | |||
| 2945 | Ga0496108_0012847 | |||
| 2946 | Ga0496108_0016193 | |||
| 2947 | Ga0496108_0039833 | |||
| 2948 | Ga0496108_0083557 | |||
| 2949 | Ga0496108_0138029 | |||
| 2950 | Ga0496108_0164549 | |||
| 2951 | Ga0496108_0285428 | |||
| 2952 | Ga0496109_0000372 | |||
| 2953 | Ga0496109_0003915 | |||
| 2954 | Ga0496109_0004434 | |||
| 2955 | Ga0496109_0006984 | |||
| 2956 | Ga0496109_0070126 | |||
| 2957 | Ga0496109_0126744 | |||
| 2958 | Ga0496109_0144816 | |||
| 2959 | Ga0496109_0210066 | |||
| 2960 | Ga0496109_0210168 | |||
| 2961 | Ga0496109_0214737 | |||
| 2962 | Ga0496109_0291272 | |||
| 2963 | Ga0496109_0383787 | |||
| 2964 | Ga0496110_0003733 | |||
| 2965 | Ga0496110_0008900 | |||
| 2966 | Ga0496110_0013311 | |||
| 2967 | Ga0496110_0132493 | |||
| 2968 | Ga0496110_0136649 | |||
| 2969 | Ga0496110_0221102 | |||
| 2970 | Ga0496110_0229669 | |||
| 2971 | Ga0496110_0234288 | |||
| 2972 | Ga0496110_0307005 | |||
| 2973 | Ga0496111_0001479 | |||
| 2974 | Ga0496111_0004912 | |||
| 2975 | Ga0496111_0010409 | |||
| 2976 | Ga0496111_0022166 | |||
| 2977 | Ga0496111_0024813 | |||
| 2978 | Ga0496111_0033040 | |||
| 2979 | Ga0496111_0042274 | |||
| 2980 | Ga0496111_0098938 | |||
| 2981 | Ga0496111_0255747 | |||
| 2982 | Ga0496111_0269618 | |||
| 2983 | Ga0496112_0002980 | |||
| 2984 | Ga0496112_0020629 | |||
| 2985 | Ga0496112_0175132 | |||
| 2986 | Ga0496112_0206458 | |||
| 2987 | Ga0496112_0365608 | |||
| 2988 | Ga0496112_0396274 | |||
| 2989 | Ga0496112_0426703 | |||
| 2990 | Ga0496113_0000259 | |||
| 2991 | Ga0496113_0022480 | |||
| 2992 | Ga0496113_0120348 | |||
| 2993 | Ga0496113_0225407 | |||
| 2994 | Ga0496113_0299520 | |||
| 2995 | Ga0496114_0004601 | |||
| 2996 | Ga0496114_0033513 | |||
| 2997 | Ga0496114_0035727 | |||
| 2998 | Ga0496114_0063483 | |||
| 2999 | Ga0496114_0111712 | |||
| 3000 | Ga0496114_0112697 | |||
| 3001 | Ga0496115_0000653 | |||
| 3002 | Ga0496115_0019005 | |||
| 3003 | Ga0496115_0167412 | |||
| 3004 | Ga0496115_0232304 | |||
| 3005 | Ga0496115_0256297 | |||
| 3006 | Ga0496116_0014048 | |||
| 3007 | Ga0496116_0074485 | |||
| 3008 | Ga0496117_0001890 | |||
| 3009 | Ga0496118_0003649 | |||
| 3010 | Ga0496118_0037905 | |||
| 3011 | Ga0496118_0073434 | |||
| 3012 | Ga0496120_0027659 | |||
| 3013 | Ga0496121_0002758 | |||
| 3014 | Ga0496121_0006036 | |||
| 3015 | Ga0496121_0024819 | |||
| 3016 | Ga0496121_0061833 | |||
| 3017 | Ga0496121_0221246 | |||
| 3018 | Ga0496122_0026905 | |||
| 3019 | Ga0496122_0072876 | |||
| 3020 | Ga0496123_0121479 | |||
| 3021 | Ga0496124_0037633 | |||
| 3022 | Ga0496125_0008218 | |||
| 3023 | Ga0496126_0030362 | |||
| 3024 | Ga0496126_0160180 | |||
| 3025 | Ga0501031_0025466 | |||
| 3026 | Ga0501031_0119463 | |||
| 3027 | Ga0501031_0191432 | |||
| 3028 | Ga0501032_0000435 | |||
| 3029 | Ga0501032_0003450 | |||
| 3030 | Ga0501032_0158663 | |||
| 3031 | Ga0501032_0178260 | |||
| 3032 | Ga0501033_0002280 | |||
| 3033 | Ga0501033_0067598 | |||
| 3034 | Ga0501033_0268964 | |||
| 3035 | Ga0501034_0000089 | |||
| 3036 | Ga0501034_0006067 | |||
| 3037 | Ga0501034_0010727 | |||
| 3038 | Ga0501034_0020731 | |||
| 3039 | Ga0501034_0021328 | |||
| 3040 | Ga0501034_0052744 | |||
| 3041 | Ga0501034_0099184 | |||
| 3042 | Ga0501034_0100761 | |||
| 3043 | Ga0501034_0113906 | |||
| 3044 | Ga0501034_0128398 | |||
| 3045 | Ga0501034_0316647 | |||
| 3046 | Ga0501034_0448226 | |||
| 3047 | Ga0501034_0528554 | |||
| 3048 | Ga0501034_0587642 | |||
| 3049 | Ga0501036_0007715 | |||
| 3050 | Ga0501036_0012537 | |||
| 3051 | Ga0501036_0015870 | |||
| 3052 | Ga0501036_0101331 | |||
| 3053 | Ga0501036_0105646 | |||
| 3054 | Ga0501036_0145030 | |||
| 3055 | Ga0501037_0018072 | |||
| 3056 | Ga0501037_0020234 | |||
| 3057 | Ga0501037_0046381 | |||
| 3058 | Ga0501037_0090076 | |||
| 3059 | Ga0501037_0305049 | |||
| 3060 | Ga0501038_0017332 | |||
| 3061 | Ga0501038_0056635 | |||
| 3062 | Ga0501038_0124419 | |||
| 3063 | Ga0501038_0183370 | |||
| 3064 | Ga0501038_0286587 | |||
| 3065 | Ga0501038_0295344 | |||
| 3066 | Ga0501038_0305636 | |||
| 3067 | Ga0501039_0016934 | |||
| 3068 | Ga0501039_0073847 | |||
| 3069 | Ga0501039_0108483 | |||
| 3070 | Ga0501043_0002335 | |||
| 3071 | Ga0501043_0002883 | |||
| 3072 | Ga0501043_0027922 | |||
| 3073 | Ga0501043_0042204 | |||
| 3074 | Ga0501043_0076456 | |||
| 3075 | Ga0501043_0182072 | |||
| 3076 | Ga0501043_0229649 | |||
| 3077 | Ga0501046_0032334 | |||
| 3078 | Ga0501046_0060006 | |||
| 3079 | Ga0501046_0302407 | |||
| 3080 | Ga0501047_0000108 | |||
| 3081 | Ga0501047_0005210 | |||
| 3082 | Ga0501047_0005643 | |||
| 3083 | Ga0501047_0020718 | |||
| 3084 | Ga0501047_0026864 | |||
| 3085 | Ga0501047_0035599 | |||
| 3086 | Ga0501047_0153246 | |||
| 3087 | Ga0501047_0164624 | |||
| 3088 | Ga0501047_0205650 | |||
| 3089 | Ga0501047_0629821 | |||
| 3090 | Ga0501048_0001627 | |||
| 3091 | Ga0501048_0001786 | |||
| 3092 | Ga0501048_0249331 | |||
| 3093 | Ga0501067_0003119 | |||
| 3094 | Ga0501067_0016484 | |||
| 3095 | Ga0501068_0018262 | |||
| 3096 | Ga0501068_0031880 | |||
| 3097 | Ga0501068_0071311 | |||
| 3098 | Ga0501068_0128193 | |||
| 3099 | Ga0501069_0004000 | |||
| 3100 | Ga0501069_0038216 | |||
| 3101 | Ga0501069_0039702 | |||
| 3102 | Ga0501070_0025261 | |||
| 3103 | Ga0501070_0027267 | |||
| 3104 | Ga0501070_0039394 | |||
| 3105 | Ga0501070_0081427 | |||
| 3106 | Ga0501070_0097377 | |||
| 3107 | Ga0501070_0386013 | |||
| 3108 | Ga0501071_0005716 | |||
| 3109 | Ga0501071_0030857 | |||
| 3110 | Ga0501072_0002592 | |||
| 3111 | Ga0501072_0004367 | |||
| 3112 | Ga0501072_0077680 | |||
| 3113 | Ga0501072_0186131 | |||
| 3114 | Ga0501073_0000019 | |||
| 3115 | Ga0501073_0002379 | |||
| 3116 | Ga0501073_0046698 | |||
| 3117 | Ga0501073_0107620 | |||
| 3118 | Ga0501073_0112921 | |||
| 3119 | Ga0501073_0182275 | |||
| 3120 | Ga0501073_0309232 | |||
| 3121 | Ga0501074_0013871 | |||
| 3122 | Ga0501074_0016822 | |||
| 3123 | Ga0501074_0059163 | |||
| 3124 | Ga0501074_0238044 | |||
| 3125 | Ga0501075_0279956 | |||
| 3126 | Ga0501076_0151753 | |||
| 3127 | Ga0501076_0291531 | |||
| 3128 | Ga0501077_0000035 | |||
| 3129 | Ga0501079_0014331 | |||
| 3130 | Ga0501079_0031812 | |||
| 3131 | Ga0501079_0039580 | |||
| 3132 | Ga0501080_0000045 | |||
| 3133 | Ga0501080_0000655 | |||
| 3134 | Ga0501080_0035718 | |||
| 3135 | Ga0501080_0057651 | |||
| 3136 | Ga0501080_0100394 | |||
| 3137 | Ga0501080_0107189 | |||
| 3138 | Ga0501080_0135330 | |||
| 3139 | Ga0501080_0139150 | |||
| 3140 | Ga0501080_0293651 | |||
| 3141 | Ga0501081_0045742 | |||
| 3142 | Ga0501081_0056833 | |||
| 3143 | Ga0501081_0214958 | |||
| 3144 | Ga0501081_0310762 | |||
| 3145 | Ga0501083_0002606 | |||
| 3146 | Ga0501083_0005531 | |||
| 3147 | Ga0501083_0015039 | |||
| 3148 | Ga0501083_0031690 | |||
| 3149 | Ga0501083_0070668 | |||
| 3150 | Ga0501083_0081626 | |||
| 3151 | Ga0501083_0113452 | |||
| 3152 | Ga0501083_0114793 | |||
| 3153 | Ga0501035_0001364 | |||
| 3154 | Ga0501035_0016145 | |||
| 3155 | Ga0501035_0018105 | |||
| 3156 | Ga0501035_0067679 | |||
| 3157 | Ga0501035_0167683 | |||
| 3158 | Ga0501035_0213324 | |||
| 3159 | Ga0501035_0406497 | |||
| 3160 | Ga0501044_0002199 | |||
| 3161 | Ga0501044_0002915 | |||
| 3162 | Ga0501044_0009512 | |||
| 3163 | Ga0501044_0015174 | |||
| 3164 | Ga0501044_0019836 | |||
| 3165 | Ga0501044_0031382 | |||
| 3166 | Ga0501044_0047827 | |||
| 3167 | Ga0501044_0084474 | |||
| 3168 | Ga0501044_0098536 | |||
| 3169 | Ga0501044_0100872 | |||
| 3170 | Ga0501044_0141831 | |||
| 3171 | Ga0501044_0273150 | |||
| 3172 | Ga0501044_0295854 | |||
| 3173 | Ga0501044_0524536 | |||
| 3174 | Ga0501044_0561278 | |||
| 3175 | Ga0501045_0093339 | |||
| 3176 | nmdc:mga03683_6131_c1 | |||
| 3177 | nmdc:mga03n38_4244_c1 | |||
| 3178 | nmdc:mga03n38_63567_c1 | |||
| 3179 | nmdc:mga00v17_4458_c1 | |||
| 3180 | nmdc:mga0yw44_41720_c1 | |||
| 3181 | nmdc:mga0yw44_4866_c1 | |||
| 3182 | nmdc:mga0yw44_72156_c1 | |||
| 3183 | nmdc:mga0k408_2007_c1 | |||
| 3184 | nmdc:mga0k408_29518_c1 | |||
| 3185 | nmdc:mga06z11_149781_c1 | |||
| 3186 | nmdc:mga06z11_159215_c1 | |||
| 3187 | nmdc:mga06z11_47995_c1 | |||
| 3188 | nmdc:mga06z11_71921_c1 | |||
| 3189 | nmdc:mga06z11_9696_c1 | |||
| 3190 | nmdc:mga05p37_11094_c1 | |||
| 3191 | nmdc:mga05p37_24149_c1 | |||
| 3192 | nmdc:mga05p37_24288_c1 | |||
| 3193 | nmdc:mga05p37_268746_c1 | |||
| 3194 | nmdc:mga05p37_46633_c1 | |||
| 3195 | nmdc:mga05p37_80697_c1 | |||
| 3196 | nmdc:mga09592_196019_c1 | |||
| 3197 | nmdc:mga09592_8496_c1 | |||
| 3198 | nmdc:mga0qj67_73155_c1 | |||
| 3199 | nmdc:mga06r32_316996_c1 | |||
| 3200 | nmdc:mga06r32_33762_c1 | |||
| 3201 | nmdc:mga06r32_442293_c1 | |||
| 3202 | nmdc:mga08y16_114053_c1 | |||
| 3203 | nmdc:mga08y16_145256_c1 | |||
| 3204 | nmdc:mga08y16_188752_c1 | |||
| 3205 | nmdc:mga08y16_3254_c1 | |||
| 3206 | nmdc:mga08y16_49190_c1 | |||
| 3207 | nmdc:mga08y16_7494_c1 | |||
| 3208 | nmdc:mga08y16_83519_c1 | |||
| 3209 | nmdc:mga0n895_118189_c1 | |||
| 3210 | nmdc:mga0n895_234151_c1 | |||
| 3211 | nmdc:mga0n895_31564_c1 | |||
| 3212 | nmdc:mga0n895_322663_c1 | |||
| 3213 | nmdc:mga0n895_382360_c1 | |||
| 3214 | nmdc:mga0n895_39649_c1 | |||
| 3215 | nmdc:mga0n895_484088_c1 | |||
| 3216 | nmdc:mga0rr50_178440_c1 | |||
| 3217 | nmdc:mga0rr50_178847_c1 | |||
| 3218 | nmdc:mga0rr50_2395_c1 | |||
| 3219 | nmdc:mga0rr50_26063_c1 | |||
| 3220 | nmdc:mga0rr50_56554_c1 | |||
| 3221 | nmdc:mga0rr50_69462_c1 | |||
| 3222 | nmdc:mga0rr50_79377_c1 | |||
| 3223 | nmdc:mga0a205_10762_c1 | |||
| 3224 | nmdc:mga0a205_1434_c1 | |||
| 3225 | nmdc:mga0a205_148336_c1 | |||
| 3226 | nmdc:mga0a205_37528_c1 | |||
| 3227 | nmdc:mga0a205_407287_c1 | |||
| 3228 | nmdc:mga0sz30_11526_c1 | |||
| 3229 | nmdc:mga0sz30_2397_c1 | |||
| 3230 | Ga0495601_0000016 | |||
| 3231 | Ga0495601_0000114 | |||
| 3232 | Ga0495601_0000315 | |||
| 3233 | Ga0495601_0008408 | |||
| 3234 | Ga0495601_0032962 | |||
| 3235 | Ga0495601_0049973 | |||
| 3236 | Ga0495601_0054419 | |||
| 3237 | Ga0495601_0080604 | |||
| 3238 | Ga0495601_0092159 | |||
| 3239 | Ga0495601_0199401 | |||
| 3240 | Ga0495612_0000056 | |||
| 3241 | Ga0495612_0000154 | |||
| 3242 | Ga0495612_0001726 | |||
| 3243 | Ga0495612_0002268 | |||
| 3244 | Ga0495612_0004956 | |||
| 3245 | Ga0495612_0023868 | |||
| 3246 | Ga0495612_0079755 | |||
| 3247 | Ga0495612_0101463 | |||
| 3248 | Ga0495655_0027909 | |||
| 3249 | Ga0495595_0000032 | |||
| 3250 | Ga0495595_0005189 | |||
| 3251 | Ga0495595_0005799 | |||
| 3252 | Ga0495595_0009928 | |||
| 3253 | Ga0495595_0011977 | |||
| 3254 | Ga0495595_0021898 | |||
| 3255 | Ga0495595_0102244 | |||
| 3256 | Ga0495619_0000033 | |||
| 3257 | Ga0495619_0000206 | |||
| 3258 | Ga0495619_0001397 | |||
| 3259 | Ga0495619_0002416 | |||
| 3260 | Ga0495619_0003323 | |||
| 3261 | Ga0495619_0004683 | |||
| 3262 | Ga0495619_0004828 | |||
| 3263 | Ga0495619_0011415 | |||
| 3264 | Ga0495619_0018328 | |||
| 3265 | Ga0495619_0023944 | |||
| 3266 | Ga0500643_000014 | |||
| 3267 | Ga0500643_008687 | |||
| 3268 | Ga0500643_021179 | |||
| 3269 | Ga0500644_0001168 | |||
| 3270 | Ga0500646_0034154 | |||
| 3271 | Ga0500651_0203450 | |||
| 3272 | Ga0500641_0018054 | |||
| 3273 | Ga0500641_0019245 | |||
| 3274 | Ga0500592_008051 | |||
| 3275 | Ga0500593_034271 | |||
| 3276 | Ga0500595_000001 | |||
| 3277 | Ga0500595_014074 | |||
| 3278 | Ga0500595_031287 | |||
| 3279 | Ga0500614_007698 | |||
| 3280 | Ga0500652_000198 | |||
| 3281 | Ga0500652_008290 | |||
| 3282 | Ga0500568_0010093 | |||
| 3283 | Ga0500568_0019795 | |||
| 3284 | Ga0500568_0042182 | |||
| 3285 | Ga0500590_000069 | |||
| 3286 | Ga0500616_0000001 | |||
| 3287 | Ga0500616_0029769 | |||
| 3288 | Ga0500622_0002923 | |||
| 3289 | Ga0500645_001721 | |||
| 3290 | Ga0500645_049098 | |||
| 3291 | Ga0501084_0065110 | |||
| 3292 | Ga0501084_0116070 | |||
| 3293 | Ga0501084_0122937 | |||
| 3294 | Ga0501084_0229387 | |||
| 3295 | Ga0501082_0000028 | |||
| 3296 | Ga0501082_0009479 | |||
| 3297 | Ga0501082_0110937 | |||
| 3298 | Ga0501082_0154198 | |||
| 3299 | Ga0501082_0235725 | |||
| 3300 | Ga0501082_0331571 | |||
| 3301 | Ga0530510_0011090 | |||
| 3302 | 2524458028 | |||
| 3303 | 2528851283 | |||
| 3304 | 2537873416 | |||
| 3305 | 2585330479 | |||
| 3306 | 2599604432 | |||
| 3307 | 2643758072 | |||
| 3308 | 2824663837 | |||
| 3309 | 2842299790 | |||
| 3310 | 2842359688 | |||
| 3311 | 2842698106 | |||
| 3312 | 2879085824 | |||
| 3313 | 2879108643 | |||
| 3314 | 2899794492 | |||
| 3315 | 2908776167 | |||
| 3316 | 2922378711 | |||
| 3317 | 2932786696 | |||
| 3318 | 2932812260 | |||
| 3319 | 2932823251 | |||
| 3320 | 2932829909 | |||
| 3321 | 2935618427 | |||
| 3322 | 2935641175 | |||
| 3323 | 2935670091 | |||
| 3324 | 2935680915 | |||
| 3325 | 2935689930 | |||
| 3326 | 2935698451 | |||
| 3327 | 2935707593 | |||
| 3328 | 2935717449 | |||
| 3329 | 2935723881 | |||
| 3330 | 2935740090 | |||
| 3331 | 2935749353 | |||
| 3332 | 2935757284 | |||
| 3333 | 2935763630 | |||
| 3334 | 2935804019 | |||
| 3335 | 2935815113 | |||
| 3336 | 2935830906 | |||
| 3337 | 2935841516 | |||
| 3338 | 2935862478 | |||
| 3339 | 2935866594 | |||
| 3340 | 2935874901 | |||
| 3341 | 2935994407 | |||
| 3342 | 2936004615 | |||
| 3343 | 2936043180 | |||
| 3344 | 2940563197 | |||
| 3345 | 2941543114 | |||
| 3346 | 3003931568 | |||
| 3347 | 3005486813 | |||
| 3348 | 8017058370 | |||
| 3349 | 8019577331 | |||
| 3350 | 8019595413 | |||
| 3351 | 8019612185 | |||
| 3352 | 8024491736 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8e73-assembly1.cif.gz_A9 | vigna radiata supercomplex i+iii2 (full bridge) | 0.95 | 9 | 314 |
| 7r4f-assembly1.cif.gz_P | bovine complex i in the presence of im1761092, slack class i (composite map) | 0.9463 | 9 | 313 |
| 7r41-assembly1.cif.gz_P | bovine complex i in the presence of im1761092, active class i (composite map) | 0.9457 | 9 | 314 |
| 6zkg-assembly1.cif.gz_d | complex i with nadh, closed | 0.9457 | 9 | 314 |
| 5xtb-assembly1.cif.gz_J | cryo-em structure of human respiratory complex i matrix arm | 0.9431 | 9 | 314 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9SK66_71_329_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9653 | 12 | 260 | 3.40.50.720 |
| af_Q559Z0_43_331_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9542 | 13 | 301 | 3.40.50.720 |
| af_Q9DC69_47_264_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9524 | 9 | 215 | 3.40.50.720 |
| af_Q559Z0_43_331_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9445 | 13 | 301 | 3.40.50.720 |
| af_Q4DU32_30_254_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9371 | 9 | 219 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V3KSF4-F1-model_v4 | Complex I NDUFA9 subunit family protein | 0.9928 | 60 | 156 |
GO:0044877
GO:1901006 |
| AF-A0A2N3CM24-F1-model_v4 | Complex I NDUFA9 subunit family protein | 0.992 | 9 | 151 |
GO:0044877
GO:1901006 |
| AF-A0A355VXT9-F1-model_v4 | Complex I NDUFA9 subunit family protein | 0.9819 | 8 | 313 |
GO:0044877
GO:1901006 |
| AF-A0A4Q3YF92-F1-model_v4 | Complex I NDUFA9 subunit family protein | 0.9779 | 9 | 241 |
GO:0044877
GO:1901006 |
| AF-C0F8L7-F1-model_v4 | deleted | 0.9754 | 9 | 200 |
|