F495228

General Info

Members Datasets Scaffolds Average Seq Length
1655 555 1557 381

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0165760|Ga0496102_0165760_274_1602
Length 442
Sequence VDVDEAGLGCVVGHLGSLGPGGPWSSSHGSSRTSGFAAQGTAALADPDGPTPDVPTQLNLMTMRALFEDEHEQFRETVRRFIEKEMAPNFDRWEAAGVADREMYRKAGEIGLLGMAVPEQYGGGGVDDFRYNLVILEEVQRAGMGGAGLGITLHNDIVLPYFLTYCDDAQRDRWLPGIVSGDLITAIAMTEPGIGSDLASMSTSAIRDGDDYVVNGAKTFITNGINSDLVVTAVKTDPSERHRGISLLVLERGMEGFERGRNLAKVGMHSQDTAELFFTDVRVPVANRLGLEGDGFRYLVSNLPQERLSIAASGVAAARAALDWTLEYTKERRAFGQPINSFQHSRFVLAEMATEVEIGQTFVDACVLELNAGTLTAEKAAMAKWWCTELQKRAVDHGVQLHGGYGYMTEYPIARAYTDARVTTIYGGTTEIMKEIIGRSLA

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2506783011 Frankia datiscae Dg1 Isolate Nodule
3 2508501039 Frankia saprophytica CN3 Isolate Nodule
4 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
5 2547132424 Nocardia nova SH22a Isolate Unclassified
6 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
7 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
8 2626541554 Frankia sp. AvcI.1 Isolate Nodule
9 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
10 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
11 2671180195 Frankia sp. CcI49 Isolate Nodule
12 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
13 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
14 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
15 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
16 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
17 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
18 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
19 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
20 2738543010 Bacillus sp. YR335 Isolate Unclassified
21 2738543017 Bacillus sp. OV186 Isolate Unclassified
22 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
23 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
24 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
25 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
26 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
27 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
28 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
29 2773857922 Frankia sp. CcI49 Isolate Nodule
30 2773857933 Frankia sp. BMG5.30 Isolate Nodule
31 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
32 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
33 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
34 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
35 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
36 2842682962 Bacillus sp. R-72492 Isolate Unclassified
37 2849139964 Bacillus sp. R-71875 Isolate Unclassified
38 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
39 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
40 2857581216 Bacillus sp. R-71922 Isolate Unclassified
41 2857586860 Bacillus sp. R-71935 Isolate Unclassified
42 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
43 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
44 2862574272 Streptomyces sp. AcE210 Isolate Nodule
45 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
46 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
47 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
48 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
49 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
50 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
51 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
52 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
53 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
54 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
55 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
56 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
57 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
58 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
59 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
60 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
61 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
62 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
63 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
64 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
65 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
66 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
67 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
68 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
69 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
70 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
71 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
72 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
73 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
74 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
75 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
76 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
77 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
78 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
80 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
81 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
82 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
83 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
84 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
85 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
86 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
87 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
88 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
89 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
90 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
91 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
92 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
93 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
94 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
95 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
96 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
97 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
98 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
99 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
100 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
101 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
102 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
103 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
104 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
105 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
106 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
107 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
108 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
109 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
110 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
111 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
112 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
113 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
114 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
115 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
116 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
117 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
118 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
119 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
120 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
121 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
122 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
123 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
124 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
125 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
126 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
127 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
128 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
129 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
130 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
131 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
132 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
133 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
134 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
135 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
136 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
137 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
138 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
139 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
140 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
141 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
142 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
143 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
144 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
145 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
146 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
147 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
148 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
149 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
150 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
151 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
152 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
153 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
154 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
155 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
156 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
157 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
158 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
159 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
160 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
161 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
162 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
163 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
164 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
165 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
166 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
167 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
168 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
169 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
170 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
171 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
172 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
173 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
174 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
175 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
176 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
177 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
178 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
179 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
180 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
181 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
182 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
183 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
184 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
185 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
186 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
187 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
188 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
189 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
190 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
191 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
192 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
193 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
194 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
195 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
196 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
197 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
198 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
199 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
200 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
201 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
202 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
203 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
204 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
205 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
206 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
207 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
208 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
209 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
210 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
211 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
212 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
213 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
214 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
215 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
216 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
217 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
218 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
219 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
220 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
221 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
222 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
223 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
224 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
229 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
292 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
296 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
297 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
298 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
299 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
300 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
301 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
304 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
305 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
306 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
307 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
308 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
309 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
310 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
311 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
312 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
313 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
314 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
315 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
316 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
317 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
318 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
319 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
320 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
321 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
322 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
323 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
324 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
325 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
326 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
327 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
328 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
329 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
330 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
331 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
332 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
333 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
334 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
335 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
336 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
337 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
338 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
339 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
340 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
341 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
342 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
343 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
344 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
345 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
346 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
347 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
348 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
349 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
350 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
351 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
352 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
353 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
354 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
355 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
356 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
357 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
358 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
359 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
360 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
361 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
362 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
363 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
364 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
365 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
366 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
367 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
368 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
369 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
370 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
371 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
372 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
373 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
374 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
375 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
376 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
377 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
378 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
379 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
380 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
381 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
382 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
383 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
384 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
385 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
386 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
387 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
388 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
389 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
390 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
391 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
392 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
393 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
394 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
395 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
396 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
397 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
398 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
399 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
400 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
401 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
402 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
403 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
404 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
405 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
406 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
407 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
408 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
409 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
410 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
411 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
412 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
413 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
414 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
415 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
416 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
417 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
418 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
419 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
420 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
421 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
422 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
423 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
424 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
425 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
426 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
427 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
428 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
429 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
430 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
431 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
432 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
433 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
434 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
435 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
436 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
437 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
438 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
439 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
440 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
441 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
442 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
443 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
444 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
445 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
446 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
447 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
448 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
449 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
450 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
451 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
452 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
453 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
454 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
455 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
456 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
457 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
458 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
459 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
460 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
461 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
462 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
463 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
464 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
465 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
466 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
467 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
468 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
469 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
470 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
471 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
472 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
473 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
474 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
475 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
476 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
477 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
479 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
481 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
482 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
483 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
484 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
487 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
488 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
489 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
490 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
491 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
492 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
493 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
494 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
495 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
496 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
497 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
498 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
499 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
500 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
501 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
502 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
503 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
504 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
505 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
506 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
507 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
508 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
509 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
510 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
511 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
512 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
513 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
514 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
515 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
516 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
517 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
518 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
519 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
520 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
521 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
522 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
523 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
524 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
525 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
526 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
527 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
528 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
529 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
530 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
531 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
532 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
533 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
534 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
535 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
536 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
537 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
538 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
539 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
540 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
541 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
542 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
543 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
544 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
545 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
546 649633069 Micromonospora sp. L5 Isolate Unclassified
547 8002775197 Frankia nepalensis CN7 Isolate Nodule
548 8022792930 Bacillus sp. Xin Isolate Rhizosphere
549 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
550 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
551 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
552 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
553 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
554 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
555 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.23
Metatranscriptomes 0.91
Isolates 5.86

Biome Distribution

Category Percentage (%)
Aerial Root 0.06
Bulb 0
Endosphere 3.32
Nodule 0.79
Rhizoplane 5.86
Rhizosphere 82.84
Stem 0
Stem Tuber 0
Unclassified 7.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1005422 3300000549 Bacteria 1620
2 JGI24752J21851_1000031 3300001976 Bacteria 16764
3 JGI25151J46595_10001297 3300003187 Bacteria 17528
4 JGI25151J46595_10001914 3300003187 Bacteria 13217
5 JGI25151J46595_10002376 3300003187 Bacteria 11424
6 JGI25151J46595_10003056 3300003187 Bacteria 9468
7 JGI25151J46595_10003287 3300003187 Bacteria 8984
8 JGI25151J46595_10018537 3300003187 Bacteria 2984
9 JGI25406J46586_10000099 3300003203 Bacteria 38165
10 JGI25406J46586_10001854 3300003203 Bacteria 9929
11 rootH1_10192437 3300003316 Bacteria 1430
12 Ga0006562J51391_1016962 3300003578 Bacteria 1857
13 Ga0006562J51391_1041968 3300003578 Bacteria 1291
14 Ga0055538_1000283 3300003751 Bacteria 25962
15 Ga0055532_1000229 3300003758 Bacteria 42014
16 Ga0055536_1022910 3300003781 Bacteria 1849
17 Ga0058692_1000001 3300003856 Bacteria 834230
18 Ga0058692_1000063 3300003856 Bacteria 93069
19 Ga0065714_10080014 3300005288 Bacteria 2471
20 Ga0065704_10003837 3300005289 Bacteria 4474
21 Ga0065704_10010176 3300005289 Bacteria 2830
22 Ga0065704_10077027 3300005289 Bacteria 4883
23 Ga0065707_10084189 3300005295 Bacteria 7555
24 Ga0065707_10118720 3300005295 Bacteria 2178
25 Ga0070658_10026316 3300005327 Bacteria 4666
26 Ga0070676_10041771 3300005328 Bacteria 2660
27 Ga0070676_10099977 3300005328 Bacteria 1790
28 Ga0070683_100007853 3300005329 Bacteria 9036
29 Ga0070683_100024318 3300005329 Bacteria 5425
30 Ga0070683_100254800 3300005329 Bacteria 1669
31 Ga0070690_100027158 3300005330 Bacteria 3537
32 Ga0070690_100171394 3300005330 Bacteria 1494
33 Ga0070670_100000072 3300005331 Bacteria 102029
34 Ga0070670_100119174 3300005331 Bacteria 2276
35 Ga0070670_100144088 3300005331 Bacteria 2061
36 Ga0070677_10023288 3300005333 Bacteria 2292
37 Ga0068869_100028234 3300005334 Bacteria 3920
38 Ga0068869_100081247 3300005334 Bacteria 2420
39 Ga0070666_10050020 3300005335 Bacteria 2811
40 Ga0070666_10129546 3300005335 Bacteria 1752
41 Ga0070680_100000261 3300005336 Bacteria 34740
42 Ga0070680_100017787 3300005336 Bacteria 5607
43 Ga0070680_100069143 3300005336 Bacteria 2899
44 Ga0070680_100107679 3300005336 Bacteria 2318
45 Ga0070680_100240839 3300005336 Bacteria 1529
46 Ga0068868_100002141 3300005338 Bacteria 13628
47 Ga0068868_100019874 3300005338 Bacteria 5038
48 Ga0070660_100012370 3300005339 Bacteria 6092
49 Ga0070660_100026559 3300005339 Bacteria 4312
50 Ga0070660_100224956 3300005339 Bacteria 1526
51 Ga0070689_100036774 3300005340 Bacteria 3743
52 Ga0070691_10011061 3300005341 Bacteria 4122
53 Ga0070691_10033980 3300005341 Bacteria 2399
54 Ga0070687_100018616 3300005343 Bacteria 3216
55 Ga0070687_100055083 3300005343 Bacteria 2075
56 Ga0070687_100058624 3300005343 Bacteria 2023
57 Ga0070661_100068424 3300005344 Bacteria 2609
58 Ga0070661_100097130 3300005344 Bacteria 2187
59 Ga0070692_10071974 3300005345 Bacteria 1843
60 Ga0070668_100001049 3300005347 Bacteria 19395
61 Ga0070668_100005680 3300005347 Bacteria 9248
62 Ga0070668_100057236 3300005347 Bacteria 3012
63 Ga0070668_100087008 3300005347 Bacteria 2458
64 Ga0070669_100005928 3300005353 Bacteria 8817
65 Ga0070669_100016997 3300005353 Bacteria 5194
66 Ga0070669_100050975 3300005353 Bacteria 3024
67 Ga0070669_100113457 3300005353 Bacteria 2059
68 Ga0070675_100000935 3300005354 Bacteria 20796
69 Ga0070675_100028702 3300005354 Bacteria 4479
70 Ga0070671_100000969 3300005355 Bacteria 21018
71 Ga0070671_100015123 3300005355 Bacteria 6233
72 Ga0070671_100019608 3300005355 Bacteria 5506
73 Ga0070671_100027586 3300005355 Bacteria 4675
74 Ga0070671_100118565 3300005355 Bacteria 2226
75 Ga0070674_100027421 3300005356 Bacteria 3732
76 Ga0070673_100031261 3300005364 Bacteria 3993
77 Ga0070673_100051522 3300005364 Bacteria 3225
78 Ga0070688_100048884 3300005365 Bacteria 2630
79 Ga0070659_100003482 3300005366 Bacteria 11205
80 Ga0070659_100073290 3300005366 Bacteria 2725
81 Ga0070659_100140338 3300005366 Bacteria 1967
82 Ga0070667_100000746 3300005367 Bacteria 31099
83 Ga0070667_100012821 3300005367 Bacteria 6927
84 Ga0070667_100021378 3300005367 Bacteria 5373
85 Ga0070703_10013487 3300005406 Bacteria 2322
86 Ga0070709_10000727 3300005434 Bacteria 18619
87 Ga0070709_10001186 3300005434 Bacteria 14341
88 Ga0070709_10001840 3300005434 Bacteria 11510
89 Ga0070709_10014473 3300005434 Bacteria 4463
90 Ga0070709_10052770 3300005434 Bacteria 2557
91 Ga0070709_10063900 3300005434 Bacteria 2352
92 Ga0070709_10168283 3300005434 Bacteria 1529
93 Ga0070714_100000601 3300005435 Bacteria 25736
94 Ga0070714_100007663 3300005435 Bacteria 8407
95 Ga0070714_100034070 3300005435 Bacteria 4263
96 Ga0070714_100057419 3300005435 Bacteria 3332
97 Ga0070713_100008515 3300005436 Bacteria 7279
98 Ga0070713_100020320 3300005436 Bacteria 5089
99 Ga0070713_100053270 3300005436 Bacteria 3352
100 Ga0070713_100061729 3300005436 Bacteria 3136
101 Ga0070713_100075790 3300005436 Bacteria 2854
102 Ga0070713_100099046 3300005436 Bacteria 2521
103 Ga0070713_100141823 3300005436 Bacteria 2129
104 Ga0070710_10000225 3300005437 Bacteria 26402
105 Ga0070710_10000234 3300005437 Bacteria 25949
106 Ga0070710_10000408 3300005437 Bacteria 20191
107 Ga0070710_10004952 3300005437 Bacteria 6303
108 Ga0070710_10024459 3300005437 Bacteria 3186
109 Ga0070710_10039025 3300005437 Bacteria 2611
110 Ga0070710_10040416 3300005437 Bacteria 2571
111 Ga0070711_100000428 3300005439 Bacteria 21935
112 Ga0070711_100000526 3300005439 Bacteria 19854
113 Ga0070711_100001089 3300005439 Bacteria 14524
114 Ga0070711_100001574 3300005439 Bacteria 12551
115 Ga0070711_100032364 3300005439 Bacteria 3476
116 Ga0070705_100012199 3300005440 Bacteria 4362
117 Ga0070705_100043448 3300005440 Bacteria 2575
118 Ga0070705_100052962 3300005440 Bacteria 2373
119 Ga0070700_100002856 3300005441 Bacteria 8860
120 Ga0070694_100029011 3300005444 Bacteria 3607
121 Ga0070694_100065923 3300005444 Bacteria 2483
122 Ga0070708_100004853 3300005445 Bacteria 10615
123 Ga0070663_100001262 3300005455 Bacteria 13900
124 Ga0070663_100002450 3300005455 Bacteria 10453
125 Ga0070678_100068784 3300005456 Bacteria 2641
126 Ga0070662_100037024 3300005457 Bacteria 3456
127 Ga0070662_100123912 3300005457 Bacteria 1984
128 Ga0070681_10000079 3300005458 Bacteria 71936
129 Ga0070681_10057401 3300005458 Bacteria 3873
130 Ga0070681_10077913 3300005458 Bacteria 3271
131 Ga0070681_10186803 3300005458 Bacteria 1993
132 Ga0070681_10240551 3300005458 Bacteria 1724
133 Ga0070685_10203052 3300005466 Bacteria 1289
134 Ga0070706_100001191 3300005467 Bacteria 27870
135 Ga0070706_100012100 3300005467 Bacteria 8008
136 Ga0070706_100023248 3300005467 Bacteria 5710
137 Ga0070706_100023878 3300005467 Bacteria 5630
138 Ga0070706_100117704 3300005467 Bacteria 2475
139 Ga0070707_100000563 3300005468 Bacteria 37248
140 Ga0070707_100001915 3300005468 Bacteria 19953
141 Ga0070707_100009169 3300005468 Bacteria 9180
142 Ga0070707_100015399 3300005468 Bacteria 7175
143 Ga0070707_100024691 3300005468 Bacteria 5695
144 Ga0070707_100042973 3300005468 Bacteria 4327
145 Ga0070707_100109691 3300005468 Bacteria 2676
146 Ga0070707_100133074 3300005468 Bacteria 2419
147 Ga0070707_100169209 3300005468 Bacteria 2130
148 Ga0070698_100000280 3300005471 Bacteria 51955
149 Ga0070698_100000592 3300005471 Bacteria 38966
150 Ga0070698_100000647 3300005471 Bacteria 37248
151 Ga0070698_100006462 3300005471 Bacteria 12717
152 Ga0070698_100008349 3300005471 Bacteria 11193
153 Ga0070698_100013896 3300005471 Bacteria 8516
154 Ga0070698_100017952 3300005471 Bacteria 7451
155 Ga0070698_100083485 3300005471 Bacteria 3183
156 Ga0070698_100093440 3300005471 Bacteria 2987
157 Ga0070699_100000149 3300005518 Bacteria 66121
158 Ga0070699_100268449 3300005518 Bacteria 1527
159 Ga0070679_100000056 3300005530 Bacteria 83790
160 Ga0070679_100019580 3300005530 Bacteria 6585
161 Ga0070684_100004005 3300005535 Bacteria 11150
162 Ga0070684_100071856 3300005535 Bacteria 3045
163 Ga0070684_100086865 3300005535 Bacteria 2776
164 Ga0070684_100134362 3300005535 Bacteria 2233
165 Ga0070684_100154934 3300005535 Bacteria 2077
166 Ga0070684_100183608 3300005535 Bacteria 1902
167 Ga0070697_100000222 3300005536 Bacteria 46798
168 Ga0070697_100119837 3300005536 Bacteria 2200
169 Ga0070697_100250938 3300005536 Bacteria 1513
170 Ga0068853_100042114 3300005539 Bacteria 3903
171 Ga0068853_100234628 3300005539 Bacteria 1679
172 Ga0068853_100298155 3300005539 Bacteria 1489
173 Ga0070672_100010102 3300005543 Bacteria 6536
174 Ga0070686_100024100 3300005544 Bacteria 3645
175 Ga0070695_100004596 3300005545 Bacteria 8100
176 Ga0070695_100032163 3300005545 Bacteria 3279
177 Ga0070695_100081324 3300005545 Bacteria 2143
178 Ga0070695_100193948 3300005545 Bacteria 1447
179 Ga0070696_100010621 3300005546 Bacteria 6167
180 Ga0070696_100045553 3300005546 Bacteria 3039
181 Ga0070696_100052323 3300005546 Bacteria 2841
182 Ga0070693_100009751 3300005547 Bacteria 4785
183 Ga0070693_100011397 3300005547 Bacteria 4478
184 Ga0070693_100040158 3300005547 Bacteria 2625
185 Ga0070665_100055258 3300005548 Bacteria 3982
186 Ga0070665_100318480 3300005548 Bacteria 1559
187 Ga0070665_100425573 3300005548 Bacteria 1336
188 Ga0070704_100035963 3300005549 Bacteria 3370
189 Ga0070704_100051187 3300005549 Bacteria 2907
190 Ga0070704_100056813 3300005549 Bacteria 2780
191 Ga0070704_100074806 3300005549 Bacteria 2472
192 Ga0070704_100077506 3300005549 Bacteria 2435
193 Ga0068855_100007525 3300005563 Bacteria 13183
194 Ga0070664_100000402 3300005564 Bacteria 32165
195 Ga0070664_100014689 3300005564 Bacteria 6394
196 Ga0070664_100215100 3300005564 Bacteria 1718
197 Ga0068857_100010684 3300005577 Bacteria 7986
198 Ga0068857_100028644 3300005577 Bacteria 4914
199 Ga0068857_100077797 3300005577 Bacteria 2960
200 Ga0068857_100095592 3300005577 Bacteria 2662
201 Ga0068857_100125796 3300005577 Bacteria 2309
202 Ga0068854_100002153 3300005578 Bacteria 12088
203 Ga0068854_100009528 3300005578 Bacteria 6269
204 Ga0068856_100018569 3300005614 Bacteria 6738
205 Ga0068856_100029701 3300005614 Bacteria 5340
206 Ga0068856_100096372 3300005614 Bacteria 2947
207 Ga0070702_100031728 3300005615 Bacteria 2893
208 Ga0070702_100104153 3300005615 Bacteria 1746
209 Ga0070702_100150879 3300005615 Bacteria 1492
210 Ga0068852_100021347 3300005616 Bacteria 5169
211 Ga0068852_100036367 3300005616 Bacteria 4119
212 Ga0068852_100081232 3300005616 Bacteria 2877
213 Ga0068852_100220995 3300005616 Bacteria 1801
214 Ga0068859_100013427 3300005617 Bacteria 8212
215 Ga0068859_100095026 3300005617 Bacteria 3033
216 Ga0068859_100104974 3300005617 Bacteria 2885
217 Ga0068859_100116526 3300005617 Bacteria 2736
218 Ga0068859_100143667 3300005617 Bacteria 2460
219 Ga0068864_100000019 3300005618 Bacteria 271650
220 Ga0068864_100000038 3300005618 Bacteria 181005
221 Ga0068864_100022161 3300005618 Bacteria 5326
222 Ga0068864_100055644 3300005618 Bacteria 3416
223 Ga0068864_100095729 3300005618 Bacteria 2626
224 Ga0068866_10023473 3300005718 Bacteria 2871
225 Ga0068866_10030458 3300005718 Bacteria 2590
226 Ga0068861_100005613 3300005719 Bacteria 8504
227 Ga0068861_100036062 3300005719 Bacteria 3667
228 Ga0068861_100224450 3300005719 Bacteria 1590
229 Ga0068870_10044825 3300005840 Bacteria 2312
230 Ga0068870_10160202 3300005840 Bacteria 1334
231 Ga0068863_100000026 3300005841 Bacteria 185590
232 Ga0068863_100000104 3300005841 Bacteria 90766
233 Ga0068863_100023034 3300005841 Bacteria 5952
234 Ga0068863_100026479 3300005841 Bacteria 5532
235 Ga0068863_100038287 3300005841 Bacteria 4562
236 Ga0068863_100055667 3300005841 Bacteria 3745
237 Ga0068863_100078450 3300005841 Bacteria 3127
238 Ga0068858_100000061 3300005842 Bacteria 113998
239 Ga0068858_100009842 3300005842 Bacteria 9090
240 Ga0068858_100018641 3300005842 Bacteria 6497
241 Ga0068858_100293361 3300005842 Bacteria 1550
242 Ga0068860_100025917 3300005843 Bacteria 5657
243 Ga0068860_100144017 3300005843 Bacteria 2292
244 Ga0068860_100156066 3300005843 Bacteria 2199
245 Ga0068862_100000279 3300005844 Bacteria 56941
246 Ga0068862_100005914 3300005844 Bacteria 10187
247 Ga0068862_100018828 3300005844 Bacteria 5754
248 Ga0081455_10006019 3300005937 Bacteria 13143
249 Ga0081455_10010606 3300005937 Bacteria 9323
250 Ga0081455_10012222 3300005937 Bacteria 8573
251 Ga0081455_10040682 3300005937 Bacteria 4097
252 Ga0081455_10100803 3300005937 Bacteria 2319
253 Ga0081455_10205544 3300005937 Bacteria 1471
254 Ga0081538_10001179 3300005981 Bacteria 27583
255 Ga0081540_1001050 3300005983 Bacteria 24617
256 Ga0081540_1001110 3300005983 Bacteria 23850
257 Ga0081540_1002720 3300005983 Bacteria 14387
258 Ga0081539_10000183 3300005985 Bacteria 148051
259 Ga0081539_10003736 3300005985 Bacteria 18107
260 Ga0081539_10013047 3300005985 Bacteria 6302
261 Ga0081539_10155366 3300005985 Bacteria 1096
262 Ga0070717_10001939 3300006028 Bacteria 14431
263 Ga0070717_10020874 3300006028 Bacteria 5157
264 Ga0070717_10051249 3300006028 Bacteria 3396
265 Ga0070717_10058473 3300006028 Bacteria 3188
266 Ga0070717_10065448 3300006028 Bacteria 3022
267 Ga0070717_10090203 3300006028 Bacteria 2586
268 Ga0070717_10127910 3300006028 Bacteria 2182
269 Ga0070717_10145010 3300006028 Bacteria 2050
270 Ga0075365_10021633 3300006038 Bacteria 4015
271 Ga0075365_10034701 3300006038 Bacteria 3259
272 Ga0075365_10042756 3300006038 Bacteria 2964
273 Ga0075365_10047169 3300006038 Bacteria 2831
274 Ga0075365_10145120 3300006038 Bacteria 1649
275 Ga0075364_10054781 3300006051 Bacteria 2608
276 Ga0070715_10008016 3300006163 Bacteria 3663
277 Ga0070715_10022431 3300006163 Bacteria 2462
278 Ga0070716_100001419 3300006173 Bacteria 10643
279 Ga0070716_100009855 3300006173 Bacteria 4775
280 Ga0070716_100041749 3300006173 Bacteria 2557
281 Ga0070716_100134387 3300006173 Bacteria 1568
282 Ga0070716_100152432 3300006173 Bacteria 1488
283 Ga0070712_100000151 3300006175 Bacteria 37005
284 Ga0070712_100018301 3300006175 Bacteria 4548
285 Ga0070712_100077823 3300006175 Bacteria 2392
286 Ga0070712_100078117 3300006175 Bacteria 2388
287 Ga0070712_100118895 3300006175 Bacteria 1985
288 Ga0070712_100136035 3300006175 Bacteria 1868
289 Ga0097621_100056583 3300006237 Bacteria 3204
290 Ga0075370_10004043 3300006353 Bacteria 7051
291 Ga0075370_10100818 3300006353 Bacteria 1671
292 Ga0068871_100039518 3300006358 Bacteria 3776
293 Ga0068871_100092724 3300006358 Bacteria 2519
294 Ga0075428_100171501 3300006844 Bacteria 2351
295 Ga0075428_100464928 3300006844 Bacteria 1354
296 Ga0075428_100483770 3300006844 Bacteria 1325
297 Ga0075430_100045529 3300006846 Bacteria 3706
298 Ga0075431_100000341 3300006847 Bacteria 36704
299 Ga0075431_100000800 3300006847 Bacteria 27517
300 Ga0075431_100010582 3300006847 Bacteria 9276
301 Ga0075431_100207211 3300006847 Bacteria 2004
302 Ga0075431_100283634 3300006847 Bacteria 1677
303 Ga0075433_10068651 3300006852 Bacteria 3112
304 Ga0075434_100026312 3300006871 Bacteria 5698
305 Ga0075434_100050538 3300006871 Bacteria 4130
306 Ga0075434_100204005 3300006871 Bacteria 1997
307 Ga0075429_100023407 3300006880 Bacteria 5360
308 Ga0075436_100017334 3300006914 Bacteria 4930
309 Ga0075436_100043069 3300006914 Bacteria 3112
310 Ga0075436_100126404 3300006914 Bacteria 1791
311 Ga0097620_100013427 3300006931 Bacteria 8212
312 Ga0097620_100095023 3300006931 Bacteria 3033
313 Ga0097620_100104974 3300006931 Bacteria 2885
314 Ga0097620_100116513 3300006931 Bacteria 2736
315 Ga0097620_100143669 3300006931 Bacteria 2460
316 Ga0075435_100006251 3300007076 Bacteria 8409
317 Ga0075435_100016534 3300007076 Bacteria 5563
318 Ga0075435_100026937 3300007076 Bacteria 4491
319 Ga0105251_10000905 3300009011 Bacteria 26609
320 Ga0105251_10007705 3300009011 Bacteria 6578
321 Ga0105251_10019101 3300009011 Bacteria 3628
322 Ga0105251_10029432 3300009011 Bacteria 2766
323 Ga0105251_10039953 3300009011 Bacteria 2289
324 Ga0105244_10001754 3300009036 Bacteria 17039
325 Ga0105244_10005044 3300009036 Bacteria 8882
326 Ga0105244_10005353 3300009036 Bacteria 8543
327 Ga0105250_10000642 3300009092 Bacteria 22235
328 Ga0105250_10001851 3300009092 Bacteria 11018
329 Ga0105250_10016467 3300009092 Bacteria 3011
330 Ga0105250_10053938 3300009092 Bacteria 1612
331 Ga0105240_10093238 3300009093 Bacteria 3676
332 Ga0105240_10185438 3300009093 Bacteria 2451
333 Ga0105240_10203795 3300009093 Bacteria 2317
334 Ga0111539_10000944 3300009094 Bacteria 38074
335 Ga0111539_10017082 3300009094 Bacteria 8981
336 Ga0111539_10054923 3300009094 Bacteria 4736
337 Ga0111539_10086300 3300009094 Bacteria 3688
338 Ga0111539_10113334 3300009094 Bacteria 3181
339 Ga0111539_10113709 3300009094 Bacteria 3175
340 Ga0105245_10011337 3300009098 Bacteria 7762
341 Ga0105245_10036871 3300009098 Bacteria 4345
342 Ga0105245_10090808 3300009098 Bacteria 2810
343 Ga0105247_10000251 3300009101 Bacteria 49900
344 Ga0105247_10008026 3300009101 Bacteria 6450
345 Ga0105247_10019843 3300009101 Bacteria 4037
346 Ga0105247_10056251 3300009101 Bacteria 2429
347 Ga0114129_10006787 3300009147 Bacteria 16254
348 Ga0114129_10008886 3300009147 Bacteria 14325
349 Ga0114129_10018930 3300009147 Bacteria 9810
350 Ga0114129_10030723 3300009147 Bacteria 7597
351 Ga0114129_10655607 3300009147 Bacteria 1354
352 Ga0114129_10664763 3300009147 Bacteria 1343
353 Ga0105243_10000010 3300009148 Bacteria 316672
354 Ga0105243_10000155 3300009148 Bacteria 78612
355 Ga0105243_10009892 3300009148 Bacteria 7251
356 Ga0105243_10080826 3300009148 Bacteria 2652
357 Ga0105243_10095464 3300009148 Bacteria 2457
358 Ga0105243_10096414 3300009148 Bacteria 2447
359 Ga0105241_10043770 3300009174 Bacteria 3391
360 Ga0105241_10097509 3300009174 Bacteria 2331
361 Ga0105242_10028818 3300009176 Bacteria 4422
362 Ga0105242_10047973 3300009176 Bacteria 3469
363 Ga0105242_10087236 3300009176 Bacteria 2620
364 Ga0105242_10108327 3300009176 Bacteria 2364
365 Ga0105248_10000014 3300009177 Bacteria 324729
366 Ga0105248_10020029 3300009177 Bacteria 7407
367 Ga0105248_10028137 3300009177 Bacteria 6260
368 Ga0105248_10034717 3300009177 Bacteria 5642
369 Ga0105248_10085006 3300009177 Bacteria 3560
370 Ga0105248_10445446 3300009177 Bacteria 1459
371 Ga0105237_10000681 3300009545 Bacteria 47030
372 Ga0105237_10015085 3300009545 Bacteria 8051
373 Ga0105237_10017247 3300009545 Bacteria 7488
374 Ga0105237_10046841 3300009545 Bacteria 4348
375 Ga0105237_10050938 3300009545 Bacteria 4160
376 Ga0105237_10063603 3300009545 Bacteria 3687
377 Ga0105237_10077247 3300009545 Bacteria 3320
378 Ga0105238_10068561 3300009551 Bacteria 3548
379 Ga0105249_10000048 3300009553 Bacteria 172137
380 Ga0105249_10000305 3300009553 Bacteria 49977
381 Ga0105249_10001408 3300009553 Bacteria 21068
382 Ga0105249_10017159 3300009553 Bacteria 6426
383 Ga0105249_10070021 3300009553 Bacteria 3238
384 Ga0105249_10119965 3300009553 Bacteria 2498
385 Ga0105249_10134540 3300009553 Bacteria 2364
386 Ga0105239_10003066 3300010375 Bacteria 20762
387 Ga0105239_10066734 3300010375 Bacteria 3952
388 Ga0105239_10078462 3300010375 Bacteria 3634
389 Ga0105239_10174362 3300010375 Bacteria 2405
390 Ga0105239_10263549 3300010375 Bacteria 1937
391 Ga0105239_10338014 3300010375 Bacteria 1699
392 Ga0105246_10001817 3300011119 Bacteria 12785
393 Ga0105246_10009585 3300011119 Bacteria 5968
394 Ga0105246_10037415 3300011119 Bacteria 3257
395 Ga0105246_10117137 3300011119 Bacteria 1968
396 Ga0157373_10043419 3300013100 Bacteria 3211
397 Ga0157373_10057099 3300013100 Bacteria 2769
398 Ga0157371_10032330 3300013102 Bacteria 3766
399 Ga0157371_10033162 3300013102 Bacteria 3712
400 Ga0157371_10068432 3300013102 Bacteria 2513
401 Ga0157371_10107024 3300013102 Bacteria 1984
402 Ga0157371_10115375 3300013102 Bacteria 1907
403 Ga0157370_10048914 3300013104 Bacteria 4050
404 Ga0157370_10124500 3300013104 Bacteria 2407
405 Ga0157370_10157510 3300013104 Bacteria 2113
406 Ga0157369_10028383 3300013105 Bacteria 6193
407 Ga0157369_10053243 3300013105 Bacteria 4375
408 Ga0157369_10080438 3300013105 Bacteria 3489
409 Ga0157369_10110381 3300013105 Bacteria 2924
410 Ga0171462_1002 3300013250 Bacteria 1052134
411 Ga0157374_10029225 3300013296 Bacteria 4988
412 Ga0157378_10041354 3300013297 Bacteria 4088
413 Ga0163162_10024165 3300013306 Bacteria 5997
414 Ga0163162_10056847 3300013306 Bacteria 3940
415 Ga0163162_10224878 3300013306 Bacteria 2006
416 Ga0163162_10477674 3300013306 Bacteria 1378
417 Ga0157375_10010788 3300013308 Bacteria 8049
418 Ga0157375_10048566 3300013308 Bacteria 4152
419 Ga0157375_10091051 3300013308 Bacteria 3110
420 Ga0157375_10489359 3300013308 Bacteria 1395
421 Ga0163163_10179161 3300014325 Bacteria 2166
422 Ga0163163_10325178 3300014325 Bacteria 1592
423 Ga0157380_10007550 3300014326 Bacteria 7725
424 Ga0157380_10173779 3300014326 Bacteria 1885
425 Ga0157380_10310741 3300014326 Bacteria 1457
426 Ga0182008_10002889 3300014497 Bacteria 10629
427 Ga0157377_10131214 3300014745 Bacteria 1530
428 Ga0157379_10015692 3300014968 Bacteria 6656
429 Ga0157379_10017157 3300014968 Bacteria 6376
430 Ga0157379_10244541 3300014968 Bacteria 1628
431 Ga0157376_10031970 3300014969 Bacteria 4221
432 Ga0182006_1000214 3300015261 Bacteria 56285
433 Ga0163161_10012381 3300017792 Bacteria 5922
434 Ga0163161_10042245 3300017792 Bacteria 3278
435 Ga0163161_10044709 3300017792 Bacteria 3191
436 Ga0163161_10159331 3300017792 Bacteria 1720
437 Ga0197907_11483172 3300020069 Bacteria 1572
438 Ga0206356_11001745 3300020070 Bacteria 1575
439 Ga0206356_11711657 3300020070 Bacteria 3391
440 Ga0206351_10051467 3300020077 Bacteria 1568
441 Ga0206354_10117409 3300020081 Bacteria 1440
442 Ga0206354_10807169 3300020081 Bacteria 2016
443 Ga0206354_11645157 3300020081 Bacteria 2199
444 Ga0206353_11721640 3300020082 Bacteria 3142
445 Ga0213873_10000130 3300021358 Bacteria 14226
446 Ga0213876_10000004 3300021384 Bacteria 943822
447 Ga0213876_10001915 3300021384 Bacteria 12500
448 Ga0213876_10046411 3300021384 Bacteria 2297
449 Ga0213875_10000174 3300021388 Bacteria 67979
450 Ga0213875_10001334 3300021388 Bacteria 16255
451 Ga0213875_10004336 3300021388 Bacteria 7814
452 Ga0213875_10029575 3300021388 Bacteria 2598
453 Ga0213875_10051292 3300021388 Bacteria 1933
454 Ga0224712_10011188 3300022467 Bacteria 2774
455 Ga0209784_100105 3300025224 Bacteria 98262
456 Ga0209566_100178 3300025225 Bacteria 69170
457 Ga0209147_100160 3300025229 Bacteria 90883
458 Ga0209676_1000833 3300025292 Bacteria 39972
459 Ga0209676_1001081 3300025292 Bacteria 30764
460 Ga0209025_1000107 3300025294 Bacteria 222387
461 Ga0209025_1000945 3300025294 Bacteria 44061
462 Ga0209025_1001134 3300025294 Bacteria 38133
463 Ga0209025_1001208 3300025294 Bacteria 36263
464 Ga0209025_1001403 3300025294 Bacteria 31984
465 Ga0209025_1001415 3300025294 Bacteria 31780
466 Ga0209025_1007148 3300025294 Bacteria 8433
467 Ga0209025_1016229 3300025294 Bacteria 4418
468 Ga0207696_1001447 3300025711 Bacteria 12882
469 Ga0207696_1002892 3300025711 Bacteria 8083
470 Ga0207696_1004519 3300025711 Bacteria 5976
471 Ga0207655_1000612 3300025728 Bacteria 43148
472 Ga0207655_1000947 3300025728 Bacteria 30071
473 Ga0207655_1001468 3300025728 Bacteria 21769
474 Ga0207655_1001487 3300025728 Bacteria 21477
475 Ga0207655_1004432 3300025728 Bacteria 9957
476 Ga0207655_1004629 3300025728 Bacteria 9661
477 Ga0207655_1025039 3300025728 Bacteria 2907
478 Ga0207713_1001490 3300025735 Bacteria 18513
479 Ga0207713_1002830 3300025735 Bacteria 12207
480 Ga0207713_1003575 3300025735 Bacteria 10501
481 Ga0207713_1003827 3300025735 Bacteria 10070
482 Ga0207692_10000421 3300025898 Bacteria 14851
483 Ga0207692_10001282 3300025898 Bacteria 9329
484 Ga0207692_10003061 3300025898 Bacteria 6492
485 Ga0207692_10005915 3300025898 Bacteria 4935
486 Ga0207692_10006481 3300025898 Bacteria 4746
487 Ga0207692_10006566 3300025898 Bacteria 4723
488 Ga0207692_10019402 3300025898 Bacteria 3072
489 Ga0207692_10062047 3300025898 Bacteria 1939
490 Ga0207692_10078831 3300025898 Bacteria 1756
491 Ga0207692_10082230 3300025898 Bacteria 1725
492 Ga0207642_10054531 3300025899 Bacteria 1824
493 Ga0207710_10000005 3300025900 Bacteria 607066
494 Ga0207710_10000009 3300025900 Bacteria 485205
495 Ga0207710_10027386 3300025900 Bacteria 2467
496 Ga0207688_10000991 3300025901 Bacteria 14486
497 Ga0207688_10006904 3300025901 Bacteria 6179
498 Ga0207688_10009574 3300025901 Bacteria 5275
499 Ga0207647_10022112 3300025904 Bacteria 4230
500 Ga0207647_10038435 3300025904 Bacteria 3026
501 Ga0207685_10004419 3300025905 Bacteria 3571
502 Ga0207685_10030921 3300025905 Bacteria 1912
503 Ga0207685_10041816 3300025905 Bacteria 1717
504 Ga0207685_10048846 3300025905 Bacteria 1623
505 Ga0207699_10000093 3300025906 Bacteria 65868
506 Ga0207699_10000284 3300025906 Bacteria 27725
507 Ga0207699_10000662 3300025906 Bacteria 16542
508 Ga0207699_10001582 3300025906 Bacteria 10795
509 Ga0207699_10005863 3300025906 Bacteria 5910
510 Ga0207699_10017060 3300025906 Bacteria 3812
511 Ga0207699_10020355 3300025906 Bacteria 3554
512 Ga0207699_10091957 3300025906 Bacteria 1906
513 Ga0207699_10094877 3300025906 Bacteria 1880
514 Ga0207645_10009910 3300025907 Bacteria 6564
515 Ga0207643_10008182 3300025908 Bacteria 5613
516 Ga0207643_10012512 3300025908 Bacteria 4585
517 Ga0207705_10146877 3300025909 Bacteria 1765
518 Ga0207684_10001772 3300025910 Bacteria 22781
519 Ga0207684_10004720 3300025910 Bacteria 12781
520 Ga0207684_10008252 3300025910 Bacteria 9272
521 Ga0207684_10009745 3300025910 Bacteria 8472
522 Ga0207684_10014241 3300025910 Bacteria 6862
523 Ga0207654_10222854 3300025911 Bacteria 1252
524 Ga0207707_10000103 3300025912 Bacteria 83766
525 Ga0207707_10091743 3300025912 Bacteria 2655
526 Ga0207707_10210546 3300025912 Bacteria 1693
527 Ga0207695_10120527 3300025913 Bacteria 2592
528 Ga0207695_10145102 3300025913 Bacteria 2318
529 Ga0207695_10296735 3300025913 Bacteria 1508
530 Ga0207671_10006846 3300025914 Bacteria 10060
531 Ga0207671_10015047 3300025914 Bacteria 6081
532 Ga0207671_10038462 3300025914 Bacteria 3546
533 Ga0207671_10052534 3300025914 Bacteria 3020
534 Ga0207671_10158968 3300025914 Bacteria 1749
535 Ga0207693_10000132 3300025915 Bacteria 67726
536 Ga0207693_10001324 3300025915 Bacteria 21935
537 Ga0207693_10003617 3300025915 Bacteria 13200
538 Ga0207693_10020370 3300025915 Bacteria 5276
539 Ga0207693_10029138 3300025915 Bacteria 4363
540 Ga0207693_10082483 3300025915 Bacteria 2518
541 Ga0207693_10191902 3300025915 Bacteria 1607
542 Ga0207663_10000336 3300025916 Bacteria 20570
543 Ga0207663_10002893 3300025916 Bacteria 8294
544 Ga0207663_10003266 3300025916 Bacteria 7910
545 Ga0207663_10007631 3300025916 Bacteria 5622
546 Ga0207663_10020136 3300025916 Bacteria 3774
547 Ga0207663_10025482 3300025916 Bacteria 3420
548 Ga0207663_10081312 3300025916 Bacteria 2121
549 Ga0207660_10000257 3300025917 Bacteria 34559
550 Ga0207662_10002153 3300025918 Bacteria 9810
551 Ga0207662_10002244 3300025918 Bacteria 9651
552 Ga0207662_10008170 3300025918 Bacteria 5722
553 Ga0207657_10006511 3300025919 Bacteria 12098
554 Ga0207657_10014772 3300025919 Bacteria 7603
555 Ga0207657_10022199 3300025919 Bacteria 5951
556 Ga0207657_10184560 3300025919 Bacteria 1685
557 Ga0207649_10080394 3300025920 Bacteria 2108
558 Ga0207652_10000256 3300025921 Bacteria 55346
559 Ga0207652_10031578 3300025921 Bacteria 4449
560 Ga0207652_10072673 3300025921 Bacteria 2991
561 Ga0207646_10000075 3300025922 Bacteria 136316
562 Ga0207646_10015421 3300025922 Bacteria 7218
563 Ga0207646_10017449 3300025922 Bacteria 6716
564 Ga0207646_10057499 3300025922 Bacteria 3475
565 Ga0207646_10080270 3300025922 Bacteria 2917
566 Ga0207646_10182212 3300025922 Bacteria 1897
567 Ga0207681_10021318 3300025923 Bacteria 4117
568 Ga0207650_10000116 3300025925 Bacteria 104652
569 Ga0207650_10052964 3300025925 Bacteria 3007
570 Ga0207659_10098405 3300025926 Bacteria 2200
571 Ga0207659_10106030 3300025926 Bacteria 2127
572 Ga0207687_10005129 3300025927 Bacteria 8686
573 Ga0207700_10000103 3300025928 Bacteria 51803
574 Ga0207700_10002220 3300025928 Bacteria 11146
575 Ga0207700_10034685 3300025928 Bacteria 3625
576 Ga0207700_10049537 3300025928 Bacteria 3125
577 Ga0207700_10060223 3300025928 Bacteria 2874
578 Ga0207700_10073786 3300025928 Bacteria 2636
579 Ga0207700_10096707 3300025928 Bacteria 2345
580 Ga0207700_10122798 3300025928 Bacteria 2108
581 Ga0207700_10154778 3300025928 Bacteria 1898
582 Ga0207700_10189588 3300025928 Bacteria 1727
583 Ga0207700_10291627 3300025928 Bacteria 1406
584 Ga0207664_10000533 3300025929 Bacteria 27072
585 Ga0207664_10000556 3300025929 Bacteria 26167
586 Ga0207664_10003071 3300025929 Bacteria 11091
587 Ga0207664_10004341 3300025929 Bacteria 9604
588 Ga0207664_10019976 3300025929 Bacteria 4959
589 Ga0207664_10028924 3300025929 Bacteria 4217
590 Ga0207664_10030465 3300025929 Bacteria 4119
591 Ga0207664_10051508 3300025929 Bacteria 3251
592 Ga0207664_10062833 3300025929 Bacteria 2966
593 Ga0207664_10177398 3300025929 Bacteria 1827
594 Ga0207644_10005148 3300025931 Bacteria 8544
595 Ga0207644_10007134 3300025931 Bacteria 7281
596 Ga0207644_10093215 3300025931 Bacteria 2248
597 Ga0207690_10040941 3300025932 Bacteria 3033
598 Ga0207706_10000852 3300025933 Bacteria 31410
599 Ga0207706_10013671 3300025933 Bacteria 7368
600 Ga0207706_10057206 3300025933 Bacteria 3436
601 Ga0207706_10074067 3300025933 Bacteria 2994
602 Ga0207686_10103163 3300025934 Bacteria 1908
603 Ga0207686_10137525 3300025934 Bacteria 1684
604 Ga0207709_10000001 3300025935 Bacteria 2228154
605 Ga0207709_10105690 3300025935 Bacteria 1871
606 Ga0207709_10131806 3300025935 Bacteria 1705
607 Ga0207665_10000110 3300025939 Bacteria 53827
608 Ga0207665_10000836 3300025939 Bacteria 20786
609 Ga0207665_10003439 3300025939 Bacteria 10589
610 Ga0207665_10006149 3300025939 Bacteria 7973
611 Ga0207665_10048553 3300025939 Bacteria 2850
612 Ga0207665_10049003 3300025939 Bacteria 2838
613 Ga0207665_10113935 3300025939 Bacteria 1903
614 Ga0207665_10210750 3300025939 Bacteria 1419
615 Ga0207691_10009921 3300025940 Bacteria 9142
616 Ga0207691_10023464 3300025940 Bacteria 5808
617 Ga0207691_10025511 3300025940 Bacteria 5548
618 Ga0207691_10090507 3300025940 Bacteria 2742
619 Ga0207711_10000021 3300025941 Bacteria 355952
620 Ga0207711_10008827 3300025941 Bacteria 8428
621 Ga0207711_10018068 3300025941 Bacteria 5863
622 Ga0207711_10104916 3300025941 Bacteria 2505
623 Ga0207689_10001908 3300025942 Bacteria 19711
624 Ga0207689_10009281 3300025942 Bacteria 8504
625 Ga0207689_10015339 3300025942 Bacteria 6486
626 Ga0207689_10032937 3300025942 Bacteria 4307
627 Ga0207661_10183331 3300025944 Bacteria 1830
628 Ga0207679_10040889 3300025945 Bacteria 3321
629 Ga0207679_10190171 3300025945 Bacteria 1706
630 Ga0207679_10194987 3300025945 Bacteria 1687
631 Ga0207667_10007694 3300025949 Bacteria 12896
632 Ga0207667_10029360 3300025949 Bacteria 5964
633 Ga0207667_10050910 3300025949 Bacteria 4368
634 Ga0207667_10154310 3300025949 Bacteria 2363
635 Ga0207667_10267137 3300025949 Bacteria 1749
636 Ga0207712_10000148 3300025961 Bacteria 72568
637 Ga0207712_10001509 3300025961 Bacteria 15781
638 Ga0207712_10018892 3300025961 Bacteria 4496
639 Ga0207668_10004092 3300025972 Bacteria 8569
640 Ga0207668_10157608 3300025972 Bacteria 1765
641 Ga0207640_10002707 3300025981 Bacteria 9484
642 Ga0207658_10000555 3300025986 Bacteria 33908
643 Ga0207658_10015000 3300025986 Bacteria 5313
644 Ga0207658_10130302 3300025986 Bacteria 2020
645 Ga0207677_10013523 3300026023 Bacteria 4733
646 Ga0207677_10138169 3300026023 Bacteria 1861
647 Ga0207703_10000149 3300026035 Bacteria 80168
648 Ga0207703_10012392 3300026035 Bacteria 6645
649 Ga0207703_10183402 3300026035 Bacteria 1848
650 Ga0207639_10023938 3300026041 Bacteria 4413
651 Ga0207639_10196246 3300026041 Bacteria 1728
652 Ga0207678_10002509 3300026067 Bacteria 16704
653 Ga0207678_10008904 3300026067 Bacteria 8835
654 Ga0207678_10034232 3300026067 Bacteria 4425
655 Ga0207678_10042538 3300026067 Bacteria 3934
656 Ga0207678_10067322 3300026067 Bacteria 3074
657 Ga0207678_10319843 3300026067 Bacteria 1335
658 Ga0207708_10006195 3300026075 Bacteria 8866
659 Ga0207708_10036612 3300026075 Bacteria 3737
660 Ga0207708_10108336 3300026075 Bacteria 2155
661 Ga0207702_10024238 3300026078 Bacteria 5034
662 Ga0207702_10031911 3300026078 Bacteria 4394
663 Ga0207702_10056729 3300026078 Bacteria 3326
664 Ga0207641_10000005 3300026088 Bacteria 470841
665 Ga0207641_10000008 3300026088 Bacteria 424415
666 Ga0207648_10130635 3300026089 Bacteria 2211
667 Ga0207676_10000019 3300026095 Bacteria 305653
668 Ga0207676_10000049 3300026095 Bacteria 133695
669 Ga0207674_10003114 3300026116 Bacteria 20468
670 Ga0207674_10024371 3300026116 Bacteria 6468
671 Ga0207674_10033349 3300026116 Bacteria 5392
672 Ga0207674_10083656 3300026116 Bacteria 3191
673 Ga0207674_10092626 3300026116 Bacteria 3011
674 Ga0207674_10266163 3300026116 Bacteria 1661
675 Ga0207675_100003405 3300026118 Bacteria 15530
676 Ga0207675_100013383 3300026118 Bacteria 7655
677 Ga0207675_100114121 3300026118 Bacteria 2551
678 Ga0207675_100571901 3300026118 Bacteria 1131
679 Ga0207683_10001681 3300026121 Bacteria 19802
680 Ga0207683_10001732 3300026121 Bacteria 19433
681 Ga0207683_10093430 3300026121 Bacteria 2680
682 Ga0207698_10016317 3300026142 Bacteria 5003
683 Ga0207698_10019935 3300026142 Bacteria 4604
684 Ga0207698_10038915 3300026142 Bacteria 3518
685 Ga0209371_1000006 3300027312 Bacteria 1055642
686 Ga0209371_1000008 3300027312 Bacteria 1024606
687 Ga0207428_10089450 3300027907 Bacteria 2393
688 Ga0207428_10177711 3300027907 Bacteria 1609
689 Ga0207428_10260813 3300027907 Bacteria 1291
690 Ga0268266_10038719 3300028379 Bacteria 4059
691 Ga0268266_10060121 3300028379 Bacteria 3275
692 Ga0268265_10000165 3300028380 Bacteria 80699
693 Ga0268265_10112618 3300028380 Bacteria 2225
694 Ga0268265_10152037 3300028380 Bacteria 1953
695 Ga0268264_10059779 3300028381 Bacteria 3194
696 Ga0268264_10158808 3300028381 Bacteria 2034
697 Ga0268264_10230455 3300028381 Bacteria 1710
698 Ga0268264_10340054 3300028381 Bacteria 1425
699 Ga0268264_10390934 3300028381 Bacteria 1334
700 Ga0265319_1004182 3300028563 Bacteria 7227
701 Ga0265334_10057558 3300028573 Bacteria 1473
702 Ga0265318_10002515 3300028577 Bacteria 9735
703 Ga0265336_10000005 3300028666 Bacteria 399349
704 Ga0265336_10008838 3300028666 Bacteria 3512
705 Ga0265338_10000001 3300028800 Bacteria 1177449
706 Ga0265338_10010903 3300028800 Bacteria 10576
707 Ga0268256_1000007 3300030500 Bacteria 1055326
708 Ga0268256_1000009 3300030500 Bacteria 1022625
709 Ga0265762_1006823 3300030760 Bacteria 2040
710 Ga0265760_10036986 3300031090 Bacteria 1449
711 Ga0265340_10000001 3300031247 Bacteria 1647668
712 Ga0265339_10037585 3300031249 Bacteria 2705
713 Ga0265327_10048452 3300031251 Bacteria 2235
714 Ga0265327_10061873 3300031251 Bacteria 1907
715 Ga0265327_10090003 3300031251 Bacteria 1498
716 Ga0265316_10236769 3300031344 Bacteria 1343
717 Ga0307513_10007758 3300031456 Bacteria 13855
718 Ga0307513_10105448 3300031456 Bacteria 2828
719 Ga0307509_10000004 3300031507 Bacteria 535507
720 Ga0307408_100000387 3300031548 Bacteria 40174
721 Ga0307408_100271656 3300031548 Bacteria 1408
722 Ga0316575_10016255 3300031665 Bacteria 2814
723 Ga0316579_10119735 3300031691 Bacteria 1265
724 Ga0316576_10002159 3300031727 Bacteria 11090
725 Ga0316576_10004942 3300031727 Bacteria 8070
726 Ga0316576_10014931 3300031727 Bacteria 5197
727 Ga0316576_10023559 3300031727 Bacteria 4290
728 Ga0316576_10058201 3300031727 Bacteria 2827
729 Ga0316576_10220302 3300031727 Bacteria 1427
730 Ga0316578_10008294 3300031728 Bacteria 5278
731 Ga0316578_10011678 3300031728 Bacteria 4607
732 Ga0316578_10027510 3300031728 Bacteria 3214
733 Ga0316577_10005905 3300031733 Bacteria 6445
734 Ga0307413_10092852 3300031824 Bacteria 1971
735 Ga0307409_100049254 3300031995 Bacteria 3211
736 Ga0307409_100106607 3300031995 Bacteria 2339
737 Ga0307416_100237259 3300032002 Bacteria 1764
738 Ga0373930_0002746 3300034816 Bacteria 2745
739 Ga0373959_0006108 3300034820 Bacteria 1991
740 Ga0373959_0009144 3300034820 Bacteria 1702
741 Ga0373926_0009320 3300035083 Bacteria 3278
742 Ga0373928_0000501 3300035084 Bacteria 7713
743 Ga0373929_0008922 3300035085 Bacteria 1853
744 Ga0373934_0000074 3300035086 Bacteria 34573
745 Ga0373934_0004420 3300035086 Bacteria 5192
746 Ga0373934_0011417 3300035086 Bacteria 3341
747 Ga0373934_0013932 3300035086 Bacteria 3042
748 Ga0373934_0025762 3300035086 Bacteria 2279
749 Ga0373944_0002708 3300035089 Bacteria 4521
750 Ga0373944_0012433 3300035089 Bacteria 2346
751 Ga0373949_0022946 3300035090 Bacteria 1442
752 Ga0373951_0007038 3300035091 Bacteria 2563
753 Ga0373951_0031416 3300035091 Bacteria 1252
754 Ga0373952_0008979 3300035092 Bacteria 1906
755 Ga0373923_0003312 3300035111 Bacteria 5143
756 Ga0373923_0007133 3300035111 Bacteria 3913
757 Ga0373923_0067947 3300035111 Bacteria 1525
758 Ga0373923_0070525 3300035111 Bacteria 1500
759 Ga0373923_0107184 3300035111 Bacteria 1237
760 Ga0373932_0000217 3300035112 Bacteria 17000
761 Ga0373932_0003244 3300035112 Bacteria 3937
762 Ga0373932_0011995 3300035112 Bacteria 2128
763 Ga0373936_0000119 3300035113 Bacteria 27899
764 Ga0373936_0001254 3300035113 Bacteria 9160
765 Ga0373936_0003910 3300035113 Bacteria 5612
766 Ga0373936_0088890 3300035113 Bacteria 1293
767 Ga0373939_0005890 3300035114 Bacteria 2933
768 Ga0373941_0031976 3300035115 Bacteria 1572
769 Ga0373945_0000755 3300035116 Bacteria 9443
770 Ga0373953_0001822 3300035117 Bacteria 6292
771 Ga0373953_0008422 3300035117 Bacteria 3502
772 Ga0373953_0015121 3300035117 Bacteria 2789
773 Ga0373953_0056397 3300035117 Bacteria 1597
774 Ga0373954_0008571 3300035118 Bacteria 4495
775 Ga0373954_0009201 3300035118 Bacteria 4346
776 Ga0373954_0034572 3300035118 Bacteria 2341
777 Ga0373954_0054112 3300035118 Bacteria 1887
778 Ga0373956_0001407 3300035119 Bacteria 9949
779 Ga0373956_0020403 3300035119 Bacteria 2819
780 Ga0373957_0000056 3300035120 Bacteria 28254
781 Ga0373957_0002119 3300035120 Bacteria 5579
782 Ga0373957_0040416 3300035120 Bacteria 1753
783 Ga0373957_0087385 3300035120 Bacteria 1235
784 Ga0373960_0010364 3300035121 Bacteria 2275
785 Ga0373943_0008618 3300035170 Bacteria 4572
786 Ga0373943_0030676 3300035170 Bacteria 2546
787 Ga0373943_0044748 3300035170 Bacteria 2155
788 Ga0373943_0076988 3300035170 Bacteria 1702
789 Ga0373943_0098645 3300035170 Bacteria 1524
790 Ga0373943_0100093 3300035170 Bacteria 1515
791 Ga0373946_0001411 3300035171 Bacteria 8333
792 Ga0373955_0004271 3300035172 Bacteria 6312
793 Ga0373955_0013253 3300035172 Bacteria 3981
794 Ga0373955_0096568 3300035172 Bacteria 1691
795 Ga0373955_0140777 3300035172 Bacteria 1414
796 Ga0373942_0002905 3300035207 Bacteria 4064
797 Ga0373962_0025291 3300035242 Bacteria 1594
798 Ga0316574_0006801 3300035398 Bacteria 6215
799 Ga0316574_0011379 3300035398 Bacteria 5056
800 Ga0316574_0011947 3300035398 Bacteria 4952
801 Ga0316574_0035842 3300035398 Bacteria 3034
802 Ga0316574_0126126 3300035398 Bacteria 1646
803 Ga0373924_0000088 3300035410 Bacteria 25289
804 Ga0373924_0002191 3300035410 Bacteria 6543
805 Ga0373924_0003031 3300035410 Bacteria 5726
806 Ga0373924_0003240 3300035410 Bacteria 5570
807 Ga0373931_0000005 3300035691 Bacteria 480485
808 Ga0373931_0000027 3300035691 Bacteria 123672
809 Ga0373931_0002914 3300035691 Bacteria 7634
810 Ga0373931_0149047 3300035691 Bacteria 1362
811 Ga0373931_0154931 3300035691 Bacteria 1338
812 Ga0373935_0004208 3300035692 Bacteria 8433
813 Ga0373935_0009981 3300035692 Bacteria 5687
814 Ga0373935_0011653 3300035692 Bacteria 5280
815 Ga0373935_0080562 3300035692 Bacteria 2115
816 Ga0373927_0022062 3300035695 Bacteria 4172
817 Ga0373927_0248107 3300035695 Bacteria 1170
818 Ga0373933_0000005 3300035724 Bacteria 128820
819 Ga0373933_0033741 3300035724 Bacteria 2979
820 Ga0373933_0071890 3300035724 Bacteria 2106
821 Ga0373947_0000220 3300035725 Bacteria 32120
822 Ga0373947_0090298 3300035725 Bacteria 1909
823 Ga0373937_0000278 3300036401 Bacteria 48828
824 Ga0373937_0054255 3300036401 Bacteria 3677
825 Ga0373937_0079557 3300036401 Bacteria 3029
826 Ga0373937_0189654 3300036401 Bacteria 1931
827 Ga0372808_000663 3300036459 Bacteria 2966
828 Ga0372808_001740 3300036459 Bacteria 2350
829 Ga0316582_0010895 3300036647 Bacteria 5004
830 Ga0316582_0095040 3300036647 Bacteria 1967
831 Ga0316584_0003409 3300036712 Bacteria 10313
832 Ga0316584_0004433 3300036712 Bacteria 9296
833 Ga0316584_0008628 3300036712 Bacteria 7028
834 Ga0316584_0050522 3300036712 Bacteria 3109
835 Ga0316584_0102651 3300036712 Bacteria 2141
836 Ga0373925_0041858 3300037068 Bacteria 3397
837 Ga0373925_0055558 3300037068 Bacteria 2964
838 Ga0436364_0033704 3300037853 Bacteria 1710
839 Ga0436364_0509088 3300037853 Bacteria 1565
840 Ga0436364_0604875 3300037853 Bacteria 15615
841 Ga0436364_0676163 3300037853 Bacteria 64006
842 Ga0436364_0757834 3300037853 Bacteria 1263
843 Ga0436364_0786042 3300037853 Bacteria 20160
844 Ga0436364_0802940 3300037853 Bacteria 6735
845 Ga0436364_1227141 3300037853 Bacteria 4136
846 Ga0436364_1456387 3300037853 Bacteria 1888
847 Ga0436364_1464045 3300037853 Bacteria 3338
848 Ga0395901_0060605 3300038443 Bacteria 3938
849 Ga0400485_02355 3300038735 Bacteria 4319
850 Ga0400483_058289 3300039062 Bacteria 9230
851 Ga0400483_215395 3300039062 Bacteria 9338
852 Ga0400483_232124 3300039062 Bacteria 10279
853 Ga0400483_245537 3300039062 Bacteria 4243
854 Ga0237816_01881 3300039145 Bacteria 1672
855 Ga0436365_0012902 3300039437 Bacteria 1185
856 Ga0436365_0075484 3300039437 Bacteria 13035
857 Ga0436365_0758715 3300039437 Bacteria 2292
858 Ga0436365_1202098 3300039437 Bacteria 19080
859 Ga0436361_0374946 3300039447 Bacteria 3283
860 Ga0436361_1186958 3300039447 Bacteria 1328
861 Ga0436362_0035386 3300039453 Bacteria 9973
862 Ga0436362_0131109 3300039453 Bacteria 1777
863 Ga0439447_043708 3300041407 Bacteria 1085
864 Ga0439466_0021474 3300041411 Bacteria 2287
865 Ga0439465_0053120 3300041413 Bacteria 1331
866 Ga0451791_1300260 3300041451 Bacteria 2966
867 Ga0451843_0067489 3300041509 Bacteria 1551
868 Ga0451843_1574986 3300041509 Bacteria 1340
869 Ga0439445_0031973 3300042004 Bacteria 1370
870 Ga0439432_032374 3300042006 Bacteria 1686
871 Ga0439449_0001300 3300042007 Bacteria 9777
872 Ga0439450_014046 3300042008 Bacteria 1618
873 Ga0439452_019347 3300042010 Bacteria 1802
874 Ga0439457_022828 3300042014 Bacteria 1385
875 Ga0439440_0002061 3300042993 Bacteria 3749
876 Ga0466969_0002027 3300044656 Bacteria 10820
877 Ga0466969_0016901 3300044656 Bacteria 3815
878 Ga0466972_0002652 3300044658 Bacteria 8856
879 Ga0466965_0000829 3300044683 Bacteria 11695
880 Ga0466965_0003566 3300044683 Bacteria 6843
881 Ga0466966_0011220 3300044684 Bacteria 5945
882 Ga0466966_0023668 3300044684 Bacteria 4020
883 Ga0466966_0068845 3300044684 Bacteria 2221
884 Ga0466961_0018481 3300044693 Bacteria 4484
885 Ga0466963_0005494 3300044694 Bacteria 7421
886 Ga0466963_0015101 3300044694 Bacteria 4775
887 Ga0466963_0027405 3300044694 Bacteria 3648
888 Ga0466963_0039987 3300044694 Bacteria 3073
889 Ga0466963_0052033 3300044694 Bacteria 2716
890 Ga0466963_0105466 3300044694 Bacteria 1932
891 Ga0466963_0134633 3300044694 Bacteria 1709
892 Ga0466964_0029818 3300044706 Bacteria 2156
893 Ga0466971_0092278 3300044719 Bacteria 1387
894 Ga0466968_0002914 3300044735 Bacteria 6321
895 Ga0466968_0035557 3300044735 Bacteria 2085
896 Ga0466970_0054126 3300044765 Bacteria 2143
897 Ga0466957_0007518 3300044842 Bacteria 6156
898 Ga0466957_0157063 3300044842 Bacteria 1475
899 Ga0466959_0017904 3300045049 Bacteria 5197
900 Ga0466959_0124003 3300045049 Bacteria 1834
901 Ga0466958_0185212 3300045836 Bacteria 1322
902 Ga0466967_0012564 3300045976 Bacteria 6486
903 Ga0466967_0019489 3300045976 Bacteria 5455
904 Ga0466967_0024982 3300045976 Bacteria 4919
905 Ga0466967_0089070 3300045976 Bacteria 2802
906 Ga0466967_0089880 3300045976 Bacteria 2789
907 Ga0466967_0111096 3300045976 Bacteria 2518
908 Ga0466967_0621354 3300045976 Bacteria 1067
909 Ga0495627_000110 3300046453 Bacteria 101742
910 Ga0495592_0000010 3300046454 Bacteria 157001
911 Ga0495592_0006585 3300046454 Bacteria 8655
912 Ga0495592_0012104 3300046454 Bacteria 6544
913 Ga0495592_0027319 3300046454 Bacteria 4327
914 Ga0495592_0043975 3300046454 Bacteria 3339
915 Ga0495592_0052562 3300046454 Bacteria 3024
916 Ga0495592_0137810 3300046454 Bacteria 1700
917 Ga0495603_0003396 3300046455 Bacteria 9478
918 Ga0495603_0018742 3300046455 Bacteria 4188
919 Ga0495629_0003600 3300046459 Bacteria 11706
920 Ga0495629_0004898 3300046459 Bacteria 10049
921 Ga0495629_0012270 3300046459 Bacteria 6206
922 Ga0495641_0004957 3300046461 Bacteria 9200
923 Ga0495641_0008522 3300046461 Bacteria 6236
924 Ga0495641_0013408 3300046461 Bacteria 4506
925 Ga0495641_0040339 3300046461 Bacteria 2171
926 Ga0495641_0064342 3300046461 Bacteria 1652
927 Ga0495651_0000006 3300046462 Bacteria 171575
928 Ga0495651_0006392 3300046462 Bacteria 9017
929 Ga0495651_0016070 3300046462 Bacteria 5796
930 Ga0495651_0017225 3300046462 Bacteria 5599
931 Ga0495651_0031182 3300046462 Bacteria 4158
932 Ga0495651_0035502 3300046462 Bacteria 3880
933 Ga0495651_0053979 3300046462 Bacteria 3092
934 Ga0495651_0106132 3300046462 Bacteria 2082
935 Ga0495653_0016641 3300046463 Bacteria 5985
936 Ga0495653_0028100 3300046463 Bacteria 4501
937 Ga0495653_0041667 3300046463 Bacteria 3582
938 Ga0495653_0059979 3300046463 Bacteria 2884
939 Ga0495653_0062265 3300046463 Bacteria 2819
940 Ga0495653_0064751 3300046463 Bacteria 2753
941 Ga0495653_0076719 3300046463 Bacteria 2483
942 Ga0495653_0088750 3300046463 Bacteria 2267
943 Ga0495653_0108270 3300046463 Bacteria 2001
944 Ga0495653_0121353 3300046463 Bacteria 1862
945 Ga0495580_0011635 3300046472 Bacteria 6805
946 Ga0495580_0081125 3300046472 Bacteria 2261
947 Ga0495580_0101173 3300046472 Bacteria 2004
948 Ga0495580_0101941 3300046472 Bacteria 1996
949 Ga0495582_0002548 3300046473 Bacteria 10144
950 Ga0495582_0003759 3300046473 Bacteria 8558
951 Ga0495582_0143380 3300046473 Bacteria 1354
952 Ga0495639_0016401 3300046475 Bacteria 3216
953 Ga0495662_0000649 3300046476 Bacteria 16301
954 Ga0495662_0001170 3300046476 Bacteria 12942
955 Ga0495662_0003177 3300046476 Bacteria 8297
956 Ga0495662_0009850 3300046476 Bacteria 4694
957 Ga0495662_0015376 3300046476 Bacteria 3717
958 Ga0495664_0044348 3300046477 Bacteria 2635
959 Ga0495664_0069108 3300046477 Bacteria 2108
960 Ga0495594_0013981 3300046499 Bacteria 4202
961 Ga0495607_0086639 3300046501 Bacteria 1707
962 Ga0495607_0103113 3300046501 Bacteria 1524
963 Ga0495608_0000243 3300046511 Bacteria 39556
964 Ga0495608_0000955 3300046511 Bacteria 20371
965 Ga0495608_0012153 3300046511 Bacteria 5983
966 Ga0495608_0013781 3300046511 Bacteria 5609
967 Ga0495608_0047023 3300046511 Bacteria 2870
968 Ga0495608_0062595 3300046511 Bacteria 2444
969 Ga0495608_0071773 3300046511 Bacteria 2259
970 Ga0495608_0109376 3300046511 Bacteria 1777
971 Ga0495608_0132923 3300046511 Bacteria 1591
972 Ga0495610_0000013 3300046512 Bacteria 465872
973 Ga0495616_0000032 3300046513 Bacteria 130692
974 Ga0495618_0001036 3300046514 Bacteria 19045
975 Ga0495618_0040927 3300046514 Bacteria 2917
976 Ga0495618_0065699 3300046514 Bacteria 2305
977 Ga0495620_0006077 3300046515 Bacteria 6677
978 Ga0495628_0000566 3300046516 Bacteria 33950
979 Ga0495628_0009608 3300046516 Bacteria 8252
980 Ga0495628_0010807 3300046516 Bacteria 7732
981 Ga0495628_0162672 3300046516 Bacteria 1695
982 Ga0495628_0176461 3300046516 Bacteria 1618
983 Ga0495630_0006721 3300046517 Bacteria 8194
984 Ga0495630_0034365 3300046517 Bacteria 3786
985 Ga0495630_0047622 3300046517 Bacteria 3207
986 Ga0495630_0048699 3300046517 Bacteria 3171
987 Ga0495630_0078485 3300046517 Bacteria 2489
988 Ga0495630_0183914 3300046517 Bacteria 1594
989 Ga0495630_0202682 3300046517 Bacteria 1514
990 Ga0495643_0094826 3300046522 Bacteria 1535
991 Ga0495663_0000041 3300046525 Bacteria 63505
992 Ga0495663_0012611 3300046525 Bacteria 2356
993 Ga0495666_0015344 3300046526 Bacteria 3814
994 Ga0495666_0051407 3300046526 Bacteria 1980
995 Ga0495666_0079308 3300046526 Bacteria 1554
996 Ga0495652_0000415 3300046529 Bacteria 49757
997 Ga0495652_0003238 3300046529 Bacteria 16225
998 Ga0495652_0014498 3300046529 Bacteria 7074
999 Ga0495652_0017823 3300046529 Bacteria 6337
1000 Ga0495652_0032816 3300046529 Bacteria 4537
1001 Ga0495652_0131791 3300046529 Bacteria 1978
1002 Ga0495665_0003630 3300046531 Bacteria 8374
1003 Ga0495665_0032011 3300046531 Bacteria 2813
1004 Ga0495640_0014491 3300046533 Bacteria 5961
1005 Ga0495640_0021723 3300046533 Bacteria 4703
1006 Ga0495640_0027072 3300046533 Bacteria 4138
1007 Ga0495640_0050138 3300046533 Bacteria 2877
1008 Ga0495640_0098754 3300046533 Bacteria 1919
1009 Ga0495586_0001504 3300046535 Bacteria 12869
1010 Ga0495586_0009784 3300046535 Bacteria 5104
1011 Ga0495586_0053888 3300046535 Bacteria 2179
1012 Ga0495587_0000049 3300046536 Bacteria 104756
1013 Ga0495587_0011091 3300046536 Bacteria 5716
1014 Ga0495587_0059565 3300046536 Bacteria 2240
1015 Ga0495587_0072640 3300046536 Bacteria 1999
1016 Ga0495645_0007547 3300046543 Bacteria 7565
1017 Ga0495645_0026918 3300046543 Bacteria 4176
1018 Ga0495645_0048487 3300046543 Bacteria 3093
1019 Ga0495645_0057004 3300046543 Bacteria 2837
1020 Ga0495645_0079474 3300046543 Bacteria 2355
1021 Ga0495645_0098882 3300046543 Bacteria 2076
1022 Ga0495667_0000041 3300046559 Bacteria 124884
1023 Ga0495667_0001387 3300046559 Bacteria 15949
1024 Ga0495667_0005665 3300046559 Bacteria 8451
1025 Ga0495667_0006595 3300046559 Bacteria 7880
1026 Ga0495667_0020456 3300046559 Bacteria 4464
1027 Ga0495667_0095863 3300046559 Bacteria 1920
1028 Ga0495667_0102530 3300046559 Bacteria 1850
1029 Ga0495668_0007996 3300046616 Bacteria 6665
1030 Ga0495634_0003643 3300046642 Bacteria 12289
1031 Ga0495634_0018131 3300046642 Bacteria 5014
1032 Ga0495634_0077598 3300046642 Bacteria 2178
1033 Ga0495634_0202145 3300046642 Bacteria 1234
1034 Ga0495625_0000911 3300046660 Bacteria 39772
1035 Ga0495625_0076269 3300046660 Bacteria 2344
1036 Ga0495635_0006189 3300046663 Bacteria 8338
1037 Ga0495635_0008669 3300046663 Bacteria 7101
1038 Ga0495635_0012396 3300046663 Bacteria 5974
1039 Ga0495635_0057977 3300046663 Bacteria 2664
1040 Ga0495635_0059571 3300046663 Bacteria 2625
1041 Ga0495661_0149716 3300046665 Bacteria 1262
1042 Ga0495657_0000126 3300046675 Bacteria 68659
1043 Ga0495657_0001156 3300046675 Bacteria 23145
1044 Ga0495657_0001976 3300046675 Bacteria 17474
1045 Ga0495657_0008646 3300046675 Bacteria 7769
1046 Ga0495657_0026456 3300046675 Bacteria 4107
1047 Ga0495657_0042552 3300046675 Bacteria 3100
1048 Ga0495657_0051433 3300046675 Bacteria 2766
1049 Ga0495657_0078154 3300046675 Bacteria 2145
1050 Ga0495657_0096449 3300046675 Bacteria 1890
1051 Ga0495599_0000208 3300046678 Bacteria 38561
1052 Ga0495599_0001775 3300046678 Bacteria 12511
1053 Ga0495599_0018711 3300046678 Bacteria 4316
1054 Ga0495599_0018766 3300046678 Bacteria 4310
1055 Ga0495599_0038666 3300046678 Bacteria 2998
1056 Ga0495599_0049461 3300046678 Bacteria 2635
1057 Ga0495599_0108324 3300046678 Bacteria 1731
1058 Ga0495599_0148868 3300046678 Bacteria 1451
1059 Ga0495623_0000080 3300046679 Bacteria 57432
1060 Ga0495623_0031511 3300046679 Bacteria 3408
1061 Ga0495623_0067957 3300046679 Bacteria 2223
1062 Ga0495623_0070471 3300046679 Bacteria 2178
1063 Ga0495623_0076412 3300046679 Bacteria 2078
1064 Ga0495646_0010008 3300046680 Bacteria 6029
1065 Ga0495646_0065778 3300046680 Bacteria 2145
1066 Ga0495646_0093322 3300046680 Bacteria 1734
1067 Ga0495647_0001573 3300046681 Bacteria 7044
1068 Ga0495647_0015118 3300046681 Bacteria 2699
1069 Ga0495647_0032207 3300046681 Bacteria 1953
1070 Ga0495658_0005908 3300046683 Bacteria 6008
1071 Ga0495658_0015267 3300046683 Bacteria 3938
1072 Ga0495658_0211687 3300046683 Bacteria 1211
1073 Ga0495669_0005687 3300046684 Bacteria 5200
1074 Ga0495613_0000845 3300046689 Bacteria 23540
1075 Ga0495613_0004976 3300046689 Bacteria 9981
1076 Ga0495613_0107782 3300046689 Bacteria 2009
1077 Ga0495613_0125773 3300046689 Bacteria 1839
1078 Ga0495624_0021883 3300046690 Bacteria 4235
1079 Ga0495624_0056784 3300046690 Bacteria 2462
1080 Ga0495624_0090776 3300046690 Bacteria 1885
1081 Ga0495671_0000862 3300046692 Bacteria 21694
1082 Ga0495589_0010318 3300046794 Bacteria 4852
1083 Ga0495589_0018316 3300046794 Bacteria 3591
1084 Ga0495600_0002375 3300046809 Bacteria 10763
1085 Ga0495600_0007334 3300046809 Bacteria 6738
1086 Ga0495600_0007516 3300046809 Bacteria 6670
1087 Ga0495600_0037708 3300046809 Bacteria 3143
1088 Ga0495600_0064147 3300046809 Bacteria 2401
1089 Ga0495600_0106200 3300046809 Bacteria 1829
1090 Ga0495600_0184292 3300046809 Bacteria 1345
1091 Ga0495581_0000351 3300047315 Bacteria 22939
1092 Ga0495581_0000521 3300047315 Bacteria 19689
1093 Ga0495581_0005105 3300047315 Bacteria 7602
1094 Ga0495581_0036056 3300047315 Bacteria 2861
1095 Ga0495604_0000110 3300047317 Bacteria 68659
1096 Ga0495604_0011376 3300047317 Bacteria 7062
1097 Ga0495604_0016743 3300047317 Bacteria 5864
1098 Ga0495604_0017187 3300047317 Bacteria 5787
1099 Ga0495604_0023947 3300047317 Bacteria 4873
1100 Ga0495604_0116430 3300047317 Bacteria 1940
1101 Ga0495674_0018851 3300047319 Bacteria 6417
1102 Ga0495674_0034272 3300047319 Bacteria 4592
1103 Ga0495674_0113178 3300047319 Bacteria 2298
1104 Ga0495674_0218663 3300047319 Bacteria 1575
1105 Ga0495672_0000459 3300047320 Bacteria 48101
1106 Ga0495676_0023169 3300047321 Bacteria 5392
1107 Ga0495676_0026844 3300047321 Bacteria 4948
1108 Ga0495676_0039795 3300047321 Bacteria 3889
1109 Ga0495676_0133979 3300047321 Bacteria 1784
1110 Ga0495680_0000470 3300047322 Bacteria 45402
1111 Ga0495680_0016062 3300047322 Bacteria 6437
1112 Ga0495680_0018088 3300047322 Bacteria 5996
1113 Ga0495680_0054190 3300047322 Bacteria 3115
1114 Ga0495680_0054251 3300047322 Bacteria 3113
1115 Ga0495680_0132445 3300047322 Bacteria 1831
1116 Ga0495680_0140073 3300047322 Bacteria 1770
1117 Ga0495680_0154501 3300047322 Bacteria 1670
1118 Ga0495680_0172957 3300047322 Bacteria 1563
1119 Ga0495675_0001308 3300047444 Bacteria 15081
1120 Ga0495675_0012268 3300047444 Bacteria 5394
1121 Ga0495675_0012301 3300047444 Bacteria 5387
1122 Ga0495675_0045652 3300047444 Bacteria 2790
1123 Ga0495685_009173 3300047447 Bacteria 3299
1124 Ga0495685_018896 3300047447 Bacteria 2366
1125 Ga0495684_0007979 3300047471 Bacteria 8181
1126 Ga0495684_0015817 3300047471 Bacteria 5807
1127 Ga0495684_0016585 3300047471 Bacteria 5674
1128 Ga0495684_0044762 3300047471 Bacteria 3387
1129 Ga0495684_0081883 3300047471 Bacteria 2449
1130 Ga0495684_0116175 3300047471 Bacteria 2017
1131 Ga0495684_0176765 3300047471 Bacteria 1584
1132 Ga0495593_0002534 3300047673 Bacteria 10972
1133 Ga0495593_0008687 3300047673 Bacteria 5903
1134 Ga0495593_0012098 3300047673 Bacteria 4940
1135 Ga0495602_0000345 3300048088 Bacteria 42944
1136 Ga0495602_0017183 3300048088 Bacteria 7254
1137 Ga0495602_0049716 3300048088 Bacteria 3753
1138 Ga0495602_0116355 3300048088 Bacteria 2160
1139 Ga0495602_0286427 3300048088 Bacteria 1211
1140 Ga0496100_0011379 3300048903 Bacteria 5064
1141 Ga0496100_0034446 3300048903 Bacteria 3178
1142 Ga0496100_0044118 3300048903 Bacteria 2854
1143 Ga0496101_0011569 3300048904 Bacteria 5859
1144 Ga0496101_0029917 3300048904 Bacteria 3812
1145 Ga0496101_0061222 3300048904 Bacteria 2733
1146 Ga0496101_0072304 3300048904 Bacteria 2531
1147 Ga0496102_0000121 3300048905 Bacteria 112133
1148 Ga0496102_0017751 3300048905 Bacteria 6237
1149 Ga0496102_0018389 3300048905 Bacteria 6141
1150 Ga0496102_0032155 3300048905 Bacteria 4713
1151 Ga0496102_0107091 3300048905 Bacteria 2602
1152 Ga0496102_0165760 3300048905 Bacteria 2079
1153 Ga0496102_0191357 3300048905 Bacteria 1928
1154 Ga0496103_0000224 3300048906 Bacteria 55730
1155 Ga0496103_0005303 3300048906 Bacteria 7733
1156 Ga0496103_0025461 3300048906 Bacteria 3576
1157 Ga0496103_0039407 3300048906 Bacteria 2903
1158 Ga0496103_0133196 3300048906 Bacteria 1588
1159 Ga0496103_0145545 3300048906 Bacteria 1517
1160 Ga0496104_0004532 3300048907 Bacteria 12107
1161 Ga0496104_0006922 3300048907 Bacteria 10002
1162 Ga0496104_0007859 3300048907 Bacteria 9455
1163 Ga0496104_0011347 3300048907 Bacteria 7974
1164 Ga0496104_0016014 3300048907 Bacteria 6807
1165 Ga0496104_0033156 3300048907 Bacteria 4808
1166 Ga0496104_0077574 3300048907 Bacteria 3165
1167 Ga0496105_0007753 3300048908 Bacteria 8329
1168 Ga0496105_0025217 3300048908 Bacteria 4837
1169 Ga0496105_0031764 3300048908 Bacteria 4330
1170 Ga0496105_0044914 3300048908 Bacteria 3645
1171 Ga0496105_0055772 3300048908 Bacteria 3262
1172 Ga0496105_0091186 3300048908 Bacteria 2517
1173 Ga0496105_0177619 3300048908 Bacteria 1744
1174 Ga0496106_0051571 3300048909 Bacteria 3102
1175 Ga0496106_0080505 3300048909 Bacteria 2501
1176 Ga0496106_0106791 3300048909 Bacteria 2176
1177 Ga0496106_0171546 3300048909 Bacteria 1719
1178 Ga0496107_0012475 3300048910 Bacteria 5931
1179 Ga0496107_0023821 3300048910 Bacteria 4327
1180 Ga0496107_0039362 3300048910 Bacteria 3391
1181 Ga0496108_0013234 3300048911 Bacteria 6724
1182 Ga0496108_0015337 3300048911 Bacteria 6251
1183 Ga0496108_0023390 3300048911 Bacteria 5084
1184 Ga0496108_0239178 3300048911 Bacteria 1579
1185 Ga0496109_0010382 3300048912 Bacteria 7953
1186 Ga0496109_0017894 3300048912 Bacteria 6219
1187 Ga0496109_0031113 3300048912 Bacteria 4787
1188 Ga0496109_0048341 3300048912 Bacteria 3871
1189 Ga0496109_0107561 3300048912 Bacteria 2591
1190 Ga0496110_0000640 3300048913 Bacteria 23997
1191 Ga0496110_0003291 3300048913 Bacteria 12331
1192 Ga0496110_0010185 3300048913 Bacteria 7639
1193 Ga0496110_0011073 3300048913 Bacteria 7364
1194 Ga0496110_0014565 3300048913 Bacteria 6534
1195 Ga0496110_0061335 3300048913 Bacteria 3318
1196 Ga0496110_0077614 3300048913 Bacteria 2955
1197 Ga0496110_0284975 3300048913 Bacteria 1504
1198 Ga0496110_0325162 3300048913 Bacteria 1401
1199 Ga0496110_0352531 3300048913 Bacteria 1340
1200 Ga0496111_0010632 3300048914 Bacteria 6185
1201 Ga0496111_0033772 3300048914 Bacteria 3650
1202 Ga0496111_0050523 3300048914 Bacteria 3000
1203 Ga0496111_0073792 3300048914 Bacteria 2484
1204 Ga0496111_0114534 3300048914 Bacteria 1988
1205 Ga0496111_0115037 3300048914 Bacteria 1983
1206 Ga0496112_0002361 3300048915 Bacteria 15165
1207 Ga0496112_0027178 3300048915 Bacteria 5517
1208 Ga0496112_0068395 3300048915 Bacteria 3507
1209 Ga0496112_0143814 3300048915 Bacteria 2354
1210 Ga0496112_0170150 3300048915 Bacteria 2144
1211 Ga0496113_0026225 3300048916 Bacteria 4164
1212 Ga0496113_0115992 3300048916 Bacteria 2089
1213 Ga0496113_0184209 3300048916 Bacteria 1655
1214 Ga0496114_0000840 3300048917 Bacteria 23001
1215 Ga0496114_0001257 3300048917 Bacteria 19194
1216 Ga0496114_0002103 3300048917 Bacteria 15142
1217 Ga0496114_0009000 3300048917 Bacteria 7915
1218 Ga0496114_0019711 3300048917 Bacteria 5467
1219 Ga0496114_0062677 3300048917 Bacteria 3112
1220 Ga0496114_0093864 3300048917 Bacteria 2552
1221 Ga0496114_0129640 3300048917 Bacteria 2177
1222 Ga0496114_0148994 3300048917 Bacteria 2029
1223 Ga0496114_0239133 3300048917 Bacteria 1596
1224 Ga0496114_0245293 3300048917 Bacteria 1576
1225 Ga0496114_0334493 3300048917 Bacteria 1339
1226 Ga0496115_0016938 3300048918 Bacteria 5559
1227 Ga0496115_0024948 3300048918 Bacteria 4651
1228 Ga0496115_0034855 3300048918 Bacteria 3978
1229 Ga0496115_0049785 3300048918 Bacteria 3355
1230 Ga0496115_0051318 3300048918 Bacteria 3307
1231 Ga0496115_0087035 3300048918 Bacteria 2549
1232 Ga0496115_0088232 3300048918 Bacteria 2532
1233 Ga0496115_0125518 3300048918 Bacteria 2114
1234 Ga0496115_0169186 3300048918 Bacteria 1807
1235 Ga0496116_0001687 3300048919 Bacteria 24198
1236 Ga0496116_0002425 3300048919 Bacteria 19649
1237 Ga0496117_0022116 3300048920 Bacteria 5109
1238 Ga0496117_0045443 3300048920 Bacteria 3171
1239 Ga0496118_0000322 3300048921 Bacteria 82886
1240 Ga0496118_0000462 3300048921 Bacteria 67416
1241 Ga0496118_0031380 3300048921 Bacteria 4406
1242 Ga0496118_0044709 3300048921 Bacteria 3465
1243 Ga0496118_0172570 3300048921 Bacteria 1319
1244 Ga0496119_0000104 3300048922 Bacteria 121325
1245 Ga0496120_0002351 3300048923 Bacteria 19430
1246 Ga0496121_0006448 3300048924 Bacteria 14558
1247 Ga0496121_0009278 3300048924 Bacteria 11348
1248 Ga0496121_0028527 3300048924 Bacteria 5192
1249 Ga0496121_0111659 3300048924 Bacteria 2084
1250 Ga0496121_0134614 3300048924 Bacteria 1843
1251 Ga0496121_0297850 3300048924 Bacteria 1096
1252 Ga0496123_0002402 3300048926 Bacteria 23389
1253 Ga0496124_0000459 3300048927 Bacteria 70625
1254 Ga0496125_0030253 3300048928 Bacteria 4847
1255 Ga0496125_0053137 3300048928 Bacteria 3325
1256 Ga0496126_0000037 3300048929 Bacteria 353425
1257 Ga0496126_0000999 3300048929 Bacteria 48191
1258 Ga0496126_0004694 3300048929 Bacteria 16143
1259 Ga0496126_0005936 3300048929 Bacteria 13766
1260 Ga0496126_0075454 3300048929 Bacteria 2992
1261 Ga0496126_0231817 3300048929 Bacteria 1547
1262 Ga0501294_005152 3300049517 Bacteria 1235
1263 Ga0501031_0000485 3300049568 Bacteria 23163
1264 Ga0501031_0022708 3300049568 Bacteria 4090
1265 Ga0501031_0163834 3300049568 Bacteria 1453
1266 Ga0501032_0000424 3300049569 Bacteria 35024
1267 Ga0501032_0008084 3300049569 Bacteria 7668
1268 Ga0501033_0016983 3300049570 Bacteria 5502
1269 Ga0501033_0061288 3300049570 Bacteria 2773
1270 Ga0501033_0066414 3300049570 Bacteria 2652
1271 Ga0501033_0170713 3300049570 Bacteria 1562
1272 Ga0501034_0000339 3300049571 Bacteria 81769
1273 Ga0501034_0011396 3300049571 Bacteria 9220
1274 Ga0501034_0026673 3300049571 Bacteria 5879
1275 Ga0501034_0027747 3300049571 Bacteria 5757
1276 Ga0501034_0029476 3300049571 Bacteria 5578
1277 Ga0501034_0116918 3300049571 Bacteria 2654
1278 Ga0501034_0120428 3300049571 Bacteria 2611
1279 Ga0501034_0168887 3300049571 Bacteria 2155
1280 Ga0501034_0198045 3300049571 Bacteria 1968
1281 Ga0501036_0005274 3300049572 Bacteria 10456
1282 Ga0501036_0026339 3300049572 Bacteria 4907
1283 Ga0501036_0108991 3300049572 Bacteria 2340
1284 Ga0501036_0124055 3300049572 Bacteria 2181
1285 Ga0501037_0003342 3300049573 Bacteria 11657
1286 Ga0501037_0043187 3300049573 Bacteria 3313
1287 Ga0501037_0049439 3300049573 Bacteria 3079
1288 Ga0501037_0050557 3300049573 Bacteria 3042
1289 Ga0501038_0007562 3300049574 Bacteria 10018
1290 Ga0501038_0021944 3300049574 Bacteria 5726
1291 Ga0501038_0028260 3300049574 Bacteria 4983
1292 Ga0501038_0035688 3300049574 Bacteria 4365
1293 Ga0501038_0104806 3300049574 Bacteria 2350
1294 Ga0501038_0127699 3300049574 Bacteria 2091
1295 Ga0501038_0161269 3300049574 Bacteria 1822
1296 Ga0501038_0253855 3300049574 Bacteria 1392
1297 Ga0501039_0000966 3300049575 Bacteria 20946
1298 Ga0501039_0001751 3300049575 Bacteria 16011
1299 Ga0501039_0016350 3300049575 Bacteria 5686
1300 Ga0501039_0025475 3300049575 Bacteria 4545
1301 Ga0501039_0028102 3300049575 Bacteria 4327
1302 Ga0501039_0096987 3300049575 Bacteria 2299
1303 Ga0501039_0318269 3300049575 Bacteria 1223
1304 Ga0501040_0000581 3300049576 Bacteria 22265
1305 Ga0501040_0002936 3300049576 Bacteria 11026
1306 Ga0501040_0003290 3300049576 Bacteria 10442
1307 Ga0501040_0010682 3300049576 Bacteria 6005
1308 Ga0501040_0017049 3300049576 Bacteria 4817
1309 Ga0501040_0029162 3300049576 Bacteria 3724
1310 Ga0501041_0009664 3300049577 Bacteria 5685
1311 Ga0501041_0012306 3300049577 Bacteria 5068
1312 Ga0501041_0039741 3300049577 Bacteria 2855
1313 Ga0501041_0052236 3300049577 Bacteria 2491
1314 Ga0501041_0132853 3300049577 Bacteria 1550
1315 Ga0501041_0164675 3300049577 Bacteria 1387
1316 Ga0501042_0001049 3300049578 Bacteria 15762
1317 Ga0501042_0004432 3300049578 Bacteria 8956
1318 Ga0501042_0005589 3300049578 Bacteria 8103
1319 Ga0501042_0006659 3300049578 Bacteria 7528
1320 Ga0501042_0010012 3300049578 Bacteria 6340
1321 Ga0501042_0019346 3300049578 Bacteria 4726
1322 Ga0501042_0028106 3300049578 Bacteria 3958
1323 Ga0501042_0053785 3300049578 Bacteria 2872
1324 Ga0501042_0101067 3300049578 Bacteria 2074
1325 Ga0501042_0154025 3300049578 Bacteria 1658
1326 Ga0501043_0012258 3300049579 Bacteria 6702
1327 Ga0501043_0019067 3300049579 Bacteria 5386
1328 Ga0501046_0005483 3300049580 Bacteria 11339
1329 Ga0501046_0008010 3300049580 Bacteria 9235
1330 Ga0501046_0017525 3300049580 Bacteria 5973
1331 Ga0501046_0028814 3300049580 Bacteria 4518
1332 Ga0501046_0031002 3300049580 Bacteria 4338
1333 Ga0501046_0078648 3300049580 Bacteria 2551
1334 Ga0501047_0000601 3300049581 Bacteria 38282
1335 Ga0501047_0001963 3300049581 Bacteria 19747
1336 Ga0501047_0003093 3300049581 Bacteria 15792
1337 Ga0501047_0037282 3300049581 Bacteria 4701
1338 Ga0501047_0096977 3300049581 Bacteria 2827
1339 Ga0501047_0133398 3300049581 Bacteria 2363
1340 Ga0501047_0217953 3300049581 Bacteria 1765
1341 Ga0501048_0001137 3300049582 Bacteria 19970
1342 Ga0501048_0016878 3300049582 Bacteria 5383
1343 Ga0501048_0023764 3300049582 Bacteria 4476
1344 Ga0501048_0029364 3300049582 Bacteria 3988
1345 Ga0501048_0037709 3300049582 Bacteria 3471
1346 Ga0501048_0074323 3300049582 Bacteria 2398
1347 Ga0501048_0075556 3300049582 Bacteria 2377
1348 Ga0501048_0082044 3300049582 Bacteria 2274
1349 Ga0501067_0029205 3300049583 Bacteria 3056
1350 Ga0501068_0025615 3300049584 Bacteria 3470
1351 Ga0501068_0050086 3300049584 Bacteria 2524
1352 Ga0501068_0054389 3300049584 Bacteria 2425
1353 Ga0501068_0167417 3300049584 Bacteria 1386
1354 Ga0501069_0000089 3300049585 Bacteria 43912
1355 Ga0501069_0005202 3300049585 Bacteria 6763
1356 Ga0501069_0008959 3300049585 Bacteria 5279
1357 Ga0501069_0116590 3300049585 Bacteria 1523
1358 Ga0501070_0000008 3300049586 Bacteria 199963
1359 Ga0501070_0001203 3300049586 Bacteria 23173
1360 Ga0501070_0017196 3300049586 Bacteria 6070
1361 Ga0501070_0054912 3300049586 Bacteria 3302
1362 Ga0501070_0065034 3300049586 Bacteria 3020
1363 Ga0501070_0189953 3300049586 Bacteria 1689
1364 Ga0501071_0001866 3300049587 Bacteria 12495
1365 Ga0501071_0003038 3300049587 Bacteria 10392
1366 Ga0501071_0003173 3300049587 Bacteria 10224
1367 Ga0501071_0007247 3300049587 Bacteria 7261
1368 Ga0501071_0020290 3300049587 Bacteria 4617
1369 Ga0501071_0065614 3300049587 Bacteria 2636
1370 Ga0501072_0001968 3300049588 Bacteria 15315
1371 Ga0501072_0002597 3300049588 Bacteria 13541
1372 Ga0501072_0007326 3300049588 Bacteria 8369
1373 Ga0501072_0009139 3300049588 Bacteria 7525
1374 Ga0501072_0018044 3300049588 Bacteria 5426
1375 Ga0501072_0022975 3300049588 Bacteria 4841
1376 Ga0501072_0025611 3300049588 Bacteria 4595
1377 Ga0501072_0056152 3300049588 Bacteria 3103
1378 Ga0501072_0096587 3300049588 Bacteria 2348
1379 Ga0501072_0125836 3300049588 Bacteria 2042
1380 Ga0501072_0161244 3300049588 Bacteria 1789
1381 Ga0501074_0022034 3300049590 Bacteria 4628
1382 Ga0501074_0038358 3300049590 Bacteria 3473
1383 Ga0501074_0102731 3300049590 Bacteria 2046
1384 Ga0501075_0000895 3300049591 Bacteria 18813
1385 Ga0501075_0002183 3300049591 Bacteria 12942
1386 Ga0501075_0006676 3300049591 Bacteria 7958
1387 Ga0501075_0013675 3300049591 Bacteria 5797
1388 Ga0501075_0022349 3300049591 Bacteria 4619
1389 Ga0501075_0148205 3300049591 Bacteria 1789
1390 Ga0501075_0174122 3300049591 Bacteria 1642
1391 Ga0501076_0001798 3300049592 Bacteria 14548
1392 Ga0501076_0002273 3300049592 Bacteria 13140
1393 Ga0501076_0002738 3300049592 Bacteria 12202
1394 Ga0501076_0004824 3300049592 Bacteria 9624
1395 Ga0501076_0045646 3300049592 Bacteria 3460
1396 Ga0501076_0076524 3300049592 Bacteria 2684
1397 Ga0501076_0078451 3300049592 Bacteria 2650
1398 Ga0501076_0104808 3300049592 Bacteria 2282
1399 Ga0501076_0120304 3300049592 Bacteria 2126
1400 Ga0501076_0202792 3300049592 Bacteria 1620
1401 Ga0501077_0003196 3300049593 Bacteria 9872
1402 Ga0501077_0005440 3300049593 Bacteria 7750
1403 Ga0501077_0025113 3300049593 Bacteria 3784
1404 Ga0501077_0033857 3300049593 Bacteria 3252
1405 Ga0501077_0205902 3300049593 Bacteria 1250
1406 Ga0501198_004370 3300049649 Bacteria 1962
1407 Ga0501217_005828 3300049661 Bacteria 2591
1408 Ga0501235_023528 3300049669 Bacteria 1374
1409 Ga0501249_000117 3300049679 Bacteria 24631
1410 Ga0501079_0004718 3300049741 Bacteria 10089
1411 Ga0501079_0008561 3300049741 Bacteria 7762
1412 Ga0501079_0009798 3300049741 Bacteria 7266
1413 Ga0501079_0106805 3300049741 Bacteria 2172
1414 Ga0501079_0129740 3300049741 Bacteria 1961
1415 Ga0501079_0189018 3300049741 Bacteria 1607
1416 Ga0501080_0012185 3300049742 Bacteria 7878
1417 Ga0501080_0018696 3300049742 Bacteria 6413
1418 Ga0501080_0074250 3300049742 Bacteria 3163
1419 Ga0501080_0092571 3300049742 Bacteria 2808
1420 Ga0501080_0107899 3300049742 Bacteria 2580
1421 Ga0501080_0146369 3300049742 Bacteria 2184
1422 Ga0501080_0347985 3300049742 Bacteria 1339
1423 Ga0501081_0005016 3300049743 Bacteria 8522
1424 Ga0501081_0008789 3300049743 Bacteria 6565
1425 Ga0501081_0027685 3300049743 Bacteria 3822
1426 Ga0501081_0027709 3300049743 Bacteria 3820
1427 Ga0501081_0030670 3300049743 Bacteria 3641
1428 Ga0501081_0234164 3300049743 Bacteria 1338
1429 Ga0501081_0251147 3300049743 Bacteria 1291
1430 Ga0501083_0000408 3300049744 Bacteria 27403
1431 Ga0501083_0009305 3300049744 Bacteria 6935
1432 Ga0501083_0019807 3300049744 Bacteria 4683
1433 Ga0501281_00002 3300049777 Bacteria 40846
1434 Ga0501035_0004302 3300049822 Bacteria 13526
1435 Ga0501035_0010123 3300049822 Bacteria 8752
1436 Ga0501035_0018495 3300049822 Bacteria 6420
1437 Ga0501035_0026910 3300049822 Bacteria 5258
1438 Ga0501035_0060451 3300049822 Bacteria 3373
1439 Ga0501035_0069525 3300049822 Bacteria 3121
1440 Ga0501035_0078324 3300049822 Bacteria 2920
1441 Ga0501035_0130017 3300049822 Bacteria 2196
1442 Ga0501035_0155576 3300049822 Bacteria 1982
1443 Ga0501044_0001813 3300049823 Bacteria 24900
1444 Ga0501044_0008299 3300049823 Bacteria 11385
1445 Ga0501044_0010153 3300049823 Bacteria 10234
1446 Ga0501044_0012648 3300049823 Bacteria 9138
1447 Ga0501044_0016106 3300049823 Bacteria 8036
1448 Ga0501044_0378393 3300049823 Bacteria 1331
1449 Ga0501045_0000725 3300049824 Bacteria 20990
1450 Ga0501045_0003204 3300049824 Bacteria 11188
1451 Ga0501045_0003364 3300049824 Bacteria 10954
1452 Ga0501045_0013023 3300049824 Bacteria 5863
1453 Ga0501045_0025509 3300049824 Bacteria 4250
1454 Ga0501045_0066501 3300049824 Bacteria 2646
1455 Ga0501045_0078470 3300049824 Bacteria 2434
1456 Ga0501045_0171973 3300049824 Bacteria 1613
1457 Ga0501204_000446 3300049850 Bacteria 3579
1458 nmdc:mga03n38_97111_c1 3300050490 Bacteria 1414
1459 nmdc:mga0yw44_117309_c1 3300050492 Bacteria 1711
1460 nmdc:mga0yw44_1691_c1 3300050492 Bacteria 8928
1461 nmdc:mga0yw44_2005_c1 3300050492 Bacteria 6190
1462 nmdc:mga0yw44_2625_c1 3300050492 Bacteria 7734
1463 nmdc:mga0yw44_33385_c1 3300050492 Bacteria 3006
1464 nmdc:mga0yw44_48520_c1 3300050492 Bacteria 2560
1465 nmdc:mga07m45_6297_c1 3300050496 Bacteria 5994
1466 nmdc:mga05p37_213038_c1 3300050507 Bacteria 2334
1467 nmdc:mga05p37_2208_c1 3300050507 Bacteria 22673
1468 nmdc:mga05p37_30113_c1 3300050507 Bacteria 6623
1469 nmdc:mga05p37_47073_c1 3300050507 Bacteria 5304
1470 nmdc:mga09592_135167_c1 3300050508 Bacteria 2124
1471 nmdc:mga09592_33032_c1 3300050508 Bacteria 4317
1472 nmdc:mga0qj67_181720_c1 3300050509 Bacteria 1708
1473 nmdc:mga0qj67_20395_c1 3300050509 Bacteria 5074
1474 nmdc:mga0qj67_66004_c1 3300050509 Bacteria 2882
1475 nmdc:mga0qj67_8448_c1 3300050509 Bacteria 7641
1476 nmdc:mga06r32_107748_c1 3300050510 Bacteria 2739
1477 nmdc:mga06r32_12374_c1 3300050510 Bacteria 7697
1478 nmdc:mga06r32_158411_c1 3300050510 Bacteria 2246
1479 nmdc:mga06r32_30013_c1 3300050510 Bacteria 5100
1480 nmdc:mga08y16_155061_c1 3300050511 Bacteria 2380
1481 nmdc:mga08y16_169045_c1 3300050511 Bacteria 2271
1482 nmdc:mga08y16_451430_c1 3300050511 Bacteria 1311
1483 nmdc:mga08y16_49670_c1 3300050511 Bacteria 4390
1484 nmdc:mga08y16_72585_c1 3300050511 Bacteria 3586
1485 nmdc:mga0n895_15173_c1 3300050512 Bacteria 7021
1486 nmdc:mga0n895_196045_c1 3300050512 Bacteria 2051
1487 nmdc:mga0n895_235323_c1 3300050512 Bacteria 1859
1488 nmdc:mga0n895_3276_c1 3300050512 Bacteria 12993
1489 nmdc:mga0rr50_125550_c1 3300050513 Bacteria 2049
1490 nmdc:mga0rr50_23084_c1 3300050513 Bacteria 4283
1491 nmdc:mga0rr50_335318_c1 3300050513 Bacteria 1270
1492 nmdc:mga0rr50_62699_c1 3300050513 Bacteria 2806
1493 nmdc:mga0rr50_92352_c1 3300050513 Bacteria 2360
1494 nmdc:mga08x19_223708_c1 3300050514 Bacteria 1294
1495 nmdc:mga08x19_264524_c1 3300050514 Bacteria 1189
1496 nmdc:mga08x19_4090_c1 3300050514 Bacteria 8656
1497 nmdc:mga08x19_4_c1 3300050514 Bacteria 335979
1498 nmdc:mga0a205_116864_c1 3300050515 Bacteria 2566
1499 nmdc:mga0a205_258698_c1 3300050515 Bacteria 1619
1500 Ga0495601_0004240 3300053077 Bacteria 8277
1501 Ga0495601_0020581 3300053077 Bacteria 4031
1502 Ga0495601_0026317 3300053077 Bacteria 3591
1503 Ga0495601_0043337 3300053077 Bacteria 2826
1504 Ga0495601_0104454 3300053077 Bacteria 1831
1505 Ga0495612_0003194 3300053078 Bacteria 6789
1506 Ga0495612_0017040 3300053078 Bacteria 2910
1507 Ga0495612_0052197 3300053078 Bacteria 1682
1508 Ga0500610_0000152 3300053079 Bacteria 20704
1509 Ga0495595_0000800 3300053084 Bacteria 11997
1510 Ga0495595_0018875 3300053084 Bacteria 2985
1511 Ga0495595_0024185 3300053084 Bacteria 2681
1512 Ga0495595_0062865 3300053084 Bacteria 1742
1513 Ga0495595_0096053 3300053084 Bacteria 1426
1514 Ga0495619_0005129 3300053085 Bacteria 8315
1515 Ga0495619_0008855 3300053085 Bacteria 6362
1516 Ga0495619_0016896 3300053085 Bacteria 4622
1517 Ga0495619_0158383 3300053085 Bacteria 1563
1518 Ga0500643_000188 3300053087 Bacteria 59049
1519 Ga0500641_0065901 3300053096 Bacteria 1516
1520 Ga0500650_0000017 3300053098 Bacteria 70720
1521 Ga0500593_000100 3300053117 Bacteria 32734
1522 Ga0500593_014489 3300053117 Bacteria 3384
1523 Ga0500658_0000047 3300053134 Bacteria 66543
1524 Ga0500568_0000011 3300053139 Bacteria 248947
1525 Ga0500604_0008326 3300053151 Bacteria 2751
1526 Ga0500604_0009663 3300053151 Bacteria 2571
1527 Ga0500616_0000905 3300053153 Bacteria 32539
1528 Ga0500616_0001088 3300053153 Bacteria 28313
1529 Ga0500622_0001774 3300053156 Bacteria 16503
1530 Ga0500622_0011034 3300053156 Bacteria 4931
1531 Ga0500627_0007069 3300053158 Bacteria 3877
1532 Ga0500627_0046820 3300053158 Bacteria 1875
1533 Ga0500596_002176 3300053735 Bacteria 3883
1534 Ga0501084_0000086 3300054114 Bacteria 66940
1535 Ga0501084_0002919 3300054114 Bacteria 13834
1536 Ga0501084_0007402 3300054114 Bacteria 9050
1537 Ga0501084_0024187 3300054114 Bacteria 5067
1538 Ga0501084_0033145 3300054114 Bacteria 4320
1539 Ga0501084_0049068 3300054114 Bacteria 3533
1540 Ga0501084_0068412 3300054114 Bacteria 2973
1541 Ga0501084_0076326 3300054114 Bacteria 2809
1542 Ga0501082_0010656 3300060353 Bacteria 7914
1543 Ga0501082_0012946 3300060353 Bacteria 7171
1544 Ga0501082_0017891 3300060353 Bacteria 6105
1545 Ga0501082_0020755 3300060353 Bacteria 5664
1546 Ga0501082_0033862 3300060353 Bacteria 4406
1547 Ga0501082_0039827 3300060353 Bacteria 4054
1548 Ga0501082_0130332 3300060353 Bacteria 2182
1549 Ga0466962_0015510 3300061719 Bacteria 3675
1550 Ga0466962_0017966 3300061719 Bacteria 3403
1551 Ga0530510_0001548 3300061734 Bacteria 15504
1552 Ga0530510_0001995 3300061734 Bacteria 13994
1553 Ga0530510_0003428 3300061734 Bacteria 10903
1554 Ga0530510_0006008 3300061734 Bacteria 8424
1555 Ga0530510_0012291 3300061734 Bacteria 6011
1556 Ga0530510_0013569 3300061734 Bacteria 5730
1557 Ga0530510_0136535 3300061734 Bacteria 1806

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_10056847 Ga0163162_100568474 308
2 3300045976 Ga0466967_0621354 Ga0466967_0621354_92_1045 315
3 3300041407 Ga0439447_043708 Ga0439447_043708_100_1059 317
4 3300049649 Ga0501198_004370 Ga0501198_004370_326_1294 317
5 3300005985 Ga0081539_10155366 Ga0081539_101553661 325
6 3300048924 Ga0496121_0297850 Ga0496121_0297850_67_1065 325
7 3300026118 Ga0207675_100571901 Ga0207675_1005719011 338
8 3300044765 Ga0466970_0054126 Ga0466970_0054126_21_1046 339
9 3300035695 Ga0373927_0248107 Ga0373927_0248107_20_1069 342
10 3300046472 Ga0495580_0101941 Ga0495580_0101941_927_1976 342
11 3300035111 Ga0373923_0070525 Ga0373923_0070525_33_1064 343
12 3300035118 Ga0373954_0009201 Ga0373954_0009201_3304_4335 343
13 3300050513 nmdc:mga0rr50_92352_c1 nmdc:mga0rr50_92352_c1_1299_2333 344
14 3300050514 nmdc:mga08x19_223708_c1 nmdc:mga08x19_223708_c1_46_1080 344
15 3300050514 nmdc:mga08x19_264524_c1 nmdc:mga08x19_264524_c1_30_1064 344
16 3300005445 Ga0070708_100004853 Ga0070708_10000485310 345
17 3300005467 Ga0070706_100012100 Ga0070706_1000121005 345
18 3300005468 Ga0070707_100015399 Ga0070707_1000153993 345
19 3300005518 Ga0070699_100000149 Ga0070699_10000014957 345
20 3300005536 Ga0070697_100000222 Ga0070697_10000022244 345
21 3300006028 Ga0070717_10001939 Ga0070717_100019393 345
22 3300025910 Ga0207684_10009745 Ga0207684_1000974511 345
23 3300025922 Ga0207646_10015421 Ga0207646_100154214 345
24 3300025928 Ga0207700_10291627 Ga0207700_102916271 345
25 3300025929 Ga0207664_10177398 Ga0207664_101773982 345
26 3300009545 Ga0105237_10015085 Ga0105237_100150853 351
27 3300025914 Ga0207671_10015047 Ga0207671_100150473 351
28 3300053158 Ga0500627_0046820 Ga0500627_0046820_724_1842 352
29 3300039437 Ga0436365_0012902 Ga0436365_0012902_19_1155 355
30 3300048906 Ga0496103_0145545 Ga0496103_0145545_418_1491 355
31 3300053117 Ga0500593_014489 Ga0500593_014489_1929_3077 355
32 3300053098 Ga0500650_0000017 Ga0500650_0000017_23515_24663 357
33 3300005436 Ga0070713_100099046 Ga0070713_1000990462 359
34 3300005471 Ga0070698_100008349 Ga0070698_1000083492 360
35 3300039447 Ga0436361_1186958 Ga0436361_1186958_142_1284 360
36 3300039453 Ga0436362_0131109 Ga0436362_0131109_247_1389 360
37 3300049586 Ga0501070_0189953 Ga0501070_0189953_485_1600 361
38 3300049592 Ga0501076_0004824 Ga0501076_0004824_5811_6926 361
39 3300049743 Ga0501081_0027685 Ga0501081_0027685_853_1968 361
40 3300009093 Ga0105240_10093238 Ga0105240_100932382 362
41 3300009545 Ga0105237_10077247 Ga0105237_100772473 362
42 3300010375 Ga0105239_10066734 Ga0105239_100667343 362
43 3300025949 Ga0207667_10029360 Ga0207667_100293602 362
44 3300048906 Ga0496103_0133196 Ga0496103_0133196_196_1308 362
45 3300048917 Ga0496114_0019711 Ga0496114_0019711_2512_3606 362
46 3300005437 Ga0070710_10000408 Ga0070710_1000040810 364
47 3300005468 Ga0070707_100024691 Ga0070707_1000246915 364
48 3300025898 Ga0207692_10003061 Ga0207692_100030613 364
49 3300025922 Ga0207646_10080270 Ga0207646_100802701 364
50 3300046453 Ga0495627_000110 Ga0495627_000110_55406_56548 364
51 3300046809 Ga0495600_0184292 Ga0495600_0184292_17_1117 364
52 3300048929 Ga0496126_0000999 Ga0496126_0000999_22099_23247 364
53 3300049575 Ga0501039_0025475 Ga0501039_0025475_2498_3592 364
54 3300053156 Ga0500622_0001774 Ga0500622_0001774_14885_16042 364
55 3300053156 Ga0500622_0011034 Ga0500622_0011034_1693_2850 364
56 3300025913 Ga0207695_10120527 Ga0207695_101205272 365
57 3300035086 Ga0373934_0000074 Ga0373934_0000074_25894_27036 365
58 3300035111 Ga0373923_0003312 Ga0373923_0003312_14_1111 365
59 3300035117 Ga0373953_0001822 Ga0373953_0001822_4298_5440 365
60 3300035118 Ga0373954_0008571 Ga0373954_0008571_544_1686 365
61 3300035119 Ga0373956_0001407 Ga0373956_0001407_4750_5892 365
62 3300035120 Ga0373957_0000056 Ga0373957_0000056_7789_8931 365
63 3300035410 Ga0373924_0002191 Ga0373924_0002191_4923_6065 365
64 3300035724 Ga0373933_0000005 Ga0373933_0000005_110902_112044 365
65 3300036401 Ga0373937_0000278 Ga0373937_0000278_21949_23091 365
66 3300046454 Ga0495592_0000010 Ga0495592_0000010_128401_129543 365
67 3300046462 Ga0495651_0000006 Ga0495651_0000006_25721_26863 365
68 3300046463 Ga0495653_0062265 Ga0495653_0062265_105_1247 365
69 3300046472 Ga0495580_0101173 Ga0495580_0101173_895_1992 365
70 3300046511 Ga0495608_0000243 Ga0495608_0000243_7380_8522 365
71 3300046516 Ga0495628_0000566 Ga0495628_0000566_26575_27717 365
72 3300046529 Ga0495652_0000415 Ga0495652_0000415_18365_19507 365
73 3300046535 Ga0495586_0009784 Ga0495586_0009784_14_1111 365
74 3300046536 Ga0495587_0000049 Ga0495587_0000049_26362_27504 365
75 3300046559 Ga0495667_0000041 Ga0495667_0000041_25716_26858 365
76 3300046675 Ga0495657_0000126 Ga0495657_0000126_31055_32197 365
77 3300046678 Ga0495599_0000208 Ga0495599_0000208_7798_8940 365
78 3300046679 Ga0495623_0000080 Ga0495623_0000080_18195_19337 365
79 3300046680 Ga0495646_0010008 Ga0495646_0010008_3829_4971 365
80 3300046809 Ga0495600_0007334 Ga0495600_0007334_1718_2860 365
81 3300047317 Ga0495604_0000110 Ga0495604_0000110_36491_37633 365
82 3300047322 Ga0495680_0000470 Ga0495680_0000470_18523_19665 365
83 3300047444 Ga0495675_0001308 Ga0495675_0001308_9498_10640 365
84 3300047673 Ga0495593_0012098 Ga0495593_0012098_3832_4929 365
85 3300048088 Ga0495602_0000345 Ga0495602_0000345_14355_15497 365
86 3300048928 Ga0496125_0030253 Ga0496125_0030253_1679_2821 365
87 3300053084 Ga0495595_0000800 Ga0495595_0000800_1489_2631 365
88 3300025925 Ga0207650_10052964 Ga0207650_100529642 366
89 3300048903 Ga0496100_0011379 Ga0496100_0011379_535_1713 366
90 3300048918 Ga0496115_0016938 Ga0496115_0016938_951_2108 366
91 3300031251 Ga0265327_10048452 Ga0265327_100484522 367
92 3300021388 Ga0213875_10029575 Ga0213875_100295751 368
93 3300025933 Ga0207706_10057206 Ga0207706_100572063 368
94 3300037853 Ga0436364_1227141 Ga0436364_1227141_855_1997 368
95 3300035398 Ga0316574_0011947 Ga0316574_0011947_3827_4942 369
96 3300048929 Ga0496126_0075454 Ga0496126_0075454_1577_2719 369
97 3300053151 Ga0500604_0009663 Ga0500604_0009663_1302_2417 369
98 3300013306 Ga0163162_10224878 Ga0163162_102248782 370
99 3300017792 Ga0163161_10159331 Ga0163161_101593312 370
100 3300020081 Ga0206354_10807169 Ga0206354_108071692 370
101 3300020082 Ga0206353_11721640 Ga0206353_117216403 370
102 3300049578 Ga0501042_0006659 Ga0501042_0006659_4843_6027 370
103 3300009093 Ga0105240_10185438 Ga0105240_101854381 371
104 3300009545 Ga0105237_10050938 Ga0105237_100509382 371
105 3300041509 Ga0451843_1574986 Ga0451843_1574986_94_1242 371
106 3300046476 Ga0495662_0003177 Ga0495662_0003177_96_1259 371
107 3300046689 Ga0495613_0125773 Ga0495613_0125773_114_1277 371
108 iso_pu_bacteria 2551306352 2552748084 371
109 iso_pu_bacteria 2639762793 2640733522 371
110 iso_pu_bacteria 2675903507 2678230558 371
111 iso_pu_bacteria 2773857761 2774388911 371
112 iso_pu_bacteria 2773857770 2774439797 371
113 iso_pu_bacteria 2916699645 2916699715 371
114 iso_pu_bacteria 2919182534 2919183459 371
115 iso_pu_bacteria 2919506607 2919508598 371
116 iso_pu_bacteria 2984568884 2984569529 371
117 iso_pu_bacteria 8033232454 8033233553 371
118 3300048919 Ga0496116_0002425 Ga0496116_0002425_12322_13518 372
119 3300053735 Ga0500596_002176 Ga0500596_002176_289_1422 372
120 iso_pu_bacteria 2551306352 2552746647 372
121 iso_pu_bacteria 2639762793 2640734984 372
122 iso_pu_bacteria 2643221665 2644361825 372
123 iso_pu_bacteria 2675903507 2678231882 372
124 iso_pu_bacteria 2744054655 2745160634 372
125 iso_pu_bacteria 2773857761 2774389592 372
126 iso_pu_bacteria 2773857770 2774436704 372
127 iso_pu_bacteria 2919182534 2919183069 372
128 iso_pu_bacteria 2928515477 2928517940 372
129 iso_pu_bacteria 8033232454 8033233388 372
130 3300005468 Ga0070707_100169209 Ga0070707_1001692092 373
131 3300014497 Ga0182008_10002889 Ga0182008_100028898 373
132 3300015261 Ga0182006_1000214 Ga0182006_100021427 373
133 3300025910 Ga0207684_10014241 Ga0207684_100142412 373
134 3300042004 Ga0439445_0031973 Ga0439445_0031973_208_1353 373
135 3300042006 Ga0439432_032374 Ga0439432_032374_396_1541 373
136 3300042007 Ga0439449_0001300 Ga0439449_0001300_2708_3853 373
137 3300048915 Ga0496112_0143814 Ga0496112_0143814_102_1229 373
138 3300053134 Ga0500658_0000047 Ga0500658_0000047_21296_22441 373
139 iso_pu_bacteria 2501939600 2501940916 373
140 iso_pu_bacteria 2856858025 2856861817 373
141 iso_pu_bacteria 2867507094 2867508492 373
142 iso_pu_bacteria 2919506607 2919506965 373
143 iso_pu_bacteria 649633069 649812415 373
144 3300006028 Ga0070717_10065448 Ga0070717_100654484 374
145 3300041509 Ga0451843_0067489 Ga0451843_0067489_328_1464 374
146 3300049571 Ga0501034_0011396 Ga0501034_0011396_4843_5991 374
147 iso_pu_bacteria 2593339131 2595088439 374
148 iso_pu_bacteria 2626541554 2626636376 374
149 iso_pu_bacteria 2671180330 2672334260 374
150 iso_pu_bacteria 2738541275 2738709073 374
151 iso_pu_bacteria 2738541301 2738847498 374
152 iso_pu_bacteria 2738541304 2738863227 374
153 iso_pu_bacteria 2738543017 2739268153 374
154 iso_pu_bacteria 2738543022 2739295745 374
155 iso_pu_bacteria 2738543033 2739357423 374
156 iso_pu_bacteria 2757320391 2757565484 374
157 iso_pu_bacteria 2775507177 2777763903 374
158 iso_pu_bacteria 2775507192 2777837009 374
159 iso_pu_bacteria 2816332186 2816865838 374
160 iso_pu_bacteria 2842682962 2842685863 374
161 iso_pu_bacteria 2849139964 2849142075 374
162 iso_pu_bacteria 2857581216 2857585902 374
163 iso_pu_bacteria 2857586860 2857588220 374
164 iso_pu_bacteria 2898907183 2898907217 374
165 iso_pu_bacteria 2928100450 2928102157 374
166 iso_pu_bacteria 2928959182 2928962401 374
167 iso_pu_bacteria 2929183550 2929186610 374
168 iso_pu_bacteria 2929212328 2929212719 374
169 iso_pu_bacteria 2936340661 2936342873 374
170 iso_pu_bacteria 2936361878 2936364301 374
171 iso_pu_bacteria 2954691527 2954692323 374
172 iso_pu_bacteria 2954701450 2954707389 374
173 iso_pu_bacteria 2977254563 2977259176 374
174 iso_pu_bacteria 2990275345 2990280205 374
175 iso_pu_bacteria 3001892409 3001895645 374
176 iso_pu_bacteria 3006826541 3006829265 374
177 iso_pu_bacteria 3006973921 3006978211 374
178 iso_pu_bacteria 8022792930 8022793391 374
179 iso_pu_bacteria 8057582654 8057587118 374
180 iso_pu_bacteria 8057632132 8057634880 374
181 3300003856 Ga0058692_1000063 Ga0058692_100006367 375
182 3300005289 Ga0065704_10003837 Ga0065704_100038372 375
183 3300005353 Ga0070669_100113457 Ga0070669_1001134572 375
184 3300005548 Ga0070665_100055258 Ga0070665_1000552583 375
185 3300005616 Ga0068852_100220995 Ga0068852_1002209952 375
186 3300009011 Ga0105251_10029432 Ga0105251_100294322 375
187 3300009011 Ga0105251_10039953 Ga0105251_100399532 375
188 3300009036 Ga0105244_10001754 Ga0105244_100017542 375
189 3300009036 Ga0105244_10005353 Ga0105244_100053532 375
190 3300009092 Ga0105250_10000642 Ga0105250_100006422 375
191 3300009092 Ga0105250_10053938 Ga0105250_100539382 375
192 3300009093 Ga0105240_10203795 Ga0105240_102037952 375
193 3300009101 Ga0105247_10000251 Ga0105247_1000025122 375
194 3300009148 Ga0105243_10000155 Ga0105243_1000015554 375
195 3300009545 Ga0105237_10063603 Ga0105237_100636033 375
196 3300013100 Ga0157373_10057099 Ga0157373_100570992 375
197 3300013102 Ga0157371_10068432 Ga0157371_100684322 375
198 3300013308 Ga0157375_10489359 Ga0157375_104893592 375
199 3300017792 Ga0163161_10044709 Ga0163161_100447092 375
200 3300025711 Ga0207696_1001447 Ga0207696_10014472 375
201 3300025711 Ga0207696_1002892 Ga0207696_10028922 375
202 3300025728 Ga0207655_1000612 Ga0207655_100061214 375
203 3300025728 Ga0207655_1000947 Ga0207655_100094711 375
204 3300025728 Ga0207655_1025039 Ga0207655_10250392 375
205 3300025735 Ga0207713_1001490 Ga0207713_100149015 375
206 3300025735 Ga0207713_1002830 Ga0207713_10028302 375
207 3300025900 Ga0207710_10000009 Ga0207710_10000009244 375
208 3300025913 Ga0207695_10145102 Ga0207695_101451022 375
209 3300025914 Ga0207671_10038462 Ga0207671_100384623 375
210 3300025935 Ga0207709_10000001 Ga0207709_100000011804 375
211 3300027312 Ga0209371_1000006 Ga0209371_1000006962 375
212 3300028379 Ga0268266_10060121 Ga0268266_100601212 375
213 3300030500 Ga0268256_1000007 Ga0268256_1000007962 375
214 3300041411 Ga0439466_0021474 Ga0439466_0021474_153_1292 375
215 3300046501 Ga0495607_0103113 Ga0495607_0103113_251_1390 375
216 3300046522 Ga0495643_0094826 Ga0495643_0094826_255_1394 375
217 3300046525 Ga0495663_0000041 Ga0495663_0000041_17706_18845 375
218 3300046525 Ga0495663_0012611 Ga0495663_0012611_612_1751 375
219 3300046684 Ga0495669_0005687 Ga0495669_0005687_726_1856 375
220 3300046692 Ga0495671_0000862 Ga0495671_0000862_483_1622 375
221 3300047322 Ga0495680_0172957 Ga0495680_0172957_414_1547 375
222 3300048919 Ga0496116_0001687 Ga0496116_0001687_13461_14591 375
223 3300053079 Ga0500610_0000152 Ga0500610_0000152_9920_11050 375
224 iso_pu_bacteria 2506783011 2506867910 375
225 iso_pu_bacteria 2523231044 2523384783 375
226 iso_pu_bacteria 2738541299 2738837937 375
227 iso_pu_bacteria 2773857933 2774904332 375
228 iso_pu_bacteria 2788500588 2791211710 375
229 iso_pu_bacteria 2852673933 2852674059 375
230 iso_pu_bacteria 2894772417 2894776755 375
231 iso_pu_bacteria 2904606771 2904609068 375
232 iso_pu_bacteria 2912723979 2912727207 375
233 iso_pu_bacteria 2928510474 2928510666 375
234 iso_pu_bacteria 2939593269 2939597928 375
235 iso_pu_bacteria 2995463766 2995464186 375
236 iso_pu_bacteria 8055531788 8055532291 375
237 3300003203 JGI25406J46586_10000099 JGI25406J46586_1000009932 376
238 3300003578 Ga0006562J51391_1041968 Ga0006562J51391_10419681 376
239 3300003856 Ga0058692_1000001 Ga0058692_1000001463 376
240 3300005289 Ga0065704_10010176 Ga0065704_100101762 376
241 3300005295 Ga0065707_10118720 Ga0065707_101187202 376
242 3300005353 Ga0070669_100005928 Ga0070669_1000059286 376
243 3300005536 Ga0070697_100119837 Ga0070697_1001198372 376
244 3300005545 Ga0070695_100032163 Ga0070695_1000321632 376
245 3300005546 Ga0070696_100052323 Ga0070696_1000523233 376
246 3300005564 Ga0070664_100215100 Ga0070664_1002151002 376
247 3300005617 Ga0068859_100013427 Ga0068859_1000134276 376
248 3300005843 Ga0068860_100144017 Ga0068860_1001440172 376
249 3300006914 Ga0075436_100017334 Ga0075436_1000173343 376
250 3300006931 Ga0097620_100013427 Ga0097620_1000134276 376
251 3300009011 Ga0105251_10007705 Ga0105251_100077053 376
252 3300009094 Ga0111539_10054923 Ga0111539_100549232 376
253 3300009147 Ga0114129_10018930 Ga0114129_100189306 376
254 3300009148 Ga0105243_10000010 Ga0105243_10000010100 376
255 3300009553 Ga0105249_10000305 Ga0105249_1000030523 376
256 3300009553 Ga0105249_10001408 Ga0105249_1000140814 376
257 3300013105 Ga0157369_10053243 Ga0157369_100532432 376
258 3300017792 Ga0163161_10042245 Ga0163161_100422454 376
259 3300021358 Ga0213873_10000130 Ga0213873_100001306 376
260 3300021384 Ga0213876_10000004 Ga0213876_10000004847 376
261 3300025711 Ga0207696_1004519 Ga0207696_10045195 376
262 3300025728 Ga0207655_1001468 Ga0207655_100146818 376
263 3300025728 Ga0207655_1001487 Ga0207655_100148717 376
264 3300025728 Ga0207655_1004432 Ga0207655_10044324 376
265 3300025728 Ga0207655_1004629 Ga0207655_10046294 376
266 3300025735 Ga0207713_1003827 Ga0207713_10038278 376
267 3300025900 Ga0207710_10000005 Ga0207710_10000005432 376
268 3300025923 Ga0207681_10021318 Ga0207681_100213185 376
269 3300025935 Ga0207709_10000001 Ga0207709_10000001356 376
270 3300025945 Ga0207679_10190171 Ga0207679_101901712 376
271 3300025961 Ga0207712_10001509 Ga0207712_1000150911 376
272 3300026116 Ga0207674_10266163 Ga0207674_102661632 376
273 3300027312 Ga0209371_1000008 Ga0209371_1000008589 376
274 3300027907 Ga0207428_10089450 Ga0207428_100894502 376
275 3300030500 Ga0268256_1000009 Ga0268256_1000009589 376
276 3300030760 Ga0265762_1006823 Ga0265762_10068232 376
277 3300039145 Ga0237816_01881 Ga0237816_01881_315_1481 376
278 3300039437 Ga0436365_0075484 Ga0436365_0075484_4632_5774 376
279 3300039453 Ga0436362_0035386 Ga0436362_0035386_7538_8680 376
280 3300045976 Ga0466967_0089070 Ga0466967_0089070_292_1431 376
281 3300046660 Ga0495625_0076269 Ga0495625_0076269_773_1915 376
282 3300048924 Ga0496121_0009278 Ga0496121_0009278_2768_3931 376
283 3300048927 Ga0496124_0000459 Ga0496124_0000459_28416_29579 376
284 3300050507 nmdc:mga05p37_213038_c1 nmdc:mga05p37_213038_c1_565_1734 376
285 3300050511 nmdc:mga08y16_155061_c1 nmdc:mga08y16_155061_c1_646_1815 376
286 3300050514 nmdc:mga08x19_4_c1 nmdc:mga08x19_4_c1_212904_214040 376
287 3300053096 Ga0500641_0065901 Ga0500641_0065901_151_1317 376
288 iso_pu_bacteria 2547132424 2548692936 376
289 iso_pu_bacteria 2773857933 2774905752 376
290 iso_pu_bacteria 2773857933 2774905893 376
291 iso_pu_bacteria 2919713450 2919717854 376
292 iso_pu_bacteria 2929199973 2929201291 376
293 iso_pu_bacteria 3002998708 3003006308 376
294 iso_pu_bacteria 8055909800 8055910058 376
295 3300003187 JGI25151J46595_10003056 JGI25151J46595_100030566 377
296 3300005328 Ga0070676_10041771 Ga0070676_100417711 377
297 3300005329 Ga0070683_100024318 Ga0070683_1000243184 377
298 3300005329 Ga0070683_100254800 Ga0070683_1002548002 377
299 3300005334 Ga0068869_100081247 Ga0068869_1000812472 377
300 3300005338 Ga0068868_100002141 Ga0068868_1000021412 377
301 3300005344 Ga0070661_100097130 Ga0070661_1000971302 377
302 3300005354 Ga0070675_100000935 Ga0070675_10000093513 377
303 3300005366 Ga0070659_100003482 Ga0070659_1000034822 377
304 3300005441 Ga0070700_100002856 Ga0070700_1000028564 377
305 3300005457 Ga0070662_100037024 Ga0070662_1000370242 377
306 3300005535 Ga0070684_100183608 Ga0070684_1001836082 377
307 3300005564 Ga0070664_100000402 Ga0070664_10000040238 377
308 3300005577 Ga0068857_100010684 Ga0068857_1000106842 377
309 3300005616 Ga0068852_100036367 Ga0068852_1000363675 377
310 3300005841 Ga0068863_100026479 Ga0068863_1000264795 377
311 3300005844 Ga0068862_100005914 Ga0068862_1000059147 377
312 3300009094 Ga0111539_10000944 Ga0111539_1000094413 377
313 3300013105 Ga0157369_10110381 Ga0157369_101103812 377
314 3300021388 Ga0213875_10051292 Ga0213875_100512922 377
315 3300025294 Ga0209025_1001208 Ga0209025_10012086 377
316 3300025909 Ga0207705_10146877 Ga0207705_101468772 377
317 3300025920 Ga0207649_10080394 Ga0207649_100803942 377
318 3300025926 Ga0207659_10106030 Ga0207659_101060302 377
319 3300025929 Ga0207664_10028924 Ga0207664_100289244 377
320 3300025932 Ga0207690_10040941 Ga0207690_100409412 377
321 3300025933 Ga0207706_10013671 Ga0207706_100136714 377
322 3300025940 Ga0207691_10090507 Ga0207691_100905072 377
323 3300025942 Ga0207689_10009281 Ga0207689_100092815 377
324 3300025945 Ga0207679_10194987 Ga0207679_101949872 377
325 3300026067 Ga0207678_10042538 Ga0207678_100425382 377
326 3300026075 Ga0207708_10006195 Ga0207708_100061955 377
327 3300026116 Ga0207674_10024371 Ga0207674_100243715 377
328 3300026142 Ga0207698_10016317 Ga0207698_100163173 377
329 3300028381 Ga0268264_10059779 Ga0268264_100597794 377
330 3300031824 Ga0307413_10092852 Ga0307413_100928522 377
331 3300031995 Ga0307409_100106607 Ga0307409_1001066072 377
332 3300032002 Ga0307416_100237259 Ga0307416_1002372592 377
333 3300037853 Ga0436364_0033704 Ga0436364_0033704_462_1610 377
334 3300037853 Ga0436364_0802940 Ga0436364_0802940_5222_6364 377
335 3300039437 Ga0436365_1202098 Ga0436365_1202098_15243_16391 377
336 3300039447 Ga0436361_0374946 Ga0436361_0374946_1705_2853 377
337 3300044656 Ga0466969_0016901 Ga0466969_0016901_1346_2488 377
338 3300044684 Ga0466966_0011220 Ga0466966_0011220_3542_4684 377
339 3300044684 Ga0466966_0068845 Ga0466966_0068845_107_1249 377
340 3300044693 Ga0466961_0018481 Ga0466961_0018481_1446_2588 377
341 3300046531 Ga0495665_0003630 Ga0495665_0003630_1803_2945 377
342 3300047315 Ga0495581_0005105 Ga0495581_0005105_5374_6516 377
343 3300048913 Ga0496110_0010185 Ga0496110_0010185_5441_6589 377
344 3300049569 Ga0501032_0008084 Ga0501032_0008084_4133_5281 377
345 3300049570 Ga0501033_0061288 Ga0501033_0061288_902_2050 377
346 3300049570 Ga0501033_0170713 Ga0501033_0170713_333_1481 377
347 3300049571 Ga0501034_0027747 Ga0501034_0027747_2355_3503 377
348 3300049571 Ga0501034_0168887 Ga0501034_0168887_655_1803 377
349 3300049573 Ga0501037_0043187 Ga0501037_0043187_862_2010 377
350 3300049574 Ga0501038_0161269 Ga0501038_0161269_648_1796 377
351 3300049577 Ga0501041_0164675 Ga0501041_0164675_124_1263 377
352 3300049580 Ga0501046_0028814 Ga0501046_0028814_2272_3420 377
353 3300049581 Ga0501047_0001963 Ga0501047_0001963_7230_8369 377
354 3300049581 Ga0501047_0133398 Ga0501047_0133398_863_2011 377
355 3300049582 Ga0501048_0082044 Ga0501048_0082044_417_1565 377
356 3300049585 Ga0501069_0008959 Ga0501069_0008959_3279_4427 377
357 3300049586 Ga0501070_0017196 Ga0501070_0017196_1429_2577 377
358 3300049744 Ga0501083_0000408 Ga0501083_0000408_9888_11033 377
359 3300049822 Ga0501035_0018495 Ga0501035_0018495_2165_3313 377
360 3300049822 Ga0501035_0026910 Ga0501035_0026910_836_1984 377
361 3300049822 Ga0501035_0078324 Ga0501035_0078324_1208_2350 377
362 3300049823 Ga0501044_0001813 Ga0501044_0001813_2393_3541 377
363 3300049823 Ga0501044_0016106 Ga0501044_0016106_1518_2666 377
364 3300001976 JGI24752J21851_1000031 JGI24752J21851_10000319 378
365 3300003187 JGI25151J46595_10001297 JGI25151J46595_1000129719 378
366 3300003187 JGI25151J46595_10001914 JGI25151J46595_100019148 378
367 3300003187 JGI25151J46595_10002376 JGI25151J46595_100023765 378
368 3300003187 JGI25151J46595_10003287 JGI25151J46595_100032876 378
369 3300003187 JGI25151J46595_10018537 JGI25151J46595_100185371 378
370 3300003203 JGI25406J46586_10001854 JGI25406J46586_100018547 378
371 3300003316 rootH1_10192437 rootH1_101924371 378
372 3300003578 Ga0006562J51391_1016962 Ga0006562J51391_10169622 378
373 3300003751 Ga0055538_1000283 Ga0055538_100028312 378
374 3300003758 Ga0055532_1000229 Ga0055532_100022938 378
375 3300003781 Ga0055536_1022910 Ga0055536_10229102 378
376 3300005288 Ga0065714_10080014 Ga0065714_100800142 378
377 3300005289 Ga0065704_10077027 Ga0065704_100770272 378
378 3300005295 Ga0065707_10084189 Ga0065707_100841892 378
379 3300005331 Ga0070670_100000072 Ga0070670_10000007238 378
380 3300005331 Ga0070670_100119174 Ga0070670_1001191742 378
381 3300005331 Ga0070670_100144088 Ga0070670_1001440882 378
382 3300005333 Ga0070677_10023288 Ga0070677_100232883 378
383 3300005336 Ga0070680_100240839 Ga0070680_1002408392 378
384 3300005347 Ga0070668_100005680 Ga0070668_1000056802 378
385 3300005353 Ga0070669_100050975 Ga0070669_1000509752 378
386 3300005367 Ga0070667_100000746 Ga0070667_10000074635 378
387 3300005434 Ga0070709_10001186 Ga0070709_100011865 378
388 3300005436 Ga0070713_100020320 Ga0070713_1000203203 378
389 3300005436 Ga0070713_100141823 Ga0070713_1001418232 378
390 3300005437 Ga0070710_10000225 Ga0070710_1000022519 378
391 3300005437 Ga0070710_10039025 Ga0070710_100390252 378
392 3300005439 Ga0070711_100001574 Ga0070711_1000015748 378
393 3300005466 Ga0070685_10203052 Ga0070685_102030521 378
394 3300005468 Ga0070707_100109691 Ga0070707_1001096912 378
395 3300005471 Ga0070698_100093440 Ga0070698_1000934402 378
396 3300005518 Ga0070699_100268449 Ga0070699_1002684492 378
397 3300005530 Ga0070679_100019580 Ga0070679_1000195802 378
398 3300005539 Ga0068853_100234628 Ga0068853_1002346282 378
399 3300005578 Ga0068854_100002153 Ga0068854_1000021539 378
400 3300005616 Ga0068852_100021347 Ga0068852_1000213472 378
401 3300005617 Ga0068859_100116526 Ga0068859_1001165262 378
402 3300005617 Ga0068859_100143667 Ga0068859_1001436672 378
403 3300005618 Ga0068864_100000019 Ga0068864_100000019243 378
404 3300005618 Ga0068864_100000038 Ga0068864_10000003854 378
405 3300005719 Ga0068861_100005613 Ga0068861_1000056135 378
406 3300005841 Ga0068863_100000026 Ga0068863_10000002653 378
407 3300005841 Ga0068863_100000104 Ga0068863_10000010430 378
408 3300005842 Ga0068858_100000061 Ga0068858_100000061114 378
409 3300005844 Ga0068862_100000279 Ga0068862_10000027930 378
410 3300005844 Ga0068862_100018828 Ga0068862_1000188284 378
411 3300005937 Ga0081455_10100803 Ga0081455_101008032 378
412 3300005985 Ga0081539_10000183 Ga0081539_10000183119 378
413 3300006028 Ga0070717_10145010 Ga0070717_101450102 378
414 3300006038 Ga0075365_10021633 Ga0075365_100216334 378
415 3300006173 Ga0070716_100152432 Ga0070716_1001524322 378
416 3300006175 Ga0070712_100000151 Ga0070712_10000015117 378
417 3300006353 Ga0075370_10004043 Ga0075370_100040433 378
418 3300006847 Ga0075431_100010582 Ga0075431_1000105829 378
419 3300006931 Ga0097620_100116513 Ga0097620_1001165132 378
420 3300006931 Ga0097620_100143669 Ga0097620_1001436692 378
421 3300009011 Ga0105251_10000905 Ga0105251_100009058 378
422 3300009036 Ga0105244_10005044 Ga0105244_100050448 378
423 3300009092 Ga0105250_10001851 Ga0105250_100018512 378
424 3300009092 Ga0105250_10016467 Ga0105250_100164672 378
425 3300009094 Ga0111539_10113334 Ga0111539_101133342 378
426 3300009101 Ga0105247_10056251 Ga0105247_100562513 378
427 3300009148 Ga0105243_10095464 Ga0105243_100954642 378
428 3300009177 Ga0105248_10000014 Ga0105248_1000001437 378
429 3300009177 Ga0105248_10020029 Ga0105248_100200292 378
430 3300009177 Ga0105248_10085006 Ga0105248_100850063 378
431 3300009553 Ga0105249_10000048 Ga0105249_10000048143 378
432 3300011119 Ga0105246_10001817 Ga0105246_1000181711 378
433 3300013102 Ga0157371_10115375 Ga0157371_101153752 378
434 3300013250 Ga0171462_1002 Ga0171462_1002465 378
435 3300013308 Ga0157375_10010788 Ga0157375_100107885 378
436 3300014325 Ga0163163_10179161 Ga0163163_101791611 378
437 3300014326 Ga0157380_10007550 Ga0157380_100075505 378
438 3300014968 Ga0157379_10015692 Ga0157379_100156924 378
439 3300021384 Ga0213876_10046411 Ga0213876_100464112 378
440 3300021388 Ga0213875_10000174 Ga0213875_1000017423 378
441 3300025224 Ga0209784_100105 Ga0209784_10010583 378
442 3300025225 Ga0209566_100178 Ga0209566_10017830 378
443 3300025229 Ga0209147_100160 Ga0209147_10016054 378
444 3300025292 Ga0209676_1000833 Ga0209676_100083324 378
445 3300025292 Ga0209676_1001081 Ga0209676_100108128 378
446 3300025294 Ga0209025_1000107 Ga0209025_1000107164 378
447 3300025294 Ga0209025_1000945 Ga0209025_100094530 378
448 3300025294 Ga0209025_1001134 Ga0209025_100113431 378
449 3300025294 Ga0209025_1001403 Ga0209025_100140330 378
450 3300025294 Ga0209025_1001415 Ga0209025_10014159 378
451 3300025294 Ga0209025_1007148 Ga0209025_10071482 378
452 3300025294 Ga0209025_1016229 Ga0209025_10162292 378
453 3300025735 Ga0207713_1003575 Ga0207713_10035758 378
454 3300025898 Ga0207692_10000421 Ga0207692_1000042116 378
455 3300025898 Ga0207692_10005915 Ga0207692_100059154 378
456 3300025900 Ga0207710_10027386 Ga0207710_100273863 378
457 3300025904 Ga0207647_10022112 Ga0207647_100221123 378
458 3300025905 Ga0207685_10041816 Ga0207685_100418161 378
459 3300025906 Ga0207699_10000093 Ga0207699_1000009334 378
460 3300025913 Ga0207695_10296735 Ga0207695_102967352 378
461 3300025915 Ga0207693_10000132 Ga0207693_1000013240 378
462 3300025922 Ga0207646_10057499 Ga0207646_100574993 378
463 3300025925 Ga0207650_10000116 Ga0207650_1000011637 378
464 3300025928 Ga0207700_10000103 Ga0207700_1000010343 378
465 3300025929 Ga0207664_10000556 Ga0207664_1000055618 378
466 3300025929 Ga0207664_10062833 Ga0207664_100628333 378
467 3300025939 Ga0207665_10210750 Ga0207665_102107501 378
468 3300025941 Ga0207711_10000021 Ga0207711_10000021293 378
469 3300025941 Ga0207711_10008827 Ga0207711_100088272 378
470 3300025961 Ga0207712_10000148 Ga0207712_1000014852 378
471 3300025972 Ga0207668_10004092 Ga0207668_100040925 378
472 3300025981 Ga0207640_10002707 Ga0207640_100027073 378
473 3300025986 Ga0207658_10000555 Ga0207658_1000055537 378
474 3300025986 Ga0207658_10130302 Ga0207658_101303021 378
475 3300026023 Ga0207677_10138169 Ga0207677_101381692 378
476 3300026035 Ga0207703_10000149 Ga0207703_1000014966 378
477 3300026041 Ga0207639_10196246 Ga0207639_101962462 378
478 3300026067 Ga0207678_10319843 Ga0207678_103198431 378
479 3300026088 Ga0207641_10000005 Ga0207641_10000005265 378
480 3300026088 Ga0207641_10000008 Ga0207641_10000008345 378
481 3300026095 Ga0207676_10000019 Ga0207676_10000019229 378
482 3300026095 Ga0207676_10000049 Ga0207676_10000049125 378
483 3300026118 Ga0207675_100013383 Ga0207675_1000133835 378
484 3300026142 Ga0207698_10038915 Ga0207698_100389151 378
485 3300028380 Ga0268265_10000165 Ga0268265_1000016520 378
486 3300028380 Ga0268265_10152037 Ga0268265_101520371 378
487 3300028381 Ga0268264_10340054 Ga0268264_103400541 378
488 3300031456 Ga0307513_10007758 Ga0307513_1000775816 378
489 3300031456 Ga0307513_10105448 Ga0307513_101054484 378
490 3300031507 Ga0307509_10000004 Ga0307509_10000004133 378
491 3300031548 Ga0307408_100000387 Ga0307408_10000038736 378
492 3300031548 Ga0307408_100271656 Ga0307408_1002716562 378
493 3300031691 Ga0316579_10119735 Ga0316579_101197351 378
494 3300031727 Ga0316576_10023559 Ga0316576_100235593 378
495 3300031727 Ga0316576_10220302 Ga0316576_102203022 378
496 3300031728 Ga0316578_10011678 Ga0316578_100116784 378
497 3300031728 Ga0316578_10027510 Ga0316578_100275103 378
498 3300031733 Ga0316577_10005905 Ga0316577_100059053 378
499 3300031995 Ga0307409_100049254 Ga0307409_1000492542 378
500 3300035113 Ga0373936_0000119 Ga0373936_0000119_20575_21720 378
501 3300035398 Ga0316574_0006801 Ga0316574_0006801_3353_4498 378
502 3300035398 Ga0316574_0035842 Ga0316574_0035842_1342_2487 378
503 3300035398 Ga0316574_0126126 Ga0316574_0126126_201_1346 378
504 3300035695 Ga0373927_0022062 Ga0373927_0022062_1598_2755 378
505 3300036647 Ga0316582_0010895 Ga0316582_0010895_272_1417 378
506 3300036712 Ga0316584_0008628 Ga0316584_0008628_2832_3977 378
507 3300036712 Ga0316584_0050522 Ga0316584_0050522_418_1563 378
508 3300037853 Ga0436364_0676163 Ga0436364_0676163_43664_44806 378
509 3300037853 Ga0436364_1456387 Ga0436364_1456387_133_1275 378
510 3300038443 Ga0395901_0060605 Ga0395901_0060605_2682_3824 378
511 3300039062 Ga0400483_232124 Ga0400483_232124_4857_6005 378
512 3300039062 Ga0400483_245537 Ga0400483_245537_2917_4062 378
513 3300039437 Ga0436365_0758715 Ga0436365_0758715_856_2001 378
514 3300041413 Ga0439465_0053120 Ga0439465_0053120_148_1293 378
515 3300044656 Ga0466969_0002027 Ga0466969_0002027_1520_2713 378
516 3300044683 Ga0466965_0003566 Ga0466965_0003566_712_1875 378
517 3300044694 Ga0466963_0005494 Ga0466963_0005494_3656_4801 378
518 3300044694 Ga0466963_0039987 Ga0466963_0039987_492_1646 378
519 3300044706 Ga0466964_0029818 Ga0466964_0029818_598_1743 378
520 3300044719 Ga0466971_0092278 Ga0466971_0092278_133_1278 378
521 3300044735 Ga0466968_0035557 Ga0466968_0035557_507_1670 378
522 3300044842 Ga0466957_0007518 Ga0466957_0007518_1272_2417 378
523 3300045976 Ga0466967_0012564 Ga0466967_0012564_1655_2800 378
524 3300045976 Ga0466967_0024982 Ga0466967_0024982_176_1321 378
525 3300046455 Ga0495603_0018742 Ga0495603_0018742_2968_4131 378
526 3300046462 Ga0495651_0006392 Ga0495651_0006392_1104_2267 378
527 3300046472 Ga0495580_0081125 Ga0495580_0081125_391_1545 378
528 3300046501 Ga0495607_0086639 Ga0495607_0086639_221_1384 378
529 3300046512 Ga0495610_0000013 Ga0495610_0000013_105222_106370 378
530 3300046513 Ga0495616_0000032 Ga0495616_0000032_91417_92565 378
531 3300046515 Ga0495620_0006077 Ga0495620_0006077_1472_2629 378
532 3300046529 Ga0495652_0017823 Ga0495652_0017823_788_1951 378
533 3300046533 Ga0495640_0098754 Ga0495640_0098754_602_1759 378
534 3300046616 Ga0495668_0007996 Ga0495668_0007996_4443_5591 378
535 3300046665 Ga0495661_0149716 Ga0495661_0149716_20_1165 378
536 3300046794 Ga0495589_0010318 Ga0495589_0010318_3550_4713 378
537 3300046794 Ga0495589_0018316 Ga0495589_0018316_2004_3167 378
538 3300046809 Ga0495600_0064147 Ga0495600_0064147_91_1254 378
539 3300047320 Ga0495672_0000459 Ga0495672_0000459_4333_5490 378
540 3300047321 Ga0495676_0026844 Ga0495676_0026844_1086_2249 378
541 3300047321 Ga0495676_0039795 Ga0495676_0039795_1190_2353 378
542 3300047447 Ga0495685_009173 Ga0495685_009173_2019_3182 378
543 3300047447 Ga0495685_018896 Ga0495685_018896_302_1465 378
544 3300048905 Ga0496102_0107091 Ga0496102_0107091_500_1675 378
545 3300048906 Ga0496103_0005303 Ga0496103_0005303_6517_7674 378
546 3300048907 Ga0496104_0007859 Ga0496104_0007859_730_1995 378
547 3300048908 Ga0496105_0177619 Ga0496105_0177619_495_1643 378
548 3300048913 Ga0496110_0000640 Ga0496110_0000640_8817_9962 378
549 3300048913 Ga0496110_0014565 Ga0496110_0014565_4996_6156 378
550 3300048914 Ga0496111_0033772 Ga0496111_0033772_543_1688 378
551 3300048917 Ga0496114_0000840 Ga0496114_0000840_14808_16073 378
552 3300048917 Ga0496114_0001257 Ga0496114_0001257_10075_11220 378
553 3300048917 Ga0496114_0062677 Ga0496114_0062677_535_1683 378
554 3300048917 Ga0496114_0148994 Ga0496114_0148994_611_1756 378
555 3300048918 Ga0496115_0049785 Ga0496115_0049785_1048_2208 378
556 3300048920 Ga0496117_0022116 Ga0496117_0022116_2784_3941 378
557 3300048921 Ga0496118_0000322 Ga0496118_0000322_39368_40525 378
558 3300048921 Ga0496118_0000462 Ga0496118_0000462_5094_6251 378
559 3300048921 Ga0496118_0031380 Ga0496118_0031380_2929_4086 378
560 3300048924 Ga0496121_0028527 Ga0496121_0028527_2858_4015 378
561 3300048924 Ga0496121_0111659 Ga0496121_0111659_583_1740 378
562 3300048926 Ga0496123_0002402 Ga0496123_0002402_20110_21288 378
563 3300048928 Ga0496125_0053137 Ga0496125_0053137_591_1745 378
564 3300048929 Ga0496126_0000037 Ga0496126_0000037_10408_11562 378
565 3300049517 Ga0501294_005152 Ga0501294_005152_41_1198 378
566 3300049568 Ga0501031_0000485 Ga0501031_0000485_15932_17077 378
567 3300049573 Ga0501037_0050557 Ga0501037_0050557_903_2048 378
568 3300049574 Ga0501038_0021944 Ga0501038_0021944_249_1394 378
569 3300049575 Ga0501039_0028102 Ga0501039_0028102_1676_2821 378
570 3300049577 Ga0501041_0009664 Ga0501041_0009664_2170_3315 378
571 3300049578 Ga0501042_0001049 Ga0501042_0001049_3245_4390 378
572 3300049579 Ga0501043_0012258 Ga0501043_0012258_2969_4114 378
573 3300049580 Ga0501046_0017525 Ga0501046_0017525_1538_2683 378
574 3300049582 Ga0501048_0075556 Ga0501048_0075556_638_1783 378
575 3300049584 Ga0501068_0050086 Ga0501068_0050086_645_1790 378
576 3300049587 Ga0501071_0020290 Ga0501071_0020290_3175_4320 378
577 3300049588 Ga0501072_0022975 Ga0501072_0022975_3310_4455 378
578 3300049588 Ga0501072_0096587 Ga0501072_0096587_304_1446 378
579 3300049591 Ga0501075_0022349 Ga0501075_0022349_367_1512 378
580 3300049592 Ga0501076_0202792 Ga0501076_0202792_212_1495 378
581 3300049661 Ga0501217_005828 Ga0501217_005828_1428_2573 378
582 3300049669 Ga0501235_023528 Ga0501235_023528_180_1337 378
583 3300049679 Ga0501249_000117 Ga0501249_000117_21682_22836 378
584 3300049741 Ga0501079_0106805 Ga0501079_0106805_730_1875 378
585 3300049743 Ga0501081_0008789 Ga0501081_0008789_5054_6199 378
586 3300049777 Ga0501281_00002 Ga0501281_00002_38059_39216 378
587 3300049822 Ga0501035_0010123 Ga0501035_0010123_2922_4067 378
588 3300049824 Ga0501045_0171973 Ga0501045_0171973_82_1227 378
589 3300049850 Ga0501204_000446 Ga0501204_000446_303_1457 378
590 3300050492 nmdc:mga0yw44_117309_c1 nmdc:mga0yw44_117309_c1_208_1353 378
591 3300050492 nmdc:mga0yw44_2005_c1 nmdc:mga0yw44_2005_c1_2292_3437 378
592 3300050492 nmdc:mga0yw44_48520_c1 nmdc:mga0yw44_48520_c1_156_1313 378
593 3300050496 nmdc:mga07m45_6297_c1 nmdc:mga07m45_6297_c1_3688_4833 378
594 3300050509 nmdc:mga0qj67_20395_c1 nmdc:mga0qj67_20395_c1_2586_3731 378
595 3300053084 Ga0495595_0062865 Ga0495595_0062865_351_1499 378
596 3300053087 Ga0500643_000188 Ga0500643_000188_7179_8336 378
597 3300053117 Ga0500593_000100 Ga0500593_000100_28137_29282 378
598 3300053151 Ga0500604_0008326 Ga0500604_0008326_1172_2320 378
599 3300053158 Ga0500627_0007069 Ga0500627_0007069_1538_2686 378
600 3300054114 Ga0501084_0033145 Ga0501084_0033145_407_1564 378
601 3300060353 Ga0501082_0017891 Ga0501082_0017891_2910_4055 378
602 3300060353 Ga0501082_0130332 Ga0501082_0130332_698_1840 378
603 3300061719 Ga0466962_0017966 Ga0466962_0017966_2165_3310 378
604 3300061734 Ga0530510_0001995 Ga0530510_0001995_1189_2334 378
605 3300061734 Ga0530510_0013569 Ga0530510_0013569_3402_4547 378
606 iso_pu_bacteria 2508501039 2508678411 378
607 iso_pu_bacteria 2671180195 2671838875 378
608 iso_pu_bacteria 2675902999 2676201324 378
609 iso_pu_bacteria 2687453743 2689995690 378
610 iso_pu_bacteria 2738543010 2739231013 378
611 iso_pu_bacteria 2773857921 2774845900 378
612 iso_pu_bacteria 2773857922 2774857031 378
613 iso_pu_bacteria 2775507177 2777762820 378
614 iso_pu_bacteria 2818991451 2819628639 378
615 iso_pu_bacteria 2857581216 2857581761 378
616 iso_pu_bacteria 2857591370 2857592049 378
617 iso_pu_bacteria 2862290372 2862292997 378
618 iso_pu_bacteria 2862574272 2862575416 378
619 iso_pu_bacteria 3001892409 3001893021 378
620 iso_pu_bacteria 8002775197 8002779564 378
621 iso_pu_bacteria 8046352972 8046355932 378
622 iso_pu_bacteria 8047710418 8047713229 378
623 3300005328 Ga0070676_10099977 Ga0070676_100999772 379
624 3300005334 Ga0068869_100028234 Ga0068869_1000282343 379
625 3300005338 Ga0068868_100019874 Ga0068868_1000198744 379
626 3300005339 Ga0070660_100026559 Ga0070660_1000265594 379
627 3300005341 Ga0070691_10011061 Ga0070691_100110615 379
628 3300005343 Ga0070687_100055083 Ga0070687_1000550832 379
629 3300005344 Ga0070661_100068424 Ga0070661_1000684243 379
630 3300005347 Ga0070668_100001049 Ga0070668_1000010496 379
631 3300005347 Ga0070668_100087008 Ga0070668_1000870082 379
632 3300005353 Ga0070669_100016997 Ga0070669_1000169976 379
633 3300005355 Ga0070671_100015123 Ga0070671_1000151236 379
634 3300005355 Ga0070671_100118565 Ga0070671_1001185652 379
635 3300005356 Ga0070674_100027421 Ga0070674_1000274213 379
636 3300005364 Ga0070673_100051522 Ga0070673_1000515222 379
637 3300005366 Ga0070659_100140338 Ga0070659_1001403382 379
638 3300005367 Ga0070667_100012821 Ga0070667_1000128215 379
639 3300005367 Ga0070667_100021378 Ga0070667_1000213785 379
640 3300005434 Ga0070709_10014473 Ga0070709_100144733 379
641 3300005436 Ga0070713_100061729 Ga0070713_1000617292 379
642 3300005437 Ga0070710_10040416 Ga0070710_100404163 379
643 3300005439 Ga0070711_100032364 Ga0070711_1000323642 379
644 3300005444 Ga0070694_100029011 Ga0070694_1000290112 379
645 3300005457 Ga0070662_100123912 Ga0070662_1001239122 379
646 3300005539 Ga0068853_100042114 Ga0068853_1000421142 379
647 3300005544 Ga0070686_100024100 Ga0070686_1000241002 379
648 3300005545 Ga0070695_100081324 Ga0070695_1000813242 379
649 3300005547 Ga0070693_100011397 Ga0070693_1000113973 379
650 3300005549 Ga0070704_100035963 Ga0070704_1000359633 379
651 3300005563 Ga0068855_100007525 Ga0068855_1000075258 379
652 3300005614 Ga0068856_100018569 Ga0068856_1000185695 379
653 3300005614 Ga0068856_100029701 Ga0068856_1000297016 379
654 3300005614 Ga0068856_100096372 Ga0068856_1000963722 379
655 3300005615 Ga0070702_100031728 Ga0070702_1000317283 379
656 3300005616 Ga0068852_100081232 Ga0068852_1000812323 379
657 3300005617 Ga0068859_100095026 Ga0068859_1000950263 379
658 3300005617 Ga0068859_100104974 Ga0068859_1001049742 379
659 3300005840 Ga0068870_10044825 Ga0068870_100448251 379
660 3300005841 Ga0068863_100023034 Ga0068863_1000230342 379
661 3300005841 Ga0068863_100038287 Ga0068863_1000382873 379
662 3300005842 Ga0068858_100293361 Ga0068858_1002933611 379
663 3300005843 Ga0068860_100025917 Ga0068860_1000259172 379
664 3300005983 Ga0081540_1002720 Ga0081540_100272013 379
665 3300005985 Ga0081539_10013047 Ga0081539_100130473 379
666 3300006028 Ga0070717_10058473 Ga0070717_100584733 379
667 3300006175 Ga0070712_100118895 Ga0070712_1001188952 379
668 3300006237 Ga0097621_100056583 Ga0097621_1000565833 379
669 3300006358 Ga0068871_100039518 Ga0068871_1000395183 379
670 3300006871 Ga0075434_100050538 Ga0075434_1000505383 379
671 3300006931 Ga0097620_100095023 Ga0097620_1000950233 379
672 3300006931 Ga0097620_100104974 Ga0097620_1001049742 379
673 3300007076 Ga0075435_100026937 Ga0075435_1000269373 379
674 3300009094 Ga0111539_10113709 Ga0111539_101137093 379
675 3300009098 Ga0105245_10011337 Ga0105245_100113377 379
676 3300009098 Ga0105245_10036871 Ga0105245_100368714 379
677 3300009101 Ga0105247_10008026 Ga0105247_100080263 379
678 3300009148 Ga0105243_10009892 Ga0105243_100098927 379
679 3300009174 Ga0105241_10043770 Ga0105241_100437703 379
680 3300009176 Ga0105242_10028818 Ga0105242_100288183 379
681 3300009177 Ga0105248_10034717 Ga0105248_100347174 379
682 3300009545 Ga0105237_10000681 Ga0105237_1000068137 379
683 3300009545 Ga0105237_10017247 Ga0105237_100172478 379
684 3300009545 Ga0105237_10046841 Ga0105237_100468412 379
685 3300009551 Ga0105238_10068561 Ga0105238_100685613 379
686 3300009553 Ga0105249_10017159 Ga0105249_100171594 379
687 3300010375 Ga0105239_10003066 Ga0105239_100030663 379
688 3300010375 Ga0105239_10078462 Ga0105239_100784622 379
689 3300010375 Ga0105239_10174362 Ga0105239_101743622 379
690 3300010375 Ga0105239_10338014 Ga0105239_103380142 379
691 3300011119 Ga0105246_10009585 Ga0105246_100095853 379
692 3300013102 Ga0157371_10033162 Ga0157371_100331623 379
693 3300013104 Ga0157370_10048914 Ga0157370_100489143 379
694 3300013105 Ga0157369_10028383 Ga0157369_100283834 379
695 3300013297 Ga0157378_10041354 Ga0157378_100413543 379
696 3300013306 Ga0163162_10024165 Ga0163162_100241655 379
697 3300013308 Ga0157375_10048566 Ga0157375_100485664 379
698 3300014326 Ga0157380_10310741 Ga0157380_103107411 379
699 3300014968 Ga0157379_10017157 Ga0157379_100171571 379
700 3300017792 Ga0163161_10012381 Ga0163161_100123813 379
701 3300025898 Ga0207692_10078831 Ga0207692_100788312 379
702 3300025901 Ga0207688_10000991 Ga0207688_100009916 379
703 3300025906 Ga0207699_10094877 Ga0207699_100948772 379
704 3300025914 Ga0207671_10006846 Ga0207671_100068463 379
705 3300025914 Ga0207671_10052534 Ga0207671_100525343 379
706 3300025915 Ga0207693_10001324 Ga0207693_100013248 379
707 3300025918 Ga0207662_10008170 Ga0207662_100081703 379
708 3300025919 Ga0207657_10014772 Ga0207657_100147725 379
709 3300025933 Ga0207706_10000852 Ga0207706_1000085210 379
710 3300025934 Ga0207686_10137525 Ga0207686_101375252 379
711 3300025935 Ga0207709_10131806 Ga0207709_101318061 379
712 3300025939 Ga0207665_10003439 Ga0207665_100034399 379
713 3300025940 Ga0207691_10025511 Ga0207691_100255114 379
714 3300025941 Ga0207711_10018068 Ga0207711_100180685 379
715 3300025942 Ga0207689_10032937 Ga0207689_100329373 379
716 3300025949 Ga0207667_10007694 Ga0207667_1000769411 379
717 3300025949 Ga0207667_10154310 Ga0207667_101543102 379
718 3300025961 Ga0207712_10018892 Ga0207712_100188922 379
719 3300025972 Ga0207668_10157608 Ga0207668_101576081 379
720 3300025986 Ga0207658_10015000 Ga0207658_100150002 379
721 3300026023 Ga0207677_10013523 Ga0207677_100135235 379
722 3300026035 Ga0207703_10183402 Ga0207703_101834022 379
723 3300026041 Ga0207639_10023938 Ga0207639_100239383 379
724 3300026067 Ga0207678_10008904 Ga0207678_100089043 379
725 3300026078 Ga0207702_10024238 Ga0207702_100242383 379
726 3300026078 Ga0207702_10031911 Ga0207702_100319113 379
727 3300026116 Ga0207674_10092626 Ga0207674_100926262 379
728 3300026121 Ga0207683_10001681 Ga0207683_1000168111 379
729 3300026142 Ga0207698_10019935 Ga0207698_100199352 379
730 3300027907 Ga0207428_10177711 Ga0207428_101777112 379
731 3300028381 Ga0268264_10158808 Ga0268264_101588082 379
732 3300034820 Ga0373959_0009144 Ga0373959_0009144_112_1257 379
733 3300035091 Ga0373951_0007038 Ga0373951_0007038_228_1373 379
734 3300035112 Ga0373932_0011995 Ga0373932_0011995_534_1679 379
735 3300035114 Ga0373939_0005890 Ga0373939_0005890_855_2000 379
736 3300035121 Ga0373960_0010364 Ga0373960_0010364_29_1174 379
737 3300035691 Ga0373931_0002914 Ga0373931_0002914_2127_3272 379
738 3300038735 Ga0400485_02355 Ga0400485_02355_2499_3641 379
739 3300042014 Ga0439457_022828 Ga0439457_022828_31_1176 379
740 3300044658 Ga0466972_0002652 Ga0466972_0002652_860_2002 379
741 3300044683 Ga0466965_0000829 Ga0466965_0000829_6013_7155 379
742 3300044694 Ga0466963_0015101 Ga0466963_0015101_3478_4623 379
743 3300044694 Ga0466963_0052033 Ga0466963_0052033_1194_2339 379
744 3300044735 Ga0466968_0002914 Ga0466968_0002914_1474_2616 379
745 3300045976 Ga0466967_0019489 Ga0466967_0019489_838_2004 379
746 3300046461 Ga0495641_0064342 Ga0495641_0064342_10_1155 379
747 3300048904 Ga0496101_0072304 Ga0496101_0072304_427_1572 379
748 3300048905 Ga0496102_0000121 Ga0496102_0000121_103546_104691 379
749 3300048905 Ga0496102_0017751 Ga0496102_0017751_1265_2434 379
750 3300048905 Ga0496102_0018389 Ga0496102_0018389_3745_4890 379
751 3300048905 Ga0496102_0165760 Ga0496102_0165760_274_1602 379
752 3300048906 Ga0496103_0000224 Ga0496103_0000224_7452_8597 379
753 3300048906 Ga0496103_0025461 Ga0496103_0025461_1765_2910 379
754 3300048907 Ga0496104_0033156 Ga0496104_0033156_1375_2520 379
755 3300048908 Ga0496105_0091186 Ga0496105_0091186_1235_2380 379
756 3300048909 Ga0496106_0171546 Ga0496106_0171546_436_1581 379
757 3300048910 Ga0496107_0023821 Ga0496107_0023821_2482_3627 379
758 3300048911 Ga0496108_0013234 Ga0496108_0013234_3457_4602 379
759 3300048911 Ga0496108_0015337 Ga0496108_0015337_2367_3533 379
760 3300048912 Ga0496109_0010382 Ga0496109_0010382_23_1168 379
761 3300048912 Ga0496109_0017894 Ga0496109_0017894_360_1688 379
762 3300048912 Ga0496109_0031113 Ga0496109_0031113_1128_2273 379
763 3300048912 Ga0496109_0048341 Ga0496109_0048341_1831_2997 379
764 3300048913 Ga0496110_0003291 Ga0496110_0003291_7463_8608 379
765 3300048913 Ga0496110_0077614 Ga0496110_0077614_838_1983 379
766 3300048913 Ga0496110_0352531 Ga0496110_0352531_81_1250 379
767 3300048914 Ga0496111_0010632 Ga0496111_0010632_1109_2437 379
768 3300048914 Ga0496111_0050523 Ga0496111_0050523_1499_2644 379
769 3300048914 Ga0496111_0114534 Ga0496111_0114534_260_1429 379
770 3300048915 Ga0496112_0027178 Ga0496112_0027178_3863_5008 379
771 3300048917 Ga0496114_0002103 Ga0496114_0002103_6821_7966 379
772 3300048917 Ga0496114_0009000 Ga0496114_0009000_1044_2372 379
773 3300048918 Ga0496115_0051318 Ga0496115_0051318_2151_3296 379
774 3300048920 Ga0496117_0045443 Ga0496117_0045443_179_1324 379
775 3300048921 Ga0496118_0044709 Ga0496118_0044709_1450_2595 379
776 3300048921 Ga0496118_0172570 Ga0496118_0172570_88_1257 379
777 3300048922 Ga0496119_0000104 Ga0496119_0000104_8349_9494 379
778 3300048923 Ga0496120_0002351 Ga0496120_0002351_16280_17425 379
779 3300048924 Ga0496121_0006448 Ga0496121_0006448_13025_14170 379
780 3300048924 Ga0496121_0134614 Ga0496121_0134614_180_1325 379
781 3300049568 Ga0501031_0163834 Ga0501031_0163834_30_1175 379
782 3300049571 Ga0501034_0116918 Ga0501034_0116918_219_1370 379
783 3300049578 Ga0501042_0053785 Ga0501042_0053785_863_2008 379
784 3300049581 Ga0501047_0096977 Ga0501047_0096977_167_1321 379
785 3300049581 Ga0501047_0217953 Ga0501047_0217953_579_1724 379
786 3300049582 Ga0501048_0023764 Ga0501048_0023764_689_1834 379
787 3300049587 Ga0501071_0001866 Ga0501071_0001866_2402_3553 379
788 3300049587 Ga0501071_0065614 Ga0501071_0065614_1090_2235 379
789 3300049742 Ga0501080_0146369 Ga0501080_0146369_182_1336 379
790 3300049823 Ga0501044_0012648 Ga0501044_0012648_1761_2906 379
791 3300049824 Ga0501045_0066501 Ga0501045_0066501_1288_2433 379
792 3300050511 nmdc:mga08y16_169045_c1 nmdc:mga08y16_169045_c1_367_1512 379
793 3300050512 nmdc:mga0n895_15173_c1 nmdc:mga0n895_15173_c1_3849_4994 379
794 3300050513 nmdc:mga0rr50_23084_c1 nmdc:mga0rr50_23084_c1_2283_3428 379
795 3300054114 Ga0501084_0068412 Ga0501084_0068412_1007_2152 379
796 iso_pu_bacteria 2915358134 2915359925 379
797 3300000549 LJQas_1005422 LJQas_10054222 380
798 3300005327 Ga0070658_10026316 Ga0070658_100263164 380
799 3300005329 Ga0070683_100007853 Ga0070683_1000078537 380
800 3300005330 Ga0070690_100027158 Ga0070690_1000271583 380
801 3300005330 Ga0070690_100171394 Ga0070690_1001713941 380
802 3300005335 Ga0070666_10050020 Ga0070666_100500202 380
803 3300005335 Ga0070666_10129546 Ga0070666_101295462 380
804 3300005336 Ga0070680_100000261 Ga0070680_10000026132 380
805 3300005336 Ga0070680_100017787 Ga0070680_1000177872 380
806 3300005336 Ga0070680_100069143 Ga0070680_1000691434 380
807 3300005336 Ga0070680_100107679 Ga0070680_1001076791 380
808 3300005339 Ga0070660_100012370 Ga0070660_1000123704 380
809 3300005339 Ga0070660_100224956 Ga0070660_1002249561 380
810 3300005340 Ga0070689_100036774 Ga0070689_1000367743 380
811 3300005341 Ga0070691_10033980 Ga0070691_100339802 380
812 3300005343 Ga0070687_100018616 Ga0070687_1000186163 380
813 3300005343 Ga0070687_100058624 Ga0070687_1000586241 380
814 3300005345 Ga0070692_10071974 Ga0070692_100719742 380
815 3300005347 Ga0070668_100057236 Ga0070668_1000572363 380
816 3300005354 Ga0070675_100028702 Ga0070675_1000287024 380
817 3300005355 Ga0070671_100000969 Ga0070671_1000009693 380
818 3300005355 Ga0070671_100019608 Ga0070671_1000196085 380
819 3300005355 Ga0070671_100027586 Ga0070671_1000275863 380
820 3300005364 Ga0070673_100031261 Ga0070673_1000312612 380
821 3300005365 Ga0070688_100048884 Ga0070688_1000488842 380
822 3300005366 Ga0070659_100073290 Ga0070659_1000732902 380
823 3300005406 Ga0070703_10013487 Ga0070703_100134871 380
824 3300005434 Ga0070709_10000727 Ga0070709_100007278 380
825 3300005434 Ga0070709_10001840 Ga0070709_100018404 380
826 3300005434 Ga0070709_10052770 Ga0070709_100527703 380
827 3300005434 Ga0070709_10063900 Ga0070709_100639001 380
828 3300005434 Ga0070709_10168283 Ga0070709_101682831 380
829 3300005435 Ga0070714_100000601 Ga0070714_10000060119 380
830 3300005435 Ga0070714_100007663 Ga0070714_1000076634 380
831 3300005435 Ga0070714_100034070 Ga0070714_1000340703 380
832 3300005435 Ga0070714_100057419 Ga0070714_1000574192 380
833 3300005436 Ga0070713_100008515 Ga0070713_1000085155 380
834 3300005436 Ga0070713_100053270 Ga0070713_1000532703 380
835 3300005436 Ga0070713_100075790 Ga0070713_1000757902 380
836 3300005437 Ga0070710_10000234 Ga0070710_100002343 380
837 3300005437 Ga0070710_10004952 Ga0070710_100049523 380
838 3300005437 Ga0070710_10024459 Ga0070710_100244593 380
839 3300005439 Ga0070711_100000428 Ga0070711_1000004283 380
840 3300005439 Ga0070711_100000526 Ga0070711_10000052612 380
841 3300005439 Ga0070711_100001089 Ga0070711_1000010895 380
842 3300005440 Ga0070705_100012199 Ga0070705_1000121995 380
843 3300005440 Ga0070705_100043448 Ga0070705_1000434482 380
844 3300005440 Ga0070705_100052962 Ga0070705_1000529622 380
845 3300005444 Ga0070694_100065923 Ga0070694_1000659232 380
846 3300005455 Ga0070663_100001262 Ga0070663_1000012627 380
847 3300005455 Ga0070663_100002450 Ga0070663_1000024508 380
848 3300005456 Ga0070678_100068784 Ga0070678_1000687842 380
849 3300005458 Ga0070681_10000079 Ga0070681_1000007925 380
850 3300005458 Ga0070681_10057401 Ga0070681_100574014 380
851 3300005458 Ga0070681_10077913 Ga0070681_100779132 380
852 3300005458 Ga0070681_10186803 Ga0070681_101868033 380
853 3300005458 Ga0070681_10240551 Ga0070681_102405511 380
854 3300005467 Ga0070706_100001191 Ga0070706_10000119126 380
855 3300005467 Ga0070706_100023248 Ga0070706_1000232482 380
856 3300005467 Ga0070706_100023878 Ga0070706_1000238782 380
857 3300005467 Ga0070706_100117704 Ga0070706_1001177042 380
858 3300005468 Ga0070707_100000563 Ga0070707_10000056321 380
859 3300005468 Ga0070707_100001915 Ga0070707_1000019151 380
860 3300005468 Ga0070707_100009169 Ga0070707_1000091696 380
861 3300005468 Ga0070707_100042973 Ga0070707_1000429733 380
862 3300005468 Ga0070707_100133074 Ga0070707_1001330742 380
863 3300005471 Ga0070698_100000280 Ga0070698_1000002803 380
864 3300005471 Ga0070698_100000592 Ga0070698_10000059226 380
865 3300005471 Ga0070698_100000647 Ga0070698_1000006478 380
866 3300005471 Ga0070698_100006462 Ga0070698_1000064626 380
867 3300005471 Ga0070698_100013896 Ga0070698_1000138964 380
868 3300005471 Ga0070698_100017952 Ga0070698_10001795211 380
869 3300005471 Ga0070698_100083485 Ga0070698_1000834852 380
870 3300005530 Ga0070679_100000056 Ga0070679_10000005642 380
871 3300005535 Ga0070684_100004005 Ga0070684_1000040059 380
872 3300005535 Ga0070684_100071856 Ga0070684_1000718563 380
873 3300005535 Ga0070684_100086865 Ga0070684_1000868653 380
874 3300005535 Ga0070684_100134362 Ga0070684_1001343622 380
875 3300005535 Ga0070684_100154934 Ga0070684_1001549342 380
876 3300005536 Ga0070697_100250938 Ga0070697_1002509381 380
877 3300005539 Ga0068853_100298155 Ga0068853_1002981551 380
878 3300005543 Ga0070672_100010102 Ga0070672_1000101022 380
879 3300005545 Ga0070695_100004596 Ga0070695_1000045967 380
880 3300005545 Ga0070695_100193948 Ga0070695_1001939482 380
881 3300005546 Ga0070696_100010621 Ga0070696_1000106214 380
882 3300005546 Ga0070696_100045553 Ga0070696_1000455533 380
883 3300005547 Ga0070693_100009751 Ga0070693_1000097514 380
884 3300005547 Ga0070693_100040158 Ga0070693_1000401582 380
885 3300005548 Ga0070665_100318480 Ga0070665_1003184802 380
886 3300005548 Ga0070665_100425573 Ga0070665_1004255732 380
887 3300005549 Ga0070704_100051187 Ga0070704_1000511872 380
888 3300005549 Ga0070704_100056813 Ga0070704_1000568132 380
889 3300005549 Ga0070704_100074806 Ga0070704_1000748062 380
890 3300005549 Ga0070704_100077506 Ga0070704_1000775062 380
891 3300005564 Ga0070664_100014689 Ga0070664_1000146895 380
892 3300005577 Ga0068857_100028644 Ga0068857_1000286442 380
893 3300005577 Ga0068857_100077797 Ga0068857_1000777971 380
894 3300005577 Ga0068857_100095592 Ga0068857_1000955923 380
895 3300005577 Ga0068857_100125796 Ga0068857_1001257962 380
896 3300005578 Ga0068854_100009528 Ga0068854_1000095283 380
897 3300005615 Ga0070702_100104153 Ga0070702_1001041532 380
898 3300005615 Ga0070702_100150879 Ga0070702_1001508792 380
899 3300005618 Ga0068864_100022161 Ga0068864_1000221613 380
900 3300005618 Ga0068864_100055644 Ga0068864_1000556442 380
901 3300005618 Ga0068864_100095729 Ga0068864_1000957292 380
902 3300005718 Ga0068866_10023473 Ga0068866_100234732 380
903 3300005718 Ga0068866_10030458 Ga0068866_100304582 380
904 3300005719 Ga0068861_100036062 Ga0068861_1000360623 380
905 3300005719 Ga0068861_100224450 Ga0068861_1002244502 380
906 3300005840 Ga0068870_10160202 Ga0068870_101602022 380
907 3300005841 Ga0068863_100055667 Ga0068863_1000556671 380
908 3300005841 Ga0068863_100078450 Ga0068863_1000784502 380
909 3300005842 Ga0068858_100009842 Ga0068858_1000098424 380
910 3300005842 Ga0068858_100018641 Ga0068858_1000186416 380
911 3300005843 Ga0068860_100156066 Ga0068860_1001560662 380
912 3300005937 Ga0081455_10006019 Ga0081455_1000601913 380
913 3300005937 Ga0081455_10010606 Ga0081455_100106062 380
914 3300005937 Ga0081455_10012222 Ga0081455_100122223 380
915 3300005937 Ga0081455_10040682 Ga0081455_100406822 380
916 3300005937 Ga0081455_10205544 Ga0081455_102055441 380
917 3300005981 Ga0081538_10001179 Ga0081538_100011797 380
918 3300005983 Ga0081540_1001050 Ga0081540_100105017 380
919 3300005983 Ga0081540_1001110 Ga0081540_100111016 380
920 3300005985 Ga0081539_10003736 Ga0081539_100037362 380
921 3300006028 Ga0070717_10020874 Ga0070717_100208742 380
922 3300006028 Ga0070717_10051249 Ga0070717_100512493 380
923 3300006028 Ga0070717_10090203 Ga0070717_100902034 380
924 3300006028 Ga0070717_10127910 Ga0070717_101279102 380
925 3300006038 Ga0075365_10034701 Ga0075365_100347013 380
926 3300006038 Ga0075365_10042756 Ga0075365_100427562 380
927 3300006038 Ga0075365_10047169 Ga0075365_100471692 380
928 3300006038 Ga0075365_10145120 Ga0075365_101451201 380
929 3300006051 Ga0075364_10054781 Ga0075364_100547812 380
930 3300006163 Ga0070715_10008016 Ga0070715_100080163 380
931 3300006163 Ga0070715_10022431 Ga0070715_100224313 380
932 3300006173 Ga0070716_100001419 Ga0070716_1000014193 380
933 3300006173 Ga0070716_100009855 Ga0070716_1000098553 380
934 3300006173 Ga0070716_100041749 Ga0070716_1000417491 380
935 3300006173 Ga0070716_100134387 Ga0070716_1001343871 380
936 3300006175 Ga0070712_100018301 Ga0070712_1000183014 380
937 3300006175 Ga0070712_100077823 Ga0070712_1000778232 380
938 3300006175 Ga0070712_100078117 Ga0070712_1000781172 380
939 3300006175 Ga0070712_100136035 Ga0070712_1001360352 380
940 3300006353 Ga0075370_10100818 Ga0075370_101008182 380
941 3300006358 Ga0068871_100092724 Ga0068871_1000927243 380
942 3300006844 Ga0075428_100171501 Ga0075428_1001715012 380
943 3300006844 Ga0075428_100464928 Ga0075428_1004649281 380
944 3300006844 Ga0075428_100483770 Ga0075428_1004837701 380
945 3300006846 Ga0075430_100045529 Ga0075430_1000455295 380
946 3300006847 Ga0075431_100000341 Ga0075431_10000034127 380
947 3300006847 Ga0075431_100000800 Ga0075431_10000080018 380
948 3300006847 Ga0075431_100207211 Ga0075431_1002072112 380
949 3300006847 Ga0075431_100283634 Ga0075431_1002836342 380
950 3300006852 Ga0075433_10068651 Ga0075433_100686513 380
951 3300006871 Ga0075434_100026312 Ga0075434_1000263124 380
952 3300006871 Ga0075434_100204005 Ga0075434_1002040052 380
953 3300006880 Ga0075429_100023407 Ga0075429_1000234075 380
954 3300006914 Ga0075436_100043069 Ga0075436_1000430693 380
955 3300006914 Ga0075436_100126404 Ga0075436_1001264042 380
956 3300007076 Ga0075435_100006251 Ga0075435_1000062512 380
957 3300007076 Ga0075435_100016534 Ga0075435_1000165342 380
958 3300009011 Ga0105251_10019101 Ga0105251_100191013 380
959 3300009094 Ga0111539_10017082 Ga0111539_1001708210 380
960 3300009094 Ga0111539_10086300 Ga0111539_100863005 380
961 3300009098 Ga0105245_10090808 Ga0105245_100908082 380
962 3300009101 Ga0105247_10019843 Ga0105247_100198433 380
963 3300009147 Ga0114129_10006787 Ga0114129_1000678715 380
964 3300009147 Ga0114129_10008886 Ga0114129_100088864 380
965 3300009147 Ga0114129_10030723 Ga0114129_100307235 380
966 3300009147 Ga0114129_10655607 Ga0114129_106556072 380
967 3300009147 Ga0114129_10664763 Ga0114129_106647632 380
968 3300009148 Ga0105243_10080826 Ga0105243_100808263 380
969 3300009148 Ga0105243_10096414 Ga0105243_100964142 380
970 3300009174 Ga0105241_10097509 Ga0105241_100975093 380
971 3300009176 Ga0105242_10047973 Ga0105242_100479734 380
972 3300009176 Ga0105242_10087236 Ga0105242_100872362 380
973 3300009176 Ga0105242_10108327 Ga0105242_101083272 380
974 3300009177 Ga0105248_10028137 Ga0105248_100281374 380
975 3300009177 Ga0105248_10445446 Ga0105248_104454461 380
976 3300009553 Ga0105249_10070021 Ga0105249_100700212 380
977 3300009553 Ga0105249_10119965 Ga0105249_101199654 380
978 3300009553 Ga0105249_10134540 Ga0105249_101345402 380
979 3300010375 Ga0105239_10263549 Ga0105239_102635492 380
980 3300011119 Ga0105246_10037415 Ga0105246_100374153 380
981 3300011119 Ga0105246_10117137 Ga0105246_101171372 380
982 3300013100 Ga0157373_10043419 Ga0157373_100434192 380
983 3300013102 Ga0157371_10032330 Ga0157371_100323303 380
984 3300013102 Ga0157371_10107024 Ga0157371_101070242 380
985 3300013104 Ga0157370_10124500 Ga0157370_101245002 380
986 3300013104 Ga0157370_10157510 Ga0157370_101575102 380
987 3300013105 Ga0157369_10080438 Ga0157369_100804382 380
988 3300013296 Ga0157374_10029225 Ga0157374_100292251 380
989 3300013306 Ga0163162_10477674 Ga0163162_104776741 380
990 3300013308 Ga0157375_10091051 Ga0157375_100910511 380
991 3300014325 Ga0163163_10325178 Ga0163163_103251782 380
992 3300014326 Ga0157380_10173779 Ga0157380_101737792 380
993 3300014745 Ga0157377_10131214 Ga0157377_101312142 380
994 3300014968 Ga0157379_10244541 Ga0157379_102445412 380
995 3300014969 Ga0157376_10031970 Ga0157376_100319703 380
996 3300020069 Ga0197907_11483172 Ga0197907_114831721 380
997 3300020070 Ga0206356_11001745 Ga0206356_110017451 380
998 3300020070 Ga0206356_11711657 Ga0206356_117116573 380
999 3300020077 Ga0206351_10051467 Ga0206351_100514671 380
1000 3300020081 Ga0206354_10117409 Ga0206354_101174091 380
1001 3300020081 Ga0206354_11645157 Ga0206354_116451572 380
1002 3300021384 Ga0213876_10001915 Ga0213876_100019158 380
1003 3300021388 Ga0213875_10001334 Ga0213875_1000133410 380
1004 3300021388 Ga0213875_10004336 Ga0213875_100043366 380
1005 3300022467 Ga0224712_10011188 Ga0224712_100111883 380
1006 3300025898 Ga0207692_10001282 Ga0207692_100012825 380
1007 3300025898 Ga0207692_10006481 Ga0207692_100064813 380
1008 3300025898 Ga0207692_10006566 Ga0207692_100065663 380
1009 3300025898 Ga0207692_10019402 Ga0207692_100194021 380
1010 3300025898 Ga0207692_10062047 Ga0207692_100620472 380
1011 3300025898 Ga0207692_10082230 Ga0207692_100822302 380
1012 3300025899 Ga0207642_10054531 Ga0207642_100545312 380
1013 3300025901 Ga0207688_10006904 Ga0207688_100069043 380
1014 3300025901 Ga0207688_10009574 Ga0207688_100095742 380
1015 3300025904 Ga0207647_10038435 Ga0207647_100384353 380
1016 3300025905 Ga0207685_10004419 Ga0207685_100044193 380
1017 3300025905 Ga0207685_10030921 Ga0207685_100309211 380
1018 3300025905 Ga0207685_10048846 Ga0207685_100488462 380
1019 3300025906 Ga0207699_10000284 Ga0207699_1000028414 380
1020 3300025906 Ga0207699_10000662 Ga0207699_100006625 380
1021 3300025906 Ga0207699_10001582 Ga0207699_1000158210 380
1022 3300025906 Ga0207699_10005863 Ga0207699_100058632 380
1023 3300025906 Ga0207699_10017060 Ga0207699_100170602 380
1024 3300025906 Ga0207699_10020355 Ga0207699_100203552 380
1025 3300025906 Ga0207699_10091957 Ga0207699_100919572 380
1026 3300025907 Ga0207645_10009910 Ga0207645_100099104 380
1027 3300025908 Ga0207643_10008182 Ga0207643_100081822 380
1028 3300025908 Ga0207643_10012512 Ga0207643_100125124 380
1029 3300025910 Ga0207684_10001772 Ga0207684_100017721 380
1030 3300025910 Ga0207684_10004720 Ga0207684_100047205 380
1031 3300025910 Ga0207684_10008252 Ga0207684_100082527 380
1032 3300025911 Ga0207654_10222854 Ga0207654_102228541 380
1033 3300025912 Ga0207707_10000103 Ga0207707_1000010336 380
1034 3300025912 Ga0207707_10091743 Ga0207707_100917433 380
1035 3300025912 Ga0207707_10210546 Ga0207707_102105462 380
1036 3300025914 Ga0207671_10158968 Ga0207671_101589682 380
1037 3300025915 Ga0207693_10003617 Ga0207693_100036176 380
1038 3300025915 Ga0207693_10020370 Ga0207693_100203703 380
1039 3300025915 Ga0207693_10029138 Ga0207693_100291382 380
1040 3300025915 Ga0207693_10082483 Ga0207693_100824832 380
1041 3300025915 Ga0207693_10191902 Ga0207693_101919022 380
1042 3300025916 Ga0207663_10000336 Ga0207663_1000033616 380
1043 3300025916 Ga0207663_10002893 Ga0207663_100028935 380
1044 3300025916 Ga0207663_10003266 Ga0207663_100032663 380
1045 3300025916 Ga0207663_10007631 Ga0207663_100076315 380
1046 3300025916 Ga0207663_10020136 Ga0207663_100201362 380
1047 3300025916 Ga0207663_10025482 Ga0207663_100254824 380
1048 3300025916 Ga0207663_10081312 Ga0207663_100813122 380
1049 3300025917 Ga0207660_10000257 Ga0207660_1000025721 380
1050 3300025918 Ga0207662_10002153 Ga0207662_100021533 380
1051 3300025918 Ga0207662_10002244 Ga0207662_100022447 380
1052 3300025919 Ga0207657_10006511 Ga0207657_100065114 380
1053 3300025919 Ga0207657_10022199 Ga0207657_100221997 380
1054 3300025919 Ga0207657_10184560 Ga0207657_101845601 380
1055 3300025921 Ga0207652_10000256 Ga0207652_1000025612 380
1056 3300025921 Ga0207652_10031578 Ga0207652_100315784 380
1057 3300025921 Ga0207652_10072673 Ga0207652_100726732 380
1058 3300025922 Ga0207646_10000075 Ga0207646_1000007519 380
1059 3300025922 Ga0207646_10017449 Ga0207646_100174496 380
1060 3300025922 Ga0207646_10182212 Ga0207646_101822122 380
1061 3300025926 Ga0207659_10098405 Ga0207659_100984052 380
1062 3300025927 Ga0207687_10005129 Ga0207687_100051294 380
1063 3300025928 Ga0207700_10002220 Ga0207700_100022206 380
1064 3300025928 Ga0207700_10034685 Ga0207700_100346853 380
1065 3300025928 Ga0207700_10049537 Ga0207700_100495372 380
1066 3300025928 Ga0207700_10060223 Ga0207700_100602233 380
1067 3300025928 Ga0207700_10073786 Ga0207700_100737862 380
1068 3300025928 Ga0207700_10096707 Ga0207700_100967073 380
1069 3300025928 Ga0207700_10122798 Ga0207700_101227981 380
1070 3300025928 Ga0207700_10154778 Ga0207700_101547781 380
1071 3300025928 Ga0207700_10189588 Ga0207700_101895882 380
1072 3300025929 Ga0207664_10000533 Ga0207664_1000053321 380
1073 3300025929 Ga0207664_10003071 Ga0207664_100030716 380
1074 3300025929 Ga0207664_10004341 Ga0207664_100043415 380
1075 3300025929 Ga0207664_10019976 Ga0207664_100199763 380
1076 3300025929 Ga0207664_10030465 Ga0207664_100304655 380
1077 3300025929 Ga0207664_10051508 Ga0207664_100515081 380
1078 3300025931 Ga0207644_10005148 Ga0207644_100051486 380
1079 3300025931 Ga0207644_10007134 Ga0207644_100071343 380
1080 3300025931 Ga0207644_10093215 Ga0207644_100932152 380
1081 3300025933 Ga0207706_10074067 Ga0207706_100740673 380
1082 3300025934 Ga0207686_10103163 Ga0207686_101031632 380
1083 3300025935 Ga0207709_10105690 Ga0207709_101056902 380
1084 3300025939 Ga0207665_10000110 Ga0207665_100001103 380
1085 3300025939 Ga0207665_10000836 Ga0207665_100008363 380
1086 3300025939 Ga0207665_10006149 Ga0207665_100061497 380
1087 3300025939 Ga0207665_10048553 Ga0207665_100485532 380
1088 3300025939 Ga0207665_10049003 Ga0207665_100490033 380
1089 3300025939 Ga0207665_10113935 Ga0207665_101139352 380
1090 3300025940 Ga0207691_10009921 Ga0207691_100099214 380
1091 3300025940 Ga0207691_10023464 Ga0207691_100234642 380
1092 3300025941 Ga0207711_10104916 Ga0207711_101049162 380
1093 3300025942 Ga0207689_10001908 Ga0207689_1000190812 380
1094 3300025942 Ga0207689_10015339 Ga0207689_100153393 380
1095 3300025944 Ga0207661_10183331 Ga0207661_101833311 380
1096 3300025945 Ga0207679_10040889 Ga0207679_100408892 380
1097 3300025949 Ga0207667_10050910 Ga0207667_100509104 380
1098 3300025949 Ga0207667_10267137 Ga0207667_102671372 380
1099 3300026035 Ga0207703_10012392 Ga0207703_100123926 380
1100 3300026067 Ga0207678_10002509 Ga0207678_100025096 380
1101 3300026067 Ga0207678_10034232 Ga0207678_100342324 380
1102 3300026067 Ga0207678_10067322 Ga0207678_100673221 380
1103 3300026075 Ga0207708_10036612 Ga0207708_100366124 380
1104 3300026075 Ga0207708_10108336 Ga0207708_101083362 380
1105 3300026078 Ga0207702_10056729 Ga0207702_100567293 380
1106 3300026089 Ga0207648_10130635 Ga0207648_101306352 380
1107 3300026116 Ga0207674_10003114 Ga0207674_1000311413 380
1108 3300026116 Ga0207674_10033349 Ga0207674_100333494 380
1109 3300026116 Ga0207674_10083656 Ga0207674_100836561 380
1110 3300026118 Ga0207675_100003405 Ga0207675_1000034058 380
1111 3300026118 Ga0207675_100114121 Ga0207675_1001141212 380
1112 3300026121 Ga0207683_10001732 Ga0207683_100017327 380
1113 3300026121 Ga0207683_10093430 Ga0207683_100934302 380
1114 3300027907 Ga0207428_10260813 Ga0207428_102608131 380
1115 3300028379 Ga0268266_10038719 Ga0268266_100387193 380
1116 3300028380 Ga0268265_10112618 Ga0268265_101126182 380
1117 3300028381 Ga0268264_10230455 Ga0268264_102304552 380
1118 3300028381 Ga0268264_10390934 Ga0268264_103909341 380
1119 3300028563 Ga0265319_1004182 Ga0265319_10041821 380
1120 3300028573 Ga0265334_10057558 Ga0265334_100575581 380
1121 3300028577 Ga0265318_10002515 Ga0265318_100025153 380
1122 3300028666 Ga0265336_10000005 Ga0265336_10000005120 380
1123 3300028666 Ga0265336_10008838 Ga0265336_100088383 380
1124 3300028800 Ga0265338_10000001 Ga0265338_10000001935 380
1125 3300028800 Ga0265338_10010903 Ga0265338_100109036 380
1126 3300031090 Ga0265760_10036986 Ga0265760_100369861 380
1127 3300031247 Ga0265340_10000001 Ga0265340_10000001933 380
1128 3300031249 Ga0265339_10037585 Ga0265339_100375852 380
1129 3300031251 Ga0265327_10061873 Ga0265327_100618732 380
1130 3300031251 Ga0265327_10090003 Ga0265327_100900031 380
1131 3300031344 Ga0265316_10236769 Ga0265316_102367691 380
1132 3300031665 Ga0316575_10016255 Ga0316575_100162552 380
1133 3300031727 Ga0316576_10002159 Ga0316576_100021594 380
1134 3300031727 Ga0316576_10004942 Ga0316576_100049426 380
1135 3300031727 Ga0316576_10014931 Ga0316576_100149313 380
1136 3300031727 Ga0316576_10058201 Ga0316576_100582012 380
1137 3300031728 Ga0316578_10008294 Ga0316578_100082943 380
1138 3300034816 Ga0373930_0002746 Ga0373930_0002746_1205_2362 380
1139 3300034820 Ga0373959_0006108 Ga0373959_0006108_35_1177 380
1140 3300035083 Ga0373926_0009320 Ga0373926_0009320_446_1588 380
1141 3300035084 Ga0373928_0000501 Ga0373928_0000501_6198_7355 380
1142 3300035085 Ga0373929_0008922 Ga0373929_0008922_109_1266 380
1143 3300035086 Ga0373934_0004420 Ga0373934_0004420_177_1319 380
1144 3300035086 Ga0373934_0011417 Ga0373934_0011417_2029_3171 380
1145 3300035086 Ga0373934_0013932 Ga0373934_0013932_1531_2697 380
1146 3300035086 Ga0373934_0025762 Ga0373934_0025762_285_1427 380
1147 3300035089 Ga0373944_0002708 Ga0373944_0002708_554_1696 380
1148 3300035089 Ga0373944_0012433 Ga0373944_0012433_349_1491 380
1149 3300035090 Ga0373949_0022946 Ga0373949_0022946_55_1212 380
1150 3300035091 Ga0373951_0031416 Ga0373951_0031416_97_1239 380
1151 3300035092 Ga0373952_0008979 Ga0373952_0008979_492_1673 380
1152 3300035111 Ga0373923_0007133 Ga0373923_0007133_1661_2803 380
1153 3300035111 Ga0373923_0067947 Ga0373923_0067947_70_1212 380
1154 3300035111 Ga0373923_0107184 Ga0373923_0107184_30_1196 380
1155 3300035112 Ga0373932_0000217 Ga0373932_0000217_12708_13865 380
1156 3300035112 Ga0373932_0003244 Ga0373932_0003244_1312_2493 380
1157 3300035113 Ga0373936_0001254 Ga0373936_0001254_4474_5616 380
1158 3300035113 Ga0373936_0003910 Ga0373936_0003910_4061_5203 380
1159 3300035113 Ga0373936_0088890 Ga0373936_0088890_106_1248 380
1160 3300035115 Ga0373941_0031976 Ga0373941_0031976_321_1478 380
1161 3300035116 Ga0373945_0000755 Ga0373945_0000755_3295_4437 380
1162 3300035117 Ga0373953_0008422 Ga0373953_0008422_1975_3117 380
1163 3300035117 Ga0373953_0015121 Ga0373953_0015121_409_1551 380
1164 3300035117 Ga0373953_0056397 Ga0373953_0056397_97_1239 380
1165 3300035118 Ga0373954_0034572 Ga0373954_0034572_663_1805 380
1166 3300035118 Ga0373954_0054112 Ga0373954_0054112_44_1186 380
1167 3300035119 Ga0373956_0020403 Ga0373956_0020403_1311_2453 380
1168 3300035120 Ga0373957_0002119 Ga0373957_0002119_3392_4534 380
1169 3300035120 Ga0373957_0040416 Ga0373957_0040416_516_1658 380
1170 3300035120 Ga0373957_0087385 Ga0373957_0087385_28_1170 380
1171 3300035170 Ga0373943_0008618 Ga0373943_0008618_148_1290 380
1172 3300035170 Ga0373943_0030676 Ga0373943_0030676_1288_2469 380
1173 3300035170 Ga0373943_0044748 Ga0373943_0044748_843_1985 380
1174 3300035170 Ga0373943_0076988 Ga0373943_0076988_43_1209 380
1175 3300035170 Ga0373943_0098645 Ga0373943_0098645_327_1469 380
1176 3300035170 Ga0373943_0100093 Ga0373943_0100093_337_1479 380
1177 3300035171 Ga0373946_0001411 Ga0373946_0001411_3304_4446 380
1178 3300035172 Ga0373955_0004271 Ga0373955_0004271_4052_5194 380
1179 3300035172 Ga0373955_0013253 Ga0373955_0013253_78_1220 380
1180 3300035172 Ga0373955_0096568 Ga0373955_0096568_129_1286 380
1181 3300035172 Ga0373955_0140777 Ga0373955_0140777_215_1363 380
1182 3300035207 Ga0373942_0002905 Ga0373942_0002905_2797_3939 380
1183 3300035242 Ga0373962_0025291 Ga0373962_0025291_160_1302 380
1184 3300035398 Ga0316574_0011379 Ga0316574_0011379_2673_3821 380
1185 3300035410 Ga0373924_0000088 Ga0373924_0000088_3447_4589 380
1186 3300035410 Ga0373924_0003031 Ga0373924_0003031_1497_2639 380
1187 3300035410 Ga0373924_0003240 Ga0373924_0003240_4015_5181 380
1188 3300035691 Ga0373931_0000005 Ga0373931_0000005_300989_302146 380
1189 3300035691 Ga0373931_0000027 Ga0373931_0000027_22906_24063 380
1190 3300035691 Ga0373931_0149047 Ga0373931_0149047_198_1340 380
1191 3300035691 Ga0373931_0154931 Ga0373931_0154931_18_1199 380
1192 3300035692 Ga0373935_0004208 Ga0373935_0004208_3614_4756 380
1193 3300035692 Ga0373935_0009981 Ga0373935_0009981_1703_2845 380
1194 3300035692 Ga0373935_0011653 Ga0373935_0011653_3304_4446 380
1195 3300035692 Ga0373935_0080562 Ga0373935_0080562_957_2099 380
1196 3300035724 Ga0373933_0033741 Ga0373933_0033741_1376_2518 380
1197 3300035724 Ga0373933_0071890 Ga0373933_0071890_162_1304 380
1198 3300035725 Ga0373947_0000220 Ga0373947_0000220_8380_9522 380
1199 3300035725 Ga0373947_0090298 Ga0373947_0090298_510_1652 380
1200 3300036401 Ga0373937_0054255 Ga0373937_0054255_635_1777 380
1201 3300036401 Ga0373937_0079557 Ga0373937_0079557_1398_2540 380
1202 3300036401 Ga0373937_0189654 Ga0373937_0189654_707_1864 380
1203 3300036459 Ga0372808_000663 Ga0372808_000663_19_1161 380
1204 3300036459 Ga0372808_001740 Ga0372808_001740_299_1447 380
1205 3300036647 Ga0316582_0095040 Ga0316582_0095040_783_1934 380
1206 3300036712 Ga0316584_0003409 Ga0316584_0003409_4670_5818 380
1207 3300036712 Ga0316584_0004433 Ga0316584_0004433_5052_6203 380
1208 3300036712 Ga0316584_0102651 Ga0316584_0102651_746_1894 380
1209 3300037068 Ga0373925_0041858 Ga0373925_0041858_1705_2847 380
1210 3300037068 Ga0373925_0055558 Ga0373925_0055558_1103_2284 380
1211 3300037853 Ga0436364_0509088 Ga0436364_0509088_209_1357 380
1212 3300037853 Ga0436364_0604875 Ga0436364_0604875_5622_7001 380
1213 3300037853 Ga0436364_0757834 Ga0436364_0757834_60_1202 380
1214 3300037853 Ga0436364_0786042 Ga0436364_0786042_968_2125 380
1215 3300037853 Ga0436364_1464045 Ga0436364_1464045_2103_3245 380
1216 3300039062 Ga0400483_058289 Ga0400483_058289_1964_3115 380
1217 3300039062 Ga0400483_215395 Ga0400483_215395_6084_7235 380
1218 3300041451 Ga0451791_1300260 Ga0451791_1300260_501_1661 380
1219 3300042008 Ga0439450_014046 Ga0439450_014046_276_1424 380
1220 3300042010 Ga0439452_019347 Ga0439452_019347_445_1593 380
1221 3300042993 Ga0439440_0002061 Ga0439440_0002061_553_1701 380
1222 3300044684 Ga0466966_0023668 Ga0466966_0023668_1436_2584 380
1223 3300044694 Ga0466963_0027405 Ga0466963_0027405_206_1420 380
1224 3300044694 Ga0466963_0105466 Ga0466963_0105466_525_1667 380
1225 3300044694 Ga0466963_0134633 Ga0466963_0134633_542_1696 380
1226 3300044842 Ga0466957_0157063 Ga0466957_0157063_190_1332 380
1227 3300045049 Ga0466959_0017904 Ga0466959_0017904_3407_4555 380
1228 3300045049 Ga0466959_0124003 Ga0466959_0124003_447_1589 380
1229 3300045836 Ga0466958_0185212 Ga0466958_0185212_35_1252 380
1230 3300045976 Ga0466967_0089880 Ga0466967_0089880_493_1641 380
1231 3300045976 Ga0466967_0111096 Ga0466967_0111096_171_1313 380
1232 3300046454 Ga0495592_0006585 Ga0495592_0006585_7477_8619 380
1233 3300046454 Ga0495592_0012104 Ga0495592_0012104_3343_4509 380
1234 3300046454 Ga0495592_0027319 Ga0495592_0027319_3003_4145 380
1235 3300046454 Ga0495592_0043975 Ga0495592_0043975_1703_2845 380
1236 3300046454 Ga0495592_0052562 Ga0495592_0052562_1788_2930 380
1237 3300046454 Ga0495592_0137810 Ga0495592_0137810_123_1265 380
1238 3300046455 Ga0495603_0003396 Ga0495603_0003396_3767_4909 380
1239 3300046459 Ga0495629_0003600 Ga0495629_0003600_6803_7945 380
1240 3300046459 Ga0495629_0004898 Ga0495629_0004898_6442_7608 380
1241 3300046459 Ga0495629_0012270 Ga0495629_0012270_1639_2781 380
1242 3300046461 Ga0495641_0004957 Ga0495641_0004957_4553_5695 380
1243 3300046461 Ga0495641_0008522 Ga0495641_0008522_1767_2909 380
1244 3300046461 Ga0495641_0013408 Ga0495641_0013408_322_1488 380
1245 3300046461 Ga0495641_0040339 Ga0495641_0040339_869_2050 380
1246 3300046462 Ga0495651_0016070 Ga0495651_0016070_4237_5379 380
1247 3300046462 Ga0495651_0017225 Ga0495651_0017225_1395_2537 380
1248 3300046462 Ga0495651_0031182 Ga0495651_0031182_695_1861 380
1249 3300046462 Ga0495651_0035502 Ga0495651_0035502_1457_2599 380
1250 3300046462 Ga0495651_0053979 Ga0495651_0053979_1674_2831 380
1251 3300046462 Ga0495651_0106132 Ga0495651_0106132_141_1283 380
1252 3300046463 Ga0495653_0016641 Ga0495653_0016641_3518_4660 380
1253 3300046463 Ga0495653_0028100 Ga0495653_0028100_2888_4036 380
1254 3300046463 Ga0495653_0041667 Ga0495653_0041667_1645_2787 380
1255 3300046463 Ga0495653_0059979 Ga0495653_0059979_1576_2718 380
1256 3300046463 Ga0495653_0064751 Ga0495653_0064751_1123_2265 380
1257 3300046463 Ga0495653_0076719 Ga0495653_0076719_79_1221 380
1258 3300046463 Ga0495653_0088750 Ga0495653_0088750_395_1537 380
1259 3300046463 Ga0495653_0108270 Ga0495653_0108270_435_1601 380
1260 3300046463 Ga0495653_0121353 Ga0495653_0121353_457_1638 380
1261 3300046472 Ga0495580_0011635 Ga0495580_0011635_3661_4803 380
1262 3300046473 Ga0495582_0002548 Ga0495582_0002548_8809_9951 380
1263 3300046473 Ga0495582_0003759 Ga0495582_0003759_3434_4597 380
1264 3300046473 Ga0495582_0143380 Ga0495582_0143380_76_1257 380
1265 3300046475 Ga0495639_0016401 Ga0495639_0016401_1573_2715 380
1266 3300046476 Ga0495662_0000649 Ga0495662_0000649_12339_13481 380
1267 3300046476 Ga0495662_0001170 Ga0495662_0001170_10162_11304 380
1268 3300046476 Ga0495662_0009850 Ga0495662_0009850_1039_2205 380
1269 3300046476 Ga0495662_0015376 Ga0495662_0015376_447_1589 380
1270 3300046477 Ga0495664_0044348 Ga0495664_0044348_831_1973 380
1271 3300046477 Ga0495664_0069108 Ga0495664_0069108_266_1408 380
1272 3300046499 Ga0495594_0013981 Ga0495594_0013981_870_2012 380
1273 3300046511 Ga0495608_0000955 Ga0495608_0000955_3144_4286 380
1274 3300046511 Ga0495608_0012153 Ga0495608_0012153_54_1220 380
1275 3300046511 Ga0495608_0013781 Ga0495608_0013781_410_1552 380
1276 3300046511 Ga0495608_0047023 Ga0495608_0047023_1694_2842 380
1277 3300046511 Ga0495608_0062595 Ga0495608_0062595_1279_2421 380
1278 3300046511 Ga0495608_0071773 Ga0495608_0071773_327_1469 380
1279 3300046511 Ga0495608_0109376 Ga0495608_0109376_311_1468 380
1280 3300046511 Ga0495608_0132923 Ga0495608_0132923_36_1178 380
1281 3300046514 Ga0495618_0001036 Ga0495618_0001036_2003_3145 380
1282 3300046514 Ga0495618_0040927 Ga0495618_0040927_537_1679 380
1283 3300046514 Ga0495618_0065699 Ga0495618_0065699_706_1872 380
1284 3300046516 Ga0495628_0009608 Ga0495628_0009608_812_1960 380
1285 3300046516 Ga0495628_0010807 Ga0495628_0010807_5897_7045 380
1286 3300046516 Ga0495628_0162672 Ga0495628_0162672_527_1669 380
1287 3300046516 Ga0495628_0176461 Ga0495628_0176461_428_1591 380
1288 3300046517 Ga0495630_0006721 Ga0495630_0006721_6643_7785 380
1289 3300046517 Ga0495630_0034365 Ga0495630_0034365_896_2044 380
1290 3300046517 Ga0495630_0047622 Ga0495630_0047622_327_1493 380
1291 3300046517 Ga0495630_0048699 Ga0495630_0048699_1084_2265 380
1292 3300046517 Ga0495630_0078485 Ga0495630_0078485_254_1402 380
1293 3300046517 Ga0495630_0183914 Ga0495630_0183914_223_1371 380
1294 3300046517 Ga0495630_0202682 Ga0495630_0202682_56_1198 380
1295 3300046526 Ga0495666_0015344 Ga0495666_0015344_574_1716 380
1296 3300046526 Ga0495666_0051407 Ga0495666_0051407_520_1662 380
1297 3300046526 Ga0495666_0079308 Ga0495666_0079308_53_1234 380
1298 3300046529 Ga0495652_0003238 Ga0495652_0003238_14737_15879 380
1299 3300046529 Ga0495652_0014498 Ga0495652_0014498_5137_6279 380
1300 3300046529 Ga0495652_0032816 Ga0495652_0032816_2000_3142 380
1301 3300046529 Ga0495652_0131791 Ga0495652_0131791_314_1456 380
1302 3300046531 Ga0495665_0032011 Ga0495665_0032011_33_1175 380
1303 3300046533 Ga0495640_0014491 Ga0495640_0014491_4674_5816 380
1304 3300046533 Ga0495640_0021723 Ga0495640_0021723_1306_2448 380
1305 3300046533 Ga0495640_0027072 Ga0495640_0027072_2009_3175 380
1306 3300046533 Ga0495640_0050138 Ga0495640_0050138_1141_2283 380
1307 3300046535 Ga0495586_0001504 Ga0495586_0001504_7302_8444 380
1308 3300046535 Ga0495586_0053888 Ga0495586_0053888_40_1188 380
1309 3300046536 Ga0495587_0011091 Ga0495587_0011091_4375_5517 380
1310 3300046536 Ga0495587_0059565 Ga0495587_0059565_22_1164 380
1311 3300046536 Ga0495587_0072640 Ga0495587_0072640_401_1567 380
1312 3300046543 Ga0495645_0007547 Ga0495645_0007547_3822_4964 380
1313 3300046543 Ga0495645_0026918 Ga0495645_0026918_192_1334 380
1314 3300046543 Ga0495645_0048487 Ga0495645_0048487_1221_2363 380
1315 3300046543 Ga0495645_0057004 Ga0495645_0057004_180_1322 380
1316 3300046543 Ga0495645_0079474 Ga0495645_0079474_840_1982 380
1317 3300046543 Ga0495645_0098882 Ga0495645_0098882_717_1859 380
1318 3300046559 Ga0495667_0001387 Ga0495667_0001387_11819_12961 380
1319 3300046559 Ga0495667_0005665 Ga0495667_0005665_6643_7785 380
1320 3300046559 Ga0495667_0006595 Ga0495667_0006595_1560_2702 380
1321 3300046559 Ga0495667_0020456 Ga0495667_0020456_1566_2708 380
1322 3300046559 Ga0495667_0095863 Ga0495667_0095863_639_1787 380
1323 3300046559 Ga0495667_0102530 Ga0495667_0102530_469_1611 380
1324 3300046642 Ga0495634_0003643 Ga0495634_0003643_6900_8042 380
1325 3300046642 Ga0495634_0018131 Ga0495634_0018131_3618_4784 380
1326 3300046642 Ga0495634_0077598 Ga0495634_0077598_436_1593 380
1327 3300046642 Ga0495634_0202145 Ga0495634_0202145_76_1224 380
1328 3300046660 Ga0495625_0000911 Ga0495625_0000911_4581_5729 380
1329 3300046663 Ga0495635_0006189 Ga0495635_0006189_3964_5106 380
1330 3300046663 Ga0495635_0008669 Ga0495635_0008669_371_1552 380
1331 3300046663 Ga0495635_0012396 Ga0495635_0012396_4350_5492 380
1332 3300046663 Ga0495635_0057977 Ga0495635_0057977_664_1821 380
1333 3300046663 Ga0495635_0059571 Ga0495635_0059571_257_1423 380
1334 3300046675 Ga0495657_0001156 Ga0495657_0001156_4664_5806 380
1335 3300046675 Ga0495657_0001976 Ga0495657_0001976_8480_9628 380
1336 3300046675 Ga0495657_0008646 Ga0495657_0008646_436_1593 380
1337 3300046675 Ga0495657_0026456 Ga0495657_0026456_550_1692 380
1338 3300046675 Ga0495657_0042552 Ga0495657_0042552_696_1838 380
1339 3300046675 Ga0495657_0051433 Ga0495657_0051433_1214_2356 380
1340 3300046675 Ga0495657_0078154 Ga0495657_0078154_840_1982 380
1341 3300046675 Ga0495657_0096449 Ga0495657_0096449_375_1541 380
1342 3300046678 Ga0495599_0001775 Ga0495599_0001775_8419_9561 380
1343 3300046678 Ga0495599_0018711 Ga0495599_0018711_1658_2800 380
1344 3300046678 Ga0495599_0018766 Ga0495599_0018766_1403_2545 380
1345 3300046678 Ga0495599_0038666 Ga0495599_0038666_1429_2571 380
1346 3300046678 Ga0495599_0049461 Ga0495599_0049461_1044_2186 380
1347 3300046678 Ga0495599_0108324 Ga0495599_0108324_228_1370 380
1348 3300046678 Ga0495599_0148868 Ga0495599_0148868_110_1258 380
1349 3300046679 Ga0495623_0031511 Ga0495623_0031511_784_1950 380
1350 3300046679 Ga0495623_0067957 Ga0495623_0067957_430_1572 380
1351 3300046679 Ga0495623_0070471 Ga0495623_0070471_556_1698 380
1352 3300046679 Ga0495623_0076412 Ga0495623_0076412_662_1819 380
1353 3300046680 Ga0495646_0065778 Ga0495646_0065778_791_1933 380
1354 3300046680 Ga0495646_0093322 Ga0495646_0093322_55_1197 380
1355 3300046681 Ga0495647_0001573 Ga0495647_0001573_54_1196 380
1356 3300046681 Ga0495647_0015118 Ga0495647_0015118_1056_2237 380
1357 3300046681 Ga0495647_0032207 Ga0495647_0032207_577_1719 380
1358 3300046683 Ga0495658_0005908 Ga0495658_0005908_4189_5370 380
1359 3300046683 Ga0495658_0015267 Ga0495658_0015267_182_1324 380
1360 3300046683 Ga0495658_0211687 Ga0495658_0211687_28_1194 380
1361 3300046689 Ga0495613_0000845 Ga0495613_0000845_15985_17145 380
1362 3300046689 Ga0495613_0004976 Ga0495613_0004976_4652_5794 380
1363 3300046689 Ga0495613_0107782 Ga0495613_0107782_459_1625 380
1364 3300046690 Ga0495624_0021883 Ga0495624_0021883_229_1395 380
1365 3300046690 Ga0495624_0056784 Ga0495624_0056784_191_1333 380
1366 3300046690 Ga0495624_0090776 Ga0495624_0090776_109_1251 380
1367 3300046809 Ga0495600_0002375 Ga0495600_0002375_375_1517 380
1368 3300046809 Ga0495600_0007516 Ga0495600_0007516_3002_4144 380
1369 3300046809 Ga0495600_0037708 Ga0495600_0037708_276_1418 380
1370 3300046809 Ga0495600_0106200 Ga0495600_0106200_86_1366 380
1371 3300047315 Ga0495581_0000351 Ga0495581_0000351_10640_11782 380
1372 3300047315 Ga0495581_0000521 Ga0495581_0000521_15885_17027 380
1373 3300047315 Ga0495581_0036056 Ga0495581_0036056_647_1828 380
1374 3300047317 Ga0495604_0011376 Ga0495604_0011376_3922_5064 380
1375 3300047317 Ga0495604_0016743 Ga0495604_0016743_2582_3730 380
1376 3300047317 Ga0495604_0017187 Ga0495604_0017187_4236_5378 380
1377 3300047317 Ga0495604_0023947 Ga0495604_0023947_2601_3743 380
1378 3300047317 Ga0495604_0116430 Ga0495604_0116430_34_1176 380
1379 3300047319 Ga0495674_0018851 Ga0495674_0018851_1972_3114 380
1380 3300047319 Ga0495674_0034272 Ga0495674_0034272_1477_2619 380
1381 3300047319 Ga0495674_0113178 Ga0495674_0113178_940_2082 380
1382 3300047319 Ga0495674_0218663 Ga0495674_0218663_221_1363 380
1383 3300047321 Ga0495676_0023169 Ga0495676_0023169_3810_4952 380
1384 3300047321 Ga0495676_0133979 Ga0495676_0133979_281_1447 380
1385 3300047322 Ga0495680_0016062 Ga0495680_0016062_879_2021 380
1386 3300047322 Ga0495680_0018088 Ga0495680_0018088_4059_5201 380
1387 3300047322 Ga0495680_0054190 Ga0495680_0054190_1311_2453 380
1388 3300047322 Ga0495680_0054251 Ga0495680_0054251_892_2034 380
1389 3300047322 Ga0495680_0132445 Ga0495680_0132445_572_1723 380
1390 3300047322 Ga0495680_0140073 Ga0495680_0140073_249_1391 380
1391 3300047322 Ga0495680_0154501 Ga0495680_0154501_462_1604 380
1392 3300047444 Ga0495675_0012268 Ga0495675_0012268_3800_4966 380
1393 3300047444 Ga0495675_0012301 Ga0495675_0012301_2042_3184 380
1394 3300047444 Ga0495675_0045652 Ga0495675_0045652_1215_2357 380
1395 3300047471 Ga0495684_0007979 Ga0495684_0007979_181_1329 380
1396 3300047471 Ga0495684_0015817 Ga0495684_0015817_1944_3086 380
1397 3300047471 Ga0495684_0016585 Ga0495684_0016585_1190_2332 380
1398 3300047471 Ga0495684_0044762 Ga0495684_0044762_607_1749 380
1399 3300047471 Ga0495684_0081883 Ga0495684_0081883_982_2139 380
1400 3300047471 Ga0495684_0116175 Ga0495684_0116175_494_1636 380
1401 3300047471 Ga0495684_0176765 Ga0495684_0176765_18_1184 380
1402 3300047673 Ga0495593_0002534 Ga0495593_0002534_8737_9879 380
1403 3300047673 Ga0495593_0008687 Ga0495593_0008687_4410_5576 380
1404 3300048088 Ga0495602_0017183 Ga0495602_0017183_4561_5703 380
1405 3300048088 Ga0495602_0049716 Ga0495602_0049716_149_1291 380
1406 3300048088 Ga0495602_0116355 Ga0495602_0116355_830_1996 380
1407 3300048088 Ga0495602_0286427 Ga0495602_0286427_36_1184 380
1408 3300048903 Ga0496100_0034446 Ga0496100_0034446_746_1897 380
1409 3300048903 Ga0496100_0044118 Ga0496100_0044118_1079_2260 380
1410 3300048904 Ga0496101_0011569 Ga0496101_0011569_2067_3209 380
1411 3300048904 Ga0496101_0029917 Ga0496101_0029917_1046_2197 380
1412 3300048904 Ga0496101_0061222 Ga0496101_0061222_992_2173 380
1413 3300048905 Ga0496102_0032155 Ga0496102_0032155_510_1661 380
1414 3300048905 Ga0496102_0191357 Ga0496102_0191357_749_1891 380
1415 3300048906 Ga0496103_0039407 Ga0496103_0039407_610_1767 380
1416 3300048907 Ga0496104_0004532 Ga0496104_0004532_5861_7003 380
1417 3300048907 Ga0496104_0006922 Ga0496104_0006922_3223_4419 380
1418 3300048907 Ga0496104_0011347 Ga0496104_0011347_2838_3989 380
1419 3300048907 Ga0496104_0016014 Ga0496104_0016014_2294_3436 380
1420 3300048907 Ga0496104_0077574 Ga0496104_0077574_1776_2933 380
1421 3300048908 Ga0496105_0007753 Ga0496105_0007753_2129_3271 380
1422 3300048908 Ga0496105_0025217 Ga0496105_0025217_2253_3395 380
1423 3300048908 Ga0496105_0031764 Ga0496105_0031764_2947_4143 380
1424 3300048908 Ga0496105_0044914 Ga0496105_0044914_1593_2744 380
1425 3300048908 Ga0496105_0055772 Ga0496105_0055772_2072_3238 380
1426 3300048909 Ga0496106_0051571 Ga0496106_0051571_1779_2921 380
1427 3300048909 Ga0496106_0080505 Ga0496106_0080505_285_1451 380
1428 3300048909 Ga0496106_0106791 Ga0496106_0106791_85_1242 380
1429 3300048910 Ga0496107_0012475 Ga0496107_0012475_2603_3754 380
1430 3300048910 Ga0496107_0039362 Ga0496107_0039362_291_1433 380
1431 3300048911 Ga0496108_0023390 Ga0496108_0023390_371_1513 380
1432 3300048911 Ga0496108_0239178 Ga0496108_0239178_407_1549 380
1433 3300048912 Ga0496109_0107561 Ga0496109_0107561_700_1851 380
1434 3300048913 Ga0496110_0011073 Ga0496110_0011073_2537_3733 380
1435 3300048913 Ga0496110_0061335 Ga0496110_0061335_1995_3137 380
1436 3300048913 Ga0496110_0284975 Ga0496110_0284975_275_1432 380
1437 3300048913 Ga0496110_0325162 Ga0496110_0325162_107_1255 380
1438 3300048914 Ga0496111_0073792 Ga0496111_0073792_372_1529 380
1439 3300048914 Ga0496111_0115037 Ga0496111_0115037_370_1551 380
1440 3300048915 Ga0496112_0002361 Ga0496112_0002361_4309_5451 380
1441 3300048915 Ga0496112_0068395 Ga0496112_0068395_1224_2420 380
1442 3300048915 Ga0496112_0170150 Ga0496112_0170150_564_1712 380
1443 3300048916 Ga0496113_0026225 Ga0496113_0026225_2819_4015 380
1444 3300048916 Ga0496113_0115992 Ga0496113_0115992_20_1162 380
1445 3300048916 Ga0496113_0184209 Ga0496113_0184209_412_1569 380
1446 3300048917 Ga0496114_0093864 Ga0496114_0093864_492_1640 380
1447 3300048917 Ga0496114_0129640 Ga0496114_0129640_746_1894 380
1448 3300048917 Ga0496114_0239133 Ga0496114_0239133_366_1532 380
1449 3300048917 Ga0496114_0245293 Ga0496114_0245293_233_1381 380
1450 3300048917 Ga0496114_0334493 Ga0496114_0334493_165_1313 380
1451 3300048918 Ga0496115_0024948 Ga0496115_0024948_728_1870 380
1452 3300048918 Ga0496115_0034855 Ga0496115_0034855_2014_3171 380
1453 3300048918 Ga0496115_0087035 Ga0496115_0087035_336_1502 380
1454 3300048918 Ga0496115_0088232 Ga0496115_0088232_723_1877 380
1455 3300048918 Ga0496115_0125518 Ga0496115_0125518_579_1775 380
1456 3300048918 Ga0496115_0169186 Ga0496115_0169186_366_1547 380
1457 3300048929 Ga0496126_0004694 Ga0496126_0004694_11829_12983 380
1458 3300048929 Ga0496126_0005936 Ga0496126_0005936_12184_13332 380
1459 3300048929 Ga0496126_0231817 Ga0496126_0231817_252_1394 380
1460 3300049568 Ga0501031_0022708 Ga0501031_0022708_2742_3890 380
1461 3300049569 Ga0501032_0000424 Ga0501032_0000424_30809_31957 380
1462 3300049570 Ga0501033_0016983 Ga0501033_0016983_1736_2884 380
1463 3300049570 Ga0501033_0066414 Ga0501033_0066414_290_1438 380
1464 3300049571 Ga0501034_0000339 Ga0501034_0000339_47923_49071 380
1465 3300049571 Ga0501034_0026673 Ga0501034_0026673_3732_4874 380
1466 3300049571 Ga0501034_0029476 Ga0501034_0029476_2840_3988 380
1467 3300049571 Ga0501034_0120428 Ga0501034_0120428_1434_2582 380
1468 3300049571 Ga0501034_0198045 Ga0501034_0198045_520_1668 380
1469 3300049572 Ga0501036_0005274 Ga0501036_0005274_5715_6863 380
1470 3300049572 Ga0501036_0026339 Ga0501036_0026339_2461_3609 380
1471 3300049572 Ga0501036_0108991 Ga0501036_0108991_1028_2170 380
1472 3300049572 Ga0501036_0124055 Ga0501036_0124055_251_1399 380
1473 3300049573 Ga0501037_0003342 Ga0501037_0003342_6814_7962 380
1474 3300049573 Ga0501037_0049439 Ga0501037_0049439_839_1981 380
1475 3300049574 Ga0501038_0007562 Ga0501038_0007562_6998_8146 380
1476 3300049574 Ga0501038_0028260 Ga0501038_0028260_1632_2780 380
1477 3300049574 Ga0501038_0035688 Ga0501038_0035688_176_1318 380
1478 3300049574 Ga0501038_0104806 Ga0501038_0104806_354_1496 380
1479 3300049574 Ga0501038_0127699 Ga0501038_0127699_209_1357 380
1480 3300049574 Ga0501038_0253855 Ga0501038_0253855_97_1245 380
1481 3300049575 Ga0501039_0000966 Ga0501039_0000966_18167_19315 380
1482 3300049575 Ga0501039_0001751 Ga0501039_0001751_1137_2285 380
1483 3300049575 Ga0501039_0016350 Ga0501039_0016350_3342_4490 380
1484 3300049575 Ga0501039_0096987 Ga0501039_0096987_964_2112 380
1485 3300049575 Ga0501039_0318269 Ga0501039_0318269_24_1172 380
1486 3300049576 Ga0501040_0000581 Ga0501040_0000581_546_1694 380
1487 3300049576 Ga0501040_0002936 Ga0501040_0002936_4617_5765 380
1488 3300049576 Ga0501040_0003290 Ga0501040_0003290_2618_3766 380
1489 3300049576 Ga0501040_0010682 Ga0501040_0010682_3646_4794 380
1490 3300049576 Ga0501040_0017049 Ga0501040_0017049_2266_3414 380
1491 3300049576 Ga0501040_0029162 Ga0501040_0029162_463_1611 380
1492 3300049577 Ga0501041_0012306 Ga0501041_0012306_100_1248 380
1493 3300049577 Ga0501041_0039741 Ga0501041_0039741_396_1544 380
1494 3300049577 Ga0501041_0052236 Ga0501041_0052236_264_1412 380
1495 3300049577 Ga0501041_0132853 Ga0501041_0132853_304_1452 380
1496 3300049578 Ga0501042_0004432 Ga0501042_0004432_6794_7936 380
1497 3300049578 Ga0501042_0005589 Ga0501042_0005589_1050_2198 380
1498 3300049578 Ga0501042_0010012 Ga0501042_0010012_5130_6278 380
1499 3300049578 Ga0501042_0019346 Ga0501042_0019346_2577_3725 380
1500 3300049578 Ga0501042_0028106 Ga0501042_0028106_1333_2481 380
1501 3300049578 Ga0501042_0101067 Ga0501042_0101067_390_1538 380
1502 3300049578 Ga0501042_0154025 Ga0501042_0154025_432_1580 380
1503 3300049579 Ga0501043_0019067 Ga0501043_0019067_2054_3196 380
1504 3300049580 Ga0501046_0005483 Ga0501046_0005483_1294_2442 380
1505 3300049580 Ga0501046_0008010 Ga0501046_0008010_8066_9214 380
1506 3300049580 Ga0501046_0031002 Ga0501046_0031002_991_2139 380
1507 3300049580 Ga0501046_0078648 Ga0501046_0078648_1102_2250 380
1508 3300049581 Ga0501047_0000601 Ga0501047_0000601_1780_2928 380
1509 3300049581 Ga0501047_0003093 Ga0501047_0003093_1050_2192 380
1510 3300049581 Ga0501047_0037282 Ga0501047_0037282_2330_3511 380
1511 3300049582 Ga0501048_0001137 Ga0501048_0001137_10059_11207 380
1512 3300049582 Ga0501048_0016878 Ga0501048_0016878_3091_4233 380
1513 3300049582 Ga0501048_0029364 Ga0501048_0029364_2239_3387 380
1514 3300049582 Ga0501048_0037709 Ga0501048_0037709_2011_3159 380
1515 3300049582 Ga0501048_0074323 Ga0501048_0074323_1006_2154 380
1516 3300049583 Ga0501067_0029205 Ga0501067_0029205_1702_2850 380
1517 3300049584 Ga0501068_0025615 Ga0501068_0025615_1162_2310 380
1518 3300049584 Ga0501068_0054389 Ga0501068_0054389_1215_2363 380
1519 3300049584 Ga0501068_0167417 Ga0501068_0167417_191_1339 380
1520 3300049585 Ga0501069_0000089 Ga0501069_0000089_38581_39729 380
1521 3300049585 Ga0501069_0005202 Ga0501069_0005202_235_1383 380
1522 3300049585 Ga0501069_0116590 Ga0501069_0116590_184_1356 380
1523 3300049586 Ga0501070_0000008 Ga0501070_0000008_139767_140915 380
1524 3300049586 Ga0501070_0001203 Ga0501070_0001203_14821_15969 380
1525 3300049586 Ga0501070_0054912 Ga0501070_0054912_1614_2762 380
1526 3300049586 Ga0501070_0065034 Ga0501070_0065034_1130_2278 380
1527 3300049587 Ga0501071_0003038 Ga0501071_0003038_8615_9763 380
1528 3300049587 Ga0501071_0003173 Ga0501071_0003173_4833_5981 380
1529 3300049587 Ga0501071_0007247 Ga0501071_0007247_5649_6797 380
1530 3300049588 Ga0501072_0001968 Ga0501072_0001968_4444_5592 380
1531 3300049588 Ga0501072_0002597 Ga0501072_0002597_9753_10901 380
1532 3300049588 Ga0501072_0007326 Ga0501072_0007326_2725_3873 380
1533 3300049588 Ga0501072_0009139 Ga0501072_0009139_211_1359 380
1534 3300049588 Ga0501072_0018044 Ga0501072_0018044_4120_5319 380
1535 3300049588 Ga0501072_0025611 Ga0501072_0025611_3350_4498 380
1536 3300049588 Ga0501072_0056152 Ga0501072_0056152_35_1183 380
1537 3300049588 Ga0501072_0125836 Ga0501072_0125836_78_1226 380
1538 3300049588 Ga0501072_0161244 Ga0501072_0161244_289_1437 380
1539 3300049590 Ga0501074_0022034 Ga0501074_0022034_435_1577 380
1540 3300049590 Ga0501074_0038358 Ga0501074_0038358_1085_2233 380
1541 3300049590 Ga0501074_0102731 Ga0501074_0102731_854_2002 380
1542 3300049591 Ga0501075_0000895 Ga0501075_0000895_1216_2364 380
1543 3300049591 Ga0501075_0002183 Ga0501075_0002183_6864_8012 380
1544 3300049591 Ga0501075_0006676 Ga0501075_0006676_4516_5664 380
1545 3300049591 Ga0501075_0013675 Ga0501075_0013675_1175_2323 380
1546 3300049591 Ga0501075_0148205 Ga0501075_0148205_516_1664 380
1547 3300049591 Ga0501075_0174122 Ga0501075_0174122_292_1440 380
1548 3300049592 Ga0501076_0001798 Ga0501076_0001798_8775_9923 380
1549 3300049592 Ga0501076_0002273 Ga0501076_0002273_9583_10731 380
1550 3300049592 Ga0501076_0002738 Ga0501076_0002738_8410_9558 380
1551 3300049592 Ga0501076_0045646 Ga0501076_0045646_31_1179 380
1552 3300049592 Ga0501076_0076524 Ga0501076_0076524_1502_2650 380
1553 3300049592 Ga0501076_0078451 Ga0501076_0078451_52_1200 380
1554 3300049592 Ga0501076_0104808 Ga0501076_0104808_38_1186 380
1555 3300049592 Ga0501076_0120304 Ga0501076_0120304_966_2114 380
1556 3300049593 Ga0501077_0003196 Ga0501077_0003196_6104_7252 380
1557 3300049593 Ga0501077_0005440 Ga0501077_0005440_4947_6095 380
1558 3300049593 Ga0501077_0025113 Ga0501077_0025113_2355_3503 380
1559 3300049593 Ga0501077_0033857 Ga0501077_0033857_1235_2383 380
1560 3300049593 Ga0501077_0205902 Ga0501077_0205902_23_1171 380
1561 3300049741 Ga0501079_0004718 Ga0501079_0004718_948_2096 380
1562 3300049741 Ga0501079_0008561 Ga0501079_0008561_4133_5281 380
1563 3300049741 Ga0501079_0009798 Ga0501079_0009798_431_1579 380
1564 3300049741 Ga0501079_0129740 Ga0501079_0129740_681_1829 380
1565 3300049741 Ga0501079_0189018 Ga0501079_0189018_178_1326 380
1566 3300049742 Ga0501080_0012185 Ga0501080_0012185_6257_7405 380
1567 3300049742 Ga0501080_0018696 Ga0501080_0018696_5203_6375 380
1568 3300049742 Ga0501080_0074250 Ga0501080_0074250_323_1471 380
1569 3300049742 Ga0501080_0092571 Ga0501080_0092571_823_1971 380
1570 3300049742 Ga0501080_0107899 Ga0501080_0107899_671_1819 380
1571 3300049742 Ga0501080_0347985 Ga0501080_0347985_144_1292 380
1572 3300049743 Ga0501081_0005016 Ga0501081_0005016_5341_6489 380
1573 3300049743 Ga0501081_0027709 Ga0501081_0027709_2351_3499 380
1574 3300049743 Ga0501081_0030670 Ga0501081_0030670_2403_3551 380
1575 3300049743 Ga0501081_0234164 Ga0501081_0234164_170_1318 380
1576 3300049743 Ga0501081_0251147 Ga0501081_0251147_112_1260 380
1577 3300049744 Ga0501083_0009305 Ga0501083_0009305_1969_3117 380
1578 3300049744 Ga0501083_0019807 Ga0501083_0019807_3107_4255 380
1579 3300049822 Ga0501035_0004302 Ga0501035_0004302_28_1176 380
1580 3300049822 Ga0501035_0060451 Ga0501035_0060451_1001_2149 380
1581 3300049822 Ga0501035_0069525 Ga0501035_0069525_167_1315 380
1582 3300049822 Ga0501035_0130017 Ga0501035_0130017_694_1842 380
1583 3300049822 Ga0501035_0155576 Ga0501035_0155576_811_1959 380
1584 3300049823 Ga0501044_0008299 Ga0501044_0008299_5731_6879 380
1585 3300049823 Ga0501044_0010153 Ga0501044_0010153_7974_9116 380
1586 3300049823 Ga0501044_0378393 Ga0501044_0378393_153_1304 380
1587 3300049824 Ga0501045_0000725 Ga0501045_0000725_4252_5400 380
1588 3300049824 Ga0501045_0003204 Ga0501045_0003204_4244_5392 380
1589 3300049824 Ga0501045_0003364 Ga0501045_0003364_1119_2267 380
1590 3300049824 Ga0501045_0013023 Ga0501045_0013023_170_1318 380
1591 3300049824 Ga0501045_0025509 Ga0501045_0025509_888_2036 380
1592 3300049824 Ga0501045_0078470 Ga0501045_0078470_1227_2375 380
1593 3300050490 nmdc:mga03n38_97111_c1 nmdc:mga03n38_97111_c1_154_1302 380
1594 3300050492 nmdc:mga0yw44_1691_c1 nmdc:mga0yw44_1691_c1_7454_8605 380
1595 3300050492 nmdc:mga0yw44_2625_c1 nmdc:mga0yw44_2625_c1_6104_7255 380
1596 3300050492 nmdc:mga0yw44_33385_c1 nmdc:mga0yw44_33385_c1_1721_2869 380
1597 3300050507 nmdc:mga05p37_2208_c1 nmdc:mga05p37_2208_c1_9009_10157 380
1598 3300050507 nmdc:mga05p37_30113_c1 nmdc:mga05p37_30113_c1_5408_6550 380
1599 3300050507 nmdc:mga05p37_47073_c1 nmdc:mga05p37_47073_c1_3133_4281 380
1600 3300050508 nmdc:mga09592_135167_c1 nmdc:mga09592_135167_c1_807_1955 380
1601 3300050508 nmdc:mga09592_33032_c1 nmdc:mga09592_33032_c1_663_1811 380
1602 3300050509 nmdc:mga0qj67_181720_c1 nmdc:mga0qj67_181720_c1_296_1444 380
1603 3300050509 nmdc:mga0qj67_66004_c1 nmdc:mga0qj67_66004_c1_1335_2483 380
1604 3300050509 nmdc:mga0qj67_8448_c1 nmdc:mga0qj67_8448_c1_663_1811 380
1605 3300050510 nmdc:mga06r32_107748_c1 nmdc:mga06r32_107748_c1_385_1533 380
1606 3300050510 nmdc:mga06r32_12374_c1 nmdc:mga06r32_12374_c1_5368_6516 380
1607 3300050510 nmdc:mga06r32_158411_c1 nmdc:mga06r32_158411_c1_268_1416 380
1608 3300050510 nmdc:mga06r32_30013_c1 nmdc:mga06r32_30013_c1_1995_3143 380
1609 3300050511 nmdc:mga08y16_451430_c1 nmdc:mga08y16_451430_c1_10_1152 380
1610 3300050511 nmdc:mga08y16_49670_c1 nmdc:mga08y16_49670_c1_214_1362 380
1611 3300050511 nmdc:mga08y16_72585_c1 nmdc:mga08y16_72585_c1_1505_2656 380
1612 3300050512 nmdc:mga0n895_196045_c1 nmdc:mga0n895_196045_c1_558_1739 380
1613 3300050512 nmdc:mga0n895_235323_c1 nmdc:mga0n895_235323_c1_610_1767 380
1614 3300050512 nmdc:mga0n895_3276_c1 nmdc:mga0n895_3276_c1_4361_5503 380
1615 3300050513 nmdc:mga0rr50_125550_c1 nmdc:mga0rr50_125550_c1_161_1303 380
1616 3300050513 nmdc:mga0rr50_335318_c1 nmdc:mga0rr50_335318_c1_62_1219 380
1617 3300050513 nmdc:mga0rr50_62699_c1 nmdc:mga0rr50_62699_c1_453_1634 380
1618 3300050514 nmdc:mga08x19_4090_c1 nmdc:mga08x19_4090_c1_3988_5130 380
1619 3300050515 nmdc:mga0a205_116864_c1 nmdc:mga0a205_116864_c1_28_1170 380
1620 3300050515 nmdc:mga0a205_258698_c1 nmdc:mga0a205_258698_c1_467_1609 380
1621 3300053077 Ga0495601_0004240 Ga0495601_0004240_795_1937 380
1622 3300053077 Ga0495601_0020581 Ga0495601_0020581_2324_3466 380
1623 3300053077 Ga0495601_0026317 Ga0495601_0026317_2042_3208 380
1624 3300053077 Ga0495601_0043337 Ga0495601_0043337_267_1409 380
1625 3300053077 Ga0495601_0104454 Ga0495601_0104454_28_1170 380
1626 3300053078 Ga0495612_0003194 Ga0495612_0003194_1944_3086 380
1627 3300053078 Ga0495612_0017040 Ga0495612_0017040_248_1390 380
1628 3300053078 Ga0495612_0052197 Ga0495612_0052197_271_1422 380
1629 3300053084 Ga0495595_0018875 Ga0495595_0018875_499_1641 380
1630 3300053084 Ga0495595_0024185 Ga0495595_0024185_665_1831 380
1631 3300053084 Ga0495595_0096053 Ga0495595_0096053_92_1234 380
1632 3300053085 Ga0495619_0005129 Ga0495619_0005129_2754_3896 380
1633 3300053085 Ga0495619_0008855 Ga0495619_0008855_4891_6057 380
1634 3300053085 Ga0495619_0016896 Ga0495619_0016896_2709_3857 380
1635 3300053085 Ga0495619_0158383 Ga0495619_0158383_279_1421 380
1636 3300053139 Ga0500568_0000011 Ga0500568_0000011_72906_74054 380
1637 3300053153 Ga0500616_0000905 Ga0500616_0000905_15105_16256 380
1638 3300053153 Ga0500616_0001088 Ga0500616_0001088_7667_8815 380
1639 3300054114 Ga0501084_0000086 Ga0501084_0000086_17522_18670 380
1640 3300054114 Ga0501084_0002919 Ga0501084_0002919_872_2020 380
1641 3300054114 Ga0501084_0007402 Ga0501084_0007402_4433_5581 380
1642 3300054114 Ga0501084_0024187 Ga0501084_0024187_1988_3136 380
1643 3300054114 Ga0501084_0049068 Ga0501084_0049068_1173_2321 380
1644 3300054114 Ga0501084_0076326 Ga0501084_0076326_142_1290 380
1645 3300060353 Ga0501082_0010656 Ga0501082_0010656_2523_3671 380
1646 3300060353 Ga0501082_0012946 Ga0501082_0012946_4674_5822 380
1647 3300060353 Ga0501082_0020755 Ga0501082_0020755_1704_2852 380
1648 3300060353 Ga0501082_0033862 Ga0501082_0033862_2420_3568 380
1649 3300060353 Ga0501082_0039827 Ga0501082_0039827_151_1299 380
1650 3300061719 Ga0466962_0015510 Ga0466962_0015510_1422_2570 380
1651 3300061734 Ga0530510_0001548 Ga0530510_0001548_8441_9589 380
1652 3300061734 Ga0530510_0003428 Ga0530510_0003428_8750_9898 380
1653 3300061734 Ga0530510_0006008 Ga0530510_0006008_4252_5400 380
1654 3300061734 Ga0530510_0012291 Ga0530510_0012291_1701_2849 380
1655 3300061734 Ga0530510_0136535 Ga0530510_0136535_607_1755 380

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

293

442

0.99

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

68

182

0.95

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

308

431

0.94

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

186

281

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pg0-assembly1.cif.gz_A crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus 0.9846 2 378
2jif-assembly1.cif.gz_D structure of human short-branched chain acyl-coa dehydrogenase (acadsb) 0.9627 1 379
1ivh-assembly1.cif.gz_B structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity 0.9621 6 379
4kto-assembly1.cif.gz_D crystal structure of a putative isovaleryl-coa dehydrogenase (psi-nysgrc-012251) from sinorhizobium meliloti 1021 0.9618 2 380
4kto-assembly1.cif.gz_C crystal structure of a putative isovaleryl-coa dehydrogenase (psi-nysgrc-012251) from sinorhizobium meliloti 1021 0.9604 2 379
ID Description Score Start End Superfamily
af_P28330_285_428_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 1.001 237 380 1.20.140.10
af_O33229_243_386_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9959 237 380 1.20.140.10
2pg0B03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9944 233 378 1.20.140.10
af_P28330_285_428_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9939 237 380 1.20.140.10
af_O33229_243_386_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.989 237 380 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A2R7SUN5-F1-model_v4 deleted 0.998 140 377
AF-V7MQB5-F1-model_v4 deleted 0.9948 1 323
AF-A0A848DKD1-F1-model_v4 Acyl-CoA dehydrogenase 0.9918 214 380 GO:0003995
GO:0005737
GO:0033539
GO:0050660
AF-A0A3Q2P568-F1-model_v4 Long-chain specific acyl-CoA dehydrogenase, mitochondrial (EC 1.3.8.8) 0.9913 2 379 GO:0004466
GO:0005759
GO:0016401
GO:0019254
GO:0033539
GO:0042758
GO:0050660
AF-A0A3S3V250-F1-model_v4 Acyl-[acyl-carrier-protein] dehydrogenase MbtN (Mycobactin synthase protein N) 0.9908 1 378 GO:0003995
GO:0005737
GO:0033539
GO:0050660

Feature Viewer

pLDDT pTM Quality
96.09 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map