F495176

General Info

Members Datasets Scaffolds Average Seq Length
1643 755 1412 195

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2876808645|2876810941
Length 229
Sequence NYDDNYIRGILNGVKSIAMVGASPVNVRPSYFAFKYLAQRGYDMIPVNPGHVGKSLLGKPFVASLSDIGRPVDMIDIFRNSSHIMPVVDEALTLSPPPKVIWMQLGARDDAAAEKAEAAGLKVVMNRCPKIEYGRLSSEISWMGVNSRTLSSKRAPIPTQGMRLSLNRTSVGGGATAASDRAAKNKSEXXXXXXXXXXXXXXXXDVTQYETIVSNTPQEEADAFLIHDM

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
17 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
18 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
19 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
20 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
21 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
22 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
23 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
24 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
25 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
26 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
27 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
28 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
29 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
30 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
31 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
32 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
33 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
34 2791355199
35 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
36 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
37 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
38 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
39 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
40 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
41 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
42 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
43 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
44 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
45 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
46 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
47 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
48 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
49 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
50 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
51 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
52 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
53 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
54 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
55 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
56 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
57 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
58 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
59 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
60 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
61 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
62 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
63 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
64 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
65 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
66 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
67 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
68 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
69 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
70 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
71 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
72 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
73 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
74 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
75 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
76 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
77 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
78 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
79 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
80 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
81 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
82 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
83 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
84 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
85 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
86 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
87 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
88 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
89 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
90 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
91 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
92 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
93 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
94 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
95 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
96 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
97 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
98 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
99 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
100 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
101 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
102 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
103 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
104 2904699407
105 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
106 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
107 2906610324
108 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
109 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
110 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
111 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
112 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
113 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
114 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
115 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
116 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
117 2922368715
118 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
119 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
120 2922425934
121 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
122 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
123 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
124 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
125 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
126 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
127 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
128 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
129 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
130 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
131 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
132 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
133 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
134 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
135 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
136 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
137 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
138 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
139 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
140 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
141 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
142 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
143 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
144 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
145 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
146 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
147 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
148 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
149 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
150 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
151 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
152 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
153 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
154 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
155 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
156 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
157 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
158 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
159 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
160 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
161 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
162 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
163 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
164 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
165 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
166 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
167 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
168 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
169 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
170 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
171 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
172 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
173 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
174 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
175 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
176 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
177 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
178 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
179 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
180 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
181 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
182 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
183 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
184 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
185 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
186 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
187 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
188 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
189 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
190 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
191 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
192 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
193 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
194 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
195 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
196 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
197 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
198 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
199 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
200 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
201 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
202 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
203 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
204 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
205 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
206 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
207 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
208 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
209 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
210 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
211 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
212 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
213 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
214 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
215 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
216 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
217 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
218 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
219 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
220 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
221 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
222 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
223 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
224 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
225 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
226 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
227 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
228 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
229 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
230 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
231 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
232 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
233 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
234 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
235 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
236 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
237 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
238 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
239 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
240 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
241 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
242 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
243 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
244 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
245 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
246 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
247 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
248 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
249 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
250 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
251 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
252 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
253 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
254 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
255 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
256 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
257 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
258 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
259 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
260 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
261 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
262 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
263 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
264 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
265 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
266 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
267 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
268 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
269 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
270 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
271 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
272 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
273 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
274 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
275 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
276 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
277 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
278 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
279 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
280 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
281 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
282 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
283 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
284 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
285 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
286 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
287 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
288 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
289 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
290 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
291 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
292 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
293 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
294 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
295 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
296 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
297 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
298 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
299 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
300 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
301 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
302 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
303 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
304 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
305 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
306 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
307 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
308 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
309 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
310 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
311 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
312 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
313 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
314 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
315 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
316 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
317 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
318 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
319 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
320 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
321 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
322 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
323 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
324 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
325 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
326 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
327 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
328 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
329 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
330 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
331 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
332 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
333 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
334 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
335 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
398 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
399 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
400 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
401 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
403 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
407 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
408 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
409 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
410 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
411 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
412 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
413 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
414 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
415 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
418 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
419 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
420 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
421 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
422 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
423 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
424 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
425 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
426 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
427 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
428 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
429 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
430 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
431 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
432 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
433 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
434 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
435 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
436 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
437 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
438 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
439 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
440 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
441 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
442 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
443 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
444 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
445 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
446 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
447 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
448 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
449 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
450 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
451 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
452 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
453 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
454 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
455 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
456 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
457 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
458 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
459 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
460 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
461 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
462 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
463 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
464 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
465 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
466 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
467 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
468 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
469 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
470 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
471 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
472 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
473 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
474 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
475 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
476 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
477 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
478 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
479 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
480 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
481 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
482 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
483 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
484 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
485 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
486 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
487 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
488 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
489 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
490 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
491 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
492 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
493 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
494 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
495 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
496 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
497 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
498 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
499 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
500 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
501 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
502 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
503 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
504 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
505 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
506 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
507 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
508 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
509 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
510 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
511 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
512 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
513 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
514 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
515 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
516 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
517 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
518 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
519 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
520 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
521 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
522 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
523 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
524 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
525 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
526 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
527 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
528 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
529 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
530 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
531 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
532 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
533 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
534 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
535 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
536 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
537 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
538 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
539 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
540 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
541 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
542 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
543 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
544 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
545 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
546 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
547 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
548 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
549 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
550 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
551 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
552 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
553 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
554 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
555 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
556 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
557 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
558 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
559 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
560 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
561 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
562 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
563 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
564 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
565 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
566 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
567 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
568 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
569 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
570 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
571 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
572 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
573 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
574 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
575 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
576 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
577 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
578 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
579 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
580 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
581 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
582 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
583 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
584 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
585 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
586 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
587 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
588 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
589 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
590 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
591 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
592 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
593 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
594 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
595 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
596 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
597 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
598 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
599 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
600 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
601 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
602 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
603 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
604 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
605 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
606 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
607 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
608 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
609 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
610 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
611 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
612 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
613 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
614 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
615 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
616 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
617 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
618 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
619 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
620 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
621 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
622 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
623 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
624 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
625 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
626 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
627 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
628 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
629 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
630 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
631 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
632 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
633 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
634 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
635 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
636 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
637 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
638 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
639 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
640 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
641 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
642 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
643 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
644 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
645 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
646 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
647 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
648 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
649 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
650 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
651 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
652 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
653 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
654 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
655 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
656 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
657 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
658 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
659 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
660 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
661 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
662 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
663 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
664 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
665 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
666 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
667 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
668 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
669 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
670 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
671 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
672 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
673 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
674 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
675 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
676 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
677 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
678 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
679 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
680 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
681 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
682 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
683 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
684 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
685 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
686 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
687 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
688 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
689 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
690 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
691 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
692 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
693 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
694 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
695 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
696 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
697 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
698 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
699 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
700 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
701 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
702 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
703 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
704 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
705 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
706 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
707 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
708 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
709 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
710 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
711 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
712 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
713 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
714 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
715 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
716 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
717 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
718 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
719 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
720 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
721 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
722 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
723 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
724 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
725 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
726 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
727 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
728 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
729 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
730 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
731 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
732 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
733 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
734 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
735 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
736 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
737 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
738 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
739 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
740 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
741 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
742 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
743 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
744 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
745 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
746 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
747 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
748 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
749 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
750 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
751 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
752 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
753 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
754 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
755 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.08
Metatranscriptomes 0.12
Isolates 13.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.76
Nodule 11.02
Rhizoplane 5.84
Rhizosphere 58.06
Stem 0
Stem Tuber 0
Unclassified 11.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C651 2010549000 Bacteria 1116
2 JGI25406J46586_10014911 3300003203 Bacteria 3291
3 JGI25406J46586_10094120 3300003203 Bacteria 900
4 JGI25165J46597_1006252 3300003214 Bacteria 2134
5 JGI25153J46596_10003518 3300003215 Bacteria 8738
6 JGI25153J46596_10006847 3300003215 Bacteria 5697
7 JGI25153J46596_10012797 3300003215 Bacteria 3593
8 JGI25153J46596_10016522 3300003215 Bacteria 2950
9 JGI25160J50197_1003097 3300003354 Bacteria 7586
10 JGI25160J50197_1005052 3300003354 Bacteria 5574
11 JGI25160J50197_1044907 3300003354 Bacteria 982
12 JGI25404J52841_10007374 3300003659 Bacteria 2324
13 JGI25404J52841_10040120 3300003659 Bacteria 991
14 Ga0055542_1011767 3300003762 Bacteria 1539
15 Ga0055526_1064162 3300003771 Bacteria 770
16 Ga0055531_10008796 3300003794 Bacteria 5262
17 Ga0055543_1003302 3300004625 Bacteria 4840
18 Ga0065165_1001864 3300005262 Bacteria 20463
19 Ga0065165_1019808 3300005262 Bacteria 2389
20 Ga0065165_1020382 3300005262 Bacteria 2333
21 Ga0070658_10230450 3300005327 Bacteria 1568
22 Ga0070676_10153610 3300005328 Bacteria 1475
23 Ga0070683_100029863 3300005329 Bacteria 4942
24 Ga0070683_100689422 3300005329 Bacteria 978
25 Ga0070670_100508728 3300005331 Bacteria 1072
26 Ga0068869_100111795 3300005334 Bacteria 2079
27 Ga0068869_100335859 3300005334 Bacteria 1229
28 Ga0068869_100467874 3300005334 Bacteria 1048
29 Ga0070680_100018923 3300005336 Bacteria 5449
30 Ga0070680_100187668 3300005336 Bacteria 1742
31 Ga0070680_100463579 3300005336 Bacteria 1083
32 Ga0070680_100492177 3300005336 Bacteria 1049
33 Ga0070682_100026401 3300005337 Bacteria 3475
34 Ga0070682_100162523 3300005337 Bacteria 1544
35 Ga0070682_100362253 3300005337 Bacteria 1085
36 Ga0070682_100542480 3300005337 Bacteria 909
37 Ga0068868_100589656 3300005338 Bacteria 983
38 Ga0070660_100010416 3300005339 Bacteria 6570
39 Ga0070660_100253469 3300005339 Bacteria 1436
40 Ga0070660_100299299 3300005339 Bacteria 1319
41 Ga0070687_100206945 3300005343 Bacteria 1193
42 Ga0070661_100006251 3300005344 Bacteria 8217
43 Ga0070661_100377068 3300005344 Bacteria 1118
44 Ga0070668_100067207 3300005347 Bacteria 2784
45 Ga0070668_100089962 3300005347 Bacteria 2418
46 Ga0070668_100138774 3300005347 Bacteria 1957
47 Ga0070669_100378212 3300005353 Bacteria 1154
48 Ga0070669_100843392 3300005353 Bacteria 780
49 Ga0070675_100065137 3300005354 Bacteria 3012
50 Ga0070675_101244157 3300005354 Bacteria 686
51 Ga0070671_100276120 3300005355 Bacteria 1429
52 Ga0070671_100531100 3300005355 Bacteria 1013
53 Ga0070671_100706021 3300005355 Bacteria 875
54 Ga0070674_100078595 3300005356 Bacteria 2351
55 Ga0070674_100111556 3300005356 Bacteria 2009
56 Ga0070659_100177733 3300005366 Bacteria 1746
57 Ga0070659_100375862 3300005366 Bacteria 1196
58 Ga0070659_100448417 3300005366 Bacteria 1094
59 Ga0070667_100134781 3300005367 Bacteria 2159
60 Ga0070709_10000951 3300005434 Bacteria 16067
61 Ga0070709_10076815 3300005434 Bacteria 2170
62 Ga0070709_10172145 3300005434 Bacteria 1514
63 Ga0070714_100010720 3300005435 Bacteria 7252
64 Ga0070714_100074142 3300005435 Bacteria 2950
65 Ga0070714_100226980 3300005435 Bacteria 1719
66 Ga0070714_100386619 3300005435 Bacteria 1320
67 Ga0070713_100000936 3300005436 Bacteria 18647
68 Ga0070713_100005223 3300005436 Bacteria 8847
69 Ga0070713_100066626 3300005436 Bacteria 3028
70 Ga0070713_100098866 3300005436 Bacteria 2524
71 Ga0070713_100294418 3300005436 Bacteria 1493
72 Ga0070710_10002437 3300005437 Bacteria 8807
73 Ga0070710_10372108 3300005437 Bacteria 951
74 Ga0070711_100003765 3300005439 Bacteria 8895
75 Ga0070711_100010373 3300005439 Bacteria 5763
76 Ga0070711_100133712 3300005439 Bacteria 1850
77 Ga0070705_100788869 3300005440 Bacteria 755
78 Ga0070663_100028775 3300005455 Bacteria 3788
79 Ga0070663_100033215 3300005455 Bacteria 3563
80 Ga0070663_100051889 3300005455 Bacteria 2924
81 Ga0070663_100153154 3300005455 Bacteria 1769
82 Ga0070678_100038290 3300005456 Bacteria 3375
83 Ga0070678_100046100 3300005456 Bacteria 3123
84 Ga0070678_100050632 3300005456 Bacteria 3006
85 Ga0070678_100622586 3300005456 Bacteria 966
86 Ga0070662_100017777 3300005457 Bacteria 4797
87 Ga0070662_100462378 3300005457 Bacteria 1055
88 Ga0070662_100473847 3300005457 Bacteria 1042
89 Ga0070681_10013529 3300005458 Bacteria 8113
90 Ga0070681_10024245 3300005458 Bacteria 6107
91 Ga0070681_10034302 3300005458 Bacteria 5096
92 Ga0070681_10147981 3300005458 Bacteria 2276
93 Ga0070681_10189850 3300005458 Bacteria 1974
94 Ga0070681_10200951 3300005458 Bacteria 1911
95 Ga0070681_10531280 3300005458 Bacteria 1090
96 Ga0068867_100452316 3300005459 Bacteria 1094
97 Ga0070698_100415922 3300005471 Bacteria 1279
98 Ga0070699_100742334 3300005518 Bacteria 898
99 Ga0070699_101106830 3300005518 Bacteria 727
100 Ga0070679_100007218 3300005530 Bacteria 10377
101 Ga0070679_100095395 3300005530 Bacteria 2962
102 Ga0070679_100136758 3300005530 Bacteria 2431
103 Ga0070679_100418008 3300005530 Bacteria 1286
104 Ga0070679_100485784 3300005530 Bacteria 1179
105 Ga0070679_100526022 3300005530 Bacteria 1126
106 Ga0070684_100018029 3300005535 Bacteria 5805
107 Ga0070684_100036613 3300005535 Bacteria 4205
108 Ga0070684_100064431 3300005535 Bacteria 3215
109 Ga0070684_100084021 3300005535 Bacteria 2821
110 Ga0070684_100456942 3300005535 Bacteria 1181
111 Ga0070697_100056309 3300005536 Bacteria 3199
112 Ga0068853_100004481 3300005539 Bacteria 10832
113 Ga0068853_100263379 3300005539 Bacteria 1585
114 Ga0068853_100422717 3300005539 Bacteria 1250
115 Ga0068853_100435135 3300005539 Bacteria 1232
116 Ga0070672_100651502 3300005543 Bacteria 920
117 Ga0070693_100060897 3300005547 Bacteria 2192
118 Ga0070693_100390176 3300005547 Bacteria 963
119 Ga0070665_100062885 3300005548 Bacteria 3722
120 Ga0070665_100094386 3300005548 Bacteria 2996
121 Ga0070665_100100681 3300005548 Bacteria 2894
122 Ga0070665_100139357 3300005548 Bacteria 2429
123 Ga0070665_100290721 3300005548 Bacteria 1637
124 Ga0070665_100335848 3300005548 Bacteria 1515
125 Ga0070665_100475332 3300005548 Bacteria 1260
126 Ga0070665_100839981 3300005548 Bacteria 931
127 Ga0070704_100205904 3300005549 Bacteria 1591
128 Ga0068855_100026568 3300005563 Bacteria 6926
129 Ga0068855_100067965 3300005563 Bacteria 4150
130 Ga0068855_100121768 3300005563 Bacteria 2985
131 Ga0068855_100202775 3300005563 Bacteria 2232
132 Ga0068855_100221112 3300005563 Bacteria 2123
133 Ga0068855_100325301 3300005563 Bacteria 1698
134 Ga0068855_100446345 3300005563 Bacteria 1412
135 Ga0068855_100505285 3300005563 Bacteria 1313
136 Ga0068855_100610859 3300005563 Bacteria 1175
137 Ga0070664_100074373 3300005564 Bacteria 2916
138 Ga0070664_100631390 3300005564 Bacteria 995
139 Ga0068857_100017569 3300005577 Bacteria 6271
140 Ga0068857_100145722 3300005577 Bacteria 2143
141 Ga0068857_100921285 3300005577 Bacteria 839
142 Ga0068857_101371698 3300005577 Bacteria 687
143 Ga0068854_100177549 3300005578 Bacteria 1661
144 Ga0068856_100006094 3300005614 Bacteria 11843
145 Ga0068856_100185539 3300005614 Bacteria 2094
146 Ga0068856_100253901 3300005614 Bacteria 1773
147 Ga0068856_100519403 3300005614 Bacteria 1212
148 Ga0068856_100547175 3300005614 Bacteria 1179
149 Ga0068856_100984659 3300005614 Bacteria 862
150 Ga0068852_100002018 3300005616 Bacteria 13824
151 Ga0068852_100082448 3300005616 Bacteria 2857
152 Ga0068852_100103345 3300005616 Bacteria 2577
153 Ga0068852_100141834 3300005616 Bacteria 2225
154 Ga0068852_100218320 3300005616 Bacteria 1812
155 Ga0068852_100312610 3300005616 Bacteria 1524
156 Ga0068852_100641887 3300005616 Bacteria 1069
157 Ga0068852_101445009 3300005616 Bacteria 710
158 Ga0068859_100251619 3300005617 Bacteria 1857
159 Ga0068859_100414858 3300005617 Bacteria 1442
160 Ga0068859_100474485 3300005617 Bacteria 1346
161 Ga0068864_100546987 3300005618 Bacteria 1118
162 Ga0068861_100195399 3300005719 Bacteria 1694
163 Ga0068861_100354350 3300005719 Bacteria 1288
164 Ga0068851_10013775 3300005834 Bacteria 3829
165 Ga0068851_10201064 3300005834 Bacteria 1112
166 Ga0068863_100318014 3300005841 Bacteria 1511
167 Ga0068863_100905256 3300005841 Bacteria 882
168 Ga0068858_100248395 3300005842 Bacteria 1690
169 Ga0068858_100313002 3300005842 Bacteria 1499
170 Ga0068858_100355497 3300005842 Bacteria 1404
171 Ga0068858_100444577 3300005842 Bacteria 1249
172 Ga0068860_100000058 3300005843 Bacteria 197181
173 Ga0068860_100204938 3300005843 Bacteria 1912
174 Ga0068860_100353409 3300005843 Bacteria 1446
175 Ga0068860_100692530 3300005843 Bacteria 1028
176 Ga0068862_100037323 3300005844 Bacteria 4118
177 Ga0068862_100105591 3300005844 Bacteria 2468
178 Ga0068862_100626257 3300005844 Bacteria 1035
179 Ga0068862_100943347 3300005844 Bacteria 850
180 Ga0081455_10009084 3300005937 Bacteria 10254
181 Ga0081455_10018953 3300005937 Bacteria 6526
182 Ga0081455_10059666 3300005937 Bacteria 3220
183 Ga0081455_10074357 3300005937 Bacteria 2807
184 Ga0081455_10202229 3300005937 Bacteria 1487
185 Ga0081455_10251739 3300005937 Bacteria 1291
186 Ga0081538_10043006 3300005981 Bacteria 2843
187 Ga0081538_10176859 3300005981 Bacteria 920
188 Ga0081540_1001631 3300005983 Bacteria 19125
189 Ga0081540_1004115 3300005983 Bacteria 11230
190 Ga0081540_1009209 3300005983 Bacteria 6810
191 Ga0081540_1009520 3300005983 Bacteria 6689
192 Ga0081540_1024605 3300005983 Bacteria 3491
193 Ga0081540_1031069 3300005983 Bacteria 2945
194 Ga0081540_1037550 3300005983 Bacteria 2566
195 Ga0081540_1040575 3300005983 Bacteria 2425
196 Ga0081540_1122431 3300005983 Bacteria 1077
197 Ga0081539_10000250 3300005985 Bacteria 125352
198 Ga0081539_10000269 3300005985 Bacteria 119082
199 Ga0081539_10017984 3300005985 Bacteria 4930
200 Ga0081539_10176671 3300005985 Bacteria 1005
201 Ga0070717_10001774 3300006028 Bacteria 15044
202 Ga0070717_10049640 3300006028 Bacteria 3445
203 Ga0070717_10304250 3300006028 Bacteria 1418
204 Ga0075365_10015428 3300006038 Bacteria 4623
205 Ga0075365_10040951 3300006038 Bacteria 3023
206 Ga0075365_10053219 3300006038 Bacteria 2680
207 Ga0075365_10059845 3300006038 Bacteria 2540
208 Ga0075365_10130996 3300006038 Bacteria 1736
209 Ga0075365_10148307 3300006038 Bacteria 1631
210 Ga0075365_10236657 3300006038 Bacteria 1282
211 Ga0075365_10406974 3300006038 Bacteria 960
212 Ga0075368_10017232 3300006042 Bacteria 2702
213 Ga0075368_10096813 3300006042 Bacteria 1210
214 Ga0075368_10124387 3300006042 Bacteria 1069
215 Ga0075368_10168457 3300006042 Bacteria 920
216 Ga0075363_100012935 3300006048 Bacteria 4030
217 Ga0075363_100086970 3300006048 Bacteria 1717
218 Ga0075363_100201765 3300006048 Bacteria 1136
219 Ga0075364_10090682 3300006051 Bacteria 2027
220 Ga0075364_10106011 3300006051 Bacteria 1873
221 Ga0075364_10378106 3300006051 Bacteria 966
222 Ga0070715_10000514 3300006163 Bacteria 10119
223 Ga0070715_10044050 3300006163 Bacteria 1885
224 Ga0070716_100004285 3300006173 Bacteria 6796
225 Ga0070716_100179140 3300006173 Bacteria 1390
226 Ga0070712_100072591 3300006175 Bacteria 2466
227 Ga0070712_100089027 3300006175 Bacteria 2257
228 Ga0070712_100575789 3300006175 Bacteria 951
229 Ga0075362_10229066 3300006177 Bacteria 910
230 Ga0075367_10026323 3300006178 Bacteria 3298
231 Ga0075367_10056089 3300006178 Bacteria 2340
232 Ga0075367_10215730 3300006178 Bacteria 1200
233 Ga0075369_10073960 3300006186 Bacteria 1503
234 Ga0075366_10056404 3300006195 Bacteria 2333
235 Ga0075366_10105423 3300006195 Bacteria 1694
236 Ga0075366_10253032 3300006195 Bacteria 1074
237 Ga0075366_10405609 3300006195 Bacteria 839
238 Ga0097621_100698839 3300006237 Bacteria 934
239 Ga0097621_101048862 3300006237 Bacteria 764
240 Ga0075370_10030042 3300006353 Bacteria 3031
241 Ga0075370_10065298 3300006353 Bacteria 2076
242 Ga0075370_10112231 3300006353 Bacteria 1583
243 Ga0075370_10225902 3300006353 Bacteria 1107
244 Ga0075370_10334931 3300006353 Bacteria 903
245 Ga0075433_10628661 3300006852 Bacteria 942
246 Ga0075434_100008873 3300006871 Bacteria 9361
247 Ga0075434_100915210 3300006871 Bacteria 892
248 Ga0075434_101575156 3300006871 Bacteria 666
249 Ga0068865_100075446 3300006881 Bacteria 2404
250 Ga0097620_100251646 3300006931 Bacteria 1857
251 Ga0097620_100414853 3300006931 Bacteria 1442
252 Ga0097620_100474452 3300006931 Bacteria 1346
253 Ga0099825_1017862 3300006941 Bacteria 5680
254 Ga0099824_1004496 3300006942 Bacteria 20072
255 Ga0099822_1001205 3300006943 Bacteria 29230
256 Ga0099823_1074998 3300006944 Bacteria 1417
257 Ga0099794_10111599 3300007265 Bacteria 1370
258 Ga0099794_10247543 3300007265 Bacteria 919
259 Ga0099795_10028277 3300007788 Bacteria 1905
260 Ga0099795_10043937 3300007788 Bacteria 1601
261 Ga0099795_10117800 3300007788 Bacteria 1059
262 Ga0105250_10146291 3300009092 Bacteria 981
263 Ga0105240_10037185 3300009093 Bacteria 6257
264 Ga0105240_10060299 3300009093 Bacteria 4730
265 Ga0105240_10147223 3300009093 Bacteria 2809
266 Ga0105240_10170959 3300009093 Bacteria 2574
267 Ga0105240_10216390 3300009093 Bacteria 2235
268 Ga0111539_10054668 3300009094 Bacteria 4749
269 Ga0105245_10018719 3300009098 Bacteria 6058
270 Ga0105245_10083841 3300009098 Bacteria 2918
271 Ga0105245_10132382 3300009098 Bacteria 2340
272 Ga0105247_10005197 3300009101 Bacteria 8229
273 Ga0105247_10043201 3300009101 Bacteria 2761
274 Ga0105247_10120425 3300009101 Bacteria 1700
275 Ga0105247_10122234 3300009101 Bacteria 1688
276 Ga0105247_10534453 3300009101 Bacteria 860
277 Ga0105247_10766575 3300009101 Bacteria 733
278 Ga0105247_10808356 3300009101 Bacteria 716
279 Ga0105243_10023714 3300009148 Bacteria 4676
280 Ga0105243_10246899 3300009148 Bacteria 1591
281 Ga0105241_10022043 3300009174 Bacteria 4715
282 Ga0105241_10022614 3300009174 Bacteria 4657
283 Ga0105241_10244997 3300009174 Bacteria 1517
284 Ga0105241_10351808 3300009174 Bacteria 1279
285 Ga0105241_10447478 3300009174 Bacteria 1142
286 Ga0105242_10193943 3300009176 Bacteria 1800
287 Ga0105242_10279996 3300009176 Bacteria 1515
288 Ga0105248_10199489 3300009177 Bacteria 2254
289 Ga0105248_10489643 3300009177 Bacteria 1386
290 Ga0105248_10614982 3300009177 Bacteria 1226
291 Ga0105248_10836986 3300009177 Bacteria 1039
292 Ga0105248_10858407 3300009177 Bacteria 1025
293 Ga0105248_10989480 3300009177 Bacteria 950
294 Ga0105248_11095786 3300009177 Bacteria 900
295 Ga0105237_10003757 3300009545 Bacteria 17883
296 Ga0105237_10013957 3300009545 Bacteria 8407
297 Ga0105237_10108092 3300009545 Bacteria 2773
298 Ga0105237_10154651 3300009545 Bacteria 2290
299 Ga0105237_10207611 3300009545 Bacteria 1959
300 Ga0105237_10355262 3300009545 Bacteria 1470
301 Ga0105238_10012843 3300009551 Bacteria 8450
302 Ga0105238_10087356 3300009551 Bacteria 3105
303 Ga0105238_10108517 3300009551 Bacteria 2757
304 Ga0105238_10355678 3300009551 Bacteria 1454
305 Ga0105238_10378419 3300009551 Bacteria 1407
306 Ga0105238_10431818 3300009551 Bacteria 1313
307 Ga0105238_10991369 3300009551 Bacteria 861
308 Ga0105249_10548931 3300009553 Bacteria 1206
309 Ga0099796_10007070 3300010159 Bacteria 2914
310 Ga0105239_10083730 3300010375 Bacteria 3513
311 Ga0105239_10095378 3300010375 Bacteria 3286
312 Ga0105239_10099271 3300010375 Bacteria 3219
313 Ga0105239_10132392 3300010375 Bacteria 2774
314 Ga0105239_10168407 3300010375 Bacteria 2450
315 Ga0105239_10300527 3300010375 Bacteria 1807
316 Ga0105239_10489871 3300010375 Bacteria 1397
317 Ga0105239_10608053 3300010375 Bacteria 1247
318 Ga0105239_10734397 3300010375 Bacteria 1130
319 Ga0105246_10121996 3300011119 Bacteria 1933
320 Ga0105246_10388004 3300011119 Bacteria 1156
321 Ga0105246_10416012 3300011119 Bacteria 1120
322 Ga0157325_1010924 3300012485 Bacteria 675
323 Ga0157313_1006498 3300012503 Bacteria 881
324 Ga0157373_10114711 3300013100 Bacteria 1894
325 Ga0157371_10127012 3300013102 Bacteria 1814
326 Ga0157370_10076545 3300013104 Bacteria 3152
327 Ga0157370_10358922 3300013104 Bacteria 1343
328 Ga0157370_10375147 3300013104 Bacteria 1310
329 Ga0157370_10562780 3300013104 Bacteria 1045
330 Ga0157370_10970339 3300013104 Bacteria 770
331 Ga0157369_10008435 3300013105 Bacteria 11819
332 Ga0157369_10030907 3300013105 Bacteria 5902
333 Ga0157369_10163132 3300013105 Bacteria 2351
334 Ga0157369_10455646 3300013105 Bacteria 1324
335 Ga0157369_10830928 3300013105 Bacteria 948
336 Ga0157374_10073477 3300013296 Bacteria 3228
337 Ga0157374_10161238 3300013296 Bacteria 2184
338 Ga0157374_10172122 3300013296 Bacteria 2113
339 Ga0157374_11494353 3300013296 Bacteria 699
340 Ga0157378_10015347 3300013297 Bacteria 6709
341 Ga0157378_10375595 3300013297 Bacteria 1395
342 Ga0163162_10413533 3300013306 Bacteria 1481
343 Ga0163162_10605167 3300013306 Bacteria 1222
344 Ga0157372_10096728 3300013307 Bacteria 3365
345 Ga0157372_10447920 3300013307 Bacteria 1505
346 Ga0157372_10756641 3300013307 Bacteria 1130
347 Ga0157372_11580295 3300013307 Bacteria 755
348 Ga0157375_10022349 3300013308 Bacteria 5821
349 Ga0157375_10191028 3300013308 Bacteria 2202
350 Ga0157375_10247572 3300013308 Bacteria 1943
351 Ga0157375_10312102 3300013308 Bacteria 1737
352 Ga0157375_10529595 3300013308 Bacteria 1341
353 Ga0157375_10586051 3300013308 Bacteria 1275
354 Ga0157375_11317625 3300013308 Bacteria 849
355 Ga0163163_10017322 3300014325 Bacteria 6718
356 Ga0163163_10048111 3300014325 Bacteria 4192
357 Ga0163163_10420635 3300014325 Bacteria 1395
358 Ga0163163_10549931 3300014325 Bacteria 1217
359 Ga0163163_11066205 3300014325 Bacteria 871
360 Ga0157380_10126713 3300014326 Bacteria 2171
361 Ga0157380_10338062 3300014326 Bacteria 1403
362 Ga0157380_10358136 3300014326 Bacteria 1368
363 Ga0157380_11479962 3300014326 Bacteria 731
364 Ga0157377_10198201 3300014745 Bacteria 1273
365 Ga0157379_10250131 3300014968 Bacteria 1609
366 Ga0157379_10434627 3300014968 Bacteria 1210
367 Ga0157379_10631896 3300014968 Bacteria 1001
368 Ga0157376_10054586 3300014969 Bacteria 3331
369 Ga0157376_10247875 3300014969 Bacteria 1662
370 Ga0157376_10438937 3300014969 Bacteria 1271
371 Ga0157376_10550588 3300014969 Bacteria 1142
372 Ga0163161_10180473 3300017792 Bacteria 1618
373 Ga0163161_10414456 3300017792 Bacteria 1082
374 Ga0214544_1000009 3300021320 Bacteria 285865
375 Ga0214542_1000002 3300021321 Bacteria 720798
376 Ga0214545_1000002 3300021324 Bacteria 727485
377 Ga0214543_1000013 3300021327 Bacteria 329117
378 Ga0213873_10038419 3300021358 Bacteria 1223
379 Ga0213874_10051145 3300021377 Bacteria 1268
380 Ga0213876_10001848 3300021384 Bacteria 12750
381 Ga0213876_10011429 3300021384 Bacteria 4740
382 Ga0213875_10035810 3300021388 Bacteria 2341
383 Ga0213875_10269927 3300021388 Bacteria 803
384 Ga0209563_101045 3300025230 Bacteria 7993
385 Ga0209677_102385 3300025253 Bacteria 7158
386 Ga0209677_102571 3300025253 Bacteria 6678
387 Ga0209148_1000446 3300025254 Bacteria 45354
388 Ga0209233_1001302 3300025261 Bacteria 9962
389 Ga0209233_1001367 3300025261 Bacteria 9687
390 Ga0209233_1031508 3300025261 Bacteria 1237
391 Ga0209455_1006256 3300025272 Bacteria 3543
392 Ga0209673_1049900 3300025273 Bacteria 1115
393 Ga0209564_1009891 3300025295 Bacteria 4467
394 Ga0209564_1024293 3300025295 Bacteria 2074
395 Ga0209758_1000100 3300025297 Bacteria 227948
396 Ga0209758_1000160 3300025297 Bacteria 154304
397 Ga0209758_1002793 3300025297 Bacteria 17073
398 Ga0209758_1003932 3300025297 Bacteria 12945
399 Ga0209758_1005852 3300025297 Bacteria 9179
400 Ga0209758_1016663 3300025297 Bacteria 3715
401 Ga0209758_1030410 3300025297 Bacteria 2237
402 Ga0209758_1031291 3300025297 Bacteria 2185
403 Ga0209050_1050100 3300025298 Bacteria 1064
404 Ga0209256_1010637 3300025299 Bacteria 3820
405 Ga0207426_1001094 3300025302 Bacteria 25012
406 Ga0207426_1002241 3300025302 Bacteria 12874
407 Ga0207426_1021409 3300025302 Bacteria 2236
408 Ga0209257_1005571 3300025304 Bacteria 8758
409 Ga0207697_10040240 3300025315 Bacteria 1919
410 Ga0207697_10137630 3300025315 Bacteria 1058
411 Ga0207697_10307825 3300025315 Bacteria 703
412 Ga0207656_10212297 3300025321 Bacteria 938
413 Ga0207696_1077977 3300025711 Bacteria 917
414 Ga0207692_10000308 3300025898 Bacteria 16906
415 Ga0207692_10002064 3300025898 Bacteria 7672
416 Ga0207692_10095563 3300025898 Bacteria 1621
417 Ga0207642_10018415 3300025899 Bacteria 2680
418 Ga0207710_10005066 3300025900 Bacteria 5706
419 Ga0207710_10011801 3300025900 Bacteria 3674
420 Ga0207688_10224906 3300025901 Bacteria 1131
421 Ga0207680_10359672 3300025903 Bacteria 1023
422 Ga0207647_10015173 3300025904 Bacteria 5291
423 Ga0207647_10066702 3300025904 Bacteria 2182
424 Ga0207647_10150208 3300025904 Bacteria 1362
425 Ga0207647_10173629 3300025904 Bacteria 1254
426 Ga0207685_10000468 3300025905 Bacteria 6799
427 Ga0207685_10068762 3300025905 Bacteria 1428
428 Ga0207699_10001291 3300025906 Bacteria 11902
429 Ga0207699_10010647 3300025906 Bacteria 4624
430 Ga0207699_10128528 3300025906 Bacteria 1649
431 Ga0207645_10027775 3300025907 Bacteria 3653
432 Ga0207645_10030138 3300025907 Bacteria 3496
433 Ga0207643_10223284 3300025908 Bacteria 1154
434 Ga0207705_10274616 3300025909 Bacteria 1289
435 Ga0207684_10085353 3300025910 Bacteria 2689
436 Ga0207654_10070600 3300025911 Bacteria 2074
437 Ga0207654_10077759 3300025911 Bacteria 1990
438 Ga0207654_10185810 3300025911 Bacteria 1359
439 Ga0207707_10000494 3300025912 Bacteria 40531
440 Ga0207707_10000896 3300025912 Bacteria 29115
441 Ga0207707_10026257 3300025912 Bacteria 5091
442 Ga0207707_10109574 3300025912 Bacteria 2414
443 Ga0207707_10304168 3300025912 Bacteria 1379
444 Ga0207695_10000278 3300025913 Bacteria 127446
445 Ga0207695_10080608 3300025913 Bacteria 3296
446 Ga0207695_10184308 3300025913 Bacteria 2007
447 Ga0207695_10254696 3300025913 Bacteria 1654
448 Ga0207695_10340327 3300025913 Bacteria 1388
449 Ga0207695_10752725 3300025913 Bacteria 854
450 Ga0207671_10006710 3300025914 Bacteria 10194
451 Ga0207671_10062495 3300025914 Bacteria 2765
452 Ga0207671_10128103 3300025914 Bacteria 1946
453 Ga0207671_10187699 3300025914 Bacteria 1611
454 Ga0207671_10222555 3300025914 Bacteria 1479
455 Ga0207671_10388735 3300025914 Bacteria 1109
456 Ga0207693_10001932 3300025915 Bacteria 18147
457 Ga0207693_10006236 3300025915 Bacteria 9891
458 Ga0207693_10012373 3300025915 Bacteria 6893
459 Ga0207693_10013898 3300025915 Bacteria 6483
460 Ga0207693_10105956 3300025915 Bacteria 2205
461 Ga0207663_10000365 3300025916 Bacteria 19715
462 Ga0207663_10007002 3300025916 Bacteria 5817
463 Ga0207663_10027757 3300025916 Bacteria 3304
464 Ga0207663_10129357 3300025916 Bacteria 1742
465 Ga0207660_10001052 3300025917 Bacteria 18273
466 Ga0207660_10017659 3300025917 Bacteria 4744
467 Ga0207660_10065377 3300025917 Bacteria 2628
468 Ga0207660_10082459 3300025917 Bacteria 2366
469 Ga0207657_10011901 3300025919 Bacteria 8609
470 Ga0207657_10199380 3300025919 Bacteria 1611
471 Ga0207657_10348207 3300025919 Bacteria 1168
472 Ga0207657_10349687 3300025919 Bacteria 1166
473 Ga0207657_10416926 3300025919 Bacteria 1056
474 Ga0207649_10891177 3300025920 Bacteria 697
475 Ga0207652_10001721 3300025921 Bacteria 19093
476 Ga0207652_10002542 3300025921 Bacteria 15319
477 Ga0207652_10029879 3300025921 Bacteria 4561
478 Ga0207652_10033319 3300025921 Bacteria 4337
479 Ga0207652_10255219 3300025921 Bacteria 1581
480 Ga0207652_10264232 3300025921 Bacteria 1552
481 Ga0207652_10346860 3300025921 Bacteria 1340
482 Ga0207646_10052414 3300025922 Bacteria 3651
483 Ga0207681_10237112 3300025923 Bacteria 1418
484 Ga0207694_10046441 3300025924 Bacteria 3356
485 Ga0207694_10115281 3300025924 Bacteria 2140
486 Ga0207694_10195200 3300025924 Bacteria 1646
487 Ga0207694_10239753 3300025924 Bacteria 1482
488 Ga0207694_10272737 3300025924 Bacteria 1388
489 Ga0207694_10671562 3300025924 Bacteria 873
490 Ga0207694_11045332 3300025924 Bacteria 691
491 Ga0207650_10105342 3300025925 Bacteria 2177
492 Ga0207687_10012698 3300025927 Bacteria 5503
493 Ga0207687_10086909 3300025927 Bacteria 2271
494 Ga0207687_10355679 3300025927 Bacteria 1194
495 Ga0207700_10000752 3300025928 Bacteria 18675
496 Ga0207700_10076249 3300025928 Bacteria 2601
497 Ga0207700_10209162 3300025928 Bacteria 1648
498 Ga0207700_10639121 3300025928 Bacteria 948
499 Ga0207664_10023582 3300025929 Bacteria 4613
500 Ga0207664_10143318 3300025929 Bacteria 2024
501 Ga0207664_10843445 3300025929 Bacteria 824
502 Ga0207644_10058994 3300025931 Bacteria 2775
503 Ga0207644_10244542 3300025931 Bacteria 1429
504 Ga0207690_10197654 3300025932 Bacteria 1525
505 Ga0207690_10291979 3300025932 Bacteria 1273
506 Ga0207690_10358604 3300025932 Bacteria 1154
507 Ga0207706_10114484 3300025933 Bacteria 2372
508 Ga0207686_10173751 3300025934 Bacteria 1522
509 Ga0207686_10373665 3300025934 Bacteria 1079
510 Ga0207709_10052805 3300025935 Bacteria 2498
511 Ga0207709_10369126 3300025935 Bacteria 1089
512 Ga0207669_10052815 3300025937 Bacteria 2444
513 Ga0207669_10086954 3300025937 Bacteria 2023
514 Ga0207669_10258533 3300025937 Bacteria 1301
515 Ga0207669_10447611 3300025937 Bacteria 1023
516 Ga0207669_10572483 3300025937 Bacteria 914
517 Ga0207704_10014890 3300025938 Bacteria 3945
518 Ga0207665_10000957 3300025939 Bacteria 19547
519 Ga0207665_10004741 3300025939 Bacteria 9038
520 Ga0207665_10539715 3300025939 Bacteria 905
521 Ga0207691_10033524 3300025940 Bacteria 4780
522 Ga0207691_10034661 3300025940 Bacteria 4692
523 Ga0207691_10824720 3300025940 Bacteria 779
524 Ga0207711_10396851 3300025941 Bacteria 1281
525 Ga0207711_10430120 3300025941 Bacteria 1228
526 Ga0207711_10931781 3300025941 Bacteria 807
527 Ga0207689_10188972 3300025942 Bacteria 1699
528 Ga0207689_10240079 3300025942 Bacteria 1498
529 Ga0207689_10365900 3300025942 Bacteria 1199
530 Ga0207661_10015207 3300025944 Bacteria 5658
531 Ga0207661_10223074 3300025944 Bacteria 1666
532 Ga0207661_10390469 3300025944 Bacteria 1261
533 Ga0207679_10054680 3300025945 Bacteria 2940
534 Ga0207679_10541624 3300025945 Bacteria 1043
535 Ga0207679_10565554 3300025945 Bacteria 1021
536 Ga0207667_10003512 3300025949 Bacteria 19383
537 Ga0207667_10010956 3300025949 Bacteria 10568
538 Ga0207667_10184363 3300025949 Bacteria 2143
539 Ga0207667_10215470 3300025949 Bacteria 1968
540 Ga0207667_10330631 3300025949 Bacteria 1556
541 Ga0207667_10521761 3300025949 Bacteria 1203
542 Ga0207667_11267521 3300025949 Bacteria 714
543 Ga0207651_10307059 3300025960 Bacteria 1321
544 Ga0207651_10650690 3300025960 Bacteria 925
545 Ga0207712_10215242 3300025961 Bacteria 1533
546 Ga0207712_10687044 3300025961 Bacteria 892
547 Ga0207668_10106980 3300025972 Bacteria 2090
548 Ga0207668_10191611 3300025972 Bacteria 1620
549 Ga0207668_10193574 3300025972 Bacteria 1613
550 Ga0207668_10221896 3300025972 Bacteria 1518
551 Ga0207668_11005197 3300025972 Bacteria 745
552 Ga0207658_10255064 3300025986 Bacteria 1492
553 Ga0207658_10258570 3300025986 Bacteria 1483
554 Ga0207658_11234830 3300025986 Bacteria 683
555 Ga0207677_10194612 3300026023 Bacteria 1607
556 Ga0207677_10602621 3300026023 Bacteria 964
557 Ga0207703_10093548 3300026035 Bacteria 2532
558 Ga0207703_10131827 3300026035 Bacteria 2159
559 Ga0207703_10204380 3300026035 Bacteria 1757
560 Ga0207703_10263644 3300026035 Bacteria 1558
561 Ga0207703_11031884 3300026035 Bacteria 789
562 Ga0207639_10007089 3300026041 Bacteria 7645
563 Ga0207639_10149273 3300026041 Bacteria 1956
564 Ga0207639_10358067 3300026041 Bacteria 1305
565 Ga0207639_10685993 3300026041 Bacteria 950
566 Ga0207639_10903925 3300026041 Bacteria 825
567 Ga0207678_10060617 3300026067 Bacteria 3254
568 Ga0207678_10066555 3300026067 Bacteria 3094
569 Ga0207678_10091282 3300026067 Bacteria 2603
570 Ga0207678_10126493 3300026067 Bacteria 2180
571 Ga0207678_10399880 3300026067 Bacteria 1189
572 Ga0207678_10798733 3300026067 Bacteria 833
573 Ga0207702_10004908 3300026078 Bacteria 11764
574 Ga0207702_10291263 3300026078 Bacteria 1547
575 Ga0207702_10300882 3300026078 Bacteria 1522
576 Ga0207702_10577360 3300026078 Bacteria 1102
577 Ga0207702_10683171 3300026078 Bacteria 1011
578 Ga0207702_10768230 3300026078 Bacteria 952
579 Ga0207641_10458860 3300026088 Bacteria 1232
580 Ga0207648_10027013 3300026089 Bacteria 5097
581 Ga0207676_10121979 3300026095 Bacteria 2200
582 Ga0207676_10183059 3300026095 Bacteria 1836
583 Ga0207676_10572198 3300026095 Bacteria 1082
584 Ga0207676_10635248 3300026095 Bacteria 1029
585 Ga0207674_10016819 3300026116 Bacteria 7994
586 Ga0207674_10076950 3300026116 Bacteria 3343
587 Ga0207674_10078158 3300026116 Bacteria 3314
588 Ga0207674_10812741 3300026116 Bacteria 902
589 Ga0207675_100193953 3300026118 Bacteria 1949
590 Ga0207675_100196150 3300026118 Bacteria 1938
591 Ga0207683_10036246 3300026121 Bacteria 4294
592 Ga0207683_10075265 3300026121 Bacteria 2988
593 Ga0207683_10262697 3300026121 Bacteria 1576
594 Ga0207698_10033235 3300026142 Bacteria 3746
595 Ga0207698_10094835 3300026142 Bacteria 2455
596 Ga0207698_10384358 3300026142 Bacteria 1336
597 Ga0209389_1000113 3300027296 Bacteria 72242
598 Ga0209589_1000023 3300027357 Bacteria 177856
599 Ga0209589_1000041 3300027357 Bacteria 125191
600 Ga0209489_100032 3300027361 Bacteria 177856
601 Ga0209489_100070 3300027361 Bacteria 138580
602 Ga0209489_107143 3300027361 Bacteria 17020
603 Ga0209700_100021 3300027363 Bacteria 230859
604 Ga0209700_100040 3300027363 Bacteria 177856
605 Ga0209588_1027013 3300027671 Bacteria 1825
606 Ga0209813_10016723 3300027866 Bacteria 2005
607 Ga0209813_10059055 3300027866 Bacteria 1220
608 Ga0268266_10063942 3300028379 Bacteria 3177
609 Ga0268266_10097492 3300028379 Bacteria 2585
610 Ga0268266_10149445 3300028379 Bacteria 2104
611 Ga0268266_10272122 3300028379 Bacteria 1572
612 Ga0268265_10044540 3300028380 Bacteria 3304
613 Ga0268265_10069413 3300028380 Bacteria 2736
614 Ga0268265_10267710 3300028380 Bacteria 1522
615 Ga0268265_10268890 3300028380 Bacteria 1519
616 Ga0268264_10000022 3300028381 Bacteria 476624
617 Ga0268264_10094942 3300028381 Bacteria 2579
618 Ga0268264_10294537 3300028381 Bacteria 1525
619 Ga0268264_10872588 3300028381 Bacteria 902
620 Ga0265337_1010612 3300028556 Bacteria 3215
621 Ga0265334_10033498 3300028573 Bacteria 2044
622 Ga0265334_10034598 3300028573 Bacteria 2004
623 Ga0265318_10123634 3300028577 Bacteria 951
624 Ga0265323_10019751 3300028653 Bacteria 2597
625 Ga0307517_10001054 3300028786 Bacteria 46731
626 Ga0307515_10073527 3300028794 Bacteria 4592
627 Ga0265338_10000337 3300028800 Bacteria 85427
628 Ga0265338_10611853 3300028800 Bacteria 758
629 Ga0265324_10010988 3300029957 Bacteria 3468
630 Ga0307511_10214421 3300030521 Bacteria 977
631 Ga0265762_1021662 3300030760 Bacteria 1186
632 Ga0265760_10119633 3300031090 Bacteria 844
633 Ga0265325_10017156 3300031241 Bacteria 4029
634 Ga0265340_10011816 3300031247 Bacteria 4627
635 Ga0265340_10128737 3300031247 Bacteria 1162
636 Ga0265339_10021644 3300031249 Bacteria 3736
637 Ga0265339_10071611 3300031249 Bacteria 1846
638 Ga0265331_10080665 3300031250 Bacteria 1512
639 Ga0265331_10151928 3300031250 Bacteria 1051
640 Ga0265331_10197745 3300031250 Bacteria 906
641 Ga0265316_10120452 3300031344 Bacteria 1982
642 Ga0307513_10242240 3300031456 Bacteria 1607
643 Ga0307513_10539348 3300031456 Bacteria 880
644 Ga0307509_10069489 3300031507 Bacteria 3681
645 Ga0307509_10248383 3300031507 Bacteria 1565
646 Ga0307509_10276692 3300031507 Bacteria 1442
647 Ga0307408_100624601 3300031548 Bacteria 960
648 Ga0307408_100812913 3300031548 Bacteria 849
649 Ga0265313_10241970 3300031595 Bacteria 738
650 Ga0307508_10000038 3300031616 Bacteria 150186
651 Ga0307508_10011952 3300031616 Bacteria 7942
652 Ga0307508_10049566 3300031616 Bacteria 3740
653 Ga0307508_10179027 3300031616 Bacteria 1722
654 Ga0307508_10231295 3300031616 Bacteria 1447
655 Ga0307508_10484184 3300031616 Bacteria 831
656 Ga0265314_10010719 3300031711 Bacteria 7626
657 Ga0265314_10416874 3300031711 Bacteria 722
658 Ga0265342_10005896 3300031712 Bacteria 9239
659 Ga0265342_10027683 3300031712 Bacteria 3537
660 Ga0307516_10021961 3300031730 Bacteria 6557
661 Ga0307516_10218372 3300031730 Bacteria 1617
662 Ga0307516_10253433 3300031730 Bacteria 1453
663 Ga0307516_10452957 3300031730 Bacteria 939
664 Ga0307405_10334448 3300031731 Bacteria 1162
665 Ga0307405_10486612 3300031731 Bacteria 986
666 Ga0307413_10128964 3300031824 Bacteria 1727
667 Ga0307518_10237817 3300031838 Bacteria 1172
668 Ga0307407_10086172 3300031903 Bacteria 1913
669 Ga0307409_100135783 3300031995 Bacteria 2110
670 Ga0307416_100096572 3300032002 Bacteria 2556
671 Ga0307414_10211996 3300032004 Bacteria 1584
672 Ga0307415_100298446 3300032126 Bacteria 1333
673 Ga0307507_10006782 3300033179 Bacteria 17185
674 Ga0307510_10046892 3300033180 Bacteria 4640
675 Ga0307510_10059591 3300033180 Bacteria 3939
676 Ga0315911_1000001 3300033442 Bacteria 1088602
677 Ga0316215_1008573 3300033544 Bacteria 1005
678 Ga0373958_0094615 3300034819 Bacteria 694
679 Ga0373926_0001023 3300035083 Bacteria 8192
680 Ga0373926_0042922 3300035083 Bacteria 1618
681 Ga0373934_0059515 3300035086 Bacteria 1520
682 Ga0373944_0055536 3300035089 Bacteria 1258
683 Ga0373952_0032660 3300035092 Bacteria 1164
684 Ga0373923_0000923 3300035111 Bacteria 7846
685 Ga0373923_0033913 3300035111 Bacteria 2069
686 Ga0373932_0079158 3300035112 Bacteria 1035
687 Ga0373936_0026216 3300035113 Bacteria 2283
688 Ga0373936_0036592 3300035113 Bacteria 1958
689 Ga0373936_0214801 3300035113 Bacteria 852
690 Ga0373939_0073328 3300035114 Bacteria 1120
691 Ga0373941_0010495 3300035115 Bacteria 2368
692 Ga0373945_0011559 3300035116 Bacteria 2921
693 Ga0373945_0056625 3300035116 Bacteria 1454
694 Ga0373953_0007891 3300035117 Bacteria 3588
695 Ga0373953_0015186 3300035117 Bacteria 2785
696 Ga0373953_0067556 3300035117 Bacteria 1471
697 Ga0373954_0041893 3300035118 Bacteria 2135
698 Ga0373954_0102801 3300035118 Bacteria 1379
699 Ga0373954_0158867 3300035118 Bacteria 1105
700 Ga0373957_0000375 3300035120 Bacteria 11330
701 Ga0373943_0039246 3300035170 Bacteria 2281
702 Ga0373946_0025361 3300035171 Bacteria 2331
703 Ga0373955_0001328 3300035172 Bacteria 10490
704 Ga0373924_0001614 3300035410 Bacteria 7396
705 Ga0373924_0110706 3300035410 Bacteria 1187
706 Ga0373931_0014501 3300035691 Bacteria 3853
707 Ga0373935_0284639 3300035692 Bacteria 1164
708 Ga0373935_0296239 3300035692 Bacteria 1142
709 Ga0373935_0450177 3300035692 Bacteria 930
710 Ga0373935_0525089 3300035692 Bacteria 861
711 Ga0373927_0000225 3300035695 Bacteria 44840
712 Ga0373927_0027925 3300035695 Bacteria 3683
713 Ga0373927_0032601 3300035695 Bacteria 3393
714 Ga0373927_0061827 3300035695 Bacteria 2422
715 Ga0373927_0092919 3300035695 Bacteria 1960
716 Ga0373927_0141451 3300035695 Bacteria 1574
717 Ga0373927_0166913 3300035695 Bacteria 1442
718 Ga0373933_0001518 3300035724 Bacteria 13555
719 Ga0373933_0043637 3300035724 Bacteria 2654
720 Ga0373933_0047712 3300035724 Bacteria 2548
721 Ga0373933_0142763 3300035724 Bacteria 1512
722 Ga0373947_0023122 3300035725 Bacteria 3613
723 Ga0373947_0137064 3300035725 Bacteria 1567
724 Ga0373947_0263604 3300035725 Bacteria 1142
725 Ga0373947_0406711 3300035725 Bacteria 918
726 Ga0373937_0091905 3300036401 Bacteria 2812
727 Ga0373937_0196775 3300036401 Bacteria 1894
728 Ga0373925_0000711 3300037068 Bacteria 31078
729 Ga0373925_0057892 3300037068 Bacteria 2905
730 Ga0373925_0101408 3300037068 Bacteria 2213
731 Ga0373925_0197535 3300037068 Bacteria 1598
732 Ga0373925_0209187 3300037068 Bacteria 1554
733 Ga0395899_0140917 3300037312 Bacteria 1715
734 Ga0395900_0000860 3300037418 Bacteria 40028
735 Ga0395900_0323770 3300037418 Bacteria 1521
736 Ga0395900_0483145 3300037418 Bacteria 1191
737 Ga0395898_0046012 3300037466 Bacteria 4287
738 Ga0395905_0056855 3300037471 Bacteria 3659
739 Ga0395905_0123786 3300037471 Bacteria 2431
740 Ga0436364_0267346 3300037853 Bacteria 1497
741 Ga0436364_0500303 3300037853 Bacteria 3660
742 Ga0436364_1340351 3300037853 Bacteria 1989
743 Ga0395901_0057535 3300038443 Bacteria 4044
744 Ga0395901_0974883 3300038443 Bacteria 825
745 Ga0436365_0151039 3300039437 Bacteria 2043
746 Ga0436365_0268210 3300039437 Bacteria 9455
747 Ga0436365_0710303 3300039437 Bacteria 1014
748 Ga0436365_1095310 3300039437 Bacteria 3618
749 Ga0436365_1396402 3300039437 Bacteria 1602
750 Ga0436365_1591893 3300039437 Bacteria 688
751 Ga0436365_1655446 3300039437 Bacteria 1705
752 Ga0436365_1817893 3300039437 Bacteria 1337
753 Ga0436365_1870953 3300039437 Bacteria 1609
754 Ga0436360_0660865 3300039438 Bacteria 1247
755 Ga0436363_0772753 3300039450 Bacteria 4670
756 Ga0436363_0894926 3300039450 Bacteria 838
757 Ga0436363_1201079 3300039450 Bacteria 3284
758 Ga0436363_1223665 3300039450 Bacteria 1105
759 Ga0436362_0332326 3300039453 Bacteria 2918
760 Ga0439465_0108277 3300041413 Bacteria 965
761 Ga0451791_0964902 3300041451 Bacteria 700
762 Ga0451797_0764166 3300041453 Bacteria 807
763 Ga0451802_0611095 3300041460 Bacteria 696
764 Ga0451839_1631068 3300041496 Bacteria 958
765 Ga0451839_1657451 3300041496 Bacteria 2269
766 Ga0451841_0572120 3300041498 Bacteria 742
767 Ga0451849_0054097 3300041505 Bacteria 1846
768 Ga0451853_2886446 3300041512 Bacteria 695
769 Ga0451853_3008790 3300041512 Bacteria 648
770 Ga0451853_3547507 3300041512 Bacteria 893
771 Ga0439463_049467 3300042016 Bacteria 1072
772 Ga0439458_0079320 3300042157 Bacteria 836
773 Ga0466972_0000660 3300044658 Bacteria 16624
774 Ga0466972_0004579 3300044658 Bacteria 6928
775 Ga0466972_0109388 3300044658 Bacteria 1306
776 Ga0466965_0099463 3300044683 Bacteria 1486
777 Ga0466966_0000932 3300044684 Bacteria 18644
778 Ga0466966_0102237 3300044684 Bacteria 1772
779 Ga0466961_0000488 3300044693 Bacteria 25223
780 Ga0466963_0074240 3300044694 Bacteria 2293
781 Ga0466963_0121993 3300044694 Bacteria 1794
782 Ga0466964_0352582 3300044706 Bacteria 756
783 Ga0466964_0411657 3300044706 Bacteria 709
784 Ga0466968_0002010 3300044735 Bacteria 7392
785 Ga0466957_0079290 3300044842 Bacteria 2043
786 Ga0466957_0159408 3300044842 Bacteria 1465
787 Ga0466957_0407282 3300044842 Bacteria 931
788 Ga0466967_0031184 3300045976 Bacteria 4485
789 Ga0466967_0115452 3300045976 Bacteria 2472
790 Ga0495617_042503 3300046452 Bacteria 1519
791 Ga0495617_077806 3300046452 Bacteria 1088
792 Ga0495592_0002531 3300046454 Bacteria 12897
793 Ga0495592_0018338 3300046454 Bacteria 5321
794 Ga0495592_0395432 3300046454 Bacteria 876
795 Ga0495592_0603616 3300046454 Bacteria 669
796 Ga0495603_0001221 3300046455 Bacteria 14993
797 Ga0495603_0026173 3300046455 Bacteria 3525
798 Ga0495603_0191071 3300046455 Bacteria 1184
799 Ga0495629_0000179 3300046459 Bacteria 56885
800 Ga0495629_0001007 3300046459 Bacteria 22607
801 Ga0495629_0005795 3300046459 Bacteria 9214
802 Ga0495638_0012856 3300046460 Bacteria 5719
803 Ga0495638_0066840 3300046460 Bacteria 2208
804 Ga0495638_0258927 3300046460 Bacteria 955
805 Ga0495651_0013292 3300046462 Bacteria 6367
806 Ga0495651_0157426 3300046462 Bacteria 1631
807 Ga0495651_0162720 3300046462 Bacteria 1597
808 Ga0495651_0272952 3300046462 Bacteria 1146
809 Ga0495651_0323804 3300046462 Bacteria 1026
810 Ga0495651_0360313 3300046462 Bacteria 958
811 Ga0495651_0482053 3300046462 Bacteria 797
812 Ga0495653_0211587 3300046463 Bacteria 1309
813 Ga0495650_0207173 3300046471 Bacteria 679
814 Ga0495580_0000280 3300046472 Bacteria 41385
815 Ga0495580_0029169 3300046472 Bacteria 4005
816 Ga0495582_0000061 3300046473 Bacteria 55522
817 Ga0495582_0143590 3300046473 Bacteria 1353
818 Ga0495639_0000102 3300046475 Bacteria 42249
819 Ga0495639_0036398 3300046475 Bacteria 2204
820 Ga0495662_0000074 3300046476 Bacteria 35316
821 Ga0495662_0021975 3300046476 Bacteria 3083
822 Ga0495664_0077067 3300046477 Bacteria 1996
823 Ga0495664_0116766 3300046477 Bacteria 1613
824 Ga0495584_0367079 3300046491 Bacteria 731
825 Ga0495585_0200184 3300046492 Bacteria 1017
826 Ga0495594_0000378 3300046499 Bacteria 22340
827 Ga0495594_0188928 3300046499 Bacteria 1173
828 Ga0495594_0310518 3300046499 Bacteria 898
829 Ga0495594_0332067 3300046499 Bacteria 866
830 Ga0495583_0038104 3300046506 Bacteria 2274
831 Ga0495606_0003007 3300046507 Bacteria 18477
832 Ga0495606_0094118 3300046507 Bacteria 1837
833 Ga0495606_0296470 3300046507 Bacteria 878
834 Ga0495608_0017019 3300046511 Bacteria 5029
835 Ga0495608_0410528 3300046511 Bacteria 827
836 Ga0495610_0086587 3300046512 Bacteria 1427
837 Ga0495610_0116191 3300046512 Bacteria 1179
838 Ga0495616_0254761 3300046513 Bacteria 753
839 Ga0495618_0007907 3300046514 Bacteria 6435
840 Ga0495618_0039412 3300046514 Bacteria 2970
841 Ga0495618_0245563 3300046514 Bacteria 1124
842 Ga0495620_0035877 3300046515 Bacteria 2225
843 Ga0495628_0004580 3300046516 Bacteria 12233
844 Ga0495628_0058989 3300046516 Bacteria 3015
845 Ga0495628_0078743 3300046516 Bacteria 2563
846 Ga0495628_0393307 3300046516 Bacteria 1014
847 Ga0495630_0001032 3300046517 Bacteria 19216
848 Ga0495630_0037229 3300046517 Bacteria 3638
849 Ga0495631_0105640 3300046518 Bacteria 1211
850 Ga0495632_0049316 3300046519 Bacteria 2081
851 Ga0495632_0214786 3300046519 Bacteria 871
852 Ga0495643_0019680 3300046522 Bacteria 3901
853 Ga0495648_0002612 3300046524 Bacteria 16461
854 Ga0495648_0002918 3300046524 Bacteria 15363
855 Ga0495648_0030845 3300046524 Bacteria 3538
856 Ga0495648_0030855 3300046524 Bacteria 3537
857 Ga0495648_0044101 3300046524 Bacteria 2787
858 Ga0495648_0118640 3300046524 Bacteria 1426
859 Ga0495648_0147774 3300046524 Bacteria 1229
860 Ga0495648_0207891 3300046524 Bacteria 975
861 Ga0495666_0007696 3300046526 Bacteria 5389
862 Ga0495642_0245168 3300046528 Bacteria 783
863 Ga0495652_0003857 3300046529 Bacteria 14624
864 Ga0495652_0032487 3300046529 Bacteria 4564
865 Ga0495652_0075661 3300046529 Bacteria 2795
866 Ga0495652_0249787 3300046529 Bacteria 1315
867 Ga0495654_0178950 3300046530 Bacteria 919
868 Ga0495665_0000261 3300046531 Bacteria 26625
869 Ga0495665_0011427 3300046531 Bacteria 4804
870 Ga0495640_0040108 3300046533 Bacteria 3280
871 Ga0495640_0060166 3300046533 Bacteria 2584
872 Ga0495640_0116764 3300046533 Bacteria 1738
873 Ga0495640_0270334 3300046533 Bacteria 1060
874 Ga0495586_0239141 3300046535 Bacteria 1035
875 Ga0495587_0012126 3300046536 Bacteria 5441
876 Ga0495587_0079430 3300046536 Bacteria 1902
877 Ga0495587_0181922 3300046536 Bacteria 1192
878 Ga0495621_0022283 3300046539 Bacteria 2098
879 Ga0495597_0138775 3300046542 Bacteria 1004
880 Ga0495597_0159820 3300046542 Bacteria 920
881 Ga0495645_0025567 3300046543 Bacteria 4286
882 Ga0495645_0147373 3300046543 Bacteria 1638
883 Ga0495645_0258674 3300046543 Bacteria 1154
884 Ga0495645_0277518 3300046543 Bacteria 1103
885 Ga0495645_0335358 3300046543 Bacteria 978
886 Ga0495622_0016935 3300046557 Bacteria 3392
887 Ga0495622_0101574 3300046557 Bacteria 1318
888 Ga0495633_0127435 3300046558 Bacteria 1178
889 Ga0495667_0004202 3300046559 Bacteria 9704
890 Ga0495667_0036521 3300046559 Bacteria 3279
891 Ga0495667_0124599 3300046559 Bacteria 1663
892 Ga0495667_0136614 3300046559 Bacteria 1580
893 Ga0495656_0096587 3300046615 Bacteria 1360
894 Ga0495668_0050083 3300046616 Bacteria 2315
895 Ga0495668_0053210 3300046616 Bacteria 2239
896 Ga0495668_0231398 3300046616 Bacteria 1012
897 Ga0495634_0000161 3300046642 Bacteria 60925
898 Ga0495634_0022358 3300046642 Bacteria 4457
899 Ga0495634_0195081 3300046642 Bacteria 1260
900 Ga0495625_0048156 3300046660 Bacteria 3070
901 Ga0495625_0331278 3300046660 Bacteria 967
902 Ga0495635_0008716 3300046663 Bacteria 7083
903 Ga0495635_0033710 3300046663 Bacteria 3552
904 Ga0495635_0037786 3300046663 Bacteria 3342
905 Ga0495635_0054592 3300046663 Bacteria 2752
906 Ga0495635_0071655 3300046663 Bacteria 2375
907 Ga0495659_0014177 3300046664 Bacteria 2606
908 Ga0495659_0203320 3300046664 Bacteria 813
909 Ga0495661_0181418 3300046665 Bacteria 1115
910 Ga0495588_0020981 3300046674 Bacteria 3215
911 Ga0495588_0025233 3300046674 Bacteria 2960
912 Ga0495588_0321470 3300046674 Bacteria 814
913 Ga0495588_0323936 3300046674 Bacteria 810
914 Ga0495588_0427306 3300046674 Bacteria 695
915 Ga0495657_0015740 3300046675 Bacteria 5526
916 Ga0495657_0019424 3300046675 Bacteria 4901
917 Ga0495657_0064717 3300046675 Bacteria 2407
918 Ga0495599_0009174 3300046678 Bacteria 6035
919 Ga0495599_0084427 3300046678 Bacteria 1983
920 Ga0495599_0183929 3300046678 Bacteria 1287
921 Ga0495599_0309661 3300046678 Bacteria 952
922 Ga0495623_0023186 3300046679 Bacteria 4006
923 Ga0495623_0035017 3300046679 Bacteria 3218
924 Ga0495623_0082545 3300046679 Bacteria 1986
925 Ga0495623_0115991 3300046679 Bacteria 1618
926 Ga0495623_0145015 3300046679 Bacteria 1409
927 Ga0495623_0159907 3300046679 Bacteria 1325
928 Ga0495623_0248044 3300046679 Bacteria 1003
929 Ga0495646_0040870 3300046680 Bacteria 2853
930 Ga0495646_0086315 3300046680 Bacteria 1820
931 Ga0495646_0097016 3300046680 Bacteria 1694
932 Ga0495647_0028695 3300046681 Bacteria 2053
933 Ga0495658_0000315 3300046683 Bacteria 27478
934 Ga0495658_0109624 3300046683 Bacteria 1658
935 Ga0495669_0281291 3300046684 Bacteria 800
936 Ga0495613_0002949 3300046689 Bacteria 12727
937 Ga0495613_0218703 3300046689 Bacteria 1338
938 Ga0495613_0373042 3300046689 Bacteria 977
939 Ga0495624_0029489 3300046690 Bacteria 3580
940 Ga0495624_0058579 3300046690 Bacteria 2418
941 Ga0495624_0379776 3300046690 Bacteria 849
942 Ga0495670_0020190 3300046691 Bacteria 3283
943 Ga0495671_0147083 3300046692 Bacteria 1147
944 Ga0495649_0040180 3300046694 Bacteria 2563
945 Ga0495649_0247943 3300046694 Bacteria 915
946 Ga0495589_0314519 3300046794 Bacteria 724
947 Ga0495600_0006120 3300046809 Bacteria 7288
948 Ga0495600_0010630 3300046809 Bacteria 5718
949 Ga0495600_0042515 3300046809 Bacteria 2962
950 Ga0495600_0048711 3300046809 Bacteria 2764
951 Ga0495660_0080346 3300046810 Bacteria 1711
952 Ga0495581_0000255 3300047315 Bacteria 25578
953 Ga0495581_0062966 3300047315 Bacteria 2143
954 Ga0495581_0226685 3300047315 Bacteria 1093
955 Ga0495604_0015795 3300047317 Bacteria 6025
956 Ga0495604_0066179 3300047317 Bacteria 2749
957 Ga0495604_0096882 3300047317 Bacteria 2176
958 Ga0495604_0200105 3300047317 Bacteria 1386
959 Ga0495674_0000117 3300047319 Bacteria 60130
960 Ga0495674_0027042 3300047319 Bacteria 5247
961 Ga0495674_0039883 3300047319 Bacteria 4204
962 Ga0495674_0067676 3300047319 Bacteria 3093
963 Ga0495674_0123813 3300047319 Bacteria 2183
964 Ga0495674_0298004 3300047319 Bacteria 1317
965 Ga0495672_0008790 3300047320 Bacteria 7398
966 Ga0495672_0011329 3300047320 Bacteria 6299
967 Ga0495672_0058411 3300047320 Bacteria 2236
968 Ga0495672_0128851 3300047320 Bacteria 1334
969 Ga0495672_0131965 3300047320 Bacteria 1313
970 Ga0495676_0051519 3300047321 Bacteria 3292
971 Ga0495676_0119809 3300047321 Bacteria 1916
972 Ga0495676_0312874 3300047321 Bacteria 1056
973 Ga0495676_0730243 3300047321 Bacteria 640
974 Ga0495680_0000688 3300047322 Bacteria 37864
975 Ga0495680_0004171 3300047322 Bacteria 13893
976 Ga0495680_0072956 3300047322 Bacteria 2610
977 Ga0495680_0176306 3300047322 Bacteria 1545
978 Ga0495687_015006 3300047443 Bacteria 3956
979 Ga0495675_0006128 3300047444 Bacteria 7361
980 Ga0495675_0061318 3300047444 Bacteria 2382
981 Ga0495675_0361093 3300047444 Bacteria 852
982 Ga0495677_0044745 3300047445 Bacteria 1623
983 Ga0495684_0000633 3300047471 Bacteria 28283
984 Ga0495684_0020139 3300047471 Bacteria 5137
985 Ga0495684_0060136 3300047471 Bacteria 2893
986 Ga0495684_0145984 3300047471 Bacteria 1772
987 Ga0495684_0212357 3300047471 Bacteria 1422
988 Ga0495593_0000086 3300047673 Bacteria 40986
989 Ga0495593_0002322 3300047673 Bacteria 11426
990 Ga0495593_0028926 3300047673 Bacteria 3042
991 Ga0495593_0149102 3300047673 Bacteria 1183
992 Ga0495602_0004737 3300048088 Bacteria 14223
993 Ga0495602_0029828 3300048088 Bacteria 5185
994 Ga0495602_0204155 3300048088 Bacteria 1505
995 Ga0495602_0234176 3300048088 Bacteria 1377
996 Ga0495602_0357159 3300048088 Bacteria 1053
997 Ga0495602_0369283 3300048088 Bacteria 1031
998 Ga0495626_0120996 3300048091 Bacteria 1125
999 Ga0496100_0098944 3300048903 Bacteria 2006
1000 Ga0496100_0112296 3300048903 Bacteria 1895
1001 Ga0496100_0570969 3300048903 Bacteria 876
1002 Ga0496100_0665719 3300048903 Bacteria 811
1003 Ga0496101_0023934 3300048904 Bacteria 4222
1004 Ga0496101_0444885 3300048904 Bacteria 1022
1005 Ga0496101_0780065 3300048904 Bacteria 754
1006 Ga0496102_0013632 3300048905 Bacteria 7045
1007 Ga0496102_0051025 3300048905 Bacteria 3768
1008 Ga0496102_0097921 3300048905 Bacteria 2721
1009 Ga0496102_0106172 3300048905 Bacteria 2613
1010 Ga0496102_0132304 3300048905 Bacteria 2336
1011 Ga0496102_0506723 3300048905 Bacteria 1129
1012 Ga0496102_0706217 3300048905 Bacteria 931
1013 Ga0496102_0807003 3300048905 Bacteria 861
1014 Ga0496103_0194972 3300048906 Bacteria 1302
1015 Ga0496104_0011141 3300048907 Bacteria 8046
1016 Ga0496104_0049613 3300048907 Bacteria 3958
1017 Ga0496104_0064542 3300048907 Bacteria 3473
1018 Ga0496104_0097842 3300048907 Bacteria 2808
1019 Ga0496104_0126823 3300048907 Bacteria 2451
1020 Ga0496104_0131997 3300048907 Bacteria 2399
1021 Ga0496105_0003203 3300048908 Bacteria 12051
1022 Ga0496105_0008366 3300048908 Bacteria 8038
1023 Ga0496105_0016607 3300048908 Bacteria 5878
1024 Ga0496105_0088755 3300048908 Bacteria 2554
1025 Ga0496105_0305289 3300048908 Bacteria 1278
1026 Ga0496105_0377082 3300048908 Bacteria 1129
1027 Ga0496106_0000546 3300048909 Bacteria 26747
1028 Ga0496106_0005548 3300048909 Bacteria 9340
1029 Ga0496106_0010390 3300048909 Bacteria 6878
1030 Ga0496106_0040671 3300048909 Bacteria 3482
1031 Ga0496106_0165675 3300048909 Bacteria 1749
1032 Ga0496106_0566529 3300048909 Bacteria 911
1033 Ga0496107_0002937 3300048910 Bacteria 11278
1034 Ga0496107_0004305 3300048910 Bacteria 9634
1035 Ga0496107_0017612 3300048910 Bacteria 5026
1036 Ga0496107_0057818 3300048910 Bacteria 2803
1037 Ga0496107_0094496 3300048910 Bacteria 2187
1038 Ga0496107_0130263 3300048910 Bacteria 1857
1039 Ga0496107_0258456 3300048910 Bacteria 1296
1040 Ga0496108_0001440 3300048911 Bacteria 18797
1041 Ga0496108_0501445 3300048911 Bacteria 1060
1042 Ga0496109_0001610 3300048912 Bacteria 18841
1043 Ga0496109_0015876 3300048912 Bacteria 6575
1044 Ga0496109_0081792 3300048912 Bacteria 2976
1045 Ga0496109_0103673 3300048912 Bacteria 2640
1046 Ga0496109_0131305 3300048912 Bacteria 2338
1047 Ga0496109_0292592 3300048912 Bacteria 1535
1048 Ga0496110_0012816 3300048913 Bacteria 6906
1049 Ga0496110_0017787 3300048913 Bacteria 5949
1050 Ga0496110_0050143 3300048913 Bacteria 3664
1051 Ga0496110_0088331 3300048913 Bacteria 2768
1052 Ga0496110_0119358 3300048913 Bacteria 2375
1053 Ga0496110_0856248 3300048913 Bacteria 814
1054 Ga0496110_1123985 3300048913 Bacteria 694
1055 Ga0496111_0021964 3300048914 Bacteria 4462
1056 Ga0496111_0040806 3300048914 Bacteria 3329
1057 Ga0496111_0141440 3300048914 Bacteria 1783
1058 Ga0496111_0369969 3300048914 Bacteria 1060
1059 Ga0496111_0420705 3300048914 Bacteria 987
1060 Ga0496112_0000079 3300048915 Bacteria 64101
1061 Ga0496112_0007905 3300048915 Bacteria 9474
1062 Ga0496112_0009200 3300048915 Bacteria 8878
1063 Ga0496112_0028997 3300048915 Bacteria 5348
1064 Ga0496112_0032003 3300048915 Bacteria 5106
1065 Ga0496112_0033853 3300048915 Bacteria 4970
1066 Ga0496112_0046075 3300048915 Bacteria 4275
1067 Ga0496112_0069563 3300048915 Bacteria 3477
1068 Ga0496112_0085641 3300048915 Bacteria 3118
1069 Ga0496113_0018743 3300048916 Bacteria 4826
1070 Ga0496113_0034316 3300048916 Bacteria 3702
1071 Ga0496113_0070124 3300048916 Bacteria 2663
1072 Ga0496113_0364465 3300048916 Bacteria 1159
1073 Ga0496114_0019840 3300048917 Bacteria 5451
1074 Ga0496114_0026302 3300048917 Bacteria 4763
1075 Ga0496114_0239484 3300048917 Bacteria 1595
1076 Ga0496114_0255707 3300048917 Bacteria 1541
1077 Ga0496114_0383421 3300048917 Bacteria 1244
1078 Ga0496114_0522738 3300048917 Bacteria 1049
1079 Ga0496114_0787329 3300048917 Bacteria 829
1080 Ga0496115_0030579 3300048918 Bacteria 4237
1081 Ga0496115_0034088 3300048918 Bacteria 4023
1082 Ga0496115_0039040 3300048918 Bacteria 3770
1083 Ga0496115_0050911 3300048918 Bacteria 3320
1084 Ga0496115_0056445 3300048918 Bacteria 3156
1085 Ga0496115_0121603 3300048918 Bacteria 2149
1086 Ga0496115_0216268 3300048918 Bacteria 1582
1087 Ga0496115_0300131 3300048918 Bacteria 1316
1088 Ga0496115_0436859 3300048918 Bacteria 1059
1089 Ga0496115_0544837 3300048918 Bacteria 928
1090 Ga0496116_0119249 3300048919 Bacteria 1531
1091 Ga0496116_0132314 3300048919 Bacteria 1419
1092 Ga0496117_0041834 3300048920 Bacteria 3351
1093 Ga0496117_0086770 3300048920 Bacteria 2032
1094 Ga0496117_0103769 3300048920 Bacteria 1791
1095 Ga0496117_0198089 3300048920 Bacteria 1137
1096 Ga0496117_0229638 3300048920 Bacteria 1027
1097 Ga0496118_0003967 3300048921 Bacteria 18059
1098 Ga0496118_0046546 3300048921 Bacteria 3373
1099 Ga0496118_0070050 3300048921 Bacteria 2535
1100 Ga0496118_0072285 3300048921 Bacteria 2478
1101 Ga0496119_0020659 3300048922 Bacteria 4792
1102 Ga0496119_0051144 3300048922 Bacteria 2542
1103 Ga0496119_0096053 3300048922 Bacteria 1673
1104 Ga0496119_0130553 3300048922 Bacteria 1370
1105 Ga0496120_0008075 3300048923 Bacteria 7735
1106 Ga0496120_0017144 3300048923 Bacteria 4705
1107 Ga0496121_0000495 3300048924 Bacteria 75339
1108 Ga0496121_0000576 3300048924 Bacteria 69005
1109 Ga0496121_0001789 3300048924 Bacteria 34756
1110 Ga0496121_0003477 3300048924 Bacteria 22425
1111 Ga0496121_0005072 3300048924 Bacteria 17180
1112 Ga0496121_0023876 3300048924 Bacteria 5867
1113 Ga0496121_0024511 3300048924 Bacteria 5765
1114 Ga0496121_0084412 3300048924 Bacteria 2504
1115 Ga0496121_0085565 3300048924 Bacteria 2481
1116 Ga0496121_0177005 3300048924 Bacteria 1544
1117 Ga0496121_0185412 3300048924 Bacteria 1497
1118 Ga0496121_0320823 3300048924 Bacteria 1043
1119 Ga0496121_0383172 3300048924 Bacteria 926
1120 Ga0496122_0126372 3300048925 Bacteria 1636
1121 Ga0496123_0023903 3300048926 Bacteria 4664
1122 Ga0496123_0045334 3300048926 Bacteria 2997
1123 Ga0496124_0055299 3300048927 Bacteria 3354
1124 Ga0496124_0112519 3300048927 Bacteria 2189
1125 Ga0496124_0125827 3300048927 Bacteria 2042
1126 Ga0496124_0351760 3300048927 Bacteria 1042
1127 Ga0496125_0003570 3300048928 Bacteria 18732
1128 Ga0496125_0034194 3300048928 Bacteria 4484
1129 Ga0496125_0037412 3300048928 Bacteria 4220
1130 Ga0496125_0042128 3300048928 Bacteria 3894
1131 Ga0496125_0045546 3300048928 Bacteria 3690
1132 Ga0496125_0060992 3300048928 Bacteria 3027
1133 Ga0496125_0076578 3300048928 Bacteria 2582
1134 Ga0496125_0167892 3300048928 Bacteria 1480
1135 Ga0496125_0318590 3300048928 Bacteria 944
1136 Ga0496126_0002315 3300048929 Bacteria 26122
1137 Ga0496126_0006641 3300048929 Bacteria 12873
1138 Ga0496126_0007687 3300048929 Bacteria 11766
1139 Ga0496126_0008516 3300048929 Bacteria 11055
1140 Ga0496126_0030050 3300048929 Bacteria 5155
1141 Ga0496126_0041989 3300048929 Bacteria 4228
1142 Ga0496126_0061749 3300048929 Bacteria 3365
1143 Ga0496126_0078368 3300048929 Bacteria 2928
1144 Ga0496126_0094451 3300048929 Bacteria 2624
1145 Ga0496126_0104047 3300048929 Bacteria 2480
1146 Ga0496126_0112266 3300048929 Bacteria 2373
1147 Ga0496126_0138804 3300048929 Bacteria 2094
1148 Ga0496126_0141356 3300048929 Bacteria 2071
1149 Ga0496126_0142335 3300048929 Bacteria 2063
1150 Ga0496126_0151861 3300048929 Bacteria 1984
1151 Ga0496126_0175123 3300048929 Bacteria 1825
1152 Ga0496126_0177784 3300048929 Bacteria 1809
1153 Ga0496126_0229460 3300048929 Bacteria 1556
1154 Ga0496126_0292981 3300048929 Bacteria 1345
1155 Ga0496126_0303240 3300048929 Bacteria 1317
1156 Ga0496126_0380180 3300048929 Bacteria 1150
1157 Ga0496126_0452266 3300048929 Bacteria 1033
1158 Ga0496126_0456066 3300048929 Bacteria 1028
1159 Ga0496126_0526203 3300048929 Bacteria 941
1160 Ga0496126_0603044 3300048929 Bacteria 865
1161 Ga0495678_096604 3300049459 Bacteria 1031
1162 Ga0501031_0004261 3300049568 Bacteria 9240
1163 Ga0501031_0150707 3300049568 Bacteria 1519
1164 Ga0501032_0005554 3300049569 Bacteria 9354
1165 Ga0501032_0138626 3300049569 Bacteria 1602
1166 Ga0501032_0244123 3300049569 Bacteria 1166
1167 Ga0501032_0313647 3300049569 Bacteria 1013
1168 Ga0501033_0000256 3300049570 Bacteria 50977
1169 Ga0501033_0136088 3300049570 Bacteria 1777
1170 Ga0501034_0000175 3300049571 Bacteria 119465
1171 Ga0501034_0354427 3300049571 Bacteria 1395
1172 Ga0501034_0368998 3300049571 Bacteria 1362
1173 Ga0501034_0713679 3300049571 Bacteria 900
1174 Ga0501036_0000032 3300049572 Bacteria 91370
1175 Ga0501036_0656210 3300049572 Bacteria 868
1176 Ga0501037_0001755 3300049573 Bacteria 15758
1177 Ga0501037_0092867 3300049573 Bacteria 2182
1178 Ga0501037_0147015 3300049573 Bacteria 1685
1179 Ga0501038_0000114 3300049574 Bacteria 68140
1180 Ga0501038_0025774 3300049574 Bacteria 5238
1181 Ga0501038_0110509 3300049574 Bacteria 2277
1182 Ga0501039_0001954 3300049575 Bacteria 15288
1183 Ga0501039_0487062 3300049575 Bacteria 968
1184 Ga0501040_0025761 3300049576 Bacteria 3956
1185 Ga0501041_0541366 3300049577 Bacteria 742
1186 Ga0501042_0251438 3300049578 Bacteria 1275
1187 Ga0501043_0002389 3300049579 Bacteria 15913
1188 Ga0501046_0004110 3300049580 Bacteria 13261
1189 Ga0501046_0188243 3300049580 Bacteria 1540
1190 Ga0501047_0000085 3300049581 Bacteria 118617
1191 Ga0501047_0116791 3300049581 Bacteria 2550
1192 Ga0501047_0178053 3300049581 Bacteria 1993
1193 Ga0501047_0179361 3300049581 Bacteria 1984
1194 Ga0501047_0196472 3300049581 Bacteria 1879
1195 Ga0501048_0001859 3300049582 Bacteria 16028
1196 Ga0501048_0039196 3300049582 Bacteria 3399
1197 Ga0501048_0185910 3300049582 Bacteria 1473
1198 Ga0501067_0000096 3300049583 Bacteria 50761
1199 Ga0501067_0007715 3300049583 Bacteria 5984
1200 Ga0501068_0000220 3300049584 Bacteria 27785
1201 Ga0501068_0002790 3300049584 Bacteria 9289
1202 Ga0501069_0003655 3300049585 Bacteria 7913
1203 Ga0501069_0040056 3300049585 Bacteria 2589
1204 Ga0501069_0161040 3300049585 Bacteria 1292
1205 Ga0501070_0005720 3300049586 Bacteria 10600
1206 Ga0501070_0262510 3300049586 Bacteria 1411
1207 Ga0501070_0264154 3300049586 Bacteria 1406
1208 Ga0501070_0474754 3300049586 Bacteria 1006
1209 Ga0501071_0076396 3300049587 Bacteria 2446
1210 Ga0501071_0092212 3300049587 Bacteria 2226
1211 Ga0501072_0003496 3300049588 Bacteria 11831
1212 Ga0501073_0000026 3300049589 Bacteria 124358
1213 Ga0501073_0193431 3300049589 Bacteria 1407
1214 Ga0501074_0000878 3300049590 Bacteria 19194
1215 Ga0501074_0065877 3300049590 Bacteria 2606
1216 Ga0501076_0188248 3300049592 Bacteria 1684
1217 Ga0501077_0225687 3300049593 Bacteria 1191
1218 Ga0501079_0007708 3300049741 Bacteria 8148
1219 Ga0501080_0005240 3300049742 Bacteria 11553
1220 Ga0501080_0333878 3300049742 Bacteria 1370
1221 Ga0501081_0167660 3300049743 Bacteria 1585
1222 Ga0501083_0012775 3300049744 Bacteria 5873
1223 Ga0501083_0378157 3300049744 Bacteria 921
1224 Ga0501035_0003195 3300049822 Bacteria 15713
1225 Ga0501035_0027489 3300049822 Bacteria 5199
1226 Ga0501044_0000061 3300049823 Bacteria 133207
1227 Ga0501044_0111623 3300049823 Bacteria 2741
1228 Ga0501044_0143992 3300049823 Bacteria 2370
1229 Ga0501044_0357216 3300049823 Bacteria 1379
1230 Ga0501044_0381715 3300049823 Bacteria 1324
1231 Ga0501044_0435807 3300049823 Bacteria 1219
1232 Ga0501044_0601617 3300049823 Bacteria 992
1233 Ga0501045_0090535 3300049824 Bacteria 2261
1234 Ga0501045_0387975 3300049824 Bacteria 1039
1235 nmdc:mga03n38_23321_c1 3300050490 Bacteria 2516
1236 nmdc:mga03n38_3983_c1 3300050490 Bacteria 4822
1237 nmdc:mga00v17_107230_c1 3300050491 Bacteria 1769
1238 nmdc:mga0yw44_109677_c1 3300050492 Bacteria 1767
1239 nmdc:mga0yw44_156432_c1 3300050492 Bacteria 1490
1240 nmdc:mga0yw44_163960_c1 3300050492 Bacteria 1456
1241 nmdc:mga0yw44_35589_c1 3300050492 Bacteria 2927
1242 nmdc:mga0yw44_384637_c1 3300050492 Bacteria 948
1243 nmdc:mga0yw44_385394_c1 3300050492 Bacteria 947
1244 nmdc:mga0yw44_55380_c1 3300050492 Bacteria 2413
1245 nmdc:mga0yw44_58163_c1 3300050492 Bacteria 2361
1246 nmdc:mga0k408_102575_c1 3300050493 Bacteria 1687
1247 nmdc:mga0k408_103595_c1 3300050493 Bacteria 1679
1248 nmdc:mga0k408_290809_c1 3300050493 Bacteria 975
1249 nmdc:mga06z11_109098_c1 3300050494 Bacteria 1530
1250 nmdc:mga06z11_22801_c2 3300050494 Bacteria 2530
1251 nmdc:mga06z11_30063_c1 3300050494 Bacteria 2625
1252 nmdc:mga06z11_526816_c1 3300050494 Bacteria 717
1253 nmdc:mga04h51_23345_c1 3300050495 Bacteria 1578
1254 nmdc:mga04h51_27163_c1 3300050495 Bacteria 1776
1255 nmdc:mga04h51_70640_c1 3300050495 Bacteria 1218
1256 nmdc:mga04h51_89026_c1 3300050495 Bacteria 1108
1257 nmdc:mga07m45_145517_c1 3300050496 Bacteria 1374
1258 nmdc:mga07m45_186513_c1 3300050496 Bacteria 1206
1259 nmdc:mga07m45_224211_c1 3300050496 Bacteria 1094
1260 nmdc:mga07m45_243653_c1 3300050496 Bacteria 1046
1261 nmdc:mga07m45_41716_c1 3300050496 Bacteria 2570
1262 nmdc:mga07m45_73605_c1 3300050496 Bacteria 1945
1263 nmdc:mga07m45_7361_c2 3300050496 Bacteria 2360
1264 nmdc:mga05p37_704993_c1 3300050507 Bacteria 1120
1265 nmdc:mga08y16_904525_c1 3300050511 Bacteria 868
1266 nmdc:mga0n895_337869_c1 3300050512 Bacteria 1526
1267 nmdc:mga0n895_581500_c1 3300050512 Bacteria 1124
1268 nmdc:mga0n895_804835_c1 3300050512 Bacteria 930
1269 nmdc:mga0rr50_83404_c1 3300050513 Bacteria 2471
1270 nmdc:mga08x19_40402_c2 3300050514 Bacteria 2555
1271 nmdc:mga0sz30_6811_c1 3300050516 Bacteria 3981
1272 nmdc:mga0sz30_71801_c2 3300050516 Bacteria 955
1273 Ga0495601_0069967 3300053077 Bacteria 2239
1274 Ga0495601_0200514 3300053077 Bacteria 1304
1275 Ga0495601_0371688 3300053077 Bacteria 928
1276 Ga0495601_0463683 3300053077 Bacteria 819
1277 Ga0495612_0002860 3300053078 Bacteria 7142
1278 Ga0495612_0065484 3300053078 Bacteria 1509
1279 Ga0500610_0043837 3300053079 Bacteria 2319
1280 Ga0500635_0002252 3300053080 Bacteria 4746
1281 Ga0495655_0004246 3300053083 Bacteria 2436
1282 Ga0495595_0004246 3300053084 Bacteria 5762
1283 Ga0495595_0028104 3300053084 Bacteria 2510
1284 Ga0495595_0314909 3300053084 Bacteria 788
1285 Ga0495619_0000182 3300053085 Bacteria 46524
1286 Ga0495619_0012568 3300053085 Bacteria 5331
1287 Ga0495619_0046963 3300053085 Bacteria 2841
1288 Ga0500578_0036475 3300053086 Bacteria 3158
1289 Ga0500578_0069467 3300053086 Bacteria 2245
1290 Ga0500643_000025 3300053087 Bacteria 259605
1291 Ga0500643_047421 3300053087 Bacteria 1238
1292 Ga0500647_0108689 3300053091 Bacteria 1320
1293 Ga0500647_0186634 3300053091 Bacteria 948
1294 Ga0500583_0041181 3300053092 Bacteria 2096
1295 Ga0500583_0098211 3300053092 Bacteria 1432
1296 Ga0500651_0047257 3300053093 Bacteria 2706
1297 Ga0500651_0076618 3300053093 Bacteria 2076
1298 Ga0500651_0128774 3300053093 Bacteria 1532
1299 Ga0500651_0256279 3300053093 Bacteria 1015
1300 Ga0500566_0000038 3300053094 Bacteria 66925
1301 Ga0500566_0000184 3300053094 Bacteria 32281
1302 Ga0500566_0020577 3300053094 Bacteria 3878
1303 Ga0500566_0215292 3300053094 Bacteria 959
1304 Ga0500640_000523 3300053095 Bacteria 9660
1305 Ga0500641_0017528 3300053096 Bacteria 2680
1306 Ga0500641_0076312 3300053096 Bacteria 1417
1307 Ga0500641_0264403 3300053096 Bacteria 717
1308 Ga0500648_209530 3300053097 Bacteria 969
1309 Ga0500650_0154791 3300053098 Bacteria 1058
1310 Ga0500554_060816 3300053102 Bacteria 1211
1311 Ga0500554_061704 3300053102 Bacteria 1204
1312 Ga0500556_0000002 3300053104 Bacteria 773626
1313 Ga0500556_0017722 3300053104 Bacteria 2236
1314 Ga0500557_000001 3300053105 Bacteria 241298
1315 Ga0500562_027472 3300053108 Bacteria 1493
1316 Ga0500569_000655 3300053109 Bacteria 5943
1317 Ga0500569_022048 3300053109 Bacteria 1691
1318 Ga0500569_089516 3300053109 Bacteria 995
1319 Ga0500572_000010 3300053111 Bacteria 67071
1320 Ga0500572_000333 3300053111 Bacteria 16915
1321 Ga0500572_004350 3300053111 Bacteria 3217
1322 Ga0500582_155590 3300053114 Bacteria 789
1323 Ga0500591_075170 3300053115 Bacteria 1519
1324 Ga0500592_002487 3300053116 Bacteria 2968
1325 Ga0500592_015695 3300053116 Bacteria 1216
1326 Ga0500595_000143 3300053119 Bacteria 46542
1327 Ga0500595_004985 3300053119 Bacteria 5860
1328 Ga0500595_005633 3300053119 Bacteria 5445
1329 Ga0500595_007784 3300053119 Bacteria 4420
1330 Ga0500595_008041 3300053119 Bacteria 4327
1331 Ga0500595_012396 3300053119 Bacteria 3300
1332 Ga0500595_052155 3300053119 Bacteria 1264
1333 Ga0500607_045996 3300053121 Bacteria 2340
1334 Ga0500607_097384 3300053121 Bacteria 1467
1335 Ga0500608_000393 3300053122 Bacteria 16801
1336 Ga0500614_012695 3300053123 Bacteria 1843
1337 Ga0500642_0000058 3300053130 Bacteria 66200
1338 Ga0500642_0000703 3300053130 Bacteria 9894
1339 Ga0500652_000711 3300053131 Bacteria 11297
1340 Ga0500652_140659 3300053131 Bacteria 1005
1341 Ga0500655_022180 3300053133 Bacteria 1193
1342 Ga0500658_0080186 3300053134 Bacteria 1394
1343 Ga0500559_0000366 3300053136 Bacteria 33251
1344 Ga0500559_0001403 3300053136 Bacteria 13686
1345 Ga0500559_0004662 3300053136 Bacteria 6458
1346 Ga0500559_0007008 3300053136 Bacteria 5037
1347 Ga0500559_0029053 3300053136 Bacteria 2365
1348 Ga0500559_0157801 3300053136 Bacteria 1066
1349 Ga0500568_0000603 3300053139 Bacteria 26129
1350 Ga0500568_0007229 3300053139 Bacteria 5472
1351 Ga0500568_0024624 3300053139 Bacteria 2547
1352 Ga0500568_0030896 3300053139 Bacteria 2215
1353 Ga0500568_0071299 3300053139 Bacteria 1330
1354 Ga0500568_0109911 3300053139 Bacteria 1031
1355 Ga0500573_0003825 3300053140 Bacteria 7851
1356 Ga0500577_0000616 3300053142 Bacteria 9140
1357 Ga0500586_036153 3300053145 Bacteria 1655
1358 Ga0500588_0151055 3300053146 Bacteria 840
1359 Ga0500588_0158355 3300053146 Bacteria 823
1360 Ga0500589_194989 3300053147 Bacteria 783
1361 Ga0500590_114939 3300053148 Bacteria 1270
1362 Ga0500603_000664 3300053150 Bacteria 8371
1363 Ga0500603_009507 3300053150 Bacteria 2178
1364 Ga0500603_054625 3300053150 Bacteria 1102
1365 Ga0500604_0013483 3300053151 Bacteria 2215
1366 Ga0500616_0000069 3300053153 Bacteria 234334
1367 Ga0500616_0002365 3300053153 Bacteria 15857
1368 Ga0500616_0010971 3300053153 Bacteria 5394
1369 Ga0500619_022328 3300053154 Bacteria 1835
1370 Ga0500619_090401 3300053154 Bacteria 1034
1371 Ga0500620_003266 3300053155 Bacteria 3437
1372 Ga0500622_0003891 3300053156 Bacteria 9671
1373 Ga0500622_0006990 3300053156 Bacteria 6461
1374 Ga0500622_0115937 3300053156 Bacteria 1304
1375 Ga0500627_0023382 3300053158 Bacteria 2519
1376 Ga0500627_0075119 3300053158 Bacteria 1501
1377 Ga0500630_003535 3300053159 Bacteria 7555
1378 Ga0500633_0052223 3300053160 Bacteria 1414
1379 Ga0500634_0118415 3300053161 Bacteria 1293
1380 Ga0500638_006438 3300053162 Bacteria 4805
1381 Ga0500638_206743 3300053162 Bacteria 825
1382 Ga0500638_234419 3300053162 Bacteria 751
1383 Ga0500639_000034 3300053163 Bacteria 66994
1384 Ga0500639_001800 3300053163 Bacteria 10755
1385 Ga0500639_148350 3300053163 Bacteria 1085
1386 Ga0500636_0006585 3300053177 Bacteria 6672
1387 Ga0500636_0015558 3300053177 Bacteria 4483
1388 Ga0500636_0046600 3300053177 Bacteria 2555
1389 Ga0500636_0072915 3300053177 Bacteria 1989
1390 Ga0500636_0205952 3300053177 Bacteria 1036
1391 Ga0500637_0000742 3300053178 Bacteria 13043
1392 Ga0500637_0080859 3300053178 Bacteria 1877
1393 Ga0500637_0097654 3300053178 Bacteria 1702
1394 Ga0500637_0293199 3300053178 Bacteria 890
1395 Ga0500567_177423 3300053723 Bacteria 750
1396 Ga0500576_078959 3300053725 Bacteria 1395
1397 Ga0500645_014699 3300053730 Bacteria 2490
1398 Ga0500596_002867 3300053735 Bacteria 3358
1399 Ga0500596_004222 3300053735 Bacteria 2658
1400 Ga0500599_001531 3300053736 Bacteria 2674
1401 Ga0500601_000312 3300053737 Bacteria 9081
1402 Ga0500601_009495 3300053737 Bacteria 1085
1403 Ga0501084_0043628 3300054114 Bacteria 3751
1404 Ga0501084_0460317 3300054114 Bacteria 1075
1405 Ga0500661_002298 3300055283 Bacteria 3611
1406 Ga0500661_007866 3300055283 Bacteria 1966
1407 Ga0500661_025072 3300055283 Bacteria 1054
1408 Ga0501082_0006469 3300060353 Bacteria 10161
1409 Ga0501082_0165372 3300060353 Bacteria 1922
1410 Ga0501082_0399895 3300060353 Bacteria 1199
1411 Ga0466962_0162410 3300061719 Bacteria 1086
1412 Ga0530510_0338280 3300061734 Bacteria 1130

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041496 Ga0451839_1631068 Ga0451839_1631068_121_675 171
2 3300005355 Ga0070671_100706021 Ga0070671_1007060211 184
3 3300026078 Ga0207702_10300882 Ga0207702_103008822 187
4 3300049459 Ga0495678_096604 Ga0495678_096604_405_983 188
5 3300046642 Ga0495634_0022358 Ga0495634_0022358_1739_2308 189
6 3300006042 Ga0075368_10017232 Ga0075368_100172324 190
7 3300006051 Ga0075364_10378106 Ga0075364_103781062 190
8 3300006178 Ga0075367_10056089 Ga0075367_100560892 190
9 3300006195 Ga0075366_10405609 Ga0075366_104056091 190
10 3300006353 Ga0075370_10225902 Ga0075370_102259022 190
11 3300027866 Ga0209813_10059055 Ga0209813_100590552 190
12 3300050493 nmdc:mga0k408_290809_c1 nmdc:mga0k408_290809_c1_103_678 190
13 3300050494 nmdc:mga06z11_22801_c2 nmdc:mga06z11_22801_c2_1060_1635 190
14 3300050495 nmdc:mga04h51_70640_c1 nmdc:mga04h51_70640_c1_220_795 190
15 3300050496 nmdc:mga07m45_186513_c1 nmdc:mga07m45_186513_c1_173_748 190
16 iso_pu_bacteria 2507262055 2507509406 190
17 iso_pu_bacteria 2508501009 2508543448 190
18 iso_pu_bacteria 2508501042 2508698775 190
19 iso_pu_bacteria 2511231028 2511397822 190
20 iso_pu_bacteria 2513237092 2513628257 190
21 iso_pu_bacteria 2513237094 2513637970 190
22 iso_pu_bacteria 2513237095 2513646591 190
23 iso_pu_bacteria 2513237096 2513656639 190
24 iso_pu_bacteria 2513237098 2513672317 190
25 iso_pu_bacteria 2513237101 2513691789 190
26 iso_pu_bacteria 2513237102 2513702035 190
27 iso_pu_bacteria 2513237104 2513717491 190
28 iso_pu_bacteria 2513237137 2513858571 190
29 iso_pu_bacteria 2513237139 2513876398 190
30 iso_pu_bacteria 2513237145 2513917824 190
31 iso_pu_bacteria 2513237161 2514010738 190
32 iso_pu_bacteria 2515154112 2515628984 190
33 iso_pu_bacteria 2517093001 2517102064 190
34 iso_pu_bacteria 2517572143 2517893128 190
35 iso_pu_bacteria 2524023205 2524436496 190
36 iso_pu_bacteria 2524023210 2524466880 190
37 iso_pu_bacteria 2524023228 2524539346 190
38 iso_pu_bacteria 2528768022 2528851504 190
39 iso_pu_bacteria 2602042107 2603858836 190
40 iso_pu_bacteria 2617270735 2617352250 190
41 iso_pu_bacteria 2617270741 2617376527 190
42 iso_pu_bacteria 2667528175 2671117762 190
43 iso_pu_bacteria 2721755755 2723845797 190
44 iso_pu_bacteria 2728368998 2728754636 190
45 iso_pu_bacteria 2744054633 2745077131 190
46 iso_pu_bacteria 2791355196 2793064848 190
47 iso_pu_bacteria 2791355197 2793070002 190
48 iso_pu_bacteria 2791355199 2793077210 190
49 iso_pu_bacteria 2802429603 2805920124 190
50 iso_pu_bacteria 2816332527 2818240216 190
51 iso_pu_bacteria 2824600985 2824604223 190
52 iso_pu_bacteria 2824609381 2824617453 190
53 iso_pu_bacteria 2824617872 2824619773 190
54 iso_pu_bacteria 2824626560 2824629381 190
55 iso_pu_bacteria 2824635225 2824642140 190
56 iso_pu_bacteria 2824644064 2824651175 190
57 iso_pu_bacteria 2824653114 2824660045 190
58 iso_pu_bacteria 2824661429 2824666640 190
59 iso_pu_bacteria 2824671348 2824676999 190
60 iso_pu_bacteria 2824679649 2824683712 190
61 iso_pu_bacteria 2824687955 2824694975 190
62 iso_pu_bacteria 2824696289 2824703619 190
63 iso_pu_bacteria 2824714736 2824721229 190
64 iso_pu_bacteria 2824723954 2824731268 190
65 iso_pu_bacteria 2824732956 2824739459 190
66 iso_pu_bacteria 2824746037 2824749638 190
67 iso_pu_bacteria 2838122688 2838126605 190
68 iso_pu_bacteria 2841949485 2841950704 190
69 iso_pu_bacteria 2841957949 2841964392 190
70 iso_pu_bacteria 2841966195 2841967021 190
71 iso_pu_bacteria 2841974524 2841975766 190
72 iso_pu_bacteria 2841983080 2841990133 190
73 iso_pu_bacteria 2842038055 2842039814 190
74 iso_pu_bacteria 2842045827 2842047240 190
75 iso_pu_bacteria 2847930680 2847935203 190
76 iso_pu_bacteria 2847939898 2847945802 190
77 iso_pu_bacteria 2849076700 2849080057 190
78 iso_pu_bacteria 2857509624 2857510567 190
79 iso_pu_bacteria 2857524615 2857528058 190
80 iso_pu_bacteria 2874590934 2874597500 190
81 iso_pu_bacteria 2874604998 2874609553 190
82 iso_pu_bacteria 2874612657 2874612788 190
83 iso_pu_bacteria 2874620515 2874627835 190
84 iso_pu_bacteria 2874628541 2874636316 190
85 iso_pu_bacteria 2874645413 2874648576 190
86 iso_pu_bacteria 2876761206 2876770796 190
87 iso_pu_bacteria 2876771140 2876777703 190
88 iso_pu_bacteria 2876808645 2876810941 190
89 iso_pu_bacteria 2876818435 2876822538 190
90 iso_pu_bacteria 2879074833 2879078111 190
91 iso_pu_bacteria 2879083081 2879089107 190
92 iso_pu_bacteria 2879099564 2879102931 190
93 iso_pu_bacteria 2879110137 2879115669 190
94 iso_pu_bacteria 2879127579 2879134548 190
95 iso_pu_bacteria 2879142872 2879149917 190
96 iso_pu_bacteria 2881364244 2881366649 190
97 iso_pu_bacteria 2885366525 2885373287 190
98 iso_pu_bacteria 2885374607 2885378309 190
99 iso_pu_bacteria 2885383462 2885390637 190
100 iso_pu_bacteria 2885409591 2885417424 190
101 iso_pu_bacteria 2888378607 2888383263 190
102 iso_pu_bacteria 2888388044 2888394647 190
103 iso_pu_bacteria 2888419890 2888423646 190
104 iso_pu_bacteria 2889033259 2889040638 190
105 iso_pu_bacteria 2893066018 2893068479 190
106 iso_pu_bacteria 2903748898 2903753062 190
107 iso_pu_bacteria 2903768456 2903775120 190
108 iso_pu_bacteria 2904666416 2904672845 190
109 iso_pu_bacteria 2904690495 2904696537 190
110 iso_pu_bacteria 2904699407 2904703982 190
111 iso_pu_bacteria 2906610324 2906617661 190
112 iso_pu_bacteria 2906626472 2906634677 190
113 iso_pu_bacteria 2906635258 2906636792 190
114 iso_pu_bacteria 2906643746 2906645906 190
115 iso_pu_bacteria 2906660503 2906661360 190
116 iso_pu_bacteria 2908739725 2908743521 190
117 iso_pu_bacteria 2908756301 2908760391 190
118 iso_pu_bacteria 2908775508 2908779367 190
119 iso_pu_bacteria 2919073203 2919075457 190
120 iso_pu_bacteria 2922361189 2922367743 190
121 iso_pu_bacteria 2922368715 2922373426 190
122 iso_pu_bacteria 2922386360 2922392353 190
123 iso_pu_bacteria 2922393267 2922395577 190
124 iso_pu_bacteria 2922425934 2922429358 190
125 iso_pu_bacteria 2929615660 2929617173 190
126 iso_pu_bacteria 2929624759 2929626877 190
127 iso_pu_bacteria 2932784394 2932793197 190
128 iso_pu_bacteria 2932809354 2932813036 190
129 iso_pu_bacteria 2932818245 2932821113 190
130 iso_pu_bacteria 2932828146 2932836779 190
131 iso_pu_bacteria 2933577622 2933579130 190
132 iso_pu_bacteria 2935608549 2935611709 190
133 iso_pu_bacteria 2935616580 2935621544 190
134 iso_pu_bacteria 2935630451 2935634067 190
135 iso_pu_bacteria 2935638405 2935645477 190
136 iso_pu_bacteria 2935648319 2935651786 190
137 iso_pu_bacteria 2935656913 2935660596 190
138 iso_pu_bacteria 2935665750 2935667595 190
139 iso_pu_bacteria 2935675223 2935681757 190
140 iso_pu_bacteria 2935684952 2935688343 190
141 iso_pu_bacteria 2935694250 2935699026 190
142 iso_pu_bacteria 2935703347 2935706407 190
143 iso_pu_bacteria 2935713505 2935715362 190
144 iso_pu_bacteria 2935722832 2935726074 190
145 iso_pu_bacteria 2935732158 2935734181 190
146 iso_pu_bacteria 2935741537 2935743560 190
147 iso_pu_bacteria 2935750917 2935754403 190
148 iso_pu_bacteria 2935760218 2935768481 190
149 iso_pu_bacteria 2935769743 2935774079 190
150 iso_pu_bacteria 2935777560 2935780601 190
151 iso_pu_bacteria 2935785616 2935789551 190
152 iso_pu_bacteria 2935793552 2935797328 190
153 iso_pu_bacteria 2935801545 2935806598 190
154 iso_pu_bacteria 2935810662 2935813190 190
155 iso_pu_bacteria 2935819856 2935821187 190
156 iso_pu_bacteria 2935827899 2935830843 190
157 iso_pu_bacteria 2935837841 2935840869 190
158 iso_pu_bacteria 2935847175 2935850553 190
159 iso_pu_bacteria 2935855204 2935859791 190
160 iso_pu_bacteria 2935864058 2935869136 190
161 iso_pu_bacteria 2935873716 2935880671 190
162 iso_pu_bacteria 2935908558 2935914153 190
163 iso_pu_bacteria 2935916978 2935921323 190
164 iso_pu_bacteria 2935926038 2935931658 190
165 iso_pu_bacteria 2935934488 2935940407 190
166 iso_pu_bacteria 2935942939 2935947768 190
167 iso_pu_bacteria 2935951376 2935956691 190
168 iso_pu_bacteria 2935959822 2935965750 190
169 iso_pu_bacteria 2935967501 2935973484 190
170 iso_pu_bacteria 2935975950 2935980907 190
171 iso_pu_bacteria 2935984226 2935990395 190
172 iso_pu_bacteria 2935992306 2936000947 190
173 iso_pu_bacteria 2936002035 2936010189 190
174 iso_pu_bacteria 2936011229 2936014652 190
175 iso_pu_bacteria 2936019824 2936023551 190
176 iso_pu_bacteria 2936028420 2936032579 190
177 iso_pu_bacteria 2936037263 2936043742 190
178 iso_pu_bacteria 2936046547 2936050393 190
179 iso_pu_bacteria 2936055302 2936059115 190
180 iso_pu_bacteria 2940556831 2940560221 190
181 iso_pu_bacteria 2941507105 2941510958 190
182 iso_pu_bacteria 2941515067 2941518342 190
183 iso_pu_bacteria 2941523033 2941527395 190
184 iso_pu_bacteria 2941531003 2941534083 190
185 iso_pu_bacteria 2941538514 2941541000 190
186 iso_pu_bacteria 3005474847 3005479526 190
187 iso_pu_bacteria 3005483717 3005489410 190
188 iso_pu_bacteria 3005594810 3005598419 190
189 iso_pu_bacteria 3005718088 3005721584 190
190 iso_pu_bacteria 8006926726 8006932117 190
191 iso_pu_bacteria 8006933436 8006941613 190
192 iso_pu_bacteria 8006964411 8006967447 190
193 iso_pu_bacteria 8006973647 8006981323 190
194 iso_pu_bacteria 8006984368 8006988073 190
195 iso_pu_bacteria 8006994254 8006996441 190
196 iso_pu_bacteria 8016511872 8016514252 190
197 iso_pu_bacteria 8016522445 8016530441 190
198 iso_pu_bacteria 8016530956 8016535712 190
199 iso_pu_bacteria 8016548790 8016553240 190
200 iso_pu_bacteria 8016557553 8016561618 190
201 iso_pu_bacteria 8016575299 8016578164 190
202 iso_pu_bacteria 8016583857 8016592831 190
203 iso_pu_bacteria 8016595262 8016599456 190
204 iso_pu_bacteria 8016603502 8016611533 190
205 iso_pu_bacteria 8016613128 8016622264 190
206 iso_pu_bacteria 8016622563 8016627631 190
207 iso_pu_bacteria 8016630954 8016631848 190
208 iso_pu_bacteria 8017057580 8017062171 190
209 iso_pu_bacteria 8019530166 8019535438 190
210 iso_pu_bacteria 8019538911 8019544067 190
211 iso_pu_bacteria 8019547302 8019554736 190
212 iso_pu_bacteria 8019555841 8019557533 190
213 iso_pu_bacteria 8019565922 8019567763 190
214 iso_pu_bacteria 8019576017 8019581621 190
215 iso_pu_bacteria 8019586578 8019589256 190
216 iso_pu_bacteria 8019597564 8019601976 190
217 iso_pu_bacteria 8019608314 8019616574 190
218 iso_pu_bacteria 8019619141 8019627290 190
219 iso_pu_bacteria 8019629233 8019635281 190
220 iso_pu_bacteria 8019638758 8019644419 190
221 iso_pu_bacteria 8019659431 8019663120 190
222 iso_pu_bacteria 8019668869 8019672719 190
223 iso_pu_bacteria 8019678201 8019683442 190
224 iso_pu_bacteria 8019687851 8019689177 190
225 iso_pu_bacteria 8055742211 8055747212 190
226 iso_pu_bacteria 8056673599 8056674557 190
227 iso_pu_bacteria 8056681323 8056685298 190
228 iso_pu_bacteria 8056689827 8056690212 190
229 iso_pu_bacteria 8056967851 8056972687 190
230 3300005983 Ga0081540_1004115 Ga0081540_10041154 191
231 3300006038 Ga0075365_10059845 Ga0075365_100598452 191
232 3300046471 Ga0495650_0207173 Ga0495650_0207173_59_643 191
233 3300053139 Ga0500568_0030896 Ga0500568_0030896_122_706 191
234 iso_pu_bacteria 3005587118 3005588545 191
235 3300006038 Ga0075365_10406974 Ga0075365_104069742 192
236 3300006042 Ga0075368_10168457 Ga0075368_101684572 192
237 3300021377 Ga0213874_10051145 Ga0213874_100511452 192
238 3300025315 Ga0207697_10307825 Ga0207697_103078251 192
239 3300035116 Ga0373945_0011559 Ga0373945_0011559_849_1448 192
240 3300035695 Ga0373927_0000225 Ga0373927_0000225_24872_25471 192
241 3300036401 Ga0373937_0091905 Ga0373937_0091905_1135_1734 192
242 3300037068 Ga0373925_0000711 Ga0373925_0000711_16642_17241 192
243 3300039450 Ga0436363_0772753 Ga0436363_0772753_1652_2230 192
244 3300041451 Ga0451791_0964902 Ga0451791_0964902_90_668 192
245 3300046454 Ga0495592_0018338 Ga0495592_0018338_26_625 192
246 3300046455 Ga0495603_0001221 Ga0495603_0001221_8645_9244 192
247 3300046459 Ga0495629_0000179 Ga0495629_0000179_19633_20232 192
248 3300046472 Ga0495580_0000280 Ga0495580_0000280_18281_18880 192
249 3300046473 Ga0495582_0000061 Ga0495582_0000061_18282_18881 192
250 3300046475 Ga0495639_0000102 Ga0495639_0000102_23386_23985 192
251 3300046476 Ga0495662_0000074 Ga0495662_0000074_25383_25982 192
252 3300046499 Ga0495594_0000378 Ga0495594_0000378_13709_14308 192
253 3300046517 Ga0495630_0001032 Ga0495630_0001032_11520_12119 192
254 3300046531 Ga0495665_0000261 Ga0495665_0000261_7745_8344 192
255 3300046533 Ga0495640_0040108 Ga0495640_0040108_2469_3068 192
256 3300046557 Ga0495622_0016935 Ga0495622_0016935_415_1014 192
257 3300046642 Ga0495634_0000161 Ga0495634_0000161_34336_34935 192
258 3300046663 Ga0495635_0008716 Ga0495635_0008716_6015_6614 192
259 3300046680 Ga0495646_0040870 Ga0495646_0040870_746_1345 192
260 3300046683 Ga0495658_0000315 Ga0495658_0000315_3508_4107 192
261 3300046689 Ga0495613_0002949 Ga0495613_0002949_2434_3033 192
262 3300046690 Ga0495624_0029489 Ga0495624_0029489_2858_3457 192
263 3300047315 Ga0495581_0000255 Ga0495581_0000255_15792_16391 192
264 3300047319 Ga0495674_0000117 Ga0495674_0000117_34612_35211 192
265 3300047321 Ga0495676_0119809 Ga0495676_0119809_358_957 192
266 3300047322 Ga0495680_0176306 Ga0495680_0176306_397_996 192
267 3300047471 Ga0495684_0060136 Ga0495684_0060136_1455_2054 192
268 3300047673 Ga0495593_0000086 Ga0495593_0000086_27845_28444 192
269 3300048929 Ga0496126_0303240 Ga0496126_0303240_577_1155 192
270 3300048929 Ga0496126_0380180 Ga0496126_0380180_416_1012 192
271 3300049571 Ga0501034_0368998 Ga0501034_0368998_604_1191 192
272 3300050492 nmdc:mga0yw44_109677_c1 nmdc:mga0yw44_109677_c1_571_1149 192
273 3300031456 Ga0307513_10242240 Ga0307513_102422402 193
274 3300031548 Ga0307408_100624601 Ga0307408_1006246012 193
275 3300033544 Ga0316215_1008573 Ga0316215_10085732 193
276 3300046660 Ga0495625_0331278 Ga0495625_0331278_302_886 193
277 3300048929 Ga0496126_0603044 Ga0496126_0603044_126_713 193
278 2010549000 RicEn_C651 RicEn_11800 194
279 3300003203 JGI25406J46586_10014911 JGI25406J46586_100149114 194
280 3300003203 JGI25406J46586_10094120 JGI25406J46586_100941201 194
281 3300003214 JGI25165J46597_1006252 JGI25165J46597_10062522 194
282 3300003215 JGI25153J46596_10003518 JGI25153J46596_100035183 194
283 3300003215 JGI25153J46596_10006847 JGI25153J46596_100068472 194
284 3300003215 JGI25153J46596_10012797 JGI25153J46596_100127972 194
285 3300003215 JGI25153J46596_10016522 JGI25153J46596_100165222 194
286 3300003354 JGI25160J50197_1003097 JGI25160J50197_10030972 194
287 3300003354 JGI25160J50197_1005052 JGI25160J50197_10050522 194
288 3300003354 JGI25160J50197_1044907 JGI25160J50197_10449071 194
289 3300003659 JGI25404J52841_10007374 JGI25404J52841_100073741 194
290 3300003659 JGI25404J52841_10040120 JGI25404J52841_100401201 194
291 3300003762 Ga0055542_1011767 Ga0055542_10117672 194
292 3300003771 Ga0055526_1064162 Ga0055526_10641621 194
293 3300003794 Ga0055531_10008796 Ga0055531_100087966 194
294 3300004625 Ga0055543_1003302 Ga0055543_10033023 194
295 3300005262 Ga0065165_1001864 Ga0065165_100186410 194
296 3300005262 Ga0065165_1019808 Ga0065165_10198083 194
297 3300005262 Ga0065165_1020382 Ga0065165_10203822 194
298 3300005327 Ga0070658_10230450 Ga0070658_102304502 194
299 3300005328 Ga0070676_10153610 Ga0070676_101536102 194
300 3300005329 Ga0070683_100029863 Ga0070683_1000298631 194
301 3300005329 Ga0070683_100689422 Ga0070683_1006894221 194
302 3300005331 Ga0070670_100508728 Ga0070670_1005087282 194
303 3300005334 Ga0068869_100111795 Ga0068869_1001117952 194
304 3300005334 Ga0068869_100335859 Ga0068869_1003358592 194
305 3300005334 Ga0068869_100467874 Ga0068869_1004678741 194
306 3300005336 Ga0070680_100018923 Ga0070680_1000189237 194
307 3300005336 Ga0070680_100187668 Ga0070680_1001876682 194
308 3300005336 Ga0070680_100463579 Ga0070680_1004635791 194
309 3300005336 Ga0070680_100492177 Ga0070680_1004921771 194
310 3300005337 Ga0070682_100026401 Ga0070682_1000264014 194
311 3300005337 Ga0070682_100162523 Ga0070682_1001625232 194
312 3300005337 Ga0070682_100362253 Ga0070682_1003622531 194
313 3300005337 Ga0070682_100542480 Ga0070682_1005424801 194
314 3300005338 Ga0068868_100589656 Ga0068868_1005896561 194
315 3300005339 Ga0070660_100010416 Ga0070660_1000104167 194
316 3300005339 Ga0070660_100253469 Ga0070660_1002534692 194
317 3300005339 Ga0070660_100299299 Ga0070660_1002992992 194
318 3300005343 Ga0070687_100206945 Ga0070687_1002069452 194
319 3300005344 Ga0070661_100006251 Ga0070661_1000062511 194
320 3300005344 Ga0070661_100377068 Ga0070661_1003770682 194
321 3300005347 Ga0070668_100067207 Ga0070668_1000672074 194
322 3300005347 Ga0070668_100089962 Ga0070668_1000899622 194
323 3300005347 Ga0070668_100138774 Ga0070668_1001387742 194
324 3300005353 Ga0070669_100378212 Ga0070669_1003782122 194
325 3300005353 Ga0070669_100843392 Ga0070669_1008433921 194
326 3300005354 Ga0070675_100065137 Ga0070675_1000651373 194
327 3300005354 Ga0070675_101244157 Ga0070675_1012441571 194
328 3300005355 Ga0070671_100276120 Ga0070671_1002761202 194
329 3300005355 Ga0070671_100531100 Ga0070671_1005311001 194
330 3300005356 Ga0070674_100078595 Ga0070674_1000785952 194
331 3300005356 Ga0070674_100111556 Ga0070674_1001115564 194
332 3300005366 Ga0070659_100177733 Ga0070659_1001777331 194
333 3300005366 Ga0070659_100375862 Ga0070659_1003758622 194
334 3300005366 Ga0070659_100448417 Ga0070659_1004484171 194
335 3300005367 Ga0070667_100134781 Ga0070667_1001347812 194
336 3300005434 Ga0070709_10000951 Ga0070709_1000095116 194
337 3300005434 Ga0070709_10076815 Ga0070709_100768152 194
338 3300005434 Ga0070709_10172145 Ga0070709_101721452 194
339 3300005435 Ga0070714_100010720 Ga0070714_1000107205 194
340 3300005435 Ga0070714_100074142 Ga0070714_1000741424 194
341 3300005435 Ga0070714_100226980 Ga0070714_1002269801 194
342 3300005435 Ga0070714_100386619 Ga0070714_1003866192 194
343 3300005436 Ga0070713_100000936 Ga0070713_10000093613 194
344 3300005436 Ga0070713_100005223 Ga0070713_1000052239 194
345 3300005436 Ga0070713_100066626 Ga0070713_1000666263 194
346 3300005436 Ga0070713_100098866 Ga0070713_1000988662 194
347 3300005436 Ga0070713_100294418 Ga0070713_1002944183 194
348 3300005437 Ga0070710_10002437 Ga0070710_100024375 194
349 3300005437 Ga0070710_10372108 Ga0070710_103721081 194
350 3300005439 Ga0070711_100003765 Ga0070711_1000037652 194
351 3300005439 Ga0070711_100010373 Ga0070711_1000103731 194
352 3300005439 Ga0070711_100133712 Ga0070711_1001337123 194
353 3300005440 Ga0070705_100788869 Ga0070705_1007888691 194
354 3300005455 Ga0070663_100028775 Ga0070663_1000287752 194
355 3300005455 Ga0070663_100033215 Ga0070663_1000332153 194
356 3300005455 Ga0070663_100051889 Ga0070663_1000518893 194
357 3300005455 Ga0070663_100153154 Ga0070663_1001531542 194
358 3300005456 Ga0070678_100038290 Ga0070678_1000382902 194
359 3300005456 Ga0070678_100046100 Ga0070678_1000461004 194
360 3300005456 Ga0070678_100050632 Ga0070678_1000506322 194
361 3300005456 Ga0070678_100622586 Ga0070678_1006225861 194
362 3300005457 Ga0070662_100017777 Ga0070662_1000177772 194
363 3300005457 Ga0070662_100462378 Ga0070662_1004623781 194
364 3300005457 Ga0070662_100473847 Ga0070662_1004738472 194
365 3300005458 Ga0070681_10013529 Ga0070681_100135298 194
366 3300005458 Ga0070681_10024245 Ga0070681_100242453 194
367 3300005458 Ga0070681_10034302 Ga0070681_100343021 194
368 3300005458 Ga0070681_10147981 Ga0070681_101479812 194
369 3300005458 Ga0070681_10189850 Ga0070681_101898502 194
370 3300005458 Ga0070681_10200951 Ga0070681_102009512 194
371 3300005458 Ga0070681_10531280 Ga0070681_105312802 194
372 3300005459 Ga0068867_100452316 Ga0068867_1004523161 194
373 3300005471 Ga0070698_100415922 Ga0070698_1004159221 194
374 3300005518 Ga0070699_100742334 Ga0070699_1007423341 194
375 3300005518 Ga0070699_101106830 Ga0070699_1011068301 194
376 3300005530 Ga0070679_100007218 Ga0070679_1000072184 194
377 3300005530 Ga0070679_100095395 Ga0070679_1000953953 194
378 3300005530 Ga0070679_100136758 Ga0070679_1001367583 194
379 3300005530 Ga0070679_100418008 Ga0070679_1004180081 194
380 3300005530 Ga0070679_100485784 Ga0070679_1004857841 194
381 3300005530 Ga0070679_100526022 Ga0070679_1005260222 194
382 3300005535 Ga0070684_100018029 Ga0070684_1000180296 194
383 3300005535 Ga0070684_100036613 Ga0070684_1000366132 194
384 3300005535 Ga0070684_100064431 Ga0070684_1000644312 194
385 3300005535 Ga0070684_100084021 Ga0070684_1000840212 194
386 3300005535 Ga0070684_100456942 Ga0070684_1004569422 194
387 3300005536 Ga0070697_100056309 Ga0070697_1000563094 194
388 3300005539 Ga0068853_100004481 Ga0068853_1000044819 194
389 3300005539 Ga0068853_100263379 Ga0068853_1002633792 194
390 3300005539 Ga0068853_100422717 Ga0068853_1004227172 194
391 3300005539 Ga0068853_100435135 Ga0068853_1004351352 194
392 3300005543 Ga0070672_100651502 Ga0070672_1006515022 194
393 3300005547 Ga0070693_100060897 Ga0070693_1000608972 194
394 3300005547 Ga0070693_100390176 Ga0070693_1003901761 194
395 3300005548 Ga0070665_100062885 Ga0070665_1000628852 194
396 3300005548 Ga0070665_100094386 Ga0070665_1000943864 194
397 3300005548 Ga0070665_100100681 Ga0070665_1001006811 194
398 3300005548 Ga0070665_100139357 Ga0070665_1001393573 194
399 3300005548 Ga0070665_100290721 Ga0070665_1002907212 194
400 3300005548 Ga0070665_100335848 Ga0070665_1003358482 194
401 3300005548 Ga0070665_100475332 Ga0070665_1004753322 194
402 3300005548 Ga0070665_100839981 Ga0070665_1008399812 194
403 3300005549 Ga0070704_100205904 Ga0070704_1002059042 194
404 3300005563 Ga0068855_100026568 Ga0068855_1000265686 194
405 3300005563 Ga0068855_100067965 Ga0068855_1000679652 194
406 3300005563 Ga0068855_100121768 Ga0068855_1001217682 194
407 3300005563 Ga0068855_100202775 Ga0068855_1002027753 194
408 3300005563 Ga0068855_100221112 Ga0068855_1002211123 194
409 3300005563 Ga0068855_100325301 Ga0068855_1003253011 194
410 3300005563 Ga0068855_100446345 Ga0068855_1004463452 194
411 3300005563 Ga0068855_100505285 Ga0068855_1005052852 194
412 3300005563 Ga0068855_100610859 Ga0068855_1006108591 194
413 3300005564 Ga0070664_100074373 Ga0070664_1000743735 194
414 3300005564 Ga0070664_100631390 Ga0070664_1006313903 194
415 3300005577 Ga0068857_100017569 Ga0068857_1000175691 194
416 3300005577 Ga0068857_100145722 Ga0068857_1001457222 194
417 3300005577 Ga0068857_100921285 Ga0068857_1009212851 194
418 3300005577 Ga0068857_101371698 Ga0068857_1013716981 194
419 3300005578 Ga0068854_100177549 Ga0068854_1001775492 194
420 3300005614 Ga0068856_100006094 Ga0068856_1000060943 194
421 3300005614 Ga0068856_100185539 Ga0068856_1001855392 194
422 3300005614 Ga0068856_100253901 Ga0068856_1002539012 194
423 3300005614 Ga0068856_100519403 Ga0068856_1005194032 194
424 3300005614 Ga0068856_100547175 Ga0068856_1005471751 194
425 3300005614 Ga0068856_100984659 Ga0068856_1009846592 194
426 3300005616 Ga0068852_100002018 Ga0068852_10000201813 194
427 3300005616 Ga0068852_100082448 Ga0068852_1000824484 194
428 3300005616 Ga0068852_100103345 Ga0068852_1001033452 194
429 3300005616 Ga0068852_100141834 Ga0068852_1001418342 194
430 3300005616 Ga0068852_100218320 Ga0068852_1002183202 194
431 3300005616 Ga0068852_100312610 Ga0068852_1003126102 194
432 3300005616 Ga0068852_100641887 Ga0068852_1006418872 194
433 3300005616 Ga0068852_101445009 Ga0068852_1014450091 194
434 3300005617 Ga0068859_100251619 Ga0068859_1002516192 194
435 3300005617 Ga0068859_100414858 Ga0068859_1004148582 194
436 3300005617 Ga0068859_100474485 Ga0068859_1004744851 194
437 3300005618 Ga0068864_100546987 Ga0068864_1005469871 194
438 3300005719 Ga0068861_100195399 Ga0068861_1001953991 194
439 3300005719 Ga0068861_100354350 Ga0068861_1003543502 194
440 3300005834 Ga0068851_10013775 Ga0068851_100137756 194
441 3300005834 Ga0068851_10201064 Ga0068851_102010642 194
442 3300005841 Ga0068863_100318014 Ga0068863_1003180142 194
443 3300005841 Ga0068863_100905256 Ga0068863_1009052561 194
444 3300005842 Ga0068858_100248395 Ga0068858_1002483951 194
445 3300005842 Ga0068858_100313002 Ga0068858_1003130022 194
446 3300005842 Ga0068858_100355497 Ga0068858_1003554971 194
447 3300005842 Ga0068858_100444577 Ga0068858_1004445772 194
448 3300005843 Ga0068860_100000058 Ga0068860_1000000584 194
449 3300005843 Ga0068860_100204938 Ga0068860_1002049382 194
450 3300005843 Ga0068860_100353409 Ga0068860_1003534092 194
451 3300005843 Ga0068860_100692530 Ga0068860_1006925301 194
452 3300005844 Ga0068862_100037323 Ga0068862_1000373235 194
453 3300005844 Ga0068862_100105591 Ga0068862_1001055912 194
454 3300005844 Ga0068862_100626257 Ga0068862_1006262572 194
455 3300005844 Ga0068862_100943347 Ga0068862_1009433472 194
456 3300005937 Ga0081455_10009084 Ga0081455_100090846 194
457 3300005937 Ga0081455_10018953 Ga0081455_100189537 194
458 3300005937 Ga0081455_10059666 Ga0081455_100596663 194
459 3300005937 Ga0081455_10074357 Ga0081455_100743573 194
460 3300005937 Ga0081455_10202229 Ga0081455_102022292 194
461 3300005937 Ga0081455_10251739 Ga0081455_102517391 194
462 3300005981 Ga0081538_10043006 Ga0081538_100430062 194
463 3300005981 Ga0081538_10176859 Ga0081538_101768592 194
464 3300005983 Ga0081540_1001631 Ga0081540_100163115 194
465 3300005983 Ga0081540_1009209 Ga0081540_10092095 194
466 3300005983 Ga0081540_1009520 Ga0081540_10095208 194
467 3300005983 Ga0081540_1024605 Ga0081540_10246052 194
468 3300005983 Ga0081540_1031069 Ga0081540_10310694 194
469 3300005983 Ga0081540_1037550 Ga0081540_10375503 194
470 3300005983 Ga0081540_1040575 Ga0081540_10405752 194
471 3300005983 Ga0081540_1122431 Ga0081540_11224312 194
472 3300005985 Ga0081539_10000250 Ga0081539_10000250114 194
473 3300005985 Ga0081539_10000269 Ga0081539_1000026910 194
474 3300005985 Ga0081539_10017984 Ga0081539_100179846 194
475 3300005985 Ga0081539_10176671 Ga0081539_101766711 194
476 3300006028 Ga0070717_10001774 Ga0070717_100017745 194
477 3300006028 Ga0070717_10049640 Ga0070717_100496402 194
478 3300006028 Ga0070717_10304250 Ga0070717_103042501 194
479 3300006038 Ga0075365_10015428 Ga0075365_100154285 194
480 3300006038 Ga0075365_10040951 Ga0075365_100409512 194
481 3300006038 Ga0075365_10053219 Ga0075365_100532193 194
482 3300006038 Ga0075365_10130996 Ga0075365_101309962 194
483 3300006038 Ga0075365_10148307 Ga0075365_101483072 194
484 3300006038 Ga0075365_10236657 Ga0075365_102366572 194
485 3300006042 Ga0075368_10096813 Ga0075368_100968132 194
486 3300006042 Ga0075368_10124387 Ga0075368_101243872 194
487 3300006048 Ga0075363_100012935 Ga0075363_1000129352 194
488 3300006048 Ga0075363_100086970 Ga0075363_1000869702 194
489 3300006048 Ga0075363_100201765 Ga0075363_1002017651 194
490 3300006051 Ga0075364_10090682 Ga0075364_100906822 194
491 3300006051 Ga0075364_10106011 Ga0075364_101060112 194
492 3300006163 Ga0070715_10000514 Ga0070715_100005149 194
493 3300006163 Ga0070715_10044050 Ga0070715_100440502 194
494 3300006173 Ga0070716_100004285 Ga0070716_1000042855 194
495 3300006173 Ga0070716_100179140 Ga0070716_1001791402 194
496 3300006175 Ga0070712_100072591 Ga0070712_1000725912 194
497 3300006175 Ga0070712_100089027 Ga0070712_1000890272 194
498 3300006175 Ga0070712_100575789 Ga0070712_1005757892 194
499 3300006177 Ga0075362_10229066 Ga0075362_102290662 194
500 3300006178 Ga0075367_10026323 Ga0075367_100263232 194
501 3300006178 Ga0075367_10215730 Ga0075367_102157302 194
502 3300006186 Ga0075369_10073960 Ga0075369_100739602 194
503 3300006195 Ga0075366_10056404 Ga0075366_100564043 194
504 3300006195 Ga0075366_10105423 Ga0075366_101054231 194
505 3300006195 Ga0075366_10253032 Ga0075366_102530322 194
506 3300006237 Ga0097621_100698839 Ga0097621_1006988392 194
507 3300006237 Ga0097621_101048862 Ga0097621_1010488621 194
508 3300006353 Ga0075370_10030042 Ga0075370_100300422 194
509 3300006353 Ga0075370_10065298 Ga0075370_100652981 194
510 3300006353 Ga0075370_10112231 Ga0075370_101122312 194
511 3300006353 Ga0075370_10334931 Ga0075370_103349311 194
512 3300006852 Ga0075433_10628661 Ga0075433_106286612 194
513 3300006871 Ga0075434_100008873 Ga0075434_10000887310 194
514 3300006871 Ga0075434_100915210 Ga0075434_1009152101 194
515 3300006871 Ga0075434_101575156 Ga0075434_1015751561 194
516 3300006881 Ga0068865_100075446 Ga0068865_1000754462 194
517 3300006931 Ga0097620_100251646 Ga0097620_1002516462 194
518 3300006931 Ga0097620_100414853 Ga0097620_1004148532 194
519 3300006931 Ga0097620_100474452 Ga0097620_1004744521 194
520 3300006941 Ga0099825_1017862 Ga0099825_10178628 194
521 3300006942 Ga0099824_1004496 Ga0099824_10044966 194
522 3300006943 Ga0099822_1001205 Ga0099822_100120510 194
523 3300006944 Ga0099823_1074998 Ga0099823_10749982 194
524 3300007265 Ga0099794_10111599 Ga0099794_101115993 194
525 3300007265 Ga0099794_10247543 Ga0099794_102475431 194
526 3300007788 Ga0099795_10028277 Ga0099795_100282772 194
527 3300007788 Ga0099795_10043937 Ga0099795_100439372 194
528 3300007788 Ga0099795_10117800 Ga0099795_101178001 194
529 3300009092 Ga0105250_10146291 Ga0105250_101462912 194
530 3300009093 Ga0105240_10037185 Ga0105240_100371855 194
531 3300009093 Ga0105240_10060299 Ga0105240_100602991 194
532 3300009093 Ga0105240_10147223 Ga0105240_101472232 194
533 3300009093 Ga0105240_10170959 Ga0105240_101709593 194
534 3300009093 Ga0105240_10216390 Ga0105240_102163902 194
535 3300009094 Ga0111539_10054668 Ga0111539_100546686 194
536 3300009098 Ga0105245_10018719 Ga0105245_100187195 194
537 3300009098 Ga0105245_10083841 Ga0105245_100838413 194
538 3300009098 Ga0105245_10132382 Ga0105245_101323824 194
539 3300009101 Ga0105247_10005197 Ga0105247_100051972 194
540 3300009101 Ga0105247_10043201 Ga0105247_100432012 194
541 3300009101 Ga0105247_10120425 Ga0105247_101204252 194
542 3300009101 Ga0105247_10122234 Ga0105247_101222342 194
543 3300009101 Ga0105247_10534453 Ga0105247_105344531 194
544 3300009101 Ga0105247_10766575 Ga0105247_107665752 194
545 3300009101 Ga0105247_10808356 Ga0105247_108083561 194
546 3300009148 Ga0105243_10023714 Ga0105243_100237147 194
547 3300009148 Ga0105243_10246899 Ga0105243_102468992 194
548 3300009174 Ga0105241_10022043 Ga0105241_100220434 194
549 3300009174 Ga0105241_10022614 Ga0105241_100226145 194
550 3300009174 Ga0105241_10244997 Ga0105241_102449972 194
551 3300009174 Ga0105241_10351808 Ga0105241_103518082 194
552 3300009174 Ga0105241_10447478 Ga0105241_104474781 194
553 3300009176 Ga0105242_10193943 Ga0105242_101939432 194
554 3300009176 Ga0105242_10279996 Ga0105242_102799963 194
555 3300009177 Ga0105248_10199489 Ga0105248_101994892 194
556 3300009177 Ga0105248_10489643 Ga0105248_104896432 194
557 3300009177 Ga0105248_10614982 Ga0105248_106149822 194
558 3300009177 Ga0105248_10836986 Ga0105248_108369862 194
559 3300009177 Ga0105248_10858407 Ga0105248_108584071 194
560 3300009177 Ga0105248_10989480 Ga0105248_109894802 194
561 3300009177 Ga0105248_11095786 Ga0105248_110957862 194
562 3300009545 Ga0105237_10003757 Ga0105237_1000375715 194
563 3300009545 Ga0105237_10013957 Ga0105237_100139573 194
564 3300009545 Ga0105237_10108092 Ga0105237_101080923 194
565 3300009545 Ga0105237_10154651 Ga0105237_101546512 194
566 3300009545 Ga0105237_10207611 Ga0105237_102076114 194
567 3300009545 Ga0105237_10355262 Ga0105237_103552622 194
568 3300009551 Ga0105238_10012843 Ga0105238_1001284310 194
569 3300009551 Ga0105238_10087356 Ga0105238_100873562 194
570 3300009551 Ga0105238_10108517 Ga0105238_101085172 194
571 3300009551 Ga0105238_10355678 Ga0105238_103556782 194
572 3300009551 Ga0105238_10378419 Ga0105238_103784192 194
573 3300009551 Ga0105238_10431818 Ga0105238_104318182 194
574 3300009551 Ga0105238_10991369 Ga0105238_109913691 194
575 3300009553 Ga0105249_10548931 Ga0105249_105489312 194
576 3300010159 Ga0099796_10007070 Ga0099796_100070703 194
577 3300010375 Ga0105239_10083730 Ga0105239_100837302 194
578 3300010375 Ga0105239_10095378 Ga0105239_100953784 194
579 3300010375 Ga0105239_10099271 Ga0105239_100992712 194
580 3300010375 Ga0105239_10132392 Ga0105239_101323924 194
581 3300010375 Ga0105239_10168407 Ga0105239_101684072 194
582 3300010375 Ga0105239_10300527 Ga0105239_103005272 194
583 3300010375 Ga0105239_10489871 Ga0105239_104898712 194
584 3300010375 Ga0105239_10608053 Ga0105239_106080531 194
585 3300010375 Ga0105239_10734397 Ga0105239_107343972 194
586 3300011119 Ga0105246_10121996 Ga0105246_101219962 194
587 3300011119 Ga0105246_10388004 Ga0105246_103880042 194
588 3300011119 Ga0105246_10416012 Ga0105246_104160122 194
589 3300012485 Ga0157325_1010924 Ga0157325_10109241 194
590 3300012503 Ga0157313_1006498 Ga0157313_10064981 194
591 3300013100 Ga0157373_10114711 Ga0157373_101147112 194
592 3300013102 Ga0157371_10127012 Ga0157371_101270123 194
593 3300013104 Ga0157370_10076545 Ga0157370_100765455 194
594 3300013104 Ga0157370_10358922 Ga0157370_103589221 194
595 3300013104 Ga0157370_10375147 Ga0157370_103751473 194
596 3300013104 Ga0157370_10562780 Ga0157370_105627802 194
597 3300013104 Ga0157370_10970339 Ga0157370_109703391 194
598 3300013105 Ga0157369_10008435 Ga0157369_100084359 194
599 3300013105 Ga0157369_10030907 Ga0157369_100309074 194
600 3300013105 Ga0157369_10163132 Ga0157369_101631322 194
601 3300013105 Ga0157369_10455646 Ga0157369_104556462 194
602 3300013105 Ga0157369_10830928 Ga0157369_108309282 194
603 3300013296 Ga0157374_10073477 Ga0157374_100734775 194
604 3300013296 Ga0157374_10161238 Ga0157374_101612382 194
605 3300013296 Ga0157374_10172122 Ga0157374_101721222 194
606 3300013296 Ga0157374_11494353 Ga0157374_114943531 194
607 3300013297 Ga0157378_10015347 Ga0157378_100153478 194
608 3300013297 Ga0157378_10375595 Ga0157378_103755952 194
609 3300013306 Ga0163162_10413533 Ga0163162_104135331 194
610 3300013306 Ga0163162_10605167 Ga0163162_106051672 194
611 3300013307 Ga0157372_10096728 Ga0157372_100967283 194
612 3300013307 Ga0157372_10447920 Ga0157372_104479201 194
613 3300013307 Ga0157372_10756641 Ga0157372_107566412 194
614 3300013307 Ga0157372_11580295 Ga0157372_115802951 194
615 3300013308 Ga0157375_10022349 Ga0157375_100223492 194
616 3300013308 Ga0157375_10191028 Ga0157375_101910282 194
617 3300013308 Ga0157375_10247572 Ga0157375_102475724 194
618 3300013308 Ga0157375_10312102 Ga0157375_103121022 194
619 3300013308 Ga0157375_10529595 Ga0157375_105295952 194
620 3300013308 Ga0157375_10586051 Ga0157375_105860512 194
621 3300013308 Ga0157375_11317625 Ga0157375_113176252 194
622 3300014325 Ga0163163_10017322 Ga0163163_100173222 194
623 3300014325 Ga0163163_10048111 Ga0163163_100481112 194
624 3300014325 Ga0163163_10420635 Ga0163163_104206351 194
625 3300014325 Ga0163163_10549931 Ga0163163_105499312 194
626 3300014325 Ga0163163_11066205 Ga0163163_110662051 194
627 3300014326 Ga0157380_10126713 Ga0157380_101267133 194
628 3300014326 Ga0157380_10338062 Ga0157380_103380622 194
629 3300014326 Ga0157380_10358136 Ga0157380_103581361 194
630 3300014326 Ga0157380_11479962 Ga0157380_114799621 194
631 3300014745 Ga0157377_10198201 Ga0157377_101982012 194
632 3300014968 Ga0157379_10250131 Ga0157379_102501312 194
633 3300014968 Ga0157379_10434627 Ga0157379_104346271 194
634 3300014968 Ga0157379_10631896 Ga0157379_106318962 194
635 3300014969 Ga0157376_10054586 Ga0157376_100545866 194
636 3300014969 Ga0157376_10247875 Ga0157376_102478752 194
637 3300014969 Ga0157376_10438937 Ga0157376_104389372 194
638 3300014969 Ga0157376_10550588 Ga0157376_105505882 194
639 3300017792 Ga0163161_10180473 Ga0163161_101804733 194
640 3300017792 Ga0163161_10414456 Ga0163161_104144562 194
641 3300021320 Ga0214544_1000009 Ga0214544_1000009144 194
642 3300021321 Ga0214542_1000002 Ga0214542_1000002586 194
643 3300021324 Ga0214545_1000002 Ga0214545_1000002134 194
644 3300021327 Ga0214543_1000013 Ga0214543_1000013188 194
645 3300021358 Ga0213873_10038419 Ga0213873_100384191 194
646 3300021384 Ga0213876_10001848 Ga0213876_1000184813 194
647 3300021384 Ga0213876_10011429 Ga0213876_100114294 194
648 3300021388 Ga0213875_10035810 Ga0213875_100358101 194
649 3300021388 Ga0213875_10269927 Ga0213875_102699271 194
650 3300025230 Ga0209563_101045 Ga0209563_1010452 194
651 3300025253 Ga0209677_102385 Ga0209677_1023856 194
652 3300025253 Ga0209677_102571 Ga0209677_1025718 194
653 3300025254 Ga0209148_1000446 Ga0209148_100044620 194
654 3300025261 Ga0209233_1001302 Ga0209233_10013026 194
655 3300025261 Ga0209233_1001367 Ga0209233_10013679 194
656 3300025261 Ga0209233_1031508 Ga0209233_10315081 194
657 3300025272 Ga0209455_1006256 Ga0209455_10062564 194
658 3300025273 Ga0209673_1049900 Ga0209673_10499001 194
659 3300025295 Ga0209564_1009891 Ga0209564_10098914 194
660 3300025295 Ga0209564_1024293 Ga0209564_10242931 194
661 3300025297 Ga0209758_1000100 Ga0209758_100010027 194
662 3300025297 Ga0209758_1000160 Ga0209758_1000160171 194
663 3300025297 Ga0209758_1002793 Ga0209758_100279314 194
664 3300025297 Ga0209758_1003932 Ga0209758_10039326 194
665 3300025297 Ga0209758_1005852 Ga0209758_10058524 194
666 3300025297 Ga0209758_1016663 Ga0209758_10166632 194
667 3300025297 Ga0209758_1030410 Ga0209758_10304102 194
668 3300025297 Ga0209758_1031291 Ga0209758_10312913 194
669 3300025298 Ga0209050_1050100 Ga0209050_10501001 194
670 3300025299 Ga0209256_1010637 Ga0209256_10106374 194
671 3300025302 Ga0207426_1001094 Ga0207426_100109417 194
672 3300025302 Ga0207426_1002241 Ga0207426_100224110 194
673 3300025302 Ga0207426_1021409 Ga0207426_10214092 194
674 3300025304 Ga0209257_1005571 Ga0209257_10055712 194
675 3300025315 Ga0207697_10040240 Ga0207697_100402402 194
676 3300025315 Ga0207697_10137630 Ga0207697_101376302 194
677 3300025321 Ga0207656_10212297 Ga0207656_102122971 194
678 3300025711 Ga0207696_1077977 Ga0207696_10779772 194
679 3300025898 Ga0207692_10000308 Ga0207692_1000030815 194
680 3300025898 Ga0207692_10002064 Ga0207692_100020649 194
681 3300025898 Ga0207692_10095563 Ga0207692_100955632 194
682 3300025899 Ga0207642_10018415 Ga0207642_100184152 194
683 3300025900 Ga0207710_10005066 Ga0207710_100050662 194
684 3300025900 Ga0207710_10011801 Ga0207710_100118012 194
685 3300025901 Ga0207688_10224906 Ga0207688_102249062 194
686 3300025903 Ga0207680_10359672 Ga0207680_103596721 194
687 3300025904 Ga0207647_10015173 Ga0207647_100151732 194
688 3300025904 Ga0207647_10066702 Ga0207647_100667022 194
689 3300025904 Ga0207647_10150208 Ga0207647_101502082 194
690 3300025904 Ga0207647_10173629 Ga0207647_101736291 194
691 3300025905 Ga0207685_10000468 Ga0207685_100004684 194
692 3300025905 Ga0207685_10068762 Ga0207685_100687621 194
693 3300025906 Ga0207699_10001291 Ga0207699_1000129112 194
694 3300025906 Ga0207699_10010647 Ga0207699_100106474 194
695 3300025906 Ga0207699_10128528 Ga0207699_101285281 194
696 3300025907 Ga0207645_10027775 Ga0207645_100277752 194
697 3300025907 Ga0207645_10030138 Ga0207645_100301384 194
698 3300025908 Ga0207643_10223284 Ga0207643_102232842 194
699 3300025909 Ga0207705_10274616 Ga0207705_102746163 194
700 3300025910 Ga0207684_10085353 Ga0207684_100853533 194
701 3300025911 Ga0207654_10070600 Ga0207654_100706001 194
702 3300025911 Ga0207654_10077759 Ga0207654_100777592 194
703 3300025911 Ga0207654_10185810 Ga0207654_101858102 194
704 3300025912 Ga0207707_10000494 Ga0207707_1000049426 194
705 3300025912 Ga0207707_10000896 Ga0207707_1000089624 194
706 3300025912 Ga0207707_10026257 Ga0207707_100262576 194
707 3300025912 Ga0207707_10109574 Ga0207707_101095742 194
708 3300025912 Ga0207707_10304168 Ga0207707_103041681 194
709 3300025913 Ga0207695_10000278 Ga0207695_1000027879 194
710 3300025913 Ga0207695_10080608 Ga0207695_100806082 194
711 3300025913 Ga0207695_10184308 Ga0207695_101843082 194
712 3300025913 Ga0207695_10254696 Ga0207695_102546961 194
713 3300025913 Ga0207695_10340327 Ga0207695_103403271 194
714 3300025913 Ga0207695_10752725 Ga0207695_107527251 194
715 3300025914 Ga0207671_10006710 Ga0207671_100067109 194
716 3300025914 Ga0207671_10062495 Ga0207671_100624952 194
717 3300025914 Ga0207671_10128103 Ga0207671_101281032 194
718 3300025914 Ga0207671_10187699 Ga0207671_101876992 194
719 3300025914 Ga0207671_10222555 Ga0207671_102225552 194
720 3300025914 Ga0207671_10388735 Ga0207671_103887352 194
721 3300025915 Ga0207693_10001932 Ga0207693_1000193214 194
722 3300025915 Ga0207693_10006236 Ga0207693_1000623610 194
723 3300025915 Ga0207693_10012373 Ga0207693_100123732 194
724 3300025915 Ga0207693_10013898 Ga0207693_100138982 194
725 3300025915 Ga0207693_10105956 Ga0207693_101059562 194
726 3300025916 Ga0207663_10000365 Ga0207663_1000036515 194
727 3300025916 Ga0207663_10007002 Ga0207663_100070029 194
728 3300025916 Ga0207663_10027757 Ga0207663_100277574 194
729 3300025916 Ga0207663_10129357 Ga0207663_101293571 194
730 3300025917 Ga0207660_10001052 Ga0207660_1000105219 194
731 3300025917 Ga0207660_10017659 Ga0207660_100176592 194
732 3300025917 Ga0207660_10065377 Ga0207660_100653771 194
733 3300025917 Ga0207660_10082459 Ga0207660_100824591 194
734 3300025919 Ga0207657_10011901 Ga0207657_100119019 194
735 3300025919 Ga0207657_10199380 Ga0207657_101993803 194
736 3300025919 Ga0207657_10348207 Ga0207657_103482072 194
737 3300025919 Ga0207657_10349687 Ga0207657_103496872 194
738 3300025919 Ga0207657_10416926 Ga0207657_104169261 194
739 3300025920 Ga0207649_10891177 Ga0207649_108911771 194
740 3300025921 Ga0207652_10001721 Ga0207652_1000172114 194
741 3300025921 Ga0207652_10002542 Ga0207652_100025425 194
742 3300025921 Ga0207652_10029879 Ga0207652_100298796 194
743 3300025921 Ga0207652_10033319 Ga0207652_100333191 194
744 3300025921 Ga0207652_10255219 Ga0207652_102552191 194
745 3300025921 Ga0207652_10264232 Ga0207652_102642321 194
746 3300025921 Ga0207652_10346860 Ga0207652_103468602 194
747 3300025922 Ga0207646_10052414 Ga0207646_100524145 194
748 3300025923 Ga0207681_10237112 Ga0207681_102371121 194
749 3300025924 Ga0207694_10046441 Ga0207694_100464415 194
750 3300025924 Ga0207694_10115281 Ga0207694_101152813 194
751 3300025924 Ga0207694_10195200 Ga0207694_101952002 194
752 3300025924 Ga0207694_10239753 Ga0207694_102397532 194
753 3300025924 Ga0207694_10272737 Ga0207694_102727372 194
754 3300025924 Ga0207694_10671562 Ga0207694_106715621 194
755 3300025924 Ga0207694_11045332 Ga0207694_110453321 194
756 3300025925 Ga0207650_10105342 Ga0207650_101053422 194
757 3300025927 Ga0207687_10012698 Ga0207687_100126984 194
758 3300025927 Ga0207687_10086909 Ga0207687_100869092 194
759 3300025927 Ga0207687_10355679 Ga0207687_103556792 194
760 3300025928 Ga0207700_10000752 Ga0207700_1000075215 194
761 3300025928 Ga0207700_10076249 Ga0207700_100762492 194
762 3300025928 Ga0207700_10209162 Ga0207700_102091622 194
763 3300025928 Ga0207700_10639121 Ga0207700_106391211 194
764 3300025929 Ga0207664_10023582 Ga0207664_100235824 194
765 3300025929 Ga0207664_10143318 Ga0207664_101433181 194
766 3300025929 Ga0207664_10843445 Ga0207664_108434451 194
767 3300025931 Ga0207644_10058994 Ga0207644_100589942 194
768 3300025931 Ga0207644_10244542 Ga0207644_102445422 194
769 3300025932 Ga0207690_10197654 Ga0207690_101976542 194
770 3300025932 Ga0207690_10291979 Ga0207690_102919792 194
771 3300025932 Ga0207690_10358604 Ga0207690_103586042 194
772 3300025933 Ga0207706_10114484 Ga0207706_101144842 194
773 3300025934 Ga0207686_10173751 Ga0207686_101737512 194
774 3300025934 Ga0207686_10373665 Ga0207686_103736651 194
775 3300025935 Ga0207709_10052805 Ga0207709_100528052 194
776 3300025935 Ga0207709_10369126 Ga0207709_103691262 194
777 3300025937 Ga0207669_10052815 Ga0207669_100528153 194
778 3300025937 Ga0207669_10086954 Ga0207669_100869541 194
779 3300025937 Ga0207669_10258533 Ga0207669_102585332 194
780 3300025937 Ga0207669_10447611 Ga0207669_104476111 194
781 3300025937 Ga0207669_10572483 Ga0207669_105724831 194
782 3300025938 Ga0207704_10014890 Ga0207704_100148904 194
783 3300025939 Ga0207665_10000957 Ga0207665_1000095715 194
784 3300025939 Ga0207665_10004741 Ga0207665_100047415 194
785 3300025939 Ga0207665_10539715 Ga0207665_105397151 194
786 3300025940 Ga0207691_10033524 Ga0207691_100335241 194
787 3300025940 Ga0207691_10034661 Ga0207691_100346613 194
788 3300025940 Ga0207691_10824720 Ga0207691_108247202 194
789 3300025941 Ga0207711_10396851 Ga0207711_103968512 194
790 3300025941 Ga0207711_10430120 Ga0207711_104301201 194
791 3300025941 Ga0207711_10931781 Ga0207711_109317811 194
792 3300025942 Ga0207689_10188972 Ga0207689_101889722 194
793 3300025942 Ga0207689_10240079 Ga0207689_102400792 194
794 3300025942 Ga0207689_10365900 Ga0207689_103659002 194
795 3300025944 Ga0207661_10015207 Ga0207661_100152075 194
796 3300025944 Ga0207661_10223074 Ga0207661_102230741 194
797 3300025944 Ga0207661_10390469 Ga0207661_103904692 194
798 3300025945 Ga0207679_10054680 Ga0207679_100546801 194
799 3300025945 Ga0207679_10541624 Ga0207679_105416241 194
800 3300025945 Ga0207679_10565554 Ga0207679_105655542 194
801 3300025949 Ga0207667_10003512 Ga0207667_1000351213 194
802 3300025949 Ga0207667_10010956 Ga0207667_1001095611 194
803 3300025949 Ga0207667_10184363 Ga0207667_101843633 194
804 3300025949 Ga0207667_10215470 Ga0207667_102154703 194
805 3300025949 Ga0207667_10330631 Ga0207667_103306312 194
806 3300025949 Ga0207667_10521761 Ga0207667_105217611 194
807 3300025949 Ga0207667_11267521 Ga0207667_112675211 194
808 3300025960 Ga0207651_10307059 Ga0207651_103070592 194
809 3300025960 Ga0207651_10650690 Ga0207651_106506901 194
810 3300025961 Ga0207712_10215242 Ga0207712_102152421 194
811 3300025961 Ga0207712_10687044 Ga0207712_106870442 194
812 3300025972 Ga0207668_10106980 Ga0207668_101069802 194
813 3300025972 Ga0207668_10191611 Ga0207668_101916112 194
814 3300025972 Ga0207668_10193574 Ga0207668_101935741 194
815 3300025972 Ga0207668_10221896 Ga0207668_102218961 194
816 3300025972 Ga0207668_11005197 Ga0207668_110051971 194
817 3300025986 Ga0207658_10255064 Ga0207658_102550642 194
818 3300025986 Ga0207658_10258570 Ga0207658_102585701 194
819 3300025986 Ga0207658_11234830 Ga0207658_112348301 194
820 3300026023 Ga0207677_10194612 Ga0207677_101946122 194
821 3300026023 Ga0207677_10602621 Ga0207677_106026212 194
822 3300026035 Ga0207703_10093548 Ga0207703_100935482 194
823 3300026035 Ga0207703_10131827 Ga0207703_101318273 194
824 3300026035 Ga0207703_10204380 Ga0207703_102043802 194
825 3300026035 Ga0207703_10263644 Ga0207703_102636442 194
826 3300026035 Ga0207703_11031884 Ga0207703_110318841 194
827 3300026041 Ga0207639_10007089 Ga0207639_100070892 194
828 3300026041 Ga0207639_10149273 Ga0207639_101492732 194
829 3300026041 Ga0207639_10358067 Ga0207639_103580672 194
830 3300026041 Ga0207639_10685993 Ga0207639_106859932 194
831 3300026041 Ga0207639_10903925 Ga0207639_109039252 194
832 3300026067 Ga0207678_10060617 Ga0207678_100606172 194
833 3300026067 Ga0207678_10066555 Ga0207678_100665552 194
834 3300026067 Ga0207678_10091282 Ga0207678_100912822 194
835 3300026067 Ga0207678_10126493 Ga0207678_101264931 194
836 3300026067 Ga0207678_10399880 Ga0207678_103998801 194
837 3300026067 Ga0207678_10798733 Ga0207678_107987331 194
838 3300026078 Ga0207702_10004908 Ga0207702_100049083 194
839 3300026078 Ga0207702_10291263 Ga0207702_102912632 194
840 3300026078 Ga0207702_10577360 Ga0207702_105773602 194
841 3300026078 Ga0207702_10683171 Ga0207702_106831712 194
842 3300026078 Ga0207702_10768230 Ga0207702_107682301 194
843 3300026088 Ga0207641_10458860 Ga0207641_104588601 194
844 3300026089 Ga0207648_10027013 Ga0207648_100270133 194
845 3300026095 Ga0207676_10121979 Ga0207676_101219792 194
846 3300026095 Ga0207676_10183059 Ga0207676_101830592 194
847 3300026095 Ga0207676_10572198 Ga0207676_105721982 194
848 3300026095 Ga0207676_10635248 Ga0207676_106352482 194
849 3300026116 Ga0207674_10016819 Ga0207674_100168194 194
850 3300026116 Ga0207674_10076950 Ga0207674_100769504 194
851 3300026116 Ga0207674_10078158 Ga0207674_100781582 194
852 3300026116 Ga0207674_10812741 Ga0207674_108127411 194
853 3300026118 Ga0207675_100193953 Ga0207675_1001939532 194
854 3300026118 Ga0207675_100196150 Ga0207675_1001961503 194
855 3300026121 Ga0207683_10036246 Ga0207683_100362464 194
856 3300026121 Ga0207683_10075265 Ga0207683_100752654 194
857 3300026121 Ga0207683_10262697 Ga0207683_102626972 194
858 3300026142 Ga0207698_10033235 Ga0207698_100332356 194
859 3300026142 Ga0207698_10094835 Ga0207698_100948352 194
860 3300026142 Ga0207698_10384358 Ga0207698_103843582 194
861 3300027296 Ga0209389_1000113 Ga0209389_100011316 194
862 3300027357 Ga0209589_1000023 Ga0209589_100002340 194
863 3300027357 Ga0209589_1000041 Ga0209589_100004144 194
864 3300027361 Ga0209489_100032 Ga0209489_10003240 194
865 3300027361 Ga0209489_100070 Ga0209489_10007084 194
866 3300027361 Ga0209489_107143 Ga0209489_1071435 194
867 3300027363 Ga0209700_100021 Ga0209700_100021140 194
868 3300027363 Ga0209700_100040 Ga0209700_10004040 194
869 3300027671 Ga0209588_1027013 Ga0209588_10270132 194
870 3300027866 Ga0209813_10016723 Ga0209813_100167232 194
871 3300028379 Ga0268266_10063942 Ga0268266_100639424 194
872 3300028379 Ga0268266_10097492 Ga0268266_100974922 194
873 3300028379 Ga0268266_10149445 Ga0268266_101494452 194
874 3300028379 Ga0268266_10272122 Ga0268266_102721222 194
875 3300028380 Ga0268265_10044540 Ga0268265_100445402 194
876 3300028380 Ga0268265_10069413 Ga0268265_100694132 194
877 3300028380 Ga0268265_10267710 Ga0268265_102677102 194
878 3300028380 Ga0268265_10268890 Ga0268265_102688901 194
879 3300028381 Ga0268264_10000022 Ga0268264_10000022267 194
880 3300028381 Ga0268264_10094942 Ga0268264_100949422 194
881 3300028381 Ga0268264_10294537 Ga0268264_102945372 194
882 3300028381 Ga0268264_10872588 Ga0268264_108725882 194
883 3300028556 Ga0265337_1010612 Ga0265337_10106122 194
884 3300028573 Ga0265334_10033498 Ga0265334_100334982 194
885 3300028573 Ga0265334_10034598 Ga0265334_100345981 194
886 3300028577 Ga0265318_10123634 Ga0265318_101236341 194
887 3300028653 Ga0265323_10019751 Ga0265323_100197512 194
888 3300028786 Ga0307517_10001054 Ga0307517_1000105438 194
889 3300028794 Ga0307515_10073527 Ga0307515_100735272 194
890 3300028800 Ga0265338_10000337 Ga0265338_1000033778 194
891 3300028800 Ga0265338_10611853 Ga0265338_106118531 194
892 3300029957 Ga0265324_10010988 Ga0265324_100109882 194
893 3300030521 Ga0307511_10214421 Ga0307511_102144211 194
894 3300030760 Ga0265762_1021662 Ga0265762_10216622 194
895 3300031090 Ga0265760_10119633 Ga0265760_101196332 194
896 3300031241 Ga0265325_10017156 Ga0265325_100171563 194
897 3300031247 Ga0265340_10011816 Ga0265340_100118162 194
898 3300031247 Ga0265340_10128737 Ga0265340_101287371 194
899 3300031249 Ga0265339_10021644 Ga0265339_100216443 194
900 3300031249 Ga0265339_10071611 Ga0265339_100716112 194
901 3300031250 Ga0265331_10080665 Ga0265331_100806652 194
902 3300031250 Ga0265331_10151928 Ga0265331_101519282 194
903 3300031250 Ga0265331_10197745 Ga0265331_101977451 194
904 3300031344 Ga0265316_10120452 Ga0265316_101204523 194
905 3300031456 Ga0307513_10539348 Ga0307513_105393481 194
906 3300031507 Ga0307509_10069489 Ga0307509_100694892 194
907 3300031507 Ga0307509_10248383 Ga0307509_102483832 194
908 3300031507 Ga0307509_10276692 Ga0307509_102766922 194
909 3300031548 Ga0307408_100812913 Ga0307408_1008129131 194
910 3300031595 Ga0265313_10241970 Ga0265313_102419701 194
911 3300031616 Ga0307508_10000038 Ga0307508_1000003891 194
912 3300031616 Ga0307508_10011952 Ga0307508_100119523 194
913 3300031616 Ga0307508_10049566 Ga0307508_100495664 194
914 3300031616 Ga0307508_10179027 Ga0307508_101790271 194
915 3300031616 Ga0307508_10231295 Ga0307508_102312951 194
916 3300031616 Ga0307508_10484184 Ga0307508_104841841 194
917 3300031711 Ga0265314_10010719 Ga0265314_100107195 194
918 3300031711 Ga0265314_10416874 Ga0265314_104168741 194
919 3300031712 Ga0265342_10005896 Ga0265342_100058967 194
920 3300031712 Ga0265342_10027683 Ga0265342_100276831 194
921 3300031730 Ga0307516_10021961 Ga0307516_100219613 194
922 3300031730 Ga0307516_10218372 Ga0307516_102183721 194
923 3300031730 Ga0307516_10253433 Ga0307516_102534332 194
924 3300031730 Ga0307516_10452957 Ga0307516_104529572 194
925 3300031731 Ga0307405_10334448 Ga0307405_103344482 194
926 3300031731 Ga0307405_10486612 Ga0307405_104866121 194
927 3300031824 Ga0307413_10128964 Ga0307413_101289642 194
928 3300031838 Ga0307518_10237817 Ga0307518_102378172 194
929 3300031903 Ga0307407_10086172 Ga0307407_100861722 194
930 3300031995 Ga0307409_100135783 Ga0307409_1001357833 194
931 3300032002 Ga0307416_100096572 Ga0307416_1000965722 194
932 3300032004 Ga0307414_10211996 Ga0307414_102119962 194
933 3300032126 Ga0307415_100298446 Ga0307415_1002984462 194
934 3300033179 Ga0307507_10006782 Ga0307507_100067823 194
935 3300033180 Ga0307510_10046892 Ga0307510_100468922 194
936 3300033180 Ga0307510_10059591 Ga0307510_100595912 194
937 3300033442 Ga0315911_1000001 Ga0315911_10000011108 194
938 3300034819 Ga0373958_0094615 Ga0373958_0094615_50_634 194
939 3300035083 Ga0373926_0001023 Ga0373926_0001023_5274_5858 194
940 3300035083 Ga0373926_0042922 Ga0373926_0042922_34_618 194
941 3300035086 Ga0373934_0059515 Ga0373934_0059515_134_718 194
942 3300035089 Ga0373944_0055536 Ga0373944_0055536_176_760 194
943 3300035092 Ga0373952_0032660 Ga0373952_0032660_276_860 194
944 3300035111 Ga0373923_0000923 Ga0373923_0000923_7058_7642 194
945 3300035111 Ga0373923_0033913 Ga0373923_0033913_853_1437 194
946 3300035112 Ga0373932_0079158 Ga0373932_0079158_188_772 194
947 3300035113 Ga0373936_0026216 Ga0373936_0026216_764_1348 194
948 3300035113 Ga0373936_0036592 Ga0373936_0036592_478_1062 194
949 3300035113 Ga0373936_0214801 Ga0373936_0214801_208_792 194
950 3300035114 Ga0373939_0073328 Ga0373939_0073328_437_1021 194
951 3300035115 Ga0373941_0010495 Ga0373941_0010495_1082_1666 194
952 3300035116 Ga0373945_0056625 Ga0373945_0056625_374_958 194
953 3300035117 Ga0373953_0007891 Ga0373953_0007891_1054_1638 194
954 3300035117 Ga0373953_0015186 Ga0373953_0015186_34_618 194
955 3300035117 Ga0373953_0067556 Ga0373953_0067556_368_1021 194
956 3300035118 Ga0373954_0041893 Ga0373954_0041893_883_1467 194
957 3300035118 Ga0373954_0102801 Ga0373954_0102801_29_613 194
958 3300035118 Ga0373954_0158867 Ga0373954_0158867_148_732 194
959 3300035120 Ga0373957_0000375 Ga0373957_0000375_8435_9019 194
960 3300035170 Ga0373943_0039246 Ga0373943_0039246_1152_1736 194
961 3300035171 Ga0373946_0025361 Ga0373946_0025361_1590_2174 194
962 3300035172 Ga0373955_0001328 Ga0373955_0001328_4661_5245 194
963 3300035410 Ga0373924_0001614 Ga0373924_0001614_5691_6275 194
964 3300035410 Ga0373924_0110706 Ga0373924_0110706_274_858 194
965 3300035691 Ga0373931_0014501 Ga0373931_0014501_1830_2414 194
966 3300035692 Ga0373935_0284639 Ga0373935_0284639_184_768 194
967 3300035692 Ga0373935_0296239 Ga0373935_0296239_180_764 194
968 3300035692 Ga0373935_0450177 Ga0373935_0450177_146_730 194
969 3300035692 Ga0373935_0525089 Ga0373935_0525089_106_690 194
970 3300035695 Ga0373927_0027925 Ga0373927_0027925_1999_2583 194
971 3300035695 Ga0373927_0032601 Ga0373927_0032601_2692_3276 194
972 3300035695 Ga0373927_0061827 Ga0373927_0061827_1566_2150 194
973 3300035695 Ga0373927_0092919 Ga0373927_0092919_1152_1736 194
974 3300035695 Ga0373927_0141451 Ga0373927_0141451_903_1517 194
975 3300035695 Ga0373927_0166913 Ga0373927_0166913_164_748 194
976 3300035724 Ga0373933_0001518 Ga0373933_0001518_2667_3251 194
977 3300035724 Ga0373933_0043637 Ga0373933_0043637_978_1631 194
978 3300035724 Ga0373933_0047712 Ga0373933_0047712_473_1057 194
979 3300035724 Ga0373933_0142763 Ga0373933_0142763_523_1107 194
980 3300035725 Ga0373947_0023122 Ga0373947_0023122_2614_3198 194
981 3300035725 Ga0373947_0137064 Ga0373947_0137064_878_1462 194
982 3300035725 Ga0373947_0263604 Ga0373947_0263604_283_867 194
983 3300035725 Ga0373947_0406711 Ga0373947_0406711_251_835 194
984 3300036401 Ga0373937_0196775 Ga0373937_0196775_645_1229 194
985 3300037068 Ga0373925_0057892 Ga0373925_0057892_190_774 194
986 3300037068 Ga0373925_0101408 Ga0373925_0101408_1156_1740 194
987 3300037068 Ga0373925_0197535 Ga0373925_0197535_329_913 194
988 3300037068 Ga0373925_0209187 Ga0373925_0209187_203_787 194
989 3300037312 Ga0395899_0140917 Ga0395899_0140917_823_1416 194
990 3300037418 Ga0395900_0000860 Ga0395900_0000860_7832_8416 194
991 3300037418 Ga0395900_0323770 Ga0395900_0323770_561_1145 194
992 3300037418 Ga0395900_0483145 Ga0395900_0483145_114_698 194
993 3300037466 Ga0395898_0046012 Ga0395898_0046012_1165_1749 194
994 3300037471 Ga0395905_0056855 Ga0395905_0056855_2742_3326 194
995 3300037471 Ga0395905_0123786 Ga0395905_0123786_990_1574 194
996 3300037853 Ga0436364_0267346 Ga0436364_0267346_141_725 194
997 3300037853 Ga0436364_0500303 Ga0436364_0500303_31_693 194
998 3300037853 Ga0436364_1340351 Ga0436364_1340351_1103_1687 194
999 3300038443 Ga0395901_0057535 Ga0395901_0057535_424_1008 194
1000 3300038443 Ga0395901_0974883 Ga0395901_0974883_92_676 194
1001 3300039437 Ga0436365_0151039 Ga0436365_0151039_191_775 194
1002 3300039437 Ga0436365_0268210 Ga0436365_0268210_1987_2640 194
1003 3300039437 Ga0436365_0710303 Ga0436365_0710303_384_968 194
1004 3300039437 Ga0436365_1095310 Ga0436365_1095310_2629_3213 194
1005 3300039437 Ga0436365_1396402 Ga0436365_1396402_746_1330 194
1006 3300039437 Ga0436365_1591893 Ga0436365_1591893_86_670 194
1007 3300039437 Ga0436365_1655446 Ga0436365_1655446_980_1564 194
1008 3300039437 Ga0436365_1817893 Ga0436365_1817893_289_888 194
1009 3300039437 Ga0436365_1870953 Ga0436365_1870953_323_907 194
1010 3300039438 Ga0436360_0660865 Ga0436360_0660865_534_1118 194
1011 3300039450 Ga0436363_0894926 Ga0436363_0894926_239_823 194
1012 3300039450 Ga0436363_1201079 Ga0436363_1201079_1966_2565 194
1013 3300039450 Ga0436363_1223665 Ga0436363_1223665_497_1081 194
1014 3300039453 Ga0436362_0332326 Ga0436362_0332326_1781_2434 194
1015 3300041413 Ga0439465_0108277 Ga0439465_0108277_159_743 194
1016 3300041453 Ga0451797_0764166 Ga0451797_0764166_172_756 194
1017 3300041460 Ga0451802_0611095 Ga0451802_0611095_54_638 194
1018 3300041496 Ga0451839_1657451 Ga0451839_1657451_1115_1699 194
1019 3300041498 Ga0451841_0572120 Ga0451841_0572120_130_714 194
1020 3300041505 Ga0451849_0054097 Ga0451849_0054097_634_1218 194
1021 3300041512 Ga0451853_2886446 Ga0451853_2886446_31_615 194
1022 3300041512 Ga0451853_3008790 Ga0451853_3008790_33_635 194
1023 3300041512 Ga0451853_3547507 Ga0451853_3547507_278_880 194
1024 3300042016 Ga0439463_049467 Ga0439463_049467_50_634 194
1025 3300042157 Ga0439458_0079320 Ga0439458_0079320_149_733 194
1026 3300044658 Ga0466972_0000660 Ga0466972_0000660_1747_2331 194
1027 3300044658 Ga0466972_0004579 Ga0466972_0004579_4172_4756 194
1028 3300044658 Ga0466972_0109388 Ga0466972_0109388_28_612 194
1029 3300044683 Ga0466965_0099463 Ga0466965_0099463_66_650 194
1030 3300044684 Ga0466966_0000932 Ga0466966_0000932_16844_17428 194
1031 3300044684 Ga0466966_0102237 Ga0466966_0102237_714_1298 194
1032 3300044693 Ga0466961_0000488 Ga0466961_0000488_7825_8409 194
1033 3300044694 Ga0466963_0074240 Ga0466963_0074240_250_834 194
1034 3300044694 Ga0466963_0121993 Ga0466963_0121993_837_1421 194
1035 3300044706 Ga0466964_0352582 Ga0466964_0352582_47_643 194
1036 3300044706 Ga0466964_0411657 Ga0466964_0411657_103_687 194
1037 3300044735 Ga0466968_0002010 Ga0466968_0002010_661_1245 194
1038 3300044842 Ga0466957_0079290 Ga0466957_0079290_26_610 194
1039 3300044842 Ga0466957_0159408 Ga0466957_0159408_446_1030 194
1040 3300044842 Ga0466957_0407282 Ga0466957_0407282_236_820 194
1041 3300045976 Ga0466967_0031184 Ga0466967_0031184_1451_2035 194
1042 3300045976 Ga0466967_0115452 Ga0466967_0115452_1442_2026 194
1043 3300046452 Ga0495617_042503 Ga0495617_042503_71_655 194
1044 3300046452 Ga0495617_077806 Ga0495617_077806_95_679 194
1045 3300046454 Ga0495592_0002531 Ga0495592_0002531_888_1472 194
1046 3300046454 Ga0495592_0395432 Ga0495592_0395432_217_801 194
1047 3300046454 Ga0495592_0603616 Ga0495592_0603616_31_615 194
1048 3300046455 Ga0495603_0026173 Ga0495603_0026173_1606_2214 194
1049 3300046455 Ga0495603_0191071 Ga0495603_0191071_120_704 194
1050 3300046459 Ga0495629_0001007 Ga0495629_0001007_10292_10876 194
1051 3300046459 Ga0495629_0005795 Ga0495629_0005795_3939_4550 194
1052 3300046460 Ga0495638_0012856 Ga0495638_0012856_2486_3082 194
1053 3300046460 Ga0495638_0066840 Ga0495638_0066840_344_928 194
1054 3300046460 Ga0495638_0258927 Ga0495638_0258927_261_845 194
1055 3300046462 Ga0495651_0013292 Ga0495651_0013292_3843_4427 194
1056 3300046462 Ga0495651_0157426 Ga0495651_0157426_992_1576 194
1057 3300046462 Ga0495651_0162720 Ga0495651_0162720_680_1291 194
1058 3300046462 Ga0495651_0272952 Ga0495651_0272952_44_628 194
1059 3300046462 Ga0495651_0323804 Ga0495651_0323804_246_830 194
1060 3300046462 Ga0495651_0360313 Ga0495651_0360313_32_685 194
1061 3300046462 Ga0495651_0482053 Ga0495651_0482053_201_785 194
1062 3300046463 Ga0495653_0211587 Ga0495653_0211587_595_1179 194
1063 3300046472 Ga0495580_0029169 Ga0495580_0029169_486_1070 194
1064 3300046473 Ga0495582_0143590 Ga0495582_0143590_611_1195 194
1065 3300046475 Ga0495639_0036398 Ga0495639_0036398_871_1455 194
1066 3300046476 Ga0495662_0021975 Ga0495662_0021975_1836_2420 194
1067 3300046477 Ga0495664_0077067 Ga0495664_0077067_491_1075 194
1068 3300046477 Ga0495664_0116766 Ga0495664_0116766_537_1121 194
1069 3300046491 Ga0495584_0367079 Ga0495584_0367079_15_599 194
1070 3300046492 Ga0495585_0200184 Ga0495585_0200184_163_747 194
1071 3300046499 Ga0495594_0188928 Ga0495594_0188928_399_995 194
1072 3300046499 Ga0495594_0310518 Ga0495594_0310518_45_629 194
1073 3300046499 Ga0495594_0332067 Ga0495594_0332067_100_684 194
1074 3300046506 Ga0495583_0038104 Ga0495583_0038104_20_631 194
1075 3300046507 Ga0495606_0003007 Ga0495606_0003007_8354_9028 194
1076 3300046507 Ga0495606_0094118 Ga0495606_0094118_1093_1677 194
1077 3300046507 Ga0495606_0296470 Ga0495606_0296470_168_752 194
1078 3300046511 Ga0495608_0017019 Ga0495608_0017019_2185_2769 194
1079 3300046511 Ga0495608_0410528 Ga0495608_0410528_164_748 194
1080 3300046512 Ga0495610_0086587 Ga0495610_0086587_734_1318 194
1081 3300046512 Ga0495610_0116191 Ga0495610_0116191_46_630 194
1082 3300046513 Ga0495616_0254761 Ga0495616_0254761_17_601 194
1083 3300046514 Ga0495618_0007907 Ga0495618_0007907_916_1500 194
1084 3300046514 Ga0495618_0039412 Ga0495618_0039412_2245_2829 194
1085 3300046514 Ga0495618_0245563 Ga0495618_0245563_313_897 194
1086 3300046515 Ga0495620_0035877 Ga0495620_0035877_1085_1669 194
1087 3300046516 Ga0495628_0004580 Ga0495628_0004580_6947_7531 194
1088 3300046516 Ga0495628_0058989 Ga0495628_0058989_43_627 194
1089 3300046516 Ga0495628_0078743 Ga0495628_0078743_1162_1746 194
1090 3300046516 Ga0495628_0393307 Ga0495628_0393307_159_770 194
1091 3300046517 Ga0495630_0037229 Ga0495630_0037229_206_790 194
1092 3300046518 Ga0495631_0105640 Ga0495631_0105640_143_727 194
1093 3300046519 Ga0495632_0049316 Ga0495632_0049316_139_723 194
1094 3300046519 Ga0495632_0214786 Ga0495632_0214786_163_747 194
1095 3300046522 Ga0495643_0019680 Ga0495643_0019680_1912_2496 194
1096 3300046524 Ga0495648_0002612 Ga0495648_0002612_3129_3713 194
1097 3300046524 Ga0495648_0002918 Ga0495648_0002918_6516_7100 194
1098 3300046524 Ga0495648_0030845 Ga0495648_0030845_1539_2150 194
1099 3300046524 Ga0495648_0030855 Ga0495648_0030855_2406_2990 194
1100 3300046524 Ga0495648_0044101 Ga0495648_0044101_1622_2206 194
1101 3300046524 Ga0495648_0118640 Ga0495648_0118640_382_978 194
1102 3300046524 Ga0495648_0147774 Ga0495648_0147774_52_636 194
1103 3300046524 Ga0495648_0207891 Ga0495648_0207891_231_815 194
1104 3300046526 Ga0495666_0007696 Ga0495666_0007696_931_1515 194
1105 3300046528 Ga0495642_0245168 Ga0495642_0245168_160_744 194
1106 3300046529 Ga0495652_0003857 Ga0495652_0003857_6013_6597 194
1107 3300046529 Ga0495652_0032487 Ga0495652_0032487_1344_1955 194
1108 3300046529 Ga0495652_0075661 Ga0495652_0075661_1302_1886 194
1109 3300046529 Ga0495652_0249787 Ga0495652_0249787_690_1298 194
1110 3300046530 Ga0495654_0178950 Ga0495654_0178950_132_728 194
1111 3300046531 Ga0495665_0011427 Ga0495665_0011427_659_1243 194
1112 3300046533 Ga0495640_0060166 Ga0495640_0060166_1579_2163 194
1113 3300046533 Ga0495640_0116764 Ga0495640_0116764_413_997 194
1114 3300046533 Ga0495640_0270334 Ga0495640_0270334_457_1041 194
1115 3300046535 Ga0495586_0239141 Ga0495586_0239141_266_850 194
1116 3300046536 Ga0495587_0012126 Ga0495587_0012126_4661_5245 194
1117 3300046536 Ga0495587_0079430 Ga0495587_0079430_392_1045 194
1118 3300046536 Ga0495587_0181922 Ga0495587_0181922_93_677 194
1119 3300046539 Ga0495621_0022283 Ga0495621_0022283_951_1535 194
1120 3300046542 Ga0495597_0138775 Ga0495597_0138775_380_964 194
1121 3300046542 Ga0495597_0159820 Ga0495597_0159820_73_657 194
1122 3300046543 Ga0495645_0025567 Ga0495645_0025567_2638_3222 194
1123 3300046543 Ga0495645_0147373 Ga0495645_0147373_657_1241 194
1124 3300046543 Ga0495645_0258674 Ga0495645_0258674_276_860 194
1125 3300046543 Ga0495645_0277518 Ga0495645_0277518_18_602 194
1126 3300046543 Ga0495645_0335358 Ga0495645_0335358_69_653 194
1127 3300046557 Ga0495622_0101574 Ga0495622_0101574_337_921 194
1128 3300046558 Ga0495633_0127435 Ga0495633_0127435_281_865 194
1129 3300046559 Ga0495667_0004202 Ga0495667_0004202_5017_5601 194
1130 3300046559 Ga0495667_0036521 Ga0495667_0036521_763_1347 194
1131 3300046559 Ga0495667_0124599 Ga0495667_0124599_137_721 194
1132 3300046559 Ga0495667_0136614 Ga0495667_0136614_498_1082 194
1133 3300046615 Ga0495656_0096587 Ga0495656_0096587_679_1263 194
1134 3300046616 Ga0495668_0050083 Ga0495668_0050083_1463_2047 194
1135 3300046616 Ga0495668_0053210 Ga0495668_0053210_1387_1983 194
1136 3300046616 Ga0495668_0231398 Ga0495668_0231398_335_931 194
1137 3300046642 Ga0495634_0195081 Ga0495634_0195081_150_734 194
1138 3300046660 Ga0495625_0048156 Ga0495625_0048156_39_623 194
1139 3300046663 Ga0495635_0033710 Ga0495635_0033710_2481_3065 194
1140 3300046663 Ga0495635_0037786 Ga0495635_0037786_2185_2769 194
1141 3300046663 Ga0495635_0054592 Ga0495635_0054592_1395_1979 194
1142 3300046663 Ga0495635_0071655 Ga0495635_0071655_588_1172 194
1143 3300046664 Ga0495659_0014177 Ga0495659_0014177_1277_1861 194
1144 3300046664 Ga0495659_0203320 Ga0495659_0203320_190_774 194
1145 3300046665 Ga0495661_0181418 Ga0495661_0181418_507_1103 194
1146 3300046674 Ga0495588_0020981 Ga0495588_0020981_112_696 194
1147 3300046674 Ga0495588_0025233 Ga0495588_0025233_1130_1726 194
1148 3300046674 Ga0495588_0321470 Ga0495588_0321470_31_642 194
1149 3300046674 Ga0495588_0323936 Ga0495588_0323936_171_755 194
1150 3300046674 Ga0495588_0427306 Ga0495588_0427306_65_649 194
1151 3300046675 Ga0495657_0015740 Ga0495657_0015740_1659_2243 194
1152 3300046675 Ga0495657_0019424 Ga0495657_0019424_2133_2717 194
1153 3300046675 Ga0495657_0064717 Ga0495657_0064717_1719_2303 194
1154 3300046678 Ga0495599_0009174 Ga0495599_0009174_4802_5386 194
1155 3300046678 Ga0495599_0084427 Ga0495599_0084427_124_708 194
1156 3300046678 Ga0495599_0183929 Ga0495599_0183929_194_778 194
1157 3300046678 Ga0495599_0309661 Ga0495599_0309661_148_732 194
1158 3300046679 Ga0495623_0023186 Ga0495623_0023186_1061_1645 194
1159 3300046679 Ga0495623_0035017 Ga0495623_0035017_1933_2517 194
1160 3300046679 Ga0495623_0082545 Ga0495623_0082545_835_1419 194
1161 3300046679 Ga0495623_0115991 Ga0495623_0115991_472_1056 194
1162 3300046679 Ga0495623_0145015 Ga0495623_0145015_456_1040 194
1163 3300046679 Ga0495623_0159907 Ga0495623_0159907_664_1248 194
1164 3300046679 Ga0495623_0248044 Ga0495623_0248044_209_793 194
1165 3300046680 Ga0495646_0086315 Ga0495646_0086315_825_1409 194
1166 3300046680 Ga0495646_0097016 Ga0495646_0097016_782_1366 194
1167 3300046681 Ga0495647_0028695 Ga0495647_0028695_922_1506 194
1168 3300046683 Ga0495658_0109624 Ga0495658_0109624_206_790 194
1169 3300046684 Ga0495669_0281291 Ga0495669_0281291_122_706 194
1170 3300046689 Ga0495613_0218703 Ga0495613_0218703_661_1245 194
1171 3300046689 Ga0495613_0373042 Ga0495613_0373042_132_716 194
1172 3300046690 Ga0495624_0058579 Ga0495624_0058579_665_1249 194
1173 3300046690 Ga0495624_0379776 Ga0495624_0379776_187_771 194
1174 3300046691 Ga0495670_0020190 Ga0495670_0020190_1554_2150 194
1175 3300046692 Ga0495671_0147083 Ga0495671_0147083_10_606 194
1176 3300046694 Ga0495649_0040180 Ga0495649_0040180_920_1531 194
1177 3300046694 Ga0495649_0247943 Ga0495649_0247943_129_713 194
1178 3300046794 Ga0495589_0314519 Ga0495589_0314519_69_653 194
1179 3300046809 Ga0495600_0006120 Ga0495600_0006120_1127_1711 194
1180 3300046809 Ga0495600_0010630 Ga0495600_0010630_1870_2454 194
1181 3300046809 Ga0495600_0042515 Ga0495600_0042515_1805_2389 194
1182 3300046809 Ga0495600_0048711 Ga0495600_0048711_737_1348 194
1183 3300046810 Ga0495660_0080346 Ga0495660_0080346_1019_1615 194
1184 3300047315 Ga0495581_0062966 Ga0495581_0062966_1003_1587 194
1185 3300047315 Ga0495581_0226685 Ga0495581_0226685_455_1066 194
1186 3300047317 Ga0495604_0015795 Ga0495604_0015795_2177_2761 194
1187 3300047317 Ga0495604_0066179 Ga0495604_0066179_312_896 194
1188 3300047317 Ga0495604_0096882 Ga0495604_0096882_196_780 194
1189 3300047317 Ga0495604_0200105 Ga0495604_0200105_478_1062 194
1190 3300047319 Ga0495674_0027042 Ga0495674_0027042_3545_4129 194
1191 3300047319 Ga0495674_0039883 Ga0495674_0039883_796_1380 194
1192 3300047319 Ga0495674_0067676 Ga0495674_0067676_144_728 194
1193 3300047319 Ga0495674_0123813 Ga0495674_0123813_380_964 194
1194 3300047319 Ga0495674_0298004 Ga0495674_0298004_44_697 194
1195 3300047320 Ga0495672_0008790 Ga0495672_0008790_3439_4023 194
1196 3300047320 Ga0495672_0011329 Ga0495672_0011329_1408_1992 194
1197 3300047320 Ga0495672_0058411 Ga0495672_0058411_1450_2034 194
1198 3300047320 Ga0495672_0128851 Ga0495672_0128851_88_672 194
1199 3300047320 Ga0495672_0131965 Ga0495672_0131965_218_802 194
1200 3300047321 Ga0495676_0051519 Ga0495676_0051519_567_1178 194
1201 3300047321 Ga0495676_0312874 Ga0495676_0312874_211_795 194
1202 3300047321 Ga0495676_0730243 Ga0495676_0730243_11_595 194
1203 3300047322 Ga0495680_0000688 Ga0495680_0000688_26321_26905 194
1204 3300047322 Ga0495680_0004171 Ga0495680_0004171_1257_1841 194
1205 3300047322 Ga0495680_0072956 Ga0495680_0072956_1571_2155 194
1206 3300047443 Ga0495687_015006 Ga0495687_015006_1211_1795 194
1207 3300047444 Ga0495675_0006128 Ga0495675_0006128_763_1347 194
1208 3300047444 Ga0495675_0061318 Ga0495675_0061318_1225_1809 194
1209 3300047444 Ga0495675_0361093 Ga0495675_0361093_88_672 194
1210 3300047445 Ga0495677_0044745 Ga0495677_0044745_687_1271 194
1211 3300047471 Ga0495684_0000633 Ga0495684_0000633_22454_23038 194
1212 3300047471 Ga0495684_0020139 Ga0495684_0020139_3599_4183 194
1213 3300047471 Ga0495684_0145984 Ga0495684_0145984_922_1506 194
1214 3300047471 Ga0495684_0212357 Ga0495684_0212357_526_1110 194
1215 3300047673 Ga0495593_0002322 Ga0495593_0002322_10826_11410 194
1216 3300047673 Ga0495593_0028926 Ga0495593_0028926_830_1414 194
1217 3300047673 Ga0495593_0149102 Ga0495593_0149102_229_840 194
1218 3300048088 Ga0495602_0004737 Ga0495602_0004737_296_880 194
1219 3300048088 Ga0495602_0029828 Ga0495602_0029828_2133_2717 194
1220 3300048088 Ga0495602_0204155 Ga0495602_0204155_46_630 194
1221 3300048088 Ga0495602_0234176 Ga0495602_0234176_492_1076 194
1222 3300048088 Ga0495602_0357159 Ga0495602_0357159_41_625 194
1223 3300048088 Ga0495602_0369283 Ga0495602_0369283_375_959 194
1224 3300048091 Ga0495626_0120996 Ga0495626_0120996_10_606 194
1225 3300048903 Ga0496100_0098944 Ga0496100_0098944_141_725 194
1226 3300048903 Ga0496100_0112296 Ga0496100_0112296_1229_1813 194
1227 3300048903 Ga0496100_0570969 Ga0496100_0570969_137_721 194
1228 3300048903 Ga0496100_0665719 Ga0496100_0665719_44_628 194
1229 3300048904 Ga0496101_0023934 Ga0496101_0023934_1299_1901 194
1230 3300048904 Ga0496101_0444885 Ga0496101_0444885_173_757 194
1231 3300048904 Ga0496101_0780065 Ga0496101_0780065_23_607 194
1232 3300048905 Ga0496102_0013632 Ga0496102_0013632_3822_4424 194
1233 3300048905 Ga0496102_0051025 Ga0496102_0051025_631_1215 194
1234 3300048905 Ga0496102_0097921 Ga0496102_0097921_1736_2323 194
1235 3300048905 Ga0496102_0106172 Ga0496102_0106172_830_1414 194
1236 3300048905 Ga0496102_0132304 Ga0496102_0132304_923_1507 194
1237 3300048905 Ga0496102_0506723 Ga0496102_0506723_362_946 194
1238 3300048905 Ga0496102_0706217 Ga0496102_0706217_216_857 194
1239 3300048905 Ga0496102_0807003 Ga0496102_0807003_64_660 194
1240 3300048906 Ga0496103_0194972 Ga0496103_0194972_106_690 194
1241 3300048907 Ga0496104_0011141 Ga0496104_0011141_4215_4817 194
1242 3300048907 Ga0496104_0049613 Ga0496104_0049613_1536_2123 194
1243 3300048907 Ga0496104_0064542 Ga0496104_0064542_1364_1948 194
1244 3300048907 Ga0496104_0097842 Ga0496104_0097842_1149_1790 194
1245 3300048907 Ga0496104_0126823 Ga0496104_0126823_1496_2080 194
1246 3300048907 Ga0496104_0131997 Ga0496104_0131997_1654_2238 194
1247 3300048908 Ga0496105_0003203 Ga0496105_0003203_1428_2012 194
1248 3300048908 Ga0496105_0008366 Ga0496105_0008366_4381_4983 194
1249 3300048908 Ga0496105_0016607 Ga0496105_0016607_4538_5125 194
1250 3300048908 Ga0496105_0088755 Ga0496105_0088755_730_1314 194
1251 3300048908 Ga0496105_0305289 Ga0496105_0305289_569_1153 194
1252 3300048908 Ga0496105_0377082 Ga0496105_0377082_230_814 194
1253 3300048909 Ga0496106_0000546 Ga0496106_0000546_7991_8632 194
1254 3300048909 Ga0496106_0005548 Ga0496106_0005548_7049_7648 194
1255 3300048909 Ga0496106_0010390 Ga0496106_0010390_1329_1931 194
1256 3300048909 Ga0496106_0040671 Ga0496106_0040671_2729_3316 194
1257 3300048909 Ga0496106_0165675 Ga0496106_0165675_926_1510 194
1258 3300048909 Ga0496106_0566529 Ga0496106_0566529_182_766 194
1259 3300048910 Ga0496107_0002937 Ga0496107_0002937_3828_4469 194
1260 3300048910 Ga0496107_0004305 Ga0496107_0004305_8810_9412 194
1261 3300048910 Ga0496107_0017612 Ga0496107_0017612_1835_2419 194
1262 3300048910 Ga0496107_0057818 Ga0496107_0057818_1247_1831 194
1263 3300048910 Ga0496107_0094496 Ga0496107_0094496_789_1376 194
1264 3300048910 Ga0496107_0130263 Ga0496107_0130263_393_977 194
1265 3300048910 Ga0496107_0258456 Ga0496107_0258456_526_1110 194
1266 3300048911 Ga0496108_0001440 Ga0496108_0001440_16507_17148 194
1267 3300048911 Ga0496108_0501445 Ga0496108_0501445_302_886 194
1268 3300048912 Ga0496109_0001610 Ga0496109_0001610_16447_17088 194
1269 3300048912 Ga0496109_0015876 Ga0496109_0015876_3532_4134 194
1270 3300048912 Ga0496109_0081792 Ga0496109_0081792_1257_1841 194
1271 3300048912 Ga0496109_0103673 Ga0496109_0103673_1472_2056 194
1272 3300048912 Ga0496109_0131305 Ga0496109_0131305_119_703 194
1273 3300048912 Ga0496109_0292592 Ga0496109_0292592_715_1299 194
1274 3300048913 Ga0496110_0012816 Ga0496110_0012816_1686_2327 194
1275 3300048913 Ga0496110_0017787 Ga0496110_0017787_884_1471 194
1276 3300048913 Ga0496110_0050143 Ga0496110_0050143_1265_1867 194
1277 3300048913 Ga0496110_0088331 Ga0496110_0088331_1232_1816 194
1278 3300048913 Ga0496110_0119358 Ga0496110_0119358_660_1244 194
1279 3300048913 Ga0496110_0856248 Ga0496110_0856248_153_737 194
1280 3300048913 Ga0496110_1123985 Ga0496110_1123985_76_660 194
1281 3300048914 Ga0496111_0021964 Ga0496111_0021964_3785_4387 194
1282 3300048914 Ga0496111_0040806 Ga0496111_0040806_1065_1649 194
1283 3300048914 Ga0496111_0141440 Ga0496111_0141440_90_674 194
1284 3300048914 Ga0496111_0369969 Ga0496111_0369969_46_687 194
1285 3300048914 Ga0496111_0420705 Ga0496111_0420705_268_852 194
1286 3300048915 Ga0496112_0000079 Ga0496112_0000079_18270_18893 194
1287 3300048915 Ga0496112_0007905 Ga0496112_0007905_7114_7755 194
1288 3300048915 Ga0496112_0009200 Ga0496112_0009200_5951_6535 194
1289 3300048915 Ga0496112_0028997 Ga0496112_0028997_1013_1615 194
1290 3300048915 Ga0496112_0032003 Ga0496112_0032003_956_1540 194
1291 3300048915 Ga0496112_0033853 Ga0496112_0033853_203_790 194
1292 3300048915 Ga0496112_0046075 Ga0496112_0046075_3619_4203 194
1293 3300048915 Ga0496112_0069563 Ga0496112_0069563_1835_2419 194
1294 3300048915 Ga0496112_0085641 Ga0496112_0085641_1153_1737 194
1295 3300048916 Ga0496113_0018743 Ga0496113_0018743_346_948 194
1296 3300048916 Ga0496113_0034316 Ga0496113_0034316_1566_2207 194
1297 3300048916 Ga0496113_0070124 Ga0496113_0070124_1258_1842 194
1298 3300048916 Ga0496113_0364465 Ga0496113_0364465_400_984 194
1299 3300048917 Ga0496114_0019840 Ga0496114_0019840_1445_2047 194
1300 3300048917 Ga0496114_0026302 Ga0496114_0026302_2420_3004 194
1301 3300048917 Ga0496114_0239484 Ga0496114_0239484_621_1205 194
1302 3300048917 Ga0496114_0255707 Ga0496114_0255707_830_1414 194
1303 3300048917 Ga0496114_0383421 Ga0496114_0383421_407_1048 194
1304 3300048917 Ga0496114_0522738 Ga0496114_0522738_341_925 194
1305 3300048917 Ga0496114_0787329 Ga0496114_0787329_179_763 194
1306 3300048918 Ga0496115_0030579 Ga0496115_0030579_2040_2642 194
1307 3300048918 Ga0496115_0034088 Ga0496115_0034088_1769_2353 194
1308 3300048918 Ga0496115_0039040 Ga0496115_0039040_720_1304 194
1309 3300048918 Ga0496115_0050911 Ga0496115_0050911_2652_3236 194
1310 3300048918 Ga0496115_0056445 Ga0496115_0056445_154_738 194
1311 3300048918 Ga0496115_0121603 Ga0496115_0121603_1539_2123 194
1312 3300048918 Ga0496115_0216268 Ga0496115_0216268_683_1267 194
1313 3300048918 Ga0496115_0300131 Ga0496115_0300131_712_1296 194
1314 3300048918 Ga0496115_0436859 Ga0496115_0436859_413_997 194
1315 3300048918 Ga0496115_0544837 Ga0496115_0544837_95_682 194
1316 3300048919 Ga0496116_0119249 Ga0496116_0119249_203_787 194
1317 3300048919 Ga0496116_0132314 Ga0496116_0132314_470_1066 194
1318 3300048920 Ga0496117_0041834 Ga0496117_0041834_268_867 194
1319 3300048920 Ga0496117_0086770 Ga0496117_0086770_1224_1808 194
1320 3300048920 Ga0496117_0103769 Ga0496117_0103769_1124_1708 194
1321 3300048920 Ga0496117_0198089 Ga0496117_0198089_25_609 194
1322 3300048920 Ga0496117_0229638 Ga0496117_0229638_260_844 194
1323 3300048921 Ga0496118_0003967 Ga0496118_0003967_6493_7092 194
1324 3300048921 Ga0496118_0046546 Ga0496118_0046546_1747_2331 194
1325 3300048921 Ga0496118_0070050 Ga0496118_0070050_1774_2358 194
1326 3300048921 Ga0496118_0072285 Ga0496118_0072285_1116_1712 194
1327 3300048922 Ga0496119_0020659 Ga0496119_0020659_1883_2467 194
1328 3300048922 Ga0496119_0051144 Ga0496119_0051144_434_1033 194
1329 3300048922 Ga0496119_0096053 Ga0496119_0096053_125_709 194
1330 3300048922 Ga0496119_0130553 Ga0496119_0130553_517_1101 194
1331 3300048923 Ga0496120_0008075 Ga0496120_0008075_3610_4194 194
1332 3300048923 Ga0496120_0017144 Ga0496120_0017144_1469_2065 194
1333 3300048924 Ga0496121_0000495 Ga0496121_0000495_2282_2866 194
1334 3300048924 Ga0496121_0000576 Ga0496121_0000576_22934_23533 194
1335 3300048924 Ga0496121_0001789 Ga0496121_0001789_15658_16308 194
1336 3300048924 Ga0496121_0003477 Ga0496121_0003477_20148_20732 194
1337 3300048924 Ga0496121_0005072 Ga0496121_0005072_6268_6864 194
1338 3300048924 Ga0496121_0023876 Ga0496121_0023876_3328_3912 194
1339 3300048924 Ga0496121_0024511 Ga0496121_0024511_3837_4421 194
1340 3300048924 Ga0496121_0084412 Ga0496121_0084412_1614_2198 194
1341 3300048924 Ga0496121_0085565 Ga0496121_0085565_1448_2032 194
1342 3300048924 Ga0496121_0177005 Ga0496121_0177005_895_1479 194
1343 3300048924 Ga0496121_0185412 Ga0496121_0185412_52_636 194
1344 3300048924 Ga0496121_0320823 Ga0496121_0320823_233_832 194
1345 3300048924 Ga0496121_0383172 Ga0496121_0383172_128_712 194
1346 3300048925 Ga0496122_0126372 Ga0496122_0126372_705_1289 194
1347 3300048926 Ga0496123_0023903 Ga0496123_0023903_851_1447 194
1348 3300048926 Ga0496123_0045334 Ga0496123_0045334_732_1316 194
1349 3300048927 Ga0496124_0055299 Ga0496124_0055299_2146_2745 194
1350 3300048927 Ga0496124_0112519 Ga0496124_0112519_708_1292 194
1351 3300048927 Ga0496124_0125827 Ga0496124_0125827_1017_1601 194
1352 3300048927 Ga0496124_0351760 Ga0496124_0351760_188_772 194
1353 3300048928 Ga0496125_0003570 Ga0496125_0003570_16500_17096 194
1354 3300048928 Ga0496125_0034194 Ga0496125_0034194_2136_2735 194
1355 3300048928 Ga0496125_0037412 Ga0496125_0037412_214_798 194
1356 3300048928 Ga0496125_0042128 Ga0496125_0042128_1864_2448 194
1357 3300048928 Ga0496125_0045546 Ga0496125_0045546_1441_2052 194
1358 3300048928 Ga0496125_0060992 Ga0496125_0060992_1169_1753 194
1359 3300048928 Ga0496125_0076578 Ga0496125_0076578_1825_2409 194
1360 3300048928 Ga0496125_0167892 Ga0496125_0167892_233_817 194
1361 3300048928 Ga0496125_0318590 Ga0496125_0318590_61_645 194
1362 3300048929 Ga0496126_0002315 Ga0496126_0002315_22739_23323 194
1363 3300048929 Ga0496126_0006641 Ga0496126_0006641_866_1450 194
1364 3300048929 Ga0496126_0007687 Ga0496126_0007687_10049_10633 194
1365 3300048929 Ga0496126_0008516 Ga0496126_0008516_6207_6806 194
1366 3300048929 Ga0496126_0030050 Ga0496126_0030050_4286_4870 194
1367 3300048929 Ga0496126_0041989 Ga0496126_0041989_3328_3912 194
1368 3300048929 Ga0496126_0061749 Ga0496126_0061749_2676_3260 194
1369 3300048929 Ga0496126_0078368 Ga0496126_0078368_1380_1964 194
1370 3300048929 Ga0496126_0094451 Ga0496126_0094451_154_738 194
1371 3300048929 Ga0496126_0104047 Ga0496126_0104047_739_1323 194
1372 3300048929 Ga0496126_0112266 Ga0496126_0112266_732_1316 194
1373 3300048929 Ga0496126_0138804 Ga0496126_0138804_35_619 194
1374 3300048929 Ga0496126_0141356 Ga0496126_0141356_130_714 194
1375 3300048929 Ga0496126_0142335 Ga0496126_0142335_443_1027 194
1376 3300048929 Ga0496126_0151861 Ga0496126_0151861_944_1528 194
1377 3300048929 Ga0496126_0175123 Ga0496126_0175123_512_1096 194
1378 3300048929 Ga0496126_0177784 Ga0496126_0177784_1023_1607 194
1379 3300048929 Ga0496126_0229460 Ga0496126_0229460_926_1510 194
1380 3300048929 Ga0496126_0292981 Ga0496126_0292981_750_1334 194
1381 3300048929 Ga0496126_0452266 Ga0496126_0452266_185_769 194
1382 3300048929 Ga0496126_0456066 Ga0496126_0456066_317_901 194
1383 3300048929 Ga0496126_0526203 Ga0496126_0526203_126_722 194
1384 3300049568 Ga0501031_0004261 Ga0501031_0004261_2991_3575 194
1385 3300049568 Ga0501031_0150707 Ga0501031_0150707_833_1417 194
1386 3300049569 Ga0501032_0005554 Ga0501032_0005554_6093_6677 194
1387 3300049569 Ga0501032_0138626 Ga0501032_0138626_1005_1589 194
1388 3300049569 Ga0501032_0244123 Ga0501032_0244123_443_1027 194
1389 3300049569 Ga0501032_0313647 Ga0501032_0313647_257_841 194
1390 3300049570 Ga0501033_0000256 Ga0501033_0000256_10178_10762 194
1391 3300049570 Ga0501033_0136088 Ga0501033_0136088_239_823 194
1392 3300049571 Ga0501034_0000175 Ga0501034_0000175_106840_107424 194
1393 3300049571 Ga0501034_0354427 Ga0501034_0354427_410_994 194
1394 3300049571 Ga0501034_0713679 Ga0501034_0713679_149_733 194
1395 3300049572 Ga0501036_0000032 Ga0501036_0000032_28356_28940 194
1396 3300049572 Ga0501036_0656210 Ga0501036_0656210_168_752 194
1397 3300049573 Ga0501037_0001755 Ga0501037_0001755_4997_5581 194
1398 3300049573 Ga0501037_0092867 Ga0501037_0092867_710_1294 194
1399 3300049573 Ga0501037_0147015 Ga0501037_0147015_347_931 194
1400 3300049574 Ga0501038_0000114 Ga0501038_0000114_25752_26336 194
1401 3300049574 Ga0501038_0025774 Ga0501038_0025774_2853_3437 194
1402 3300049574 Ga0501038_0110509 Ga0501038_0110509_1261_1845 194
1403 3300049575 Ga0501039_0001954 Ga0501039_0001954_5007_5591 194
1404 3300049575 Ga0501039_0487062 Ga0501039_0487062_363_947 194
1405 3300049576 Ga0501040_0025761 Ga0501040_0025761_2364_2948 194
1406 3300049577 Ga0501041_0541366 Ga0501041_0541366_16_600 194
1407 3300049578 Ga0501042_0251438 Ga0501042_0251438_249_833 194
1408 3300049579 Ga0501043_0002389 Ga0501043_0002389_10158_10742 194
1409 3300049580 Ga0501046_0004110 Ga0501046_0004110_10178_10762 194
1410 3300049580 Ga0501046_0188243 Ga0501046_0188243_305_889 194
1411 3300049581 Ga0501047_0000085 Ga0501047_0000085_104139_104723 194
1412 3300049581 Ga0501047_0116791 Ga0501047_0116791_138_722 194
1413 3300049581 Ga0501047_0178053 Ga0501047_0178053_1261_1845 194
1414 3300049581 Ga0501047_0179361 Ga0501047_0179361_202_786 194
1415 3300049581 Ga0501047_0196472 Ga0501047_0196472_200_784 194
1416 3300049582 Ga0501048_0001859 Ga0501048_0001859_10155_10739 194
1417 3300049582 Ga0501048_0039196 Ga0501048_0039196_1261_1845 194
1418 3300049582 Ga0501048_0185910 Ga0501048_0185910_661_1245 194
1419 3300049583 Ga0501067_0000096 Ga0501067_0000096_40000_40584 194
1420 3300049583 Ga0501067_0007715 Ga0501067_0007715_5356_5940 194
1421 3300049584 Ga0501068_0000220 Ga0501068_0000220_10274_10858 194
1422 3300049584 Ga0501068_0002790 Ga0501068_0002790_8661_9245 194
1423 3300049585 Ga0501069_0003655 Ga0501069_0003655_1028_1612 194
1424 3300049585 Ga0501069_0040056 Ga0501069_0040056_1540_2124 194
1425 3300049585 Ga0501069_0161040 Ga0501069_0161040_642_1226 194
1426 3300049586 Ga0501070_0005720 Ga0501070_0005720_8246_8830 194
1427 3300049586 Ga0501070_0262510 Ga0501070_0262510_23_607 194
1428 3300049586 Ga0501070_0264154 Ga0501070_0264154_572_1156 194
1429 3300049586 Ga0501070_0474754 Ga0501070_0474754_74_658 194
1430 3300049587 Ga0501071_0076396 Ga0501071_0076396_147_731 194
1431 3300049587 Ga0501071_0092212 Ga0501071_0092212_1608_2192 194
1432 3300049588 Ga0501072_0003496 Ga0501072_0003496_4978_5562 194
1433 3300049589 Ga0501073_0000026 Ga0501073_0000026_107842_108426 194
1434 3300049589 Ga0501073_0193431 Ga0501073_0193431_573_1157 194
1435 3300049590 Ga0501074_0000878 Ga0501074_0000878_6442_7026 194
1436 3300049590 Ga0501074_0065877 Ga0501074_0065877_572_1156 194
1437 3300049592 Ga0501076_0188248 Ga0501076_0188248_769_1353 194
1438 3300049593 Ga0501077_0225687 Ga0501077_0225687_280_864 194
1439 3300049741 Ga0501079_0007708 Ga0501079_0007708_2525_3109 194
1440 3300049742 Ga0501080_0005240 Ga0501080_0005240_2273_2857 194
1441 3300049742 Ga0501080_0333878 Ga0501080_0333878_357_941 194
1442 3300049743 Ga0501081_0167660 Ga0501081_0167660_305_889 194
1443 3300049744 Ga0501083_0012775 Ga0501083_0012775_395_979 194
1444 3300049744 Ga0501083_0378157 Ga0501083_0378157_57_641 194
1445 3300049822 Ga0501035_0003195 Ga0501035_0003195_4952_5536 194
1446 3300049822 Ga0501035_0027489 Ga0501035_0027489_448_1032 194
1447 3300049823 Ga0501044_0000061 Ga0501044_0000061_66626_67210 194
1448 3300049823 Ga0501044_0111623 Ga0501044_0111623_1858_2442 194
1449 3300049823 Ga0501044_0143992 Ga0501044_0143992_1232_1840 194
1450 3300049823 Ga0501044_0357216 Ga0501044_0357216_621_1205 194
1451 3300049823 Ga0501044_0381715 Ga0501044_0381715_168_752 194
1452 3300049823 Ga0501044_0435807 Ga0501044_0435807_583_1167 194
1453 3300049823 Ga0501044_0601617 Ga0501044_0601617_149_733 194
1454 3300049824 Ga0501045_0090535 Ga0501045_0090535_1539_2123 194
1455 3300049824 Ga0501045_0387975 Ga0501045_0387975_317_901 194
1456 3300050490 nmdc:mga03n38_23321_c1 nmdc:mga03n38_23321_c1_1539_2123 194
1457 3300050490 nmdc:mga03n38_3983_c1 nmdc:mga03n38_3983_c1_1367_1951 194
1458 3300050491 nmdc:mga00v17_107230_c1 nmdc:mga00v17_107230_c1_729_1313 194
1459 3300050492 nmdc:mga0yw44_156432_c1 nmdc:mga0yw44_156432_c1_789_1373 194
1460 3300050492 nmdc:mga0yw44_163960_c1 nmdc:mga0yw44_163960_c1_542_1126 194
1461 3300050492 nmdc:mga0yw44_35589_c1 nmdc:mga0yw44_35589_c1_885_1469 194
1462 3300050492 nmdc:mga0yw44_384637_c1 nmdc:mga0yw44_384637_c1_249_833 194
1463 3300050492 nmdc:mga0yw44_385394_c1 nmdc:mga0yw44_385394_c1_299_883 194
1464 3300050492 nmdc:mga0yw44_55380_c1 nmdc:mga0yw44_55380_c1_985_1569 194
1465 3300050492 nmdc:mga0yw44_58163_c1 nmdc:mga0yw44_58163_c1_1251_1835 194
1466 3300050493 nmdc:mga0k408_102575_c1 nmdc:mga0k408_102575_c1_339_923 194
1467 3300050493 nmdc:mga0k408_103595_c1 nmdc:mga0k408_103595_c1_1042_1626 194
1468 3300050494 nmdc:mga06z11_109098_c1 nmdc:mga06z11_109098_c1_697_1281 194
1469 3300050494 nmdc:mga06z11_30063_c1 nmdc:mga06z11_30063_c1_1834_2418 194
1470 3300050494 nmdc:mga06z11_526816_c1 nmdc:mga06z11_526816_c1_53_637 194
1471 3300050495 nmdc:mga04h51_23345_c1 nmdc:mga04h51_23345_c1_885_1469 194
1472 3300050495 nmdc:mga04h51_27163_c1 nmdc:mga04h51_27163_c1_785_1369 194
1473 3300050495 nmdc:mga04h51_89026_c1 nmdc:mga04h51_89026_c1_266_850 194
1474 3300050496 nmdc:mga07m45_145517_c1 nmdc:mga07m45_145517_c1_406_990 194
1475 3300050496 nmdc:mga07m45_224211_c1 nmdc:mga07m45_224211_c1_329_913 194
1476 3300050496 nmdc:mga07m45_243653_c1 nmdc:mga07m45_243653_c1_142_726 194
1477 3300050496 nmdc:mga07m45_41716_c1 nmdc:mga07m45_41716_c1_906_1490 194
1478 3300050496 nmdc:mga07m45_73605_c1 nmdc:mga07m45_73605_c1_43_627 194
1479 3300050496 nmdc:mga07m45_7361_c2 nmdc:mga07m45_7361_c2_1661_2245 194
1480 3300050507 nmdc:mga05p37_704993_c1 nmdc:mga05p37_704993_c1_140_724 194
1481 3300050511 nmdc:mga08y16_904525_c1 nmdc:mga08y16_904525_c1_44_628 194
1482 3300050512 nmdc:mga0n895_337869_c1 nmdc:mga0n895_337869_c1_197_781 194
1483 3300050512 nmdc:mga0n895_581500_c1 nmdc:mga0n895_581500_c1_486_1070 194
1484 3300050512 nmdc:mga0n895_804835_c1 nmdc:mga0n895_804835_c1_203_787 194
1485 3300050513 nmdc:mga0rr50_83404_c1 nmdc:mga0rr50_83404_c1_1160_1744 194
1486 3300050514 nmdc:mga08x19_40402_c2 nmdc:mga08x19_40402_c2_1575_2159 194
1487 3300050516 nmdc:mga0sz30_6811_c1 nmdc:mga0sz30_6811_c1_1322_1906 194
1488 3300050516 nmdc:mga0sz30_71801_c2 nmdc:mga0sz30_71801_c2_117_713 194
1489 3300053077 Ga0495601_0069967 Ga0495601_0069967_707_1291 194
1490 3300053077 Ga0495601_0200514 Ga0495601_0200514_55_639 194
1491 3300053077 Ga0495601_0371688 Ga0495601_0371688_245_829 194
1492 3300053077 Ga0495601_0463683 Ga0495601_0463683_209_793 194
1493 3300053078 Ga0495612_0002860 Ga0495612_0002860_4626_5210 194
1494 3300053078 Ga0495612_0065484 Ga0495612_0065484_438_1022 194
1495 3300053079 Ga0500610_0043837 Ga0500610_0043837_959_1543 194
1496 3300053080 Ga0500635_0002252 Ga0500635_0002252_2885_3493 194
1497 3300053083 Ga0495655_0004246 Ga0495655_0004246_1158_1742 194
1498 3300053084 Ga0495595_0004246 Ga0495595_0004246_4416_5000 194
1499 3300053084 Ga0495595_0028104 Ga0495595_0028104_759_1343 194
1500 3300053084 Ga0495595_0314909 Ga0495595_0314909_174_758 194
1501 3300053085 Ga0495619_0000182 Ga0495619_0000182_25909_26493 194
1502 3300053085 Ga0495619_0012568 Ga0495619_0012568_2794_3378 194
1503 3300053085 Ga0495619_0046963 Ga0495619_0046963_807_1391 194
1504 3300053086 Ga0500578_0036475 Ga0500578_0036475_1672_2256 194
1505 3300053086 Ga0500578_0069467 Ga0500578_0069467_707_1291 194
1506 3300053087 Ga0500643_000025 Ga0500643_000025_246060_246644 194
1507 3300053087 Ga0500643_047421 Ga0500643_047421_377_973 194
1508 3300053091 Ga0500647_0108689 Ga0500647_0108689_201_785 194
1509 3300053091 Ga0500647_0186634 Ga0500647_0186634_74_658 194
1510 3300053092 Ga0500583_0041181 Ga0500583_0041181_90_674 194
1511 3300053092 Ga0500583_0098211 Ga0500583_0098211_653_1237 194
1512 3300053093 Ga0500651_0047257 Ga0500651_0047257_29_625 194
1513 3300053093 Ga0500651_0076618 Ga0500651_0076618_1051_1635 194
1514 3300053093 Ga0500651_0128774 Ga0500651_0128774_39_623 194
1515 3300053093 Ga0500651_0256279 Ga0500651_0256279_27_611 194
1516 3300053094 Ga0500566_0000038 Ga0500566_0000038_64511_65095 194
1517 3300053094 Ga0500566_0000184 Ga0500566_0000184_25783_26379 194
1518 3300053094 Ga0500566_0020577 Ga0500566_0020577_1471_2055 194
1519 3300053094 Ga0500566_0215292 Ga0500566_0215292_231_815 194
1520 3300053095 Ga0500640_000523 Ga0500640_000523_2149_2733 194
1521 3300053096 Ga0500641_0017528 Ga0500641_0017528_56_679 194
1522 3300053096 Ga0500641_0076312 Ga0500641_0076312_556_1152 194
1523 3300053096 Ga0500641_0264403 Ga0500641_0264403_55_639 194
1524 3300053097 Ga0500648_209530 Ga0500648_209530_50_634 194
1525 3300053098 Ga0500650_0154791 Ga0500650_0154791_255_851 194
1526 3300053102 Ga0500554_060816 Ga0500554_060816_552_1160 194
1527 3300053102 Ga0500554_061704 Ga0500554_061704_242_826 194
1528 3300053104 Ga0500556_0000002 Ga0500556_0000002_540252_540848 194
1529 3300053104 Ga0500556_0017722 Ga0500556_0017722_993_1577 194
1530 3300053105 Ga0500557_000001 Ga0500557_000001_3774_4358 194
1531 3300053108 Ga0500562_027472 Ga0500562_027472_533_1117 194
1532 3300053109 Ga0500569_000655 Ga0500569_000655_3719_4303 194
1533 3300053109 Ga0500569_022048 Ga0500569_022048_784_1380 194
1534 3300053109 Ga0500569_089516 Ga0500569_089516_66_650 194
1535 3300053111 Ga0500572_000010 Ga0500572_000010_2313_2897 194
1536 3300053111 Ga0500572_000333 Ga0500572_000333_12130_12726 194
1537 3300053111 Ga0500572_004350 Ga0500572_004350_2454_3038 194
1538 3300053114 Ga0500582_155590 Ga0500582_155590_83_667 194
1539 3300053115 Ga0500591_075170 Ga0500591_075170_431_1015 194
1540 3300053116 Ga0500592_002487 Ga0500592_002487_798_1394 194
1541 3300053116 Ga0500592_015695 Ga0500592_015695_77_661 194
1542 3300053119 Ga0500595_000143 Ga0500595_000143_11381_11965 194
1543 3300053119 Ga0500595_004985 Ga0500595_004985_4668_5252 194
1544 3300053119 Ga0500595_005633 Ga0500595_005633_509_1093 194
1545 3300053119 Ga0500595_007784 Ga0500595_007784_856_1440 194
1546 3300053119 Ga0500595_008041 Ga0500595_008041_2715_3299 194
1547 3300053119 Ga0500595_012396 Ga0500595_012396_479_1063 194
1548 3300053119 Ga0500595_052155 Ga0500595_052155_553_1137 194
1549 3300053121 Ga0500607_045996 Ga0500607_045996_212_796 194
1550 3300053121 Ga0500607_097384 Ga0500607_097384_362_958 194
1551 3300053122 Ga0500608_000393 Ga0500608_000393_4292_4888 194
1552 3300053123 Ga0500614_012695 Ga0500614_012695_776_1360 194
1553 3300053130 Ga0500642_0000058 Ga0500642_0000058_23537_24133 194
1554 3300053130 Ga0500642_0000703 Ga0500642_0000703_1870_2454 194
1555 3300053131 Ga0500652_000711 Ga0500652_000711_7315_7911 194
1556 3300053131 Ga0500652_140659 Ga0500652_140659_32_616 194
1557 3300053133 Ga0500655_022180 Ga0500655_022180_562_1146 194
1558 3300053134 Ga0500658_0080186 Ga0500658_0080186_112_708 194
1559 3300053136 Ga0500559_0000366 Ga0500559_0000366_15235_15831 194
1560 3300053136 Ga0500559_0001403 Ga0500559_0001403_6684_7280 194
1561 3300053136 Ga0500559_0004662 Ga0500559_0004662_2700_3284 194
1562 3300053136 Ga0500559_0007008 Ga0500559_0007008_4236_4820 194
1563 3300053136 Ga0500559_0029053 Ga0500559_0029053_687_1271 194
1564 3300053136 Ga0500559_0157801 Ga0500559_0157801_442_1026 194
1565 3300053139 Ga0500568_0000603 Ga0500568_0000603_23970_24566 194
1566 3300053139 Ga0500568_0007229 Ga0500568_0007229_1201_1785 194
1567 3300053139 Ga0500568_0024624 Ga0500568_0024624_751_1335 194
1568 3300053139 Ga0500568_0071299 Ga0500568_0071299_554_1138 194
1569 3300053139 Ga0500568_0109911 Ga0500568_0109911_265_849 194
1570 3300053140 Ga0500573_0003825 Ga0500573_0003825_6034_6618 194
1571 3300053142 Ga0500577_0000616 Ga0500577_0000616_6324_6983 194
1572 3300053145 Ga0500586_036153 Ga0500586_036153_962_1558 194
1573 3300053146 Ga0500588_0151055 Ga0500588_0151055_149_733 194
1574 3300053146 Ga0500588_0158355 Ga0500588_0158355_122_706 194
1575 3300053147 Ga0500589_194989 Ga0500589_194989_76_660 194
1576 3300053148 Ga0500590_114939 Ga0500590_114939_496_1080 194
1577 3300053150 Ga0500603_000664 Ga0500603_000664_2894_3502 194
1578 3300053150 Ga0500603_009507 Ga0500603_009507_38_622 194
1579 3300053150 Ga0500603_054625 Ga0500603_054625_101_685 194
1580 3300053151 Ga0500604_0013483 Ga0500604_0013483_1539_2135 194
1581 3300053153 Ga0500616_0000069 Ga0500616_0000069_23636_24232 194
1582 3300053153 Ga0500616_0002365 Ga0500616_0002365_8653_9261 194
1583 3300053153 Ga0500616_0010971 Ga0500616_0010971_1302_1913 194
1584 3300053154 Ga0500619_022328 Ga0500619_022328_346_930 194
1585 3300053154 Ga0500619_090401 Ga0500619_090401_435_1019 194
1586 3300053155 Ga0500620_003266 Ga0500620_003266_496_1080 194
1587 3300053156 Ga0500622_0003891 Ga0500622_0003891_7454_8038 194
1588 3300053156 Ga0500622_0006990 Ga0500622_0006990_3769_4365 194
1589 3300053156 Ga0500622_0115937 Ga0500622_0115937_375_959 194
1590 3300053158 Ga0500627_0023382 Ga0500627_0023382_1538_2122 194
1591 3300053158 Ga0500627_0075119 Ga0500627_0075119_110_706 194
1592 3300053159 Ga0500630_003535 Ga0500630_003535_4178_4762 194
1593 3300053160 Ga0500633_0052223 Ga0500633_0052223_579_1163 194
1594 3300053161 Ga0500634_0118415 Ga0500634_0118415_624_1220 194
1595 3300053162 Ga0500638_006438 Ga0500638_006438_1611_2195 194
1596 3300053162 Ga0500638_206743 Ga0500638_206743_122_733 194
1597 3300053162 Ga0500638_234419 Ga0500638_234419_20_604 194
1598 3300053163 Ga0500639_000034 Ga0500639_000034_64194_64778 194
1599 3300053163 Ga0500639_001800 Ga0500639_001800_817_1413 194
1600 3300053163 Ga0500639_148350 Ga0500639_148350_103_687 194
1601 3300053177 Ga0500636_0006585 Ga0500636_0006585_2017_2613 194
1602 3300053177 Ga0500636_0015558 Ga0500636_0015558_1983_2567 194
1603 3300053177 Ga0500636_0046600 Ga0500636_0046600_715_1299 194
1604 3300053177 Ga0500636_0072915 Ga0500636_0072915_598_1182 194
1605 3300053177 Ga0500636_0205952 Ga0500636_0205952_183_767 194
1606 3300053178 Ga0500637_0000742 Ga0500637_0000742_10158_10742 194
1607 3300053178 Ga0500637_0080859 Ga0500637_0080859_360_944 194
1608 3300053178 Ga0500637_0097654 Ga0500637_0097654_191_799 194
1609 3300053178 Ga0500637_0293199 Ga0500637_0293199_190_774 194
1610 3300053723 Ga0500567_177423 Ga0500567_177423_38_622 194
1611 3300053725 Ga0500576_078959 Ga0500576_078959_738_1334 194
1612 3300053730 Ga0500645_014699 Ga0500645_014699_627_1211 194
1613 3300053735 Ga0500596_002867 Ga0500596_002867_1661_2245 194
1614 3300053735 Ga0500596_004222 Ga0500596_004222_1551_2147 194
1615 3300053736 Ga0500599_001531 Ga0500599_001531_151_735 194
1616 3300053737 Ga0500601_000312 Ga0500601_000312_2702_3313 194
1617 3300053737 Ga0500601_009495 Ga0500601_009495_465_1049 194
1618 3300054114 Ga0501084_0043628 Ga0501084_0043628_1892_2476 194
1619 3300054114 Ga0501084_0460317 Ga0501084_0460317_416_1000 194
1620 3300055283 Ga0500661_002298 Ga0500661_002298_1359_1943 194
1621 3300055283 Ga0500661_007866 Ga0500661_007866_853_1464 194
1622 3300055283 Ga0500661_025072 Ga0500661_025072_354_938 194
1623 3300060353 Ga0501082_0006469 Ga0501082_0006469_4452_5036 194
1624 3300060353 Ga0501082_0165372 Ga0501082_0165372_548_1132 194
1625 3300060353 Ga0501082_0399895 Ga0501082_0399895_466_1059 194
1626 3300061719 Ga0466962_0162410 Ga0466962_0162410_232_816 194
1627 3300061734 Ga0530510_0338280 Ga0530510_0338280_392_976 194
1628 iso_pu_bacteria 2824704595 2824712616 194
1629 iso_pu_bacteria 2824753945 2824760192 194
1630 iso_pu_bacteria 2824763712 2824767181 194
1631 iso_pu_bacteria 2824773399 2824780647 194
1632 iso_pu_bacteria 2841941048 2841947259 194
1633 iso_pu_bacteria 2844315083 2844318327 194
1634 iso_pu_bacteria 2881665667 2881669597 194
1635 iso_pu_bacteria 2903727486 2903729274 194
1636 iso_pu_bacteria 2904711408 2904717102 194
1637 iso_pu_bacteria 2906602504 2906609430 194
1638 iso_pu_bacteria 2932794094 2932796445 194
1639 iso_pu_bacteria 2932801729 2932808934 194
1640 iso_pu_bacteria 2935883170 2935886646 194
1641 iso_pu_bacteria 3005506211 3005511828 194
1642 iso_pu_bacteria 3005710791 3005714110 194
1643 iso_pu_bacteria 8019648815 8019657456 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

15

134

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qa9-assembly1.cif.gz_A crystal structure of prb (ph1109 protein redesigned for binding) 0.9629 4 140
2d5a-assembly1.cif.gz_A hypothetical protein from pyrococcus horikoshii ot3 0.9559 4 140
1iul-assembly1.cif.gz_A the structure of cell-free id.343 from thermus thermophilus 0.9511 6 139
3q9n-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9473 4 140
3q9u-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9452 4 140
ID Description Score Start End Superfamily
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9511 6 139 3.40.50.720
3q9nB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.945 4 140 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9307 6 139 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8969 19 132 3.40.50.720
3q9nB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8914 4 140 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7V8KJL4-F1-model_v4 deleted 0.9926 1 140
AF-A0A526S3G7-F1-model_v4 CoA-binding protein 0.9919 1 128
AF-A0A7W9ZRZ4-F1-model_v4 CoA-binding domain-containing protein 0.9914 1 140
AF-A0A2N8B2T8-F1-model_v4 deleted 0.991 23 130
AF-A0A292E4Q2-F1-model_v4 CoA-binding protein 0.9905 1 139

Feature Viewer

pLDDT pTM Quality
80.12 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map