F495124

General Info

Members Datasets Scaffolds Average Seq Length
1629 478 1629 260

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0015258|Ga0496105_0015258_996_1808
Length 270
Sequence MSAVVGVNRSAGMNRARSAYRAGLTLMVAAACYEAIARSGYFPAALLPTLPKVASTLWTLTLDGTMLEHSAATMYRVLFGLSLAIAVGLPLGILMGRFRPVENFFLPLSSALMPIPSLAWVPVFILWFGLGNTVAILIVFYALFPMLLNAWSGVRAVNPLWLRAAGAMGADERALFWKVIIPGASPFIITGLRQAFLRAWIAVIGAEMLAASDWGLGWVIFDAKEFLNADVMLAALAVIGLIGFLFERLVFGSIERATVMRWGMVRTAKG

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
8 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
17 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
18 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
24 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
54 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
70 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
95 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
101 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
102 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
103 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
104 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
105 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
106 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
107 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
108 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
109 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
110 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
111 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
118 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
119 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
120 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
121 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
122 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
123 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
124 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
125 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
127 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
128 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
129 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
130 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
131 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
133 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
134 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
136 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
137 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
138 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
139 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
140 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
141 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
142 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
145 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
146 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
147 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
148 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
149 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
150 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
151 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
152 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
153 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
154 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
155 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
156 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
157 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
158 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
159 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
160 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
161 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
162 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
164 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
165 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
241 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
245 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
246 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
247 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
248 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
249 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
250 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
251 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
252 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
253 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
254 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
255 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
256 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
257 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
258 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
259 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
260 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
261 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
262 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
263 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
264 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
265 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
266 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
267 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
268 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
269 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
270 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
271 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
273 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
274 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
275 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
276 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
277 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
278 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
279 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
280 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
281 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
282 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
283 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
284 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
285 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
286 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
287 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
288 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
289 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
290 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
291 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
292 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
293 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
294 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
295 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
296 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
297 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
298 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
299 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
300 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
301 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
302 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
303 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
304 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
305 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
306 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
307 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
308 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
309 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
310 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
311 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
312 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
313 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
314 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
315 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
316 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
317 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
318 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
319 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
320 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
321 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
322 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
323 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
324 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
325 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
326 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
327 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
328 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
329 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
330 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
331 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
332 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
333 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
334 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
335 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
336 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
337 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
338 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
339 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
340 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
341 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
342 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
343 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
344 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
345 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
346 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
347 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
348 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
349 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
350 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
351 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
352 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
353 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
354 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
355 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
356 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
357 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
358 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
359 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
360 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
361 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
362 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
363 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
364 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
365 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
366 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
367 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
368 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
369 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
370 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
371 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
372 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
373 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
374 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
375 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
376 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
377 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
378 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
379 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
380 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
381 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
382 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
383 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
384 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
385 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
386 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
387 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
388 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
389 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
390 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
391 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
392 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
393 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
394 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
395 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
396 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
397 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
398 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
399 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
400 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
401 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
402 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
403 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
404 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
405 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
406 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
407 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
408 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
409 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
425 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
426 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
427 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
428 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
429 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
430 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
431 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
432 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
433 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
434 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
435 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
436 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
437 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
438 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
439 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
442 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
443 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
444 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
445 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
446 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
447 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
448 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
449 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
450 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
451 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
452 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
453 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
454 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
455 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
456 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
457 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
458 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
459 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
460 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
461 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
462 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
463 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
464 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
465 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
466 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
467 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
468 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
469 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
470 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
471 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
472 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
473 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
474 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
475 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
476 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
477 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
478 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.21
Nodule 0
Rhizoplane 7.06
Rhizosphere 90.3
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214772980 2209111006 Bacteria 12584
2 ARcpr5oldR_c000026 3300000041 Bacteria 30226
3 ARSoilYngRDRAFT_c00029 3300000042 Bacteria 22121
4 ARcpr5yngRDRAFT_c000044 3300000043 Bacteria 19945
5 ARSoilOldRDRAFT_c000037 3300000044 Bacteria 30277
6 ARCol0yngRDRAFT_1000020 3300000652 Bacteria 30273
7 JGI24032J14994_100929 3300001430 Bacteria 1405
8 JGI24746J21847_1004318 3300001977 Bacteria 2242
9 JGI24739J22299_10004550 3300001989 Bacteria 5302
10 JGI24739J22299_10008850 3300001989 Bacteria 3753
11 JGI24737J22298_10001930 3300001990 Bacteria 7416
12 JGI24743J22301_10002254 3300001991 Bacteria 2866
13 JGI24743J22301_10003452 3300001991 Bacteria 2502
14 JGI24750J21931_1000586 3300002070 Bacteria 5547
15 JGI24750J21931_1006717 3300002070 Bacteria 1438
16 JGI24745J21846_1000864 3300002073 Bacteria 2808
17 JGI24738J21930_10003187 3300002075 Bacteria 4188
18 JGI24744J21845_10000745 3300002077 Bacteria 6048
19 JGI24744J21845_10031793 3300002077 Bacteria 1008
20 JGI24035J26624_1001145 3300002126 Bacteria 2512
21 JGI24033J26618_1000244 3300002155 Bacteria 6086
22 JGI24034J26672_10005584 3300002239 Bacteria 1804
23 JGI24742J22300_10000139 3300002244 Bacteria 10736
24 JGI24751J29686_10025022 3300002459 Bacteria 1239
25 JGI25153J46596_10003184 3300003215 Bacteria 9241
26 rootH2_10006376 3300003320 Bacteria 1061
27 Ga0065717_1003669 3300005276 Bacteria 1206
28 Ga0065716_1001673 3300005277 Bacteria 4322
29 Ga0065712_10036972 3300005290 Bacteria 971
30 Ga0065712_10071735 3300005290 Bacteria 5090
31 Ga0065712_10077193 3300005290 Bacteria 3510
32 Ga0065715_10012820 3300005293 Bacteria 2379
33 Ga0065715_10017550 3300005293 Bacteria 2405
34 Ga0065715_10092917 3300005293 Bacteria 4880
35 Ga0070658_10021114 3300005327 Bacteria 5216
36 Ga0070676_10001078 3300005328 Bacteria 13598
37 Ga0070683_100007390 3300005329 Bacteria 9282
38 Ga0070683_100108972 3300005329 Bacteria 2612
39 Ga0070690_100014887 3300005330 Bacteria 4625
40 Ga0070690_100046335 3300005330 Bacteria 2764
41 Ga0070690_100291210 3300005330 Bacteria 1168
42 Ga0070690_100380229 3300005330 Bacteria 1032
43 Ga0070670_100037546 3300005331 Bacteria 4168
44 Ga0070670_100089771 3300005331 Bacteria 2642
45 Ga0070677_10000668 3300005333 Bacteria 11465
46 Ga0068869_100013686 3300005334 Bacteria 5403
47 Ga0068869_100022846 3300005334 Bacteria 4313
48 Ga0068869_100051408 3300005334 Bacteria 2990
49 Ga0068869_100502095 3300005334 Bacteria 1013
50 Ga0070666_10085683 3300005335 Bacteria 2158
51 Ga0070680_100004715 3300005336 Bacteria 10260
52 Ga0070680_100013186 3300005336 Bacteria 6434
53 Ga0070680_100021923 3300005336 Bacteria 5080
54 Ga0070680_100024576 3300005336 Bacteria 4814
55 Ga0070680_100234127 3300005336 Bacteria 1551
56 Ga0070680_100285286 3300005336 Bacteria 1399
57 Ga0070680_100301660 3300005336 Bacteria 1358
58 Ga0070682_100001091 3300005337 Bacteria 15614
59 Ga0070682_100315815 3300005337 Unclassified 1152
60 Ga0068868_100031802 3300005338 Bacteria 4057
61 Ga0068868_100037790 3300005338 Bacteria 3744
62 Ga0070660_100001398 3300005339 Bacteria 16443
63 Ga0070660_100050299 3300005339 Bacteria 3206
64 Ga0070660_100058854 3300005339 Bacteria 2979
65 Ga0070689_100003399 3300005340 Bacteria 10580
66 Ga0070689_100017677 3300005340 Bacteria 5243
67 Ga0070689_100028202 3300005340 Bacteria 4241
68 Ga0070689_100080413 3300005340 Bacteria 2557
69 Ga0070689_100197151 3300005340 Bacteria 1642
70 Ga0070689_100381444 3300005340 Bacteria 1188
71 Ga0070691_10000769 3300005341 Bacteria 12720
72 Ga0070691_10002420 3300005341 Bacteria 8280
73 Ga0070691_10057313 3300005341 Bacteria 1869
74 Ga0070691_10062640 3300005341 Bacteria 1791
75 Ga0070687_100005958 3300005343 Bacteria 4960
76 Ga0070687_100037605 3300005343 Bacteria 2421
77 Ga0070687_100082540 3300005343 Bacteria 1758
78 Ga0070661_100001076 3300005344 Bacteria 19335
79 Ga0070661_100061862 3300005344 Bacteria 2748
80 Ga0070692_10006678 3300005345 Bacteria 5027
81 Ga0070692_10142810 3300005345 Bacteria 1356
82 Ga0070668_100012317 3300005347 Bacteria 6370
83 Ga0070668_100222315 3300005347 Bacteria 1558
84 Ga0070668_100426049 3300005347 Bacteria 1137
85 Ga0070669_100005888 3300005353 Bacteria 8845
86 Ga0070669_100086940 3300005353 Bacteria 2336
87 Ga0070669_100161681 3300005353 Bacteria 1740
88 Ga0070675_100000727 3300005354 Bacteria 22927
89 Ga0070675_100292551 3300005354 Bacteria 1433
90 Ga0070675_100303869 3300005354 Bacteria 1406
91 Ga0070671_100000438 3300005355 Bacteria 28920
92 Ga0070671_100017456 3300005355 Bacteria 5813
93 Ga0070671_100018195 3300005355 Bacteria 5704
94 Ga0070671_100097382 3300005355 Bacteria 2467
95 Ga0070671_100384509 3300005355 Bacteria 1200
96 Ga0070674_100001976 3300005356 Bacteria 11215
97 Ga0070674_100004009 3300005356 Bacteria 8344
98 Ga0070674_100036693 3300005356 Bacteria 3292
99 Ga0070674_100037164 3300005356 Bacteria 3273
100 Ga0070674_100076955 3300005356 Bacteria 2374
101 Ga0070673_100001186 3300005364 Bacteria 14992
102 Ga0070673_100064845 3300005364 Bacteria 2911
103 Ga0070673_100069361 3300005364 Bacteria 2825
104 Ga0070673_100078510 3300005364 Bacteria 2671
105 Ga0070673_100231226 3300005364 Bacteria 1604
106 Ga0070673_100308282 3300005364 Bacteria 1396
107 Ga0070688_100003863 3300005365 Bacteria 7770
108 Ga0070688_100022325 3300005365 Bacteria 3706
109 Ga0070688_100236361 3300005365 Bacteria 1295
110 Ga0070688_100298893 3300005365 Bacteria 1163
111 Ga0070659_100005874 3300005366 Bacteria 8843
112 Ga0070659_100058285 3300005366 Bacteria 3048
113 Ga0070659_100159515 3300005366 Bacteria 1844
114 Ga0070659_100536262 3300005366 Bacteria 1001
115 Ga0070667_100005963 3300005367 Bacteria 10128
116 Ga0070667_100141067 3300005367 Bacteria 2110
117 Ga0070667_100150888 3300005367 Bacteria 2041
118 Ga0070703_10002528 3300005406 Bacteria 5263
119 Ga0070709_10015469 3300005434 Bacteria 4342
120 Ga0070709_10373331 3300005434 Bacteria 1059
121 Ga0070714_100085977 3300005435 Bacteria 2748
122 Ga0070713_100015791 3300005436 Bacteria 5658
123 Ga0070713_100057053 3300005436 Bacteria 3249
124 Ga0070713_100100725 3300005436 Bacteria 2501
125 Ga0070713_100305905 3300005436 Bacteria 1465
126 Ga0070710_10021397 3300005437 Bacteria 3370
127 Ga0070710_10055864 3300005437 Bacteria 2233
128 Ga0070710_10145315 3300005437 Bacteria 1458
129 Ga0070710_10161886 3300005437 Bacteria 1388
130 Ga0070701_10000339 3300005438 Bacteria 15527
131 Ga0070701_10010726 3300005438 Bacteria 4065
132 Ga0070701_10127112 3300005438 Bacteria 1444
133 Ga0070711_100027442 3300005439 Bacteria 3738
134 Ga0070711_100034179 3300005439 Bacteria 3390
135 Ga0070711_100175493 3300005439 Bacteria 1637
136 Ga0070711_100189934 3300005439 Bacteria 1578
137 Ga0070711_100199417 3300005439 Bacteria 1543
138 Ga0070711_100291549 3300005439 Bacteria 1294
139 Ga0070705_100000010 3300005440 Bacteria 102079
140 Ga0070705_100005352 3300005440 Bacteria 6249
141 Ga0070705_100023818 3300005440 Bacteria 3294
142 Ga0070705_100080736 3300005440 Bacteria 1996
143 Ga0070700_100000783 3300005441 Bacteria 15666
144 Ga0070700_100019322 3300005441 Bacteria 3930
145 Ga0070700_100034755 3300005441 Bacteria 3046
146 Ga0070700_100129382 3300005441 Bacteria 1702
147 Ga0070694_100006633 3300005444 Bacteria 7034
148 Ga0070694_100249244 3300005444 Bacteria 1343
149 Ga0070694_100277901 3300005444 Bacteria 1276
150 Ga0070694_100409326 3300005444 Bacteria 1063
151 Ga0070694_100510658 3300005444 Bacteria 957
152 Ga0070694_100570064 3300005444 Unclassified 908
153 Ga0070708_100015350 3300005445 Bacteria 6324
154 Ga0070663_100017471 3300005455 Bacteria 4682
155 Ga0070663_100025858 3300005455 Bacteria 3968
156 Ga0070663_100033005 3300005455 Bacteria 3573
157 Ga0070663_100040103 3300005455 Bacteria 3276
158 Ga0070663_100134439 3300005455 Bacteria 1882
159 Ga0070663_100225422 3300005455 Bacteria 1473
160 Ga0070678_100006186 3300005456 Bacteria 6997
161 Ga0070678_100011564 3300005456 Bacteria 5451
162 Ga0070678_100026061 3300005456 Bacteria 3947
163 Ga0070678_100045182 3300005456 Bacteria 3149
164 Ga0070678_100077198 3300005456 Bacteria 2512
165 Ga0070678_100160180 3300005456 Bacteria 1822
166 Ga0070662_100017941 3300005457 Bacteria 4778
167 Ga0070662_100065940 3300005457 Bacteria 2655
168 Ga0070662_100093667 3300005457 Bacteria 2260
169 Ga0070662_100121519 3300005457 Bacteria 2002
170 Ga0070662_100364784 3300005457 Bacteria 1186
171 Ga0070681_10046880 3300005458 Bacteria 4320
172 Ga0070681_10051242 3300005458 Bacteria 4117
173 Ga0070681_10077725 3300005458 Bacteria 3276
174 Ga0068867_100031591 3300005459 Bacteria 3824
175 Ga0068867_100046946 3300005459 Bacteria 3174
176 Ga0068867_100060743 3300005459 Bacteria 2804
177 Ga0068867_100696329 3300005459 Bacteria 896
178 Ga0068867_100722585 3300005459 Unclassified 881
179 Ga0070685_10005962 3300005466 Bacteria 6203
180 Ga0070685_10009847 3300005466 Bacteria 4957
181 Ga0070685_10022940 3300005466 Bacteria 3410
182 Ga0070685_10088559 3300005466 Bacteria 1870
183 Ga0070685_10231391 3300005466 Bacteria 1216
184 Ga0070707_100232584 3300005468 Bacteria 1794
185 Ga0070699_100001314 3300005518 Bacteria 22902
186 Ga0070699_100010423 3300005518 Bacteria 8044
187 Ga0070679_100021002 3300005530 Bacteria 6371
188 Ga0070679_100034318 3300005530 Bacteria 5027
189 Ga0070679_100056408 3300005530 Bacteria 3914
190 Ga0070679_100076400 3300005530 Bacteria 3339
191 Ga0070679_100084600 3300005530 Bacteria 3160
192 Ga0070679_100158636 3300005530 Bacteria 2236
193 Ga0070679_100208393 3300005530 Bacteria 1919
194 Ga0070679_100315865 3300005530 Bacteria 1512
195 Ga0070679_100507683 3300005530 Bacteria 1149
196 Ga0070684_100030785 3300005535 Bacteria 4564
197 Ga0070684_100128485 3300005535 Bacteria 2285
198 Ga0070684_100134636 3300005535 Bacteria 2231
199 Ga0070684_100630839 3300005535 Bacteria 997
200 Ga0070697_100039300 3300005536 Bacteria 3825
201 Ga0070697_100441764 3300005536 Bacteria 1132
202 Ga0068853_100004375 3300005539 Bacteria 10933
203 Ga0068853_100042579 3300005539 Bacteria 3883
204 Ga0068853_100579519 3300005539 Bacteria 1064
205 Ga0070672_100011149 3300005543 Bacteria 6259
206 Ga0070672_100078196 3300005543 Bacteria 2647
207 Ga0070672_100448528 3300005543 Bacteria 1111
208 Ga0070686_100006762 3300005544 Bacteria 6383
209 Ga0070686_100049853 3300005544 Bacteria 2658
210 Ga0070686_100103076 3300005544 Bacteria 1931
211 Ga0070686_100151671 3300005544 Bacteria 1624
212 Ga0070686_100213897 3300005544 Bacteria 1389
213 Ga0070686_100266991 3300005544 Bacteria 1257
214 Ga0070686_100416152 3300005544 Bacteria 1026
215 Ga0070695_100001719 3300005545 Bacteria 12317
216 Ga0070695_100030227 3300005545 Bacteria 3371
217 Ga0070695_100066208 3300005545 Bacteria 2354
218 Ga0070695_100260215 3300005545 Bacteria 1267
219 Ga0070696_100002812 3300005546 Bacteria 11557
220 Ga0070696_100029222 3300005546 Bacteria 3766
221 Ga0070693_100000577 3300005547 Bacteria 16215
222 Ga0070693_100010134 3300005547 Bacteria 4709
223 Ga0070665_100076321 3300005548 Bacteria 3358
224 Ga0070665_100085305 3300005548 Bacteria 3163
225 Ga0070704_100028556 3300005549 Bacteria 3713
226 Ga0070704_100295544 3300005549 Bacteria 1347
227 Ga0068855_100014148 3300005563 Bacteria 9611
228 Ga0068855_100138074 3300005563 Bacteria 2780
229 Ga0068855_100190703 3300005563 Bacteria 2312
230 Ga0070664_100002073 3300005564 Bacteria 16008
231 Ga0070664_100070153 3300005564 Bacteria 3000
232 Ga0070664_100138824 3300005564 Bacteria 2139
233 Ga0070664_100145042 3300005564 Bacteria 2093
234 Ga0070664_100167671 3300005564 Bacteria 1946
235 Ga0070664_100175888 3300005564 Bacteria 1900
236 Ga0070664_100386735 3300005564 Bacteria 1278
237 Ga0068857_100008536 3300005577 Bacteria 8859
238 Ga0068857_100011549 3300005577 Bacteria 7685
239 Ga0068857_100447288 3300005577 Bacteria 1207
240 Ga0068857_100511643 3300005577 Bacteria 1128
241 Ga0068854_100001074 3300005578 Bacteria 16449
242 Ga0068854_100049093 3300005578 Bacteria 3013
243 Ga0068854_100539611 3300005578 Bacteria 988
244 Ga0068856_100026335 3300005614 Bacteria 5671
245 Ga0068856_100039625 3300005614 Bacteria 4625
246 Ga0068856_100046914 3300005614 Bacteria 4256
247 Ga0070702_100005245 3300005615 Bacteria 6011
248 Ga0070702_100023173 3300005615 Bacteria 3295
249 Ga0068852_100001086 3300005616 Bacteria 17979
250 Ga0068852_100016187 3300005616 Bacteria 5807
251 Ga0068852_100054483 3300005616 Bacteria 3447
252 Ga0068852_100055479 3300005616 Bacteria 3420
253 Ga0068859_100003708 3300005617 Bacteria 15569
254 Ga0068859_100023234 3300005617 Bacteria 6221
255 Ga0068859_100108837 3300005617 Bacteria 2832
256 Ga0068859_100127411 3300005617 Bacteria 2616
257 Ga0068864_100025772 3300005618 Bacteria 4956
258 Ga0068864_100039525 3300005618 Bacteria 4032
259 Ga0068864_100042873 3300005618 Bacteria 3873
260 Ga0068864_100053465 3300005618 Bacteria 3484
261 Ga0068864_100070454 3300005618 Bacteria 3042
262 Ga0068864_100093083 3300005618 Bacteria 2662
263 Ga0068866_10000403 3300005718 Bacteria 20138
264 Ga0068866_10002088 3300005718 Bacteria 8310
265 Ga0068866_10103993 3300005718 Bacteria 1572
266 Ga0068866_10334537 3300005718 Bacteria 957
267 Ga0068861_100180454 3300005719 Bacteria 1757
268 Ga0068861_100253512 3300005719 Bacteria 1503
269 Ga0068851_10190099 3300005834 Bacteria 1141
270 Ga0068870_10000860 3300005840 Bacteria 11868
271 Ga0068870_10001886 3300005840 Bacteria 8637
272 Ga0068870_10186282 3300005840 Bacteria 1249
273 Ga0068863_100003728 3300005841 Bacteria 15069
274 Ga0068863_100036918 3300005841 Bacteria 4652
275 Ga0068863_100248817 3300005841 Bacteria 1717
276 Ga0068863_100570405 3300005841 Bacteria 1118
277 Ga0068858_100024112 3300005842 Bacteria 5670
278 Ga0068858_100032605 3300005842 Bacteria 4837
279 Ga0068858_100145199 3300005842 Bacteria 2228
280 Ga0068858_100185868 3300005842 Bacteria 1963
281 Ga0068858_100201782 3300005842 Bacteria 1881
282 Ga0068858_100220118 3300005842 Bacteria 1798
283 Ga0068860_100013440 3300005843 Bacteria 8028
284 Ga0068860_100023327 3300005843 Bacteria 5980
285 Ga0068860_100053505 3300005843 Bacteria 3838
286 Ga0068860_100099064 3300005843 Bacteria 2780
287 Ga0068860_100349123 3300005843 Bacteria 1456
288 Ga0068860_100813597 3300005843 Unclassified 948
289 Ga0068862_100003043 3300005844 Bacteria 14604
290 Ga0068862_100024080 3300005844 Bacteria 5105
291 Ga0068862_100177573 3300005844 Bacteria 1910
292 Ga0081455_10000012 3300005937 Bacteria 201668
293 Ga0081455_10007967 3300005937 Bacteria 11076
294 Ga0081455_10119932 3300005937 Bacteria 2074
295 Ga0081455_10188134 3300005937 Bacteria 1558
296 Ga0081455_10286256 3300005937 Bacteria 1188
297 Ga0081538_10018338 3300005981 Bacteria 5260
298 Ga0081538_10047804 3300005981 Bacteria 2619
299 Ga0081540_1002413 3300005983 Bacteria 15223
300 Ga0081540_1024424 3300005983 Bacteria 3507
301 Ga0081540_1027356 3300005983 Bacteria 3233
302 Ga0081540_1031022 3300005983 Bacteria 2949
303 Ga0081540_1084127 3300005983 Bacteria 1421
304 Ga0081539_10080906 3300005985 Bacteria 1707
305 Ga0081539_10197348 3300005985 Bacteria 932
306 Ga0070717_10007114 3300006028 Bacteria 8292
307 Ga0070717_10056934 3300006028 Bacteria 3231
308 Ga0070717_10076908 3300006028 Bacteria 2794
309 Ga0070717_10085547 3300006028 Bacteria 2654
310 Ga0075365_10048846 3300006038 Bacteria 2786
311 Ga0075365_10399680 3300006038 Bacteria 970
312 Ga0075364_10008816 3300006051 Bacteria 6037
313 Ga0075432_10001490 3300006058 Bacteria 7644
314 Ga0070715_10006260 3300006163 Bacteria 4033
315 Ga0070716_100009562 3300006173 Bacteria 4834
316 Ga0070712_100025089 3300006175 Bacteria 3958
317 Ga0070712_100063297 3300006175 Bacteria 2619
318 Ga0070712_100095285 3300006175 Bacteria 2189
319 Ga0070712_100342684 3300006175 Bacteria 1221
320 Ga0075362_10000839 3300006177 Bacteria 9234
321 Ga0075362_10050193 3300006177 Bacteria 1865
322 Ga0075362_10075317 3300006177 Bacteria 1548
323 Ga0075367_10039470 3300006178 Bacteria 2753
324 Ga0075367_10047173 3300006178 Bacteria 2534
325 Ga0075366_10001687 3300006195 Bacteria 11092
326 Ga0097621_100000421 3300006237 Bacteria 29460
327 Ga0097621_100008029 3300006237 Bacteria 7577
328 Ga0097621_100176781 3300006237 Unclassified 1843
329 Ga0097621_100194171 3300006237 Bacteria 1759
330 Ga0075370_10074551 3300006353 Bacteria 1945
331 Ga0068871_100000515 3300006358 Bacteria 26586
332 Ga0068871_100012948 3300006358 Bacteria 6177
333 Ga0068871_100172423 3300006358 Bacteria 1855
334 Ga0075428_100007282 3300006844 Bacteria 12256
335 Ga0075428_100056127 3300006844 Bacteria 4315
336 Ga0075428_100069359 3300006844 Bacteria 3854
337 Ga0075428_100073481 3300006844 Bacteria 3735
338 Ga0075428_100173857 3300006844 Bacteria 2334
339 Ga0075428_100864848 3300006844 Bacteria 960
340 Ga0075430_100028858 3300006846 Bacteria 4711
341 Ga0075430_100060450 3300006846 Bacteria 3184
342 Ga0075431_100001810 3300006847 Bacteria 20184
343 Ga0075431_100072177 3300006847 Bacteria 3562
344 Ga0075431_100120887 3300006847 Bacteria 2702
345 Ga0075431_100143342 3300006847 Bacteria 2462
346 Ga0075431_100264530 3300006847 Bacteria 1745
347 Ga0075433_10002034 3300006852 Bacteria 15272
348 Ga0075433_10006137 3300006852 Bacteria 9468
349 Ga0075433_10008633 3300006852 Bacteria 8131
350 Ga0075433_10062911 3300006852 Bacteria 3250
351 Ga0075434_100000007 3300006871 Bacteria 95975
352 Ga0075434_100000693 3300006871 Bacteria 26314
353 Ga0075434_100001159 3300006871 Bacteria 21806
354 Ga0075434_100042973 3300006871 Bacteria 4481
355 Ga0075434_100060322 3300006871 Bacteria 3773
356 Ga0075434_100128088 3300006871 Bacteria 2556
357 Ga0075434_100152317 3300006871 Bacteria 2332
358 Ga0075429_100240514 3300006880 Bacteria 1586
359 Ga0075429_100561978 3300006880 Bacteria 1000
360 Ga0068865_100002115 3300006881 Bacteria 11728
361 Ga0068865_100033785 3300006881 Bacteria 3426
362 Ga0068865_100251079 3300006881 Bacteria 1396
363 Ga0075436_100002192 3300006914 Bacteria 13473
364 Ga0075436_100004166 3300006914 Bacteria 9922
365 Ga0075436_100027202 3300006914 Bacteria 3937
366 Ga0075436_100131794 3300006914 Bacteria 1753
367 Ga0075436_100357828 3300006914 Bacteria 1053
368 Ga0097620_100003708 3300006931 Bacteria 15569
369 Ga0097620_100023234 3300006931 Bacteria 6221
370 Ga0097620_100108838 3300006931 Bacteria 2832
371 Ga0097620_100127413 3300006931 Bacteria 2616
372 Ga0075435_100000432 3300007076 Bacteria 25629
373 Ga0075435_100025823 3300007076 Bacteria 4577
374 Ga0075435_100032913 3300007076 Bacteria 4097
375 Ga0075435_100039209 3300007076 Bacteria 3780
376 Ga0075435_100105730 3300007076 Bacteria 2336
377 Ga0075435_100228548 3300007076 Bacteria 1580
378 Ga0075435_100260242 3300007076 Bacteria 1478
379 Ga0099795_10093911 3300007788 Bacteria 1167
380 Ga0105244_10049754 3300009036 Bacteria 2140
381 Ga0105250_10131030 3300009092 Bacteria 1035
382 Ga0105240_10037315 3300009093 Bacteria 6246
383 Ga0105240_10294125 3300009093 Bacteria 1860
384 Ga0111539_10004448 3300009094 Bacteria 18316
385 Ga0111539_10005607 3300009094 Bacteria 16233
386 Ga0111539_10013539 3300009094 Bacteria 10195
387 Ga0111539_10017591 3300009094 Bacteria 8846
388 Ga0111539_10019998 3300009094 Bacteria 8247
389 Ga0111539_10061746 3300009094 Bacteria 4439
390 Ga0111539_10087807 3300009094 Bacteria 3653
391 Ga0111539_10197563 3300009094 Bacteria 2346
392 Ga0111539_10518722 3300009094 Bacteria 1388
393 Ga0105245_10002944 3300009098 Bacteria 15281
394 Ga0105245_10069147 3300009098 Bacteria 3202
395 Ga0105245_10119521 3300009098 Bacteria 2460
396 Ga0105245_10215404 3300009098 Bacteria 1850
397 Ga0105245_10353319 3300009098 Unclassified 1457
398 Ga0105245_10994961 3300009098 Bacteria 883
399 Ga0105247_10011296 3300009101 Bacteria 5386
400 Ga0105247_10012837 3300009101 Bacteria 5028
401 Ga0105247_10020997 3300009101 Bacteria 3929
402 Ga0114129_10000742 3300009147 Bacteria 41451
403 Ga0114129_10011756 3300009147 Bacteria 12458
404 Ga0114129_10057318 3300009147 Bacteria 5452
405 Ga0114129_10059035 3300009147 Bacteria 5364
406 Ga0114129_10065278 3300009147 Bacteria 5080
407 Ga0114129_10090263 3300009147 Bacteria 4248
408 Ga0114129_10105879 3300009147 Bacteria 3886
409 Ga0114129_10115499 3300009147 Bacteria 3700
410 Ga0114129_10641417 3300009147 Bacteria 1372
411 Ga0105243_10002574 3300009148 Bacteria 15152
412 Ga0105243_10011951 3300009148 Bacteria 6563
413 Ga0105243_10055144 3300009148 Bacteria 3157
414 Ga0105243_10132540 3300009148 Bacteria 2116
415 Ga0105243_10230745 3300009148 Bacteria 1642
416 Ga0105243_10363934 3300009148 Bacteria 1332
417 Ga0105243_10406274 3300009148 Bacteria 1266
418 Ga0105241_10024036 3300009174 Bacteria 4524
419 Ga0105241_10073396 3300009174 Bacteria 2662
420 Ga0105241_10131225 3300009174 Bacteria 2029
421 Ga0105242_10056433 3300009176 Bacteria 3214
422 Ga0105242_10058622 3300009176 Bacteria 3157
423 Ga0105242_10079357 3300009176 Bacteria 2741
424 Ga0105242_10246851 3300009176 Bacteria 1607
425 Ga0105242_10263768 3300009176 Bacteria 1557
426 Ga0105242_10279010 3300009176 Bacteria 1517
427 Ga0105242_10280681 3300009176 Bacteria 1513
428 Ga0105242_10379756 3300009176 Bacteria 1313
429 Ga0105248_10063653 3300009177 Bacteria 4140
430 Ga0105248_10084997 3300009177 Bacteria 3561
431 Ga0105248_10196174 3300009177 Bacteria 2275
432 Ga0105237_10153564 3300009545 Bacteria 2299
433 Ga0105237_10307346 3300009545 Bacteria 1588
434 Ga0105237_10343928 3300009545 Bacteria 1496
435 Ga0105238_10009936 3300009551 Bacteria 9542
436 Ga0105238_10125728 3300009551 Bacteria 2543
437 Ga0105238_10230806 3300009551 Bacteria 1827
438 Ga0105238_10308501 3300009551 Bacteria 1567
439 Ga0105238_10410489 3300009551 Bacteria 1348
440 Ga0105238_10578225 3300009551 Bacteria 1130
441 Ga0105249_10015879 3300009553 Bacteria 6674
442 Ga0105249_10017602 3300009553 Bacteria 6345
443 Ga0105249_10119957 3300009553 Bacteria 2498
444 Ga0105249_10140512 3300009553 Bacteria 2315
445 Ga0105249_10154222 3300009553 Bacteria 2214
446 Ga0105249_10216131 3300009553 Bacteria 1884
447 Ga0099796_10005153 3300010159 Bacteria 3238
448 Ga0105239_10004537 3300010375 Bacteria 16545
449 Ga0105239_10414429 3300010375 Bacteria 1525
450 Ga0105239_10781048 3300010375 Bacteria 1094
451 Ga0105246_10001092 3300011119 Bacteria 15711
452 Ga0105246_10068302 3300011119 Bacteria 2493
453 Ga0105246_10108258 3300011119 Bacteria 2037
454 Ga0157373_10125287 3300013100 Bacteria 1807
455 Ga0157373_10217607 3300013100 Bacteria 1347
456 Ga0157371_10007315 3300013102 Bacteria 8965
457 Ga0157371_10106396 3300013102 Bacteria 1991
458 Ga0157371_10262381 3300013102 Bacteria 1245
459 Ga0157370_10180697 3300013104 Bacteria 1960
460 Ga0157370_10238648 3300013104 Bacteria 1682
461 Ga0157369_10220624 3300013105 Bacteria 1985
462 Ga0157369_10261134 3300013105 Bacteria 1806
463 Ga0157369_10488880 3300013105 Bacteria 1274
464 Ga0157374_10002049 3300013296 Bacteria 16945
465 Ga0157374_10032857 3300013296 Bacteria 4729
466 Ga0157374_10136595 3300013296 Bacteria 2377
467 Ga0157374_10329981 3300013296 Bacteria 1513
468 Ga0157378_10007541 3300013297 Bacteria 9498
469 Ga0157378_10044852 3300013297 Bacteria 3927
470 Ga0157378_10078787 3300013297 Bacteria 2973
471 Ga0157378_10255188 3300013297 Bacteria 1680
472 Ga0157378_10690813 3300013297 Bacteria 1039
473 Ga0163162_10005029 3300013306 Bacteria 12738
474 Ga0163162_10077208 3300013306 Bacteria 3394
475 Ga0163162_10077995 3300013306 Bacteria 3377
476 Ga0163162_10108051 3300013306 Bacteria 2878
477 Ga0163162_10127619 3300013306 Bacteria 2651
478 Ga0163162_10402046 3300013306 Bacteria 1502
479 Ga0163162_10408190 3300013306 Bacteria 1491
480 Ga0157372_10012748 3300013307 Bacteria 8955
481 Ga0157372_10045191 3300013307 Bacteria 4884
482 Ga0157372_10091294 3300013307 Bacteria 3464
483 Ga0157372_10561435 3300013307 Bacteria 1331
484 Ga0157375_10004037 3300013308 Bacteria 12735
485 Ga0157375_10019784 3300013308 Bacteria 6134
486 Ga0157375_10054327 3300013308 Bacteria 3944
487 Ga0157375_10160750 3300013308 Bacteria 2387
488 Ga0157375_10207198 3300013308 Bacteria 2117
489 Ga0157375_10301436 3300013308 Bacteria 1766
490 Ga0157375_10928382 3300013308 Bacteria 1013
491 Ga0163163_10005574 3300014325 Bacteria 10905
492 Ga0163163_10024568 3300014325 Bacteria 5736
493 Ga0163163_10044684 3300014325 Bacteria 4347
494 Ga0163163_10055637 3300014325 Bacteria 3910
495 Ga0163163_10177888 3300014325 Bacteria 2174
496 Ga0163163_10407254 3300014325 Bacteria 1418
497 Ga0157380_10001279 3300014326 Bacteria 16357
498 Ga0157380_10091519 3300014326 Bacteria 2511
499 Ga0157380_10231218 3300014326 Bacteria 1661
500 Ga0157380_10257088 3300014326 Bacteria 1584
501 Ga0157380_10644173 3300014326 Bacteria 1056
502 Ga0157380_10699440 3300014326 Bacteria 1018
503 Ga0157380_10864854 3300014326 Bacteria 927
504 Ga0157380_10872934 3300014326 Unclassified 923
505 Ga0182008_10032141 3300014497 Bacteria 2638
506 Ga0157377_10000312 3300014745 Bacteria 22340
507 Ga0157377_10010127 3300014745 Bacteria 4652
508 Ga0157379_10001989 3300014968 Bacteria 16918
509 Ga0157379_10029559 3300014968 Bacteria 4872
510 Ga0157379_10063884 3300014968 Bacteria 3291
511 Ga0157379_10088015 3300014968 Bacteria 2784
512 Ga0157379_10161405 3300014968 Unclassified 2023
513 Ga0157376_10001372 3300014969 Bacteria 16037
514 Ga0157376_10037848 3300014969 Bacteria 3921
515 Ga0157376_10054749 3300014969 Bacteria 3327
516 Ga0157376_10067048 3300014969 Bacteria 3035
517 Ga0157376_10735798 3300014969 Bacteria 994
518 Ga0163161_10003480 3300017792 Bacteria 11037
519 Ga0163161_10078656 3300017792 Bacteria 2424
520 Ga0163161_10112250 3300017792 Bacteria 2039
521 Ga0163161_10205986 3300017792 Bacteria 1518
522 Ga0213876_10110816 3300021384 Bacteria 1457
523 Ga0213876_10133655 3300021384 Bacteria 1319
524 Ga0207666_1000038 3300025271 Bacteria 26508
525 Ga0207673_1001708 3300025290 Bacteria 2430
526 Ga0209758_1001233 3300025297 Bacteria 31967
527 Ga0207697_10000373 3300025315 Bacteria 25127
528 Ga0207697_10039973 3300025315 Bacteria 1925
529 Ga0207697_10145323 3300025315 Bacteria 1030
530 Ga0207655_1085718 3300025728 Bacteria 1123
531 Ga0207653_10000559 3300025885 Bacteria 13532
532 Ga0207653_10005254 3300025885 Bacteria 4046
533 Ga0207653_10072307 3300025885 Bacteria 1180
534 Ga0207682_10000071 3300025893 Bacteria 44843
535 Ga0207682_10001862 3300025893 Bacteria 9601
536 Ga0207692_10067079 3300025898 Bacteria 1877
537 Ga0207692_10098281 3300025898 Bacteria 1602
538 Ga0207692_10270858 3300025898 Bacteria 1024
539 Ga0207710_10007122 3300025900 Bacteria 4745
540 Ga0207710_10011401 3300025900 Bacteria 3744
541 Ga0207710_10025753 3300025900 Bacteria 2540
542 Ga0207688_10000237 3300025901 Bacteria 25119
543 Ga0207688_10002075 3300025901 Bacteria 10771
544 Ga0207688_10133137 3300025901 Bacteria 1458
545 Ga0207680_10016997 3300025903 Bacteria 3834
546 Ga0207680_10037949 3300025903 Bacteria 2785
547 Ga0207680_10186825 3300025903 Bacteria 1405
548 Ga0207647_10009005 3300025904 Bacteria 7113
549 Ga0207647_10040967 3300025904 Bacteria 2915
550 Ga0207647_10048394 3300025904 Bacteria 2640
551 Ga0207647_10073935 3300025904 Bacteria 2053
552 Ga0207647_10083625 3300025904 Bacteria 1911
553 Ga0207685_10002917 3300025905 Bacteria 4041
554 Ga0207699_10073451 3300025906 Bacteria 2098
555 Ga0207645_10000779 3300025907 Bacteria 26604
556 Ga0207645_10085716 3300025907 Bacteria 2023
557 Ga0207645_10110454 3300025907 Bacteria 1780
558 Ga0207643_10000276 3300025908 Bacteria 35671
559 Ga0207643_10002314 3300025908 Bacteria 10366
560 Ga0207643_10016243 3300025908 Bacteria 4060
561 Ga0207643_10090843 3300025908 Bacteria 1780
562 Ga0207705_10062534 3300025909 Bacteria 2689
563 Ga0207654_10014702 3300025911 Bacteria 4048
564 Ga0207654_10058895 3300025911 Bacteria 2238
565 Ga0207654_10183138 3300025911 Bacteria 1368
566 Ga0207707_10000454 3300025912 Bacteria 42654
567 Ga0207707_10070862 3300025912 Bacteria 3037
568 Ga0207707_10100506 3300025912 Bacteria 2528
569 Ga0207707_10167955 3300025912 Bacteria 1917
570 Ga0207707_10183377 3300025912 Bacteria 1827
571 Ga0207707_10199840 3300025912 Bacteria 1743
572 Ga0207707_10212418 3300025912 Bacteria 1685
573 Ga0207695_10193073 3300025913 Bacteria 1953
574 Ga0207671_10016484 3300025914 Bacteria 5741
575 Ga0207671_10037376 3300025914 Bacteria 3601
576 Ga0207671_10183842 3300025914 Bacteria 1628
577 Ga0207693_10005073 3300025915 Bacteria 11046
578 Ga0207693_10007312 3300025915 Bacteria 9084
579 Ga0207693_10010718 3300025915 Bacteria 7439
580 Ga0207693_10021275 3300025915 Bacteria 5154
581 Ga0207693_10059589 3300025915 Bacteria 2990
582 Ga0207693_10101245 3300025915 Bacteria 2259
583 Ga0207693_10132910 3300025915 Unclassified 1956
584 Ga0207693_10278799 3300025915 Bacteria 1310
585 Ga0207693_10326774 3300025915 Bacteria 1201
586 Ga0207693_10496060 3300025915 Unclassified 953
587 Ga0207663_10060626 3300025916 Bacteria 2398
588 Ga0207663_10092706 3300025916 Bacteria 2009
589 Ga0207663_10115713 3300025916 Bacteria 1827
590 Ga0207663_10242074 3300025916 Bacteria 1324
591 Ga0207660_10000087 3300025917 Bacteria 49552
592 Ga0207660_10035293 3300025917 Bacteria 3471
593 Ga0207660_10035398 3300025917 Bacteria 3467
594 Ga0207660_10065427 3300025917 Bacteria 2627
595 Ga0207660_10146519 3300025917 Bacteria 1810
596 Ga0207660_10365811 3300025917 Bacteria 1157
597 Ga0207660_10407093 3300025917 Bacteria 1096
598 Ga0207660_10492479 3300025917 Bacteria 994
599 Ga0207662_10000659 3300025918 Bacteria 15653
600 Ga0207662_10006900 3300025918 Bacteria 6157
601 Ga0207662_10009020 3300025918 Bacteria 5479
602 Ga0207662_10037840 3300025918 Bacteria 2826
603 Ga0207662_10047292 3300025918 Bacteria 2548
604 Ga0207657_10003101 3300025919 Bacteria 17768
605 Ga0207657_10005173 3300025919 Bacteria 13682
606 Ga0207657_10019458 3300025919 Bacteria 6446
607 Ga0207657_10090738 3300025919 Bacteria 2550
608 Ga0207649_10000662 3300025920 Bacteria 22982
609 Ga0207649_10013634 3300025920 Bacteria 4541
610 Ga0207649_10039165 3300025920 Bacteria 2872
611 Ga0207649_10061498 3300025920 Bacteria 2364
612 Ga0207649_10169967 3300025920 Unclassified 1517
613 Ga0207652_10001908 3300025921 Bacteria 18069
614 Ga0207652_10008147 3300025921 Bacteria 8415
615 Ga0207652_10023549 3300025921 Bacteria 5101
616 Ga0207652_10050201 3300025921 Bacteria 3574
617 Ga0207652_10065031 3300025921 Bacteria 3157
618 Ga0207652_10111416 3300025921 Bacteria 2427
619 Ga0207652_10133337 3300025921 Bacteria 2217
620 Ga0207652_10459726 3300025921 Bacteria 1147
621 Ga0207681_10001262 3300025923 Bacteria 16334
622 Ga0207681_10038145 3300025923 Bacteria 3181
623 Ga0207681_10228489 3300025923 Bacteria 1443
624 Ga0207681_10308190 3300025923 Bacteria 1255
625 Ga0207681_10390820 3300025923 Bacteria 1122
626 Ga0207694_10017984 3300025924 Bacteria 5342
627 Ga0207694_10166488 3300025924 Bacteria 1783
628 Ga0207650_10005107 3300025925 Bacteria 8956
629 Ga0207650_10159384 3300025925 Bacteria 1787
630 Ga0207659_10000143 3300025926 Bacteria 42200
631 Ga0207659_10026549 3300025926 Bacteria 3909
632 Ga0207659_10057060 3300025926 Bacteria 2798
633 Ga0207659_10070018 3300025926 Bacteria 2557
634 Ga0207659_10202567 3300025926 Bacteria 1586
635 Ga0207659_10401094 3300025926 Bacteria 1147
636 Ga0207687_10000865 3300025927 Bacteria 20461
637 Ga0207687_10052245 3300025927 Bacteria 2852
638 Ga0207687_10120981 3300025927 Bacteria 1958
639 Ga0207687_10235753 3300025927 Bacteria 1448
640 Ga0207700_10000323 3300025928 Bacteria 28133
641 Ga0207700_10034585 3300025928 Bacteria 3629
642 Ga0207700_10063780 3300025928 Bacteria 2804
643 Ga0207700_10070564 3300025928 Bacteria 2686
644 Ga0207700_10078894 3300025928 Bacteria 2563
645 Ga0207700_10229601 3300025928 Bacteria 1577
646 Ga0207700_10431403 3300025928 Bacteria 1159
647 Ga0207664_10075293 3300025929 Bacteria 2729
648 Ga0207664_10511668 3300025929 Bacteria 1075
649 Ga0207644_10000532 3300025931 Bacteria 24677
650 Ga0207644_10015181 3300025931 Bacteria 5166
651 Ga0207644_10045594 3300025931 Bacteria 3119
652 Ga0207644_10166963 3300025931 Bacteria 1715
653 Ga0207690_10000409 3300025932 Bacteria 28156
654 Ga0207690_10074024 3300025932 Bacteria 2358
655 Ga0207690_10186213 3300025932 Bacteria 1567
656 Ga0207706_10001338 3300025933 Bacteria 24639
657 Ga0207706_10006705 3300025933 Bacteria 10645
658 Ga0207706_10026317 3300025933 Bacteria 5207
659 Ga0207706_10037549 3300025933 Bacteria 4300
660 Ga0207706_10058641 3300025933 Bacteria 3390
661 Ga0207706_10121459 3300025933 Bacteria 2297
662 Ga0207686_10000500 3300025934 Bacteria 25713
663 Ga0207686_10082565 3300025934 Bacteria 2101
664 Ga0207686_10173175 3300025934 Bacteria 1524
665 Ga0207686_10301377 3300025934 Bacteria 1190
666 Ga0207709_10001266 3300025935 Bacteria 18089
667 Ga0207709_10037338 3300025935 Bacteria 2886
668 Ga0207709_10161854 3300025935 Bacteria 1561
669 Ga0207709_10196300 3300025935 Bacteria 1438
670 Ga0207709_10203809 3300025935 Unclassified 1415
671 Ga0207670_10000689 3300025936 Bacteria 17866
672 Ga0207670_10004774 3300025936 Bacteria 7352
673 Ga0207670_10007354 3300025936 Bacteria 6140
674 Ga0207670_10064980 3300025936 Bacteria 2503
675 Ga0207670_10156514 3300025936 Bacteria 1697
676 Ga0207670_10370567 3300025936 Bacteria 1138
677 Ga0207669_10001125 3300025937 Bacteria 11423
678 Ga0207669_10036510 3300025937 Bacteria 2809
679 Ga0207669_10051596 3300025937 Bacteria 2465
680 Ga0207669_10409772 3300025937 Bacteria 1064
681 Ga0207704_10000613 3300025938 Bacteria 15794
682 Ga0207704_10075416 3300025938 Bacteria 2156
683 Ga0207665_10001192 3300025939 Bacteria 17511
684 Ga0207665_10052253 3300025939 Bacteria 2753
685 Ga0207665_10088263 3300025939 Bacteria 2145
686 Ga0207665_10352722 3300025939 Bacteria 1111
687 Ga0207691_10002493 3300025940 Bacteria 18001
688 Ga0207691_10003339 3300025940 Bacteria 15624
689 Ga0207691_10024434 3300025940 Bacteria 5683
690 Ga0207691_10128419 3300025940 Bacteria 2241
691 Ga0207691_10321603 3300025940 Bacteria 1326
692 Ga0207711_10009628 3300025941 Bacteria 8051
693 Ga0207711_10029326 3300025941 Bacteria 4640
694 Ga0207711_10032877 3300025941 Bacteria 4387
695 Ga0207711_10041693 3300025941 Bacteria 3909
696 Ga0207711_10050370 3300025941 Bacteria 3565
697 Ga0207711_10192293 3300025941 Bacteria 1860
698 Ga0207689_10000440 3300025942 Bacteria 38932
699 Ga0207689_10021598 3300025942 Bacteria 5412
700 Ga0207689_10046437 3300025942 Bacteria 3589
701 Ga0207689_10065413 3300025942 Bacteria 2990
702 Ga0207689_10382488 3300025942 Bacteria 1172
703 Ga0207661_10043667 3300025944 Bacteria 3539
704 Ga0207661_10059018 3300025944 Bacteria 3090
705 Ga0207661_10059503 3300025944 Bacteria 3079
706 Ga0207661_10061762 3300025944 Bacteria 3028
707 Ga0207679_10000131 3300025945 Bacteria 61363
708 Ga0207679_10016049 3300025945 Bacteria 4965
709 Ga0207679_10052938 3300025945 Bacteria 2979
710 Ga0207679_10093901 3300025945 Bacteria 2328
711 Ga0207679_10156128 3300025945 Bacteria 1863
712 Ga0207667_10028062 3300025949 Bacteria 6115
713 Ga0207667_10040115 3300025949 Bacteria 4985
714 Ga0207667_10088810 3300025949 Bacteria 3196
715 Ga0207667_10092846 3300025949 Bacteria 3117
716 Ga0207667_10659237 3300025949 Bacteria 1051
717 Ga0207651_10000335 3300025960 Bacteria 19911
718 Ga0207651_10734133 3300025960 Bacteria 872
719 Ga0207712_10002448 3300025961 Bacteria 11985
720 Ga0207712_10004065 3300025961 Bacteria 9233
721 Ga0207712_10030909 3300025961 Bacteria 3604
722 Ga0207712_10048380 3300025961 Bacteria 2958
723 Ga0207712_10220854 3300025961 Bacteria 1515
724 Ga0207668_10000065 3300025972 Bacteria 86273
725 Ga0207668_10029098 3300025972 Bacteria 3618
726 Ga0207668_10104967 3300025972 Bacteria 2108
727 Ga0207668_10339016 3300025972 Bacteria 1253
728 Ga0207640_10000339 3300025981 Bacteria 31004
729 Ga0207658_10004428 3300025986 Bacteria 9771
730 Ga0207658_10026143 3300025986 Bacteria 4090
731 Ga0207658_10177132 3300025986 Bacteria 1762
732 Ga0207658_10433482 3300025986 Bacteria 1161
733 Ga0207677_10003580 3300026023 Bacteria 8226
734 Ga0207677_10019568 3300026023 Bacteria 4092
735 Ga0207677_10227626 3300026023 Unclassified 1500
736 Ga0207703_10001885 3300026035 Bacteria 18620
737 Ga0207703_10047628 3300026035 Bacteria 3457
738 Ga0207703_10056702 3300026035 Bacteria 3192
739 Ga0207703_10397386 3300026035 Bacteria 1278
740 Ga0207703_10430245 3300026035 Bacteria 1230
741 Ga0207639_10041384 3300026041 Bacteria 3447
742 Ga0207639_10124568 3300026041 Bacteria 2123
743 Ga0207639_10262440 3300026041 Bacteria 1511
744 Ga0207639_10514061 3300026041 Bacteria 1096
745 Ga0207678_10000944 3300026067 Bacteria 26538
746 Ga0207678_10006342 3300026067 Bacteria 10500
747 Ga0207678_10036592 3300026067 Bacteria 4273
748 Ga0207678_10056937 3300026067 Bacteria 3364
749 Ga0207678_10058587 3300026067 Bacteria 3314
750 Ga0207678_10115709 3300026067 Bacteria 2288
751 Ga0207678_10147555 3300026067 Bacteria 2007
752 Ga0207678_10160477 3300026067 Bacteria 1920
753 Ga0207708_10002019 3300026075 Bacteria 14954
754 Ga0207708_10002166 3300026075 Bacteria 14494
755 Ga0207708_10019423 3300026075 Bacteria 5122
756 Ga0207708_10031033 3300026075 Bacteria 4056
757 Ga0207702_10028991 3300026078 Bacteria 4603
758 Ga0207702_10070772 3300026078 Bacteria 3001
759 Ga0207702_10084985 3300026078 Bacteria 2757
760 Ga0207641_10005810 3300026088 Bacteria 10470
761 Ga0207641_10073016 3300026088 Bacteria 2956
762 Ga0207641_10169305 3300026088 Bacteria 1992
763 Ga0207641_10184921 3300026088 Bacteria 1911
764 Ga0207641_10726252 3300026088 Bacteria 979
765 Ga0207648_10003430 3300026089 Bacteria 16634
766 Ga0207648_10043776 3300026089 Bacteria 3930
767 Ga0207648_10081728 3300026089 Bacteria 2818
768 Ga0207648_10347959 3300026089 Bacteria 1336
769 Ga0207676_10008134 3300026095 Bacteria 7455
770 Ga0207676_10016804 3300026095 Bacteria 5298
771 Ga0207676_10047064 3300026095 Bacteria 3341
772 Ga0207676_10074119 3300026095 Bacteria 2741
773 Ga0207676_10084878 3300026095 Bacteria 2582
774 Ga0207676_10114967 3300026095 Bacteria 2258
775 Ga0207676_10139552 3300026095 Bacteria 2073
776 Ga0207674_10003323 3300026116 Bacteria 19775
777 Ga0207674_10005364 3300026116 Bacteria 15249
778 Ga0207674_10080241 3300026116 Bacteria 3266
779 Ga0207674_10084500 3300026116 Bacteria 3172
780 Ga0207674_10191770 3300026116 Bacteria 1993
781 Ga0207675_100000815 3300026118 Bacteria 31016
782 Ga0207675_100001837 3300026118 Bacteria 21301
783 Ga0207675_100069498 3300026118 Bacteria 3292
784 Ga0207675_100116502 3300026118 Bacteria 2525
785 Ga0207675_100140046 3300026118 Bacteria 2298
786 Ga0207683_10000001 3300026121 Bacteria 352047
787 Ga0207683_10006914 3300026121 Bacteria 9712
788 Ga0207683_10081084 3300026121 Bacteria 2879
789 Ga0207683_10252232 3300026121 Bacteria 1610
790 Ga0207698_10019683 3300026142 Bacteria 4626
791 Ga0207698_10027837 3300026142 Bacteria 4019
792 Ga0207698_10051342 3300026142 Bacteria 3152
793 Ga0207698_10072196 3300026142 Bacteria 2743
794 Ga0209969_1003168 3300027360 Bacteria 2277
795 Ga0209967_1000489 3300027364 Bacteria 5203
796 Ga0209981_1000830 3300027378 Bacteria 3900
797 Ga0210000_1000255 3300027462 Bacteria 7603
798 Ga0209179_1006000 3300027512 Bacteria 1933
799 Ga0209968_1002489 3300027526 Bacteria 2783
800 Ga0210002_1001135 3300027617 Bacteria 3706
801 Ga0210002_1027794 3300027617 Bacteria 932
802 Ga0209966_1000743 3300027695 Bacteria 6783
803 Ga0209998_10001042 3300027717 Bacteria 6950
804 Ga0209998_10002206 3300027717 Bacteria 4515
805 Ga0209974_10004114 3300027876 Bacteria 5197
806 Ga0207428_10000172 3300027907 Bacteria 90200
807 Ga0207428_10000255 3300027907 Bacteria 72962
808 Ga0207428_10003313 3300027907 Bacteria 15665
809 Ga0207428_10013736 3300027907 Bacteria 7059
810 Ga0207428_10016308 3300027907 Bacteria 6392
811 Ga0207428_10138752 3300027907 Bacteria 1857
812 Ga0207428_10184301 3300027907 Bacteria 1576
813 Ga0207428_10267944 3300027907 Bacteria 1271
814 Ga0268266_10020037 3300028379 Bacteria 5701
815 Ga0268266_10107574 3300028379 Bacteria 2466
816 Ga0268265_10009461 3300028380 Bacteria 6580
817 Ga0268265_10029653 3300028380 Bacteria 3930
818 Ga0268265_10055949 3300028380 Bacteria 2999
819 Ga0268265_10165088 3300028380 Bacteria 1886
820 Ga0268265_10173558 3300028380 Bacteria 1845
821 Ga0268264_10001153 3300028381 Bacteria 25764
822 Ga0268264_10006938 3300028381 Bacteria 9501
823 Ga0268264_10086369 3300028381 Bacteria 2695
824 Ga0268264_10236425 3300028381 Unclassified 1690
825 Ga0268264_10408859 3300028381 Bacteria 1306
826 Ga0265337_1010295 3300028556 Bacteria 3282
827 Ga0265318_10055027 3300028577 Bacteria 1490
828 Ga0265338_10035331 3300028800 Bacteria 4807
829 Ga0265338_10143015 3300028800 Bacteria 1871
830 Ga0265338_10198241 3300028800 Bacteria 1516
831 Ga0265330_10039488 3300031235 Bacteria 2097
832 Ga0265330_10081844 3300031235 Bacteria 1390
833 Ga0265330_10169430 3300031235 Bacteria 926
834 Ga0265325_10000901 3300031241 Bacteria 21471
835 Ga0265325_10002536 3300031241 Bacteria 12296
836 Ga0265325_10013945 3300031241 Bacteria 4559
837 Ga0265325_10019710 3300031241 Bacteria 3725
838 Ga0265329_10053302 3300031242 Bacteria 1286
839 Ga0265340_10007715 3300031247 Bacteria 5836
840 Ga0265340_10011101 3300031247 Bacteria 4801
841 Ga0265339_10000091 3300031249 Bacteria 75937
842 Ga0265339_10000387 3300031249 Bacteria 34871
843 Ga0265331_10040106 3300031250 Bacteria 2279
844 Ga0265316_10039292 3300031344 Bacteria 3801
845 Ga0265313_10000850 3300031595 Bacteria 30762
846 Ga0265313_10001068 3300031595 Bacteria 26548
847 Ga0265313_10004004 3300031595 Bacteria 11532
848 Ga0265313_10016620 3300031595 Bacteria 4223
849 Ga0265314_10007897 3300031711 Bacteria 9182
850 Ga0265314_10024428 3300031711 Bacteria 4582
851 Ga0265314_10156525 3300031711 Bacteria 1391
852 Ga0265342_10000196 3300031712 Bacteria 67364
853 Ga0265342_10024497 3300031712 Bacteria 3809
854 Ga0265342_10063512 3300031712 Bacteria 2170
855 Ga0373930_0000014 3300034816 Bacteria 17170
856 Ga0373948_0000493 3300034817 Bacteria 4922
857 Ga0373948_0000950 3300034817 Bacteria 3883
858 Ga0373948_0052100 3300034817 Bacteria 882
859 Ga0373950_0000145 3300034818 Bacteria 11351
860 Ga0373950_0018150 3300034818 Bacteria 1219
861 Ga0373958_0000064 3300034819 Bacteria 10619
862 Ga0373958_0026549 3300034819 Bacteria 1110
863 Ga0373938_0000946 3300034957 Bacteria 4658
864 Ga0373926_0015109 3300035083 Bacteria 2629
865 Ga0373928_0001389 3300035084 Bacteria 4719
866 Ga0373928_0007010 3300035084 Bacteria 2172
867 Ga0373929_0000101 3300035085 Bacteria 14304
868 Ga0373929_0002108 3300035085 Bacteria 3695
869 Ga0373929_0004137 3300035085 Bacteria 2603
870 Ga0373934_0010944 3300035086 Bacteria 3411
871 Ga0373940_0003765 3300035088 Bacteria 3134
872 Ga0373940_0034213 3300035088 Bacteria 1370
873 Ga0373944_0003519 3300035089 Bacteria 4048
874 Ga0373949_0000293 3300035090 Bacteria 18099
875 Ga0373949_0000952 3300035090 Bacteria 8980
876 Ga0373949_0018854 3300035090 Bacteria 1567
877 Ga0373951_0000154 3300035091 Bacteria 25002
878 Ga0373951_0021677 3300035091 Bacteria 1476
879 Ga0373952_0000030 3300035092 Bacteria 16323
880 Ga0373952_0000920 3300035092 Bacteria 5345
881 Ga0373923_0010802 3300035111 Bacteria 3333
882 Ga0373923_0016379 3300035111 Bacteria 2815
883 Ga0373923_0040531 3300035111 Bacteria 1917
884 Ga0373923_0088514 3300035111 Bacteria 1352
885 Ga0373932_0001243 3300035112 Bacteria 7237
886 Ga0373932_0003082 3300035112 Bacteria 4065
887 Ga0373932_0027504 3300035112 Unclassified 1557
888 Ga0373936_0008164 3300035113 Bacteria 3936
889 Ga0373936_0017372 3300035113 Bacteria 2769
890 Ga0373939_0000791 3300035114 Bacteria 7801
891 Ga0373939_0003691 3300035114 Bacteria 3605
892 Ga0373939_0006181 3300035114 Bacteria 2879
893 Ga0373941_0000050 3300035115 Bacteria 17747
894 Ga0373941_0020276 3300035115 Bacteria 1862
895 Ga0373945_0001214 3300035116 Bacteria 7848
896 Ga0373945_0010949 3300035116 Bacteria 2992
897 Ga0373953_0001444 3300035117 Bacteria 6890
898 Ga0373953_0013693 3300035117 Bacteria 2901
899 Ga0373954_0001943 3300035118 Bacteria 8567
900 Ga0373954_0008746 3300035118 Bacteria 4451
901 Ga0373954_0021614 3300035118 Bacteria 2914
902 Ga0373954_0032397 3300035118 Bacteria 2416
903 Ga0373954_0083291 3300035118 Bacteria 1530
904 Ga0373956_0024897 3300035119 Bacteria 2583
905 Ga0373956_0052136 3300035119 Bacteria 1840
906 Ga0373957_0005066 3300035120 Bacteria 4066
907 Ga0373960_0003068 3300035121 Bacteria 3771
908 Ga0373960_0020400 3300035121 Bacteria 1752
909 Ga0373943_0000132 3300035170 Bacteria 28317
910 Ga0373943_0000377 3300035170 Bacteria 18743
911 Ga0373943_0001792 3300035170 Bacteria 9710
912 Ga0373943_0010229 3300035170 Bacteria 4207
913 Ga0373943_0012484 3300035170 Bacteria 3826
914 Ga0373943_0020151 3300035170 Bacteria 3072
915 Ga0373943_0143635 3300035170 Bacteria 1288
916 Ga0373946_0000760 3300035171 Bacteria 10975
917 Ga0373946_0001192 3300035171 Bacteria 9005
918 Ga0373946_0005660 3300035171 Bacteria 4514
919 Ga0373946_0007440 3300035171 Bacteria 4005
920 Ga0373946_0012923 3300035171 Bacteria 3131
921 Ga0373946_0063519 3300035171 Bacteria 1577
922 Ga0373955_0000779 3300035172 Bacteria 13651
923 Ga0373955_0069284 3300035172 Bacteria 1967
924 Ga0373942_0000073 3300035207 Bacteria 21344
925 Ga0373961_0000480 3300035241 Bacteria 15603
926 Ga0373961_0034668 3300035241 Bacteria 1428
927 Ga0373962_0001214 3300035242 Bacteria 6025
928 Ga0373962_0001920 3300035242 Bacteria 4950
929 Ga0373962_0023763 3300035242 Bacteria 1634
930 Ga0373931_0000537 3300035691 Bacteria 15543
931 Ga0373931_0006018 3300035691 Bacteria 5644
932 Ga0373931_0010273 3300035691 Bacteria 4498
933 Ga0373931_0032608 3300035691 Bacteria 2696
934 Ga0373935_0000053 3300035692 Bacteria 46838
935 Ga0373935_0001261 3300035692 Bacteria 13962
936 Ga0373935_0003568 3300035692 Bacteria 9069
937 Ga0373935_0004470 3300035692 Bacteria 8211
938 Ga0373935_0009944 3300035692 Bacteria 5700
939 Ga0373935_0046856 3300035692 Bacteria 2732
940 Ga0373927_0002426 3300035695 Bacteria 13595
941 Ga0373927_0004260 3300035695 Bacteria 10044
942 Ga0373927_0032963 3300035695 Bacteria 3372
943 Ga0373927_0074416 3300035695 Bacteria 2199
944 Ga0373927_0100049 3300035695 Bacteria 1885
945 Ga0373933_0001426 3300035724 Bacteria 14019
946 Ga0373933_0021557 3300035724 Bacteria 3661
947 Ga0373933_0034416 3300035724 Bacteria 2953
948 Ga0373933_0165937 3300035724 Bacteria 1404
949 Ga0373947_0000239 3300035725 Bacteria 30999
950 Ga0373947_0000259 3300035725 Bacteria 29909
951 Ga0373947_0001656 3300035725 Bacteria 13631
952 Ga0373947_0008738 3300035725 Bacteria 5824
953 Ga0373947_0009288 3300035725 Bacteria 5649
954 Ga0373947_0085740 3300035725 Bacteria 1956
955 Ga0373947_0191699 3300035725 Bacteria 1334
956 Ga0373937_0000030 3300036401 Bacteria 122176
957 Ga0373937_0000907 3300036401 Bacteria 25212
958 Ga0373937_0001504 3300036401 Bacteria 19577
959 Ga0373937_0003255 3300036401 Bacteria 13620
960 Ga0373937_0029085 3300036401 Bacteria 5003
961 Ga0373937_0036814 3300036401 Bacteria 4458
962 Ga0373937_0090015 3300036401 Bacteria 2842
963 Ga0373937_0200872 3300036401 Bacteria 1874
964 Ga0373937_0287582 3300036401 Bacteria 1553
965 Ga0373937_0689296 3300036401 Bacteria 968
966 Ga0373925_0000002 3300037068 Bacteria 368879
967 Ga0373925_0000706 3300037068 Bacteria 31254
968 Ga0373925_0019842 3300037068 Bacteria 4890
969 Ga0373925_0024207 3300037068 Bacteria 4432
970 Ga0373925_0043540 3300037068 Bacteria 3332
971 Ga0373925_0044964 3300037068 Bacteria 3279
972 Ga0373925_0057569 3300037068 Bacteria 2912
973 Ga0373925_0120502 3300037068 Bacteria 2036
974 Ga0373925_0264489 3300037068 Bacteria 1382
975 Ga0373925_0346049 3300037068 Bacteria 1206
976 Ga0395900_0009186 3300037418 Bacteria 10132
977 Ga0395898_0003941 3300037466 Bacteria 16375
978 Ga0395898_0024197 3300037466 Bacteria 6126
979 Ga0395901_0075175 3300038443 Bacteria 3524
980 Ga0395901_0161489 3300038443 Bacteria 2353
981 Ga0436365_0005986 3300039437 Bacteria 1429
982 Ga0436365_0733539 3300039437 Bacteria 1504
983 Ga0436361_0561320 3300039447 Bacteria 6955
984 Ga0436363_1296716 3300039450 Bacteria 965
985 Ga0439453_0000288 3300041408 Bacteria 5235
986 Ga0439453_0014947 3300041408 Bacteria 1337
987 Ga0439461_0003514 3300041410 Bacteria 2581
988 Ga0451853_1447647 3300041512 Bacteria 938
989 Ga0439443_003618 3300042003 Bacteria 1965
990 Ga0439448_0182998 3300042005 Bacteria 733
991 Ga0439450_051973 3300042008 Bacteria 975
992 Ga0439455_0019342 3300042012 Bacteria 1605
993 Ga0439463_013245 3300042016 Bacteria 2030
994 Ga0439446_0001019 3300042156 Bacteria 6142
995 Ga0439434_0002451 3300042435 Bacteria 5395
996 Ga0439435_0000002 3300042436 Bacteria 34816
997 Ga0439435_0006285 3300042436 Bacteria 2662
998 Ga0439444_0002652 3300042437 Bacteria 2466
999 Ga0439440_0017585 3300042993 Bacteria 1576
1000 Ga0466966_0016428 3300044684 Bacteria 4891
1001 Ga0466963_0044109 3300044694 Bacteria 2935
1002 Ga0466963_0096637 3300044694 Bacteria 2018
1003 Ga0466963_0161577 3300044694 Bacteria 1559
1004 Ga0466964_0051022 3300044706 Bacteria 1698
1005 Ga0466971_0008622 3300044719 Bacteria 4448
1006 Ga0466957_0097636 3300044842 Bacteria 1848
1007 Ga0466957_0161700 3300044842 Bacteria 1455
1008 Ga0466957_0380297 3300044842 Bacteria 963
1009 Ga0466959_0150051 3300045049 Bacteria 1643
1010 Ga0466959_0361079 3300045049 Bacteria 990
1011 Ga0451576_0017130 3300045051 Bacteria 7970
1012 Ga0451576_0117936 3300045051 Bacteria 2763
1013 Ga0466958_0016008 3300045836 Bacteria 4311
1014 Ga0466958_0149142 3300045836 Bacteria 1475
1015 Ga0466967_0000135 3300045976 Bacteria 28276
1016 Ga0466967_0006741 3300045976 Bacteria 8174
1017 Ga0466967_0500056 3300045976 Bacteria 1193
1018 Ga0495592_0000046 3300046454 Bacteria 117345
1019 Ga0495592_0001393 3300046454 Bacteria 16741
1020 Ga0495592_0002484 3300046454 Bacteria 13030
1021 Ga0495592_0009550 3300046454 Bacteria 7298
1022 Ga0495592_0078729 3300046454 Bacteria 2387
1023 Ga0495592_0115815 3300046454 Bacteria 1892
1024 Ga0495592_0168976 3300046454 Bacteria 1499
1025 Ga0495603_0002249 3300046455 Bacteria 11338
1026 Ga0495603_0008354 3300046455 Bacteria 6257
1027 Ga0495603_0014184 3300046455 Bacteria 4821
1028 Ga0495603_0050857 3300046455 Bacteria 2463
1029 Ga0495603_0102843 3300046455 Bacteria 1667
1030 Ga0495591_048065 3300046458 Bacteria 1178
1031 Ga0495629_0000594 3300046459 Bacteria 29414
1032 Ga0495629_0001140 3300046459 Bacteria 20980
1033 Ga0495629_0002311 3300046459 Bacteria 14684
1034 Ga0495629_0019080 3300046459 Bacteria 4903
1035 Ga0495629_0024508 3300046459 Bacteria 4297
1036 Ga0495629_0033237 3300046459 Bacteria 3649
1037 Ga0495629_0084401 3300046459 Bacteria 2216
1038 Ga0495629_0100862 3300046459 Bacteria 2014
1039 Ga0495629_0117093 3300046459 Bacteria 1857
1040 Ga0495641_0007754 3300046461 Bacteria 6650
1041 Ga0495641_0011331 3300046461 Bacteria 5090
1042 Ga0495641_0016661 3300046461 Bacteria 3862
1043 Ga0495641_0017820 3300046461 Bacteria 3686
1044 Ga0495641_0142861 3300046461 Bacteria 1069
1045 Ga0495651_0000822 3300046462 Bacteria 24113
1046 Ga0495651_0001833 3300046462 Bacteria 16410
1047 Ga0495651_0004816 3300046462 Bacteria 10326
1048 Ga0495653_0000006 3300046463 Bacteria 363285
1049 Ga0495653_0004798 3300046463 Bacteria 10964
1050 Ga0495653_0024139 3300046463 Bacteria 4904
1051 Ga0495653_0357386 3300046463 Bacteria 938
1052 Ga0495580_0017640 3300046472 Bacteria 5332
1053 Ga0495580_0044484 3300046472 Bacteria 3157
1054 Ga0495582_0000379 3300046473 Bacteria 24152
1055 Ga0495582_0010594 3300046473 Bacteria 5072
1056 Ga0495582_0028169 3300046473 Bacteria 3083
1057 Ga0495582_0032148 3300046473 Bacteria 2887
1058 Ga0495582_0141949 3300046473 Bacteria 1361
1059 Ga0495582_0231817 3300046473 Bacteria 1057
1060 Ga0495582_0284725 3300046473 Bacteria 949
1061 Ga0495605_0023685 3300046474 Bacteria 3224
1062 Ga0495639_0004321 3300046475 Bacteria 6094
1063 Ga0495639_0015125 3300046475 Bacteria 3346
1064 Ga0495639_0030966 3300046475 Bacteria 2379
1065 Ga0495639_0050475 3300046475 Bacteria 1890
1066 Ga0495662_0000084 3300046476 Bacteria 33781
1067 Ga0495662_0000280 3300046476 Bacteria 21964
1068 Ga0495662_0002481 3300046476 Bacteria 9294
1069 Ga0495662_0021388 3300046476 Bacteria 3127
1070 Ga0495662_0068233 3300046476 Bacteria 1722
1071 Ga0495662_0188970 3300046476 Bacteria 1016
1072 Ga0495664_0000002 3300046477 Bacteria 625183
1073 Ga0495664_0000112 3300046477 Bacteria 40522
1074 Ga0495664_0007745 3300046477 Bacteria 5977
1075 Ga0495584_0033756 3300046491 Bacteria 2590
1076 Ga0495584_0037617 3300046491 Bacteria 2447
1077 Ga0495584_0242075 3300046491 Bacteria 917
1078 Ga0495585_0001932 3300046492 Bacteria 15492
1079 Ga0495594_0002726 3300046499 Bacteria 9162
1080 Ga0495594_0009110 3300046499 Bacteria 5124
1081 Ga0495594_0011284 3300046499 Bacteria 4642
1082 Ga0495594_0018037 3300046499 Bacteria 3737
1083 Ga0495583_0102989 3300046506 Bacteria 1217
1084 Ga0495608_0000006 3300046511 Bacteria 324334
1085 Ga0495608_0012927 3300046511 Bacteria 5794
1086 Ga0495608_0017846 3300046511 Bacteria 4905
1087 Ga0495618_0000034 3300046514 Bacteria 104335
1088 Ga0495618_0001016 3300046514 Bacteria 19217
1089 Ga0495618_0001547 3300046514 Bacteria 15443
1090 Ga0495618_0073148 3300046514 Bacteria 2182
1091 Ga0495618_0131903 3300046514 Bacteria 1598
1092 Ga0495618_0287857 3300046514 Unclassified 1023
1093 Ga0495628_0000002 3300046516 Bacteria 589399
1094 Ga0495628_0003624 3300046516 Bacteria 13800
1095 Ga0495628_0027943 3300046516 Bacteria 4586
1096 Ga0495628_0032270 3300046516 Bacteria 4229
1097 Ga0495628_0101756 3300046516 Bacteria 2217
1098 Ga0495630_0000662 3300046517 Bacteria 24856
1099 Ga0495630_0005622 3300046517 Bacteria 8855
1100 Ga0495630_0027968 3300046517 Bacteria 4189
1101 Ga0495630_0042264 3300046517 Bacteria 3404
1102 Ga0495630_0095680 3300046517 Unclassified 2245
1103 Ga0495630_0257836 3300046517 Bacteria 1332
1104 Ga0495637_0020521 3300046520 Bacteria 3041
1105 Ga0495637_0090560 3300046520 Bacteria 1207
1106 Ga0495644_0003085 3300046523 Bacteria 6594
1107 Ga0495663_0013733 3300046525 Bacteria 2265
1108 Ga0495663_0021273 3300046525 Bacteria 1868
1109 Ga0495666_0001508 3300046526 Bacteria 11395
1110 Ga0495666_0012392 3300046526 Bacteria 4250
1111 Ga0495666_0033888 3300046526 Bacteria 2493
1112 Ga0495666_0034119 3300046526 Bacteria 2483
1113 Ga0495652_0000004 3300046529 Bacteria 588877
1114 Ga0495652_0013904 3300046529 Bacteria 7238
1115 Ga0495652_0019057 3300046529 Bacteria 6112
1116 Ga0495652_0026657 3300046529 Bacteria 5103
1117 Ga0495652_0307758 3300046529 Bacteria 1149
1118 Ga0495665_0003909 3300046531 Bacteria 8063
1119 Ga0495665_0014689 3300046531 Bacteria 4221
1120 Ga0495665_0017779 3300046531 Bacteria 3821
1121 Ga0495665_0098481 3300046531 Bacteria 1535
1122 Ga0495640_0000007 3300046533 Bacteria 265481
1123 Ga0495640_0006199 3300046533 Bacteria 9472
1124 Ga0495640_0008881 3300046533 Bacteria 7849
1125 Ga0495640_0010455 3300046533 Bacteria 7168
1126 Ga0495640_0065752 3300046533 Bacteria 2447
1127 Ga0495586_0032879 3300046535 Bacteria 2782
1128 Ga0495587_0000031 3300046536 Bacteria 126721
1129 Ga0495587_0002979 3300046536 Bacteria 11321
1130 Ga0495587_0016339 3300046536 Bacteria 4618
1131 Ga0495587_0018087 3300046536 Bacteria 4371
1132 Ga0495587_0193285 3300046536 Bacteria 1152
1133 Ga0495598_0004396 3300046537 Bacteria 3048
1134 Ga0495598_0087189 3300046537 Bacteria 1011
1135 Ga0495621_0011059 3300046539 Bacteria 2780
1136 Ga0495645_0000003 3300046543 Bacteria 570133
1137 Ga0495645_0005275 3300046543 Bacteria 8852
1138 Ga0495645_0010875 3300046543 Bacteria 6391
1139 Ga0495645_0011025 3300046543 Bacteria 6352
1140 Ga0495645_0263654 3300046543 Bacteria 1140
1141 Ga0495622_0014593 3300046557 Bacteria 3649
1142 Ga0495622_0049494 3300046557 Bacteria 1951
1143 Ga0495633_0057678 3300046558 Bacteria 1824
1144 Ga0495667_0000002 3300046559 Bacteria 437535
1145 Ga0495667_0000202 3300046559 Bacteria 40046
1146 Ga0495667_0032919 3300046559 Bacteria 3470
1147 Ga0495667_0295836 3300046559 Bacteria 1026
1148 Ga0495667_0330463 3300046559 Unclassified 964
1149 Ga0495667_0330949 3300046559 Bacteria 963
1150 Ga0495656_0000360 3300046615 Bacteria 15300
1151 Ga0495656_0023542 3300046615 Bacteria 2424
1152 Ga0495668_0142440 3300046616 Bacteria 1312
1153 Ga0495634_0008544 3300046642 Bacteria 7612
1154 Ga0495634_0021106 3300046642 Bacteria 4610
1155 Ga0495634_0021460 3300046642 Bacteria 4564
1156 Ga0495634_0255009 3300046642 Bacteria 1072
1157 Ga0495611_0053456 3300046648 Bacteria 1823
1158 Ga0495635_0000022 3300046663 Bacteria 160907
1159 Ga0495635_0002093 3300046663 Bacteria 13548
1160 Ga0495635_0013894 3300046663 Bacteria 5633
1161 Ga0495635_0166962 3300046663 Bacteria 1497
1162 Ga0495635_0235696 3300046663 Bacteria 1235
1163 Ga0495635_0473144 3300046663 Bacteria 827
1164 Ga0495659_0037099 3300046664 Bacteria 1725
1165 Ga0495661_0010683 3300046665 Bacteria 6254
1166 Ga0495588_0025753 3300046674 Bacteria 2933
1167 Ga0495588_0075208 3300046674 Bacteria 1759
1168 Ga0495657_0000276 3300046675 Bacteria 46295
1169 Ga0495657_0031463 3300046675 Bacteria 3709
1170 Ga0495599_0000001 3300046678 Bacteria 537563
1171 Ga0495599_0002835 3300046678 Bacteria 10095
1172 Ga0495599_0317649 3300046678 Bacteria 938
1173 Ga0495623_0000094 3300046679 Bacteria 53328
1174 Ga0495623_0001448 3300046679 Bacteria 16089
1175 Ga0495623_0335799 3300046679 Bacteria 826
1176 Ga0495646_0000007 3300046680 Bacteria 236764
1177 Ga0495646_0029532 3300046680 Bacteria 3427
1178 Ga0495646_0033018 3300046680 Bacteria 3219
1179 Ga0495646_0144654 3300046680 Bacteria 1326
1180 Ga0495647_0000122 3300046681 Bacteria 19930
1181 Ga0495647_0000393 3300046681 Bacteria 12484
1182 Ga0495647_0001922 3300046681 Bacteria 6479
1183 Ga0495647_0050007 3300046681 Bacteria 1621
1184 Ga0495658_0000210 3300046683 Bacteria 33648
1185 Ga0495658_0009937 3300046683 Bacteria 4747
1186 Ga0495658_0026729 3300046683 Bacteria 3096
1187 Ga0495658_0081190 3300046683 Bacteria 1903
1188 Ga0495669_0084935 3300046684 Bacteria 1456
1189 Ga0495613_0086199 3300046689 Bacteria 2277
1190 Ga0495624_0000222 3300046690 Bacteria 44293
1191 Ga0495624_0001294 3300046690 Bacteria 19719
1192 Ga0495624_0029382 3300046690 Bacteria 3586
1193 Ga0495624_0031182 3300046690 Bacteria 3469
1194 Ga0495624_0063300 3300046690 Bacteria 2312
1195 Ga0495624_0290652 3300046690 Bacteria 986
1196 Ga0495670_0001624 3300046691 Bacteria 11000
1197 Ga0495670_0047900 3300046691 Bacteria 2137
1198 Ga0495589_0158326 3300046794 Bacteria 1079
1199 Ga0495600_0000033 3300046809 Bacteria 83590
1200 Ga0495600_0000506 3300046809 Bacteria 20198
1201 Ga0495600_0002658 3300046809 Bacteria 10329
1202 Ga0495600_0030323 3300046809 Bacteria 3503
1203 Ga0495600_0194032 3300046809 Bacteria 1305
1204 Ga0495600_0312572 3300046809 Bacteria 989
1205 Ga0495581_0005193 3300047315 Bacteria 7534
1206 Ga0495581_0005649 3300047315 Bacteria 7252
1207 Ga0495581_0020808 3300047315 Bacteria 3806
1208 Ga0495581_0021146 3300047315 Bacteria 3774
1209 Ga0495604_0000005 3300047317 Bacteria 424516
1210 Ga0495604_0001089 3300047317 Bacteria 22540
1211 Ga0495604_0002751 3300047317 Bacteria 14105
1212 Ga0495604_0007025 3300047317 Bacteria 8925
1213 Ga0495604_0082269 3300047317 Bacteria 2408
1214 Ga0495636_0016055 3300047318 Bacteria 2988
1215 Ga0495674_0000003 3300047319 Bacteria 562126
1216 Ga0495674_0001490 3300047319 Bacteria 22945
1217 Ga0495674_0001513 3300047319 Bacteria 22779
1218 Ga0495674_0014630 3300047319 Bacteria 7343
1219 Ga0495674_0026272 3300047319 Bacteria 5329
1220 Ga0495674_0058792 3300047319 Bacteria 3360
1221 Ga0495674_0096001 3300047319 Bacteria 2527
1222 Ga0495674_0240133 3300047319 Bacteria 1493
1223 Ga0495674_0565763 3300047319 Bacteria 903
1224 Ga0495672_0122114 3300047320 Bacteria 1383
1225 Ga0495676_0000289 3300047321 Bacteria 40718
1226 Ga0495676_0021676 3300047321 Bacteria 5605
1227 Ga0495676_0167572 3300047321 Bacteria 1548
1228 Ga0495680_0000091 3300047322 Bacteria 81622
1229 Ga0495680_0001414 3300047322 Bacteria 25878
1230 Ga0495680_0012301 3300047322 Bacteria 7541
1231 Ga0495680_0064482 3300047322 Bacteria 2809
1232 Ga0495675_0000064 3300047444 Bacteria 74132
1233 Ga0495675_0007298 3300047444 Bacteria 6809
1234 Ga0495677_0148172 3300047445 Bacteria 903
1235 Ga0495685_131822 3300047447 Bacteria 817
1236 Ga0495684_0000035 3300047471 Bacteria 107768
1237 Ga0495684_0000075 3300047471 Bacteria 67922
1238 Ga0495684_0000264 3300047471 Bacteria 41677
1239 Ga0495684_0001309 3300047471 Bacteria 20014
1240 Ga0495684_0420568 3300047471 Bacteria 934
1241 Ga0495593_0000228 3300047673 Bacteria 30037
1242 Ga0495593_0001106 3300047673 Bacteria 15737
1243 Ga0495593_0014059 3300047673 Bacteria 4556
1244 Ga0495593_0020031 3300047673 Bacteria 3746
1245 Ga0495593_0037694 3300047673 Bacteria 2613
1246 Ga0495593_0215723 3300047673 Unclassified 963
1247 Ga0495602_0000029 3300048088 Bacteria 142344
1248 Ga0495602_0002033 3300048088 Bacteria 20344
1249 Ga0495602_0018847 3300048088 Bacteria 6872
1250 Ga0495602_0147942 3300048088 Bacteria 1850
1251 Ga0495602_0250469 3300048088 Bacteria 1320
1252 Ga0495602_0298434 3300048088 Bacteria 1180
1253 Ga0495614_0017130 3300048089 Bacteria 3149
1254 Ga0495614_0024948 3300048089 Bacteria 2580
1255 Ga0496100_0000404 3300048903 Bacteria 20908
1256 Ga0496100_0000823 3300048903 Bacteria 14892
1257 Ga0496100_0017884 3300048903 Bacteria 4194
1258 Ga0496100_0021550 3300048903 Bacteria 3883
1259 Ga0496101_0000423 3300048904 Bacteria 27228
1260 Ga0496101_0008909 3300048904 Bacteria 6574
1261 Ga0496101_0013330 3300048904 Bacteria 5504
1262 Ga0496101_0051874 3300048904 Bacteria 2956
1263 Ga0496101_0051974 3300048904 Bacteria 2953
1264 Ga0496101_0060493 3300048904 Bacteria 2748
1265 Ga0496101_0062028 3300048904 Bacteria 2717
1266 Ga0496102_0003323 3300048905 Bacteria 13636
1267 Ga0496102_0047059 3300048905 Bacteria 3918
1268 Ga0496102_0050819 3300048905 Bacteria 3775
1269 Ga0496102_0087854 3300048905 Bacteria 2872
1270 Ga0496102_0149714 3300048905 Bacteria 2192
1271 Ga0496102_0422390 3300048905 Bacteria 1252
1272 Ga0496103_0000967 3300048906 Bacteria 20341
1273 Ga0496103_0009318 3300048906 Bacteria 5817
1274 Ga0496103_0018841 3300048906 Bacteria 4143
1275 Ga0496103_0023575 3300048906 Bacteria 3712
1276 Ga0496103_0059818 3300048906 Bacteria 2367
1277 Ga0496103_0085283 3300048906 Bacteria 1990
1278 Ga0496103_0087744 3300048906 Bacteria 1961
1279 Ga0496103_0514955 3300048906 Bacteria 765
1280 Ga0496104_0000711 3300048907 Bacteria 28620
1281 Ga0496104_0000925 3300048907 Bacteria 25187
1282 Ga0496104_0005217 3300048907 Bacteria 11362
1283 Ga0496104_0005466 3300048907 Bacteria 11129
1284 Ga0496104_0014835 3300048907 Bacteria 7042
1285 Ga0496104_0018532 3300048907 Bacteria 6351
1286 Ga0496104_0018853 3300048907 Bacteria 6302
1287 Ga0496104_0037286 3300048907 Bacteria 4546
1288 Ga0496104_0086618 3300048907 Bacteria 2990
1289 Ga0496104_0181717 3300048907 Bacteria 2014
1290 Ga0496105_0004562 3300048908 Bacteria 10431
1291 Ga0496105_0015258 3300048908 Bacteria 6119
1292 Ga0496105_0025218 3300048908 Bacteria 4837
1293 Ga0496105_0079464 3300048908 Bacteria 2708
1294 Ga0496105_0081682 3300048908 Bacteria 2669
1295 Ga0496105_0272168 3300048908 Bacteria 1367
1296 Ga0496106_0002446 3300048909 Bacteria 13839
1297 Ga0496106_0003669 3300048909 Bacteria 11448
1298 Ga0496106_0009344 3300048909 Bacteria 7247
1299 Ga0496106_0015174 3300048909 Bacteria 5701
1300 Ga0496106_0028983 3300048909 Bacteria 4125
1301 Ga0496106_0046079 3300048909 Bacteria 3277
1302 Ga0496106_0050986 3300048909 Bacteria 3120
1303 Ga0496106_0100583 3300048909 Bacteria 2242
1304 Ga0496106_0226765 3300048909 Bacteria 1491
1305 Ga0496107_0000500 3300048910 Bacteria 21655
1306 Ga0496107_0010585 3300048910 Bacteria 6412
1307 Ga0496107_0022186 3300048910 Bacteria 4486
1308 Ga0496107_0035757 3300048910 Bacteria 3561
1309 Ga0496107_0036271 3300048910 Bacteria 3536
1310 Ga0496107_0046339 3300048910 Bacteria 3129
1311 Ga0496107_0356698 3300048910 Bacteria 1088
1312 Ga0496108_0010045 3300048911 Bacteria 7677
1313 Ga0496108_0032769 3300048911 Bacteria 4315
1314 Ga0496108_0039555 3300048911 Bacteria 3930
1315 Ga0496108_0048346 3300048911 Bacteria 3556
1316 Ga0496108_0054148 3300048911 Bacteria 3367
1317 Ga0496108_0129685 3300048911 Bacteria 2167
1318 Ga0496109_0000340 3300048912 Bacteria 43565
1319 Ga0496109_0000359 3300048912 Bacteria 42297
1320 Ga0496109_0000976 3300048912 Bacteria 23658
1321 Ga0496109_0005940 3300048912 Bacteria 10246
1322 Ga0496109_0015600 3300048912 Bacteria 6625
1323 Ga0496109_0060588 3300048912 Bacteria 3458
1324 Ga0496109_0126561 3300048912 Bacteria 2382
1325 Ga0496109_0151191 3300048912 Bacteria 2173
1326 Ga0496109_0356430 3300048912 Bacteria 1382
1327 Ga0496109_0547656 3300048912 Bacteria 1091
1328 Ga0496110_0002357 3300048913 Bacteria 14148
1329 Ga0496110_0003362 3300048913 Bacteria 12213
1330 Ga0496110_0014914 3300048913 Bacteria 6458
1331 Ga0496110_0027384 3300048913 Bacteria 4886
1332 Ga0496110_0034978 3300048913 Bacteria 4355
1333 Ga0496110_0054089 3300048913 Bacteria 3531
1334 Ga0496110_0061174 3300048913 Bacteria 3323
1335 Ga0496110_0180349 3300048913 Bacteria 1917
1336 Ga0496111_0007077 3300048914 Bacteria 7329
1337 Ga0496111_0012965 3300048914 Bacteria 5658
1338 Ga0496111_0021239 3300048914 Bacteria 4530
1339 Ga0496111_0023917 3300048914 Bacteria 4294
1340 Ga0496111_0040590 3300048914 Bacteria 3338
1341 Ga0496111_0069085 3300048914 Bacteria 2569
1342 Ga0496111_0108052 3300048914 Bacteria 2049
1343 Ga0496111_0129596 3300048914 Bacteria 1866
1344 Ga0496111_0149808 3300048914 Bacteria 1730
1345 Ga0496112_0006271 3300048915 Bacteria 10427
1346 Ga0496112_0021049 3300048915 Bacteria 6194
1347 Ga0496112_0044120 3300048915 Bacteria 4367
1348 Ga0496112_0051703 3300048915 Bacteria 4030
1349 Ga0496112_0167221 3300048915 Bacteria 2165
1350 Ga0496112_0176044 3300048915 Bacteria 2104
1351 Ga0496112_0198456 3300048915 Bacteria 1966
1352 Ga0496112_0351325 3300048915 Bacteria 1417
1353 Ga0496113_0000463 3300048916 Bacteria 19814
1354 Ga0496113_0001950 3300048916 Bacteria 11812
1355 Ga0496113_0002665 3300048916 Bacteria 10463
1356 Ga0496113_0008785 3300048916 Bacteria 6598
1357 Ga0496113_0008826 3300048916 Bacteria 6585
1358 Ga0496113_0053025 3300048916 Bacteria 3031
1359 Ga0496113_0431387 3300048916 Bacteria 1059
1360 Ga0496114_0021314 3300048917 Bacteria 5271
1361 Ga0496114_0046871 3300048917 Bacteria 3592
1362 Ga0496114_0081951 3300048917 Bacteria 2726
1363 Ga0496114_0109867 3300048917 Bacteria 2361
1364 Ga0496114_0157710 3300048917 Bacteria 1971
1365 Ga0496115_0009234 3300048918 Bacteria 7323
1366 Ga0496115_0019987 3300048918 Bacteria 5160
1367 Ga0496115_0045224 3300048918 Bacteria 3514
1368 Ga0496115_0067163 3300048918 Bacteria 2899
1369 Ga0496115_0073699 3300048918 Bacteria 2771
1370 Ga0501031_0011742 3300049568 Bacteria 5713
1371 Ga0501031_0156179 3300049568 Bacteria 1491
1372 Ga0501032_0019959 3300049569 Bacteria 4677
1373 Ga0501033_0017940 3300049570 Bacteria 5343
1374 Ga0501033_0190471 3300049570 Bacteria 1468
1375 Ga0501033_0311955 3300049570 Bacteria 1106
1376 Ga0501034_0006692 3300049571 Bacteria 12361
1377 Ga0501034_0020000 3300049571 Bacteria 6837
1378 Ga0501034_0029366 3300049571 Bacteria 5588
1379 Ga0501034_0305192 3300049571 Bacteria 1527
1380 Ga0501034_0931952 3300049571 Bacteria 755
1381 Ga0501036_0018021 3300049572 Bacteria 5912
1382 Ga0501037_0007895 3300049573 Bacteria 7797
1383 Ga0501037_0071272 3300049573 Bacteria 2528
1384 Ga0501037_0102956 3300049573 Bacteria 2059
1385 Ga0501037_0259157 3300049573 Bacteria 1215
1386 Ga0501038_0043904 3300049574 Bacteria 3886
1387 Ga0501038_0064678 3300049574 Bacteria 3118
1388 Ga0501038_0076041 3300049574 Bacteria 2837
1389 Ga0501039_0121235 3300049575 Bacteria 2049
1390 Ga0501039_0188401 3300049575 Bacteria 1623
1391 Ga0501039_0193552 3300049575 Bacteria 1599
1392 Ga0501039_0237492 3300049575 Bacteria 1433
1393 Ga0501040_0012594 3300049576 Bacteria 5545
1394 Ga0501040_0018457 3300049576 Bacteria 4631
1395 Ga0501040_0076897 3300049576 Bacteria 2308
1396 Ga0501040_0213128 3300049576 Bacteria 1373
1397 Ga0501041_0017024 3300049577 Bacteria 4325
1398 Ga0501041_0027793 3300049577 Bacteria 3410
1399 Ga0501041_0075493 3300049577 Bacteria 2073
1400 Ga0501042_0241243 3300049578 Bacteria 1304
1401 Ga0501042_0567114 3300049578 Bacteria 825
1402 Ga0501043_0015891 3300049579 Bacteria 5900
1403 Ga0501043_0050356 3300049579 Bacteria 3274
1404 Ga0501043_0096527 3300049579 Bacteria 2323
1405 Ga0501043_0503787 3300049579 Bacteria 904
1406 Ga0501046_0012829 3300049580 Bacteria 7129
1407 Ga0501046_0031228 3300049580 Bacteria 4320
1408 Ga0501046_0043437 3300049580 Bacteria 3578
1409 Ga0501047_0006347 3300049581 Bacteria 11116
1410 Ga0501047_0009067 3300049581 Bacteria 9395
1411 Ga0501047_0018859 3300049581 Bacteria 6617
1412 Ga0501047_0198550 3300049581 Bacteria 1867
1413 Ga0501048_0004440 3300049582 Bacteria 10687
1414 Ga0501048_0229114 3300049582 Bacteria 1318
1415 Ga0501067_0018631 3300049583 Bacteria 3843
1416 Ga0501068_0043146 3300049584 Bacteria 2713
1417 Ga0501068_0284541 3300049584 Bacteria 1057
1418 Ga0501069_0017442 3300049585 Bacteria 3863
1419 Ga0501069_0046105 3300049585 Bacteria 2417
1420 Ga0501069_0139164 3300049585 Bacteria 1392
1421 Ga0501070_0003185 3300049586 Bacteria 14271
1422 Ga0501070_0004846 3300049586 Bacteria 11495
1423 Ga0501070_0014654 3300049586 Bacteria 6597
1424 Ga0501070_0053740 3300049586 Bacteria 3340
1425 Ga0501070_0359275 3300049586 Bacteria 1182
1426 Ga0501071_0057606 3300049587 Bacteria 2809
1427 Ga0501071_0099765 3300049587 Bacteria 2140
1428 Ga0501072_0011302 3300049588 Bacteria 6820
1429 Ga0501072_0030502 3300049588 Bacteria 4218
1430 Ga0501072_0106645 3300049588 Bacteria 2228
1431 Ga0501072_0106796 3300049588 Bacteria 2227
1432 Ga0501072_0310850 3300049588 Bacteria 1253
1433 Ga0501072_0328612 3300049588 Bacteria 1215
1434 Ga0501073_0029987 3300049589 Bacteria 3885
1435 Ga0501074_0033113 3300049590 Bacteria 3745
1436 Ga0501074_0049131 3300049590 Bacteria 3046
1437 Ga0501074_0099597 3300049590 Bacteria 2081
1438 Ga0501075_0004734 3300049591 Bacteria 9250
1439 Ga0501075_0044232 3300049591 Bacteria 3341
1440 Ga0501075_0085345 3300049591 Bacteria 2392
1441 Ga0501075_0098564 3300049591 Bacteria 2219
1442 Ga0501076_0001405 3300049592 Bacteria 16125
1443 Ga0501076_0010937 3300049592 Bacteria 6749
1444 Ga0501076_0086410 3300049592 Bacteria 2521
1445 Ga0501076_0102344 3300049592 Bacteria 2309
1446 Ga0501076_0186014 3300049592 Bacteria 1694
1447 Ga0501076_0280921 3300049592 Bacteria 1364
1448 Ga0501077_0007341 3300049593 Bacteria 6798
1449 Ga0501077_0034622 3300049593 Bacteria 3214
1450 Ga0501077_0349144 3300049593 Unclassified 944
1451 Ga0501079_0003233 3300049741 Bacteria 11932
1452 Ga0501079_0016017 3300049741 Bacteria 5728
1453 Ga0501079_0048600 3300049741 Bacteria 3274
1454 Ga0501079_0175830 3300049741 Bacteria 1669
1455 Ga0501079_0210955 3300049741 Bacteria 1517
1456 Ga0501079_0323761 3300049741 Bacteria 1207
1457 Ga0501080_0021206 3300049742 Bacteria 6013
1458 Ga0501080_0025076 3300049742 Bacteria 5533
1459 Ga0501080_0247783 3300049742 Bacteria 1625
1460 Ga0501081_0001767 3300049743 Bacteria 13415
1461 Ga0501081_0010499 3300049743 Bacteria 6045
1462 Ga0501081_0038168 3300049743 Bacteria 3280
1463 Ga0501081_0058154 3300049743 Bacteria 2675
1464 Ga0501083_0011824 3300049744 Bacteria 6116
1465 Ga0501083_0026837 3300049744 Bacteria 3979
1466 Ga0501083_0146022 3300049744 Bacteria 1549
1467 Ga0501083_0157043 3300049744 Bacteria 1489
1468 Ga0501035_0000127 3300049822 Bacteria 92397
1469 Ga0501035_0005073 3300049822 Bacteria 12482
1470 Ga0501035_0068477 3300049822 Bacteria 3147
1471 Ga0501035_0255397 3300049822 Bacteria 1487
1472 Ga0501035_0289417 3300049822 Bacteria 1383
1473 Ga0501044_0001312 3300049823 Bacteria 29308
1474 Ga0501044_0008177 3300049823 Bacteria 11483
1475 Ga0501044_0030205 3300049823 Bacteria 5712
1476 Ga0501044_0083642 3300049823 Bacteria 3227
1477 Ga0501044_0117406 3300049823 Bacteria 2664
1478 Ga0501044_0163053 3300049823 Bacteria 2204
1479 Ga0501044_0192296 3300049823 Bacteria 2002
1480 Ga0501044_0208105 3300049823 Bacteria 1911
1481 Ga0501044_0225240 3300049823 Bacteria 1825
1482 Ga0501044_0281404 3300049823 Bacteria 1597
1483 Ga0501045_0018155 3300049824 Bacteria 4999
1484 Ga0501045_0037333 3300049824 Bacteria 3530
1485 Ga0501045_0089530 3300049824 Bacteria 2273
1486 Ga0501045_0163184 3300049824 Bacteria 1659
1487 Ga0501045_0393783 3300049824 Bacteria 1031
1488 Ga0501045_0485933 3300049824 Bacteria 917
1489 nmdc:mga03683_4783_c1 3300050489 Bacteria 4521
1490 nmdc:mga00v17_40420_c1 3300050491 Bacteria 2797
1491 nmdc:mga00v17_4490_c1 3300050491 Bacteria 7264
1492 nmdc:mga0yw44_47840_c1 3300050492 Bacteria 2576
1493 nmdc:mga0yw44_60962_c1 3300050492 Bacteria 2313
1494 nmdc:mga06z11_23201_c1 3300050494 Bacteria 2911
1495 nmdc:mga06z11_26428_c1 3300050494 Bacteria 2762
1496 nmdc:mga05p37_149738_c1 3300050507 Bacteria 2856
1497 nmdc:mga05p37_1808_c2 3300050507 Bacteria 13333
1498 nmdc:mga05p37_193955_c1 3300050507 Bacteria 2464
1499 nmdc:mga05p37_22036_c1 3300050507 Bacteria 7720
1500 nmdc:mga05p37_35541_c1 3300050507 Bacteria 4652
1501 nmdc:mga05p37_45950_c1 3300050507 Bacteria 5370
1502 nmdc:mga05p37_508_c2 3300050507 Bacteria 7955
1503 nmdc:mga05p37_661502_c1 3300050507 Bacteria 1168
1504 nmdc:mga05p37_875422_c1 3300050507 Bacteria 972
1505 nmdc:mga09592_226707_c1 3300050508 Bacteria 1619
1506 nmdc:mga09592_421671_c1 3300050508 Bacteria 1153
1507 nmdc:mga09592_513695_c1 3300050508 Bacteria 1031
1508 nmdc:mga09592_78404_c1 3300050508 Bacteria 2811
1509 nmdc:mga0qj67_335685_c1 3300050509 Bacteria 1223
1510 nmdc:mga0qj67_6112_c1 3300050509 Bacteria 8826
1511 nmdc:mga0qj67_63707_c1 3300050509 Bacteria 2932
1512 nmdc:mga06r32_101497_c1 3300050510 Bacteria 2824
1513 nmdc:mga06r32_142417_c1 3300050510 Bacteria 2374
1514 nmdc:mga06r32_1960_c1 3300050510 Bacteria 18367
1515 nmdc:mga06r32_3441_c1 3300050510 Bacteria 14162
1516 nmdc:mga06r32_59228_c1 3300050510 Bacteria 3682
1517 nmdc:mga08y16_14675_c1 3300050511 Bacteria 8238
1518 nmdc:mga08y16_172282_c1 3300050511 Bacteria 2248
1519 nmdc:mga08y16_2332_c1 3300050511 Bacteria 19466
1520 nmdc:mga08y16_272265_c1 3300050511 Bacteria 1748
1521 nmdc:mga08y16_306842_c1 3300050511 Bacteria 1635
1522 nmdc:mga08y16_3146_c1 3300050511 Bacteria 17090
1523 nmdc:mga08y16_3939_c1 3300050511 Bacteria 15466
1524 nmdc:mga08y16_45632_c1 3300050511 Bacteria 4591
1525 nmdc:mga08y16_643609_c1 3300050511 Bacteria 1065
1526 nmdc:mga08y16_89125_c1 3300050511 Bacteria 3215
1527 nmdc:mga08y16_9215_c1 3300050511 Bacteria 10357
1528 nmdc:mga0n895_141652_c1 3300050512 Bacteria 2433
1529 nmdc:mga0n895_145_c1 3300050512 Bacteria 43408
1530 nmdc:mga0n895_30075_c1 3300050512 Bacteria 5187
1531 nmdc:mga0n895_37534_c1 3300050512 Bacteria 4688
1532 nmdc:mga0n895_4696_c1 3300050512 Bacteria 11271
1533 nmdc:mga0n895_493926_c1 3300050512 Bacteria 1233
1534 nmdc:mga0n895_69426_c1 3300050512 Bacteria 3491
1535 nmdc:mga0n895_952226_c1 3300050512 Bacteria 842
1536 nmdc:mga0rr50_149655_c1 3300050513 Bacteria 1885
1537 nmdc:mga0rr50_1966_c1 3300050513 Bacteria 11411
1538 nmdc:mga0rr50_25674_c1 3300050513 Bacteria 4099
1539 nmdc:mga0rr50_2684_c1 3300050513 Bacteria 10078
1540 nmdc:mga0rr50_367066_c1 3300050513 Bacteria 1212
1541 nmdc:mga0rr50_42859_c1 3300050513 Bacteria 3308
1542 nmdc:mga0rr50_435442_c1 3300050513 Bacteria 1110
1543 nmdc:mga0rr50_48815_c1 3300050513 Bacteria 3131
1544 nmdc:mga0rr50_75948_c1 3300050513 Bacteria 2577
1545 nmdc:mga08x19_1133_c1 3300050514 Bacteria 16621
1546 nmdc:mga08x19_116183_c1 3300050514 Bacteria 1789
1547 nmdc:mga08x19_127257_c1 3300050514 Bacteria 1711
1548 nmdc:mga08x19_21279_c1 3300050514 Bacteria 4001
1549 nmdc:mga08x19_33203_c1 3300050514 Bacteria 3256
1550 nmdc:mga08x19_33421_c1 3300050514 Bacteria 3246
1551 nmdc:mga08x19_46164_c1 3300050514 Bacteria 2785
1552 nmdc:mga08x19_60686_c1 3300050514 Bacteria 2449
1553 nmdc:mga0a205_18201_c1 3300050515 Bacteria 6599
1554 nmdc:mga0a205_1921_c1 3300050515 Bacteria 18059
1555 nmdc:mga0a205_2724_c1 3300050515 Bacteria 15622
1556 nmdc:mga0a205_44400_c1 3300050515 Bacteria 4284
1557 nmdc:mga0a205_50540_c1 3300050515 Bacteria 4013
1558 nmdc:mga0sz30_135475_c1 3300050516 Bacteria 1086
1559 Ga0495601_0000008 3300053077 Bacteria 362152
1560 Ga0495601_0001042 3300053077 Bacteria 15154
1561 Ga0495601_0001925 3300053077 Bacteria 11619
1562 Ga0495601_0004619 3300053077 Bacteria 7965
1563 Ga0495601_0029283 3300053077 Bacteria 3414
1564 Ga0495601_0031011 3300053077 Bacteria 3322
1565 Ga0495601_0096670 3300053077 Bacteria 1905
1566 Ga0495601_0164506 3300053077 Bacteria 1450
1567 Ga0495612_0000026 3300053078 Bacteria 111627
1568 Ga0495612_0000308 3300053078 Bacteria 19880
1569 Ga0495612_0000858 3300053078 Bacteria 12361
1570 Ga0495612_0032977 3300053078 Bacteria 2094
1571 Ga0495612_0111205 3300053078 Bacteria 1172
1572 Ga0500610_0135901 3300053079 Bacteria 1246
1573 Ga0495655_0002363 3300053083 Bacteria 2986
1574 Ga0495655_0023126 3300053083 Bacteria 1429
1575 Ga0495595_0000024 3300053084 Bacteria 108008
1576 Ga0495595_0000879 3300053084 Bacteria 11535
1577 Ga0495595_0006336 3300053084 Bacteria 4819
1578 Ga0495595_0011017 3300053084 Bacteria 3773
1579 Ga0495595_0014880 3300053084 Bacteria 3308
1580 Ga0495619_0000002 3300053085 Bacteria 530226
1581 Ga0495619_0000229 3300053085 Bacteria 40785
1582 Ga0495619_0001598 3300053085 Bacteria 14888
1583 Ga0495619_0005795 3300053085 Bacteria 7828
1584 Ga0495619_0010541 3300053085 Bacteria 5815
1585 Ga0495619_0013992 3300053085 Bacteria 5062
1586 Ga0495619_0014059 3300053085 Bacteria 5050
1587 Ga0495619_0018217 3300053085 Bacteria 4453
1588 Ga0495619_0065633 3300053085 Bacteria 2422
1589 Ga0495619_0067601 3300053085 Bacteria 2386
1590 Ga0495619_0105512 3300053085 Bacteria 1921
1591 Ga0500578_0140554 3300053086 Bacteria 1510
1592 Ga0500644_0002495 3300053088 Bacteria 4601
1593 Ga0500583_0079978 3300053092 Bacteria 1578
1594 Ga0500651_0022942 3300053093 Bacteria 3904
1595 Ga0500651_0326092 3300053093 Bacteria 876
1596 Ga0500595_000010 3300053119 Bacteria 275806
1597 Ga0500652_070981 3300053131 Bacteria 1443
1598 Ga0500573_0187135 3300053140 Bacteria 1109
1599 Ga0500588_0056159 3300053146 Bacteria 1245
1600 Ga0500604_0038365 3300053151 Bacteria 1437
1601 Ga0500616_0000001 3300053153 Bacteria 1986011
1602 Ga0500616_0096643 3300053153 Bacteria 1451
1603 Ga0500611_004286 3300053727 Bacteria 1913
1604 Ga0500645_000015 3300053730 Bacteria 150140
1605 Ga0500645_039412 3300053730 Bacteria 1400
1606 Ga0501084_0101890 3300054114 Bacteria 2411
1607 Ga0501084_0147838 3300054114 Bacteria 1979
1608 Ga0501084_0150596 3300054114 Bacteria 1961
1609 Ga0501084_0261257 3300054114 Bacteria 1462
1610 Ga0501084_0293106 3300054114 Bacteria 1374
1611 Ga0501084_0326409 3300054114 Bacteria 1296
1612 Ga0501084_0361117 3300054114 Bacteria 1227
1613 Ga0501084_0588322 3300054114 Bacteria 940
1614 Ga0590071_011869 3300059421 Bacteria 2040
1615 Ga0590071_014618 3300059421 Bacteria 1842
1616 Ga0501082_0000013 3300060353 Bacteria 119623
1617 Ga0501082_0011829 3300060353 Bacteria 7501
1618 Ga0501082_0013431 3300060353 Bacteria 7039
1619 Ga0501082_0027888 3300060353 Bacteria 4863
1620 Ga0501082_0052297 3300060353 Bacteria 3521
1621 Ga0501082_0060268 3300060353 Bacteria 3268
1622 Ga0501082_0083125 3300060353 Bacteria 2763
1623 Ga0501082_0120127 3300060353 Bacteria 2278
1624 Ga0501082_0395969 3300060353 Bacteria 1205
1625 Ga0466962_0033717 3300061719 Bacteria 2451
1626 Ga0466962_0124513 3300061719 Bacteria 1245
1627 Ga0530510_0000596 3300061734 Bacteria 23255
1628 Ga0530510_0100902 3300061734 Bacteria 2110
1629 Ga0530510_0157817 3300061734 Bacteria 1677

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025938 Ga0207704_10075416 Ga0207704_100754163 218
2 3300009098 Ga0105245_10994961 Ga0105245_109949612 220
3 3300028381 Ga0268264_10408859 Ga0268264_104088592 222
4 3300048908 Ga0496105_0272168 Ga0496105_0272168_16_684 222
5 3300060353 Ga0501082_0000013 Ga0501082_0000013_75563_76345 223
6 3300046674 Ga0495588_0075208 Ga0495588_0075208_19_696 225
7 3300048906 Ga0496103_0514955 Ga0496103_0514955_14_691 225
8 3300049571 Ga0501034_0931952 Ga0501034_0931952_14_691 225
9 3300049576 Ga0501040_0076897 Ga0501040_0076897_276_953 225
10 3300049577 Ga0501041_0027793 Ga0501041_0027793_2479_3156 225
11 3300049579 Ga0501043_0050356 Ga0501043_0050356_2108_2785 225
12 3300049580 Ga0501046_0043437 Ga0501046_0043437_2078_2755 225
13 3300049585 Ga0501069_0139164 Ga0501069_0139164_629_1306 225
14 3300049588 Ga0501072_0106645 Ga0501072_0106645_75_752 225
15 3300049590 Ga0501074_0033113 Ga0501074_0033113_2552_3229 225
16 3300049592 Ga0501076_0010937 Ga0501076_0010937_5542_6219 225
17 3300049743 Ga0501081_0010499 Ga0501081_0010499_2776_3453 225
18 3300049822 Ga0501035_0005073 Ga0501035_0005073_1720_2397 225
19 3300049824 Ga0501045_0037333 Ga0501045_0037333_285_962 225
20 3300054114 Ga0501084_0101890 Ga0501084_0101890_1622_2299 225
21 3300060353 Ga0501082_0060268 Ga0501082_0060268_1769_2446 225
22 3300061734 Ga0530510_0100902 Ga0530510_0100902_1119_1796 225
23 3300049823 Ga0501044_0281404 Ga0501044_0281404_17_700 227
24 3300044842 Ga0466957_0161700 Ga0466957_0161700_24_749 228
25 3300045976 Ga0466967_0500056 Ga0466967_0500056_456_1181 228
26 3300003215 JGI25153J46596_10003184 JGI25153J46596_100031844 230
27 3300025297 Ga0209758_1001233 Ga0209758_10012339 230
28 3300025932 Ga0207690_10186213 Ga0207690_101862132 234
29 3300042005 Ga0439448_0182998 Ga0439448_0182998_10_714 234
30 3300059421 Ga0590071_014618 Ga0590071_014618_27_818 237
31 3300025940 Ga0207691_10321603 Ga0207691_103216032 239
32 3300005985 Ga0081539_10197348 Ga0081539_101973481 240
33 3300006914 Ga0075436_100004166 Ga0075436_1000041666 240
34 3300027876 Ga0209974_10004114 Ga0209974_100041142 242
35 3300044684 Ga0466966_0016428 Ga0466966_0016428_2534_3325 242
36 3300044694 Ga0466963_0044109 Ga0466963_0044109_1102_1893 242
37 3300044719 Ga0466971_0008622 Ga0466971_0008622_845_1636 242
38 3300045049 Ga0466959_0150051 Ga0466959_0150051_385_1176 242
39 3300045836 Ga0466958_0016008 Ga0466958_0016008_3460_4251 242
40 3300049591 Ga0501075_0044232 Ga0501075_0044232_61_849 242
41 3300054114 Ga0501084_0361117 Ga0501084_0361117_199_987 242
42 3300061719 Ga0466962_0033717 Ga0466962_0033717_1248_2039 242
43 3300009148 Ga0105243_10132540 Ga0105243_101325402 243
44 3300009553 Ga0105249_10017602 Ga0105249_100176023 243
45 3300048904 Ga0496101_0062028 Ga0496101_0062028_1346_2077 243
46 3300048905 Ga0496102_0422390 Ga0496102_0422390_221_952 243
47 3300048906 Ga0496103_0085283 Ga0496103_0085283_227_958 243
48 3300048909 Ga0496106_0003669 Ga0496106_0003669_10579_11310 243
49 3300048910 Ga0496107_0046339 Ga0496107_0046339_1846_2577 243
50 3300025898 Ga0207692_10270858 Ga0207692_102708581 244
51 3300006846 Ga0075430_100060450 Ga0075430_1000604503 245
52 3300006847 Ga0075431_100143342 Ga0075431_1001433423 245
53 3300048912 Ga0496109_0356430 Ga0496109_0356430_35_772 245
54 3300050507 nmdc:mga05p37_661502_c1 nmdc:mga05p37_661502_c1_65_856 245
55 3300050514 nmdc:mga08x19_33421_c1 nmdc:mga08x19_33421_c1_1222_1959 245
56 3300009098 Ga0105245_10069147 Ga0105245_100691472 246
57 3300009098 Ga0105245_10353319 Ga0105245_103533191 246
58 3300009147 Ga0114129_10115499 Ga0114129_101154992 246
59 3300009176 Ga0105242_10280681 Ga0105242_102806812 246
60 3300009177 Ga0105248_10196174 Ga0105248_101961742 246
61 3300009553 Ga0105249_10119957 Ga0105249_101199572 246
62 3300011119 Ga0105246_10068302 Ga0105246_100683022 246
63 3300013296 Ga0157374_10032857 Ga0157374_100328574 246
64 3300013297 Ga0157378_10044852 Ga0157378_100448521 246
65 3300013306 Ga0163162_10077995 Ga0163162_100779952 246
66 3300013308 Ga0157375_10207198 Ga0157375_102071982 246
67 3300014325 Ga0163163_10177888 Ga0163163_101778882 246
68 3300014326 Ga0157380_10231218 Ga0157380_102312182 246
69 3300014968 Ga0157379_10161405 Ga0157379_101614053 246
70 3300014969 Ga0157376_10054749 Ga0157376_100547493 246
71 3300026035 Ga0207703_10430245 Ga0207703_104302452 246
72 3300035085 Ga0373929_0002108 Ga0373929_0002108_2125_2865 246
73 3300035088 Ga0373940_0034213 Ga0373940_0034213_451_1191 246
74 3300035090 Ga0373949_0018854 Ga0373949_0018854_606_1346 246
75 3300035111 Ga0373923_0088514 Ga0373923_0088514_578_1318 246
76 3300035115 Ga0373941_0020276 Ga0373941_0020276_403_1143 246
77 3300035116 Ga0373945_0010949 Ga0373945_0010949_1562_2302 246
78 3300035170 Ga0373943_0010229 Ga0373943_0010229_1273_2013 246
79 3300035171 Ga0373946_0007440 Ga0373946_0007440_2070_2810 246
80 3300035241 Ga0373961_0034668 Ga0373961_0034668_247_987 246
81 3300035691 Ga0373931_0010273 Ga0373931_0010273_2069_2809 246
82 3300035725 Ga0373947_0001656 Ga0373947_0001656_11394_12134 246
83 3300046455 Ga0495603_0014184 Ga0495603_0014184_1839_2579 246
84 3300046459 Ga0495629_0000594 Ga0495629_0000594_21588_22328 246
85 3300046491 Ga0495584_0037617 Ga0495584_0037617_1548_2339 246
86 3300046499 Ga0495594_0011284 Ga0495594_0011284_1833_2573 246
87 3300047322 Ga0495680_0064482 Ga0495680_0064482_157_897 246
88 3300048903 Ga0496100_0000823 Ga0496100_0000823_2741_3481 246
89 3300048903 Ga0496100_0017884 Ga0496100_0017884_2011_2751 246
90 3300048904 Ga0496101_0013330 Ga0496101_0013330_1509_2249 246
91 3300048904 Ga0496101_0051874 Ga0496101_0051874_1003_1743 246
92 3300048905 Ga0496102_0050819 Ga0496102_0050819_1213_1953 246
93 3300048905 Ga0496102_0087854 Ga0496102_0087854_1310_2050 246
94 3300048906 Ga0496103_0009318 Ga0496103_0009318_1451_2191 246
95 3300048906 Ga0496103_0023575 Ga0496103_0023575_1165_1905 246
96 3300048907 Ga0496104_0018532 Ga0496104_0018532_3391_4131 246
97 3300048907 Ga0496104_0037286 Ga0496104_0037286_1587_2327 246
98 3300048908 Ga0496105_0079464 Ga0496105_0079464_350_1090 246
99 3300048908 Ga0496105_0081682 Ga0496105_0081682_174_914 246
100 3300048909 Ga0496106_0046079 Ga0496106_0046079_969_1709 246
101 3300048910 Ga0496107_0035757 Ga0496107_0035757_629_1369 246
102 3300048910 Ga0496107_0036271 Ga0496107_0036271_1604_2344 246
103 3300048911 Ga0496108_0048346 Ga0496108_0048346_1214_1954 246
104 3300048912 Ga0496109_0015600 Ga0496109_0015600_5466_6206 246
105 3300048912 Ga0496109_0060588 Ga0496109_0060588_1352_2092 246
106 3300048912 Ga0496109_0151191 Ga0496109_0151191_780_1520 246
107 3300048913 Ga0496110_0003362 Ga0496110_0003362_8557_9297 246
108 3300048913 Ga0496110_0034978 Ga0496110_0034978_1433_2173 246
109 3300048914 Ga0496111_0021239 Ga0496111_0021239_1594_2334 246
110 3300048914 Ga0496111_0040590 Ga0496111_0040590_322_1062 246
111 3300048915 Ga0496112_0021049 Ga0496112_0021049_2061_2801 246
112 3300048915 Ga0496112_0044120 Ga0496112_0044120_174_914 246
113 3300048915 Ga0496112_0051703 Ga0496112_0051703_1214_1954 246
114 3300048916 Ga0496113_0008785 Ga0496113_0008785_5528_6268 246
115 3300048916 Ga0496113_0008826 Ga0496113_0008826_1601_2341 246
116 3300048917 Ga0496114_0046871 Ga0496114_0046871_1660_2400 246
117 3300048917 Ga0496114_0157710 Ga0496114_0157710_812_1552 246
118 3300048918 Ga0496115_0019987 Ga0496115_0019987_2246_2986 246
119 3300048918 Ga0496115_0073699 Ga0496115_0073699_117_857 246
120 3300050508 nmdc:mga09592_78404_c1 nmdc:mga09592_78404_c1_1759_2550 246
121 3300050509 nmdc:mga0qj67_6112_c1 nmdc:mga0qj67_6112_c1_6251_7042 246
122 3300050510 nmdc:mga06r32_101497_c1 nmdc:mga06r32_101497_c1_121_912 246
123 3300050512 nmdc:mga0n895_69426_c1 nmdc:mga0n895_69426_c1_915_1655 246
124 3300050514 nmdc:mga08x19_33203_c1 nmdc:mga08x19_33203_c1_1926_2666 246
125 3300053085 Ga0495619_0000229 Ga0495619_0000229_14021_14761 246
126 3300005356 Ga0070674_100036693 Ga0070674_1000366933 248
127 3300005364 Ga0070673_100078510 Ga0070673_1000785102 248
128 3300021384 Ga0213876_10110816 Ga0213876_101108162 248
129 3300039450 Ga0436363_1296716 Ga0436363_1296716_40_825 248
130 3300046558 Ga0495633_0057678 Ga0495633_0057678_13_759 248
131 3300046616 Ga0495668_0142440 Ga0495668_0142440_544_1290 248
132 3300047447 Ga0495685_131822 Ga0495685_131822_58_804 248
133 3300050511 nmdc:mga08y16_45632_c1 nmdc:mga08y16_45632_c1_389_1171 248
134 3300025929 Ga0207664_10511668 Ga0207664_105116682 249
135 3300036401 Ga0373937_0689296 Ga0373937_0689296_191_940 249
136 3300053086 Ga0500578_0140554 Ga0500578_0140554_302_1087 249
137 3300005983 Ga0081540_1084127 Ga0081540_10841272 250
138 3300006353 Ga0075370_10074551 Ga0075370_100745513 250
139 3300006914 Ga0075436_100027202 Ga0075436_1000272022 250
140 3300039437 Ga0436365_0005986 Ga0436365_0005986_93_884 250
141 3300044694 Ga0466963_0096637 Ga0466963_0096637_559_1350 250
142 3300044706 Ga0466964_0051022 Ga0466964_0051022_637_1428 250
143 3300045049 Ga0466959_0361079 Ga0466959_0361079_170_961 250
144 3300045836 Ga0466958_0149142 Ga0466958_0149142_663_1454 250
145 3300050512 nmdc:mga0n895_141652_c1 nmdc:mga0n895_141652_c1_1554_2333 250
146 3300050514 nmdc:mga08x19_21279_c1 nmdc:mga08x19_21279_c1_2850_3641 250
147 3300053151 Ga0500604_0038365 Ga0500604_0038365_374_1159 250
148 3300005937 Ga0081455_10188134 Ga0081455_101881342 251
149 3300009147 Ga0114129_10641417 Ga0114129_106414173 251
150 3300050507 nmdc:mga05p37_875422_c1 nmdc:mga05p37_875422_c1_112_897 251
151 3300003320 rootH2_10006376 rootH2_100063762 252
152 3300005334 Ga0068869_100051408 Ga0068869_1000514083 252
153 3300005340 Ga0070689_100197151 Ga0070689_1001971512 252
154 3300005439 Ga0070711_100175493 Ga0070711_1001754932 252
155 3300005440 Ga0070705_100080736 Ga0070705_1000807362 252
156 3300005518 Ga0070699_100010423 Ga0070699_1000104236 252
157 3300005546 Ga0070696_100029222 Ga0070696_1000292223 252
158 3300005614 Ga0068856_100046914 Ga0068856_1000469142 252
159 3300005618 Ga0068864_100053465 Ga0068864_1000534654 252
160 3300006852 Ga0075433_10006137 Ga0075433_100061377 252
161 3300006871 Ga0075434_100000007 Ga0075434_10000000795 252
162 3300006871 Ga0075434_100001159 Ga0075434_10000115917 252
163 3300006880 Ga0075429_100561978 Ga0075429_1005619781 252
164 3300006914 Ga0075436_100002192 Ga0075436_1000021927 252
165 3300006914 Ga0075436_100357828 Ga0075436_1003578282 252
166 3300007076 Ga0075435_100000432 Ga0075435_10000043227 252
167 3300007076 Ga0075435_100025823 Ga0075435_1000258235 252
168 3300009094 Ga0111539_10019998 Ga0111539_100199984 252
169 3300025936 Ga0207670_10156514 Ga0207670_101565142 252
170 3300025942 Ga0207689_10065413 Ga0207689_100654133 252
171 3300026078 Ga0207702_10070772 Ga0207702_100707722 252
172 3300026095 Ga0207676_10074119 Ga0207676_100741193 252
173 3300027360 Ga0209969_1003168 Ga0209969_10031683 252
174 3300027364 Ga0209967_1000489 Ga0209967_10004893 252
175 3300027378 Ga0209981_1000830 Ga0209981_10008303 252
176 3300027462 Ga0210000_1000255 Ga0210000_10002557 252
177 3300027526 Ga0209968_1002489 Ga0209968_10024892 252
178 3300027907 Ga0207428_10138752 Ga0207428_101387522 252
179 3300028577 Ga0265318_10055027 Ga0265318_100550272 252
180 3300031235 Ga0265330_10039488 Ga0265330_100394882 252
181 3300031247 Ga0265340_10011101 Ga0265340_100111015 252
182 3300041410 Ga0439461_0003514 Ga0439461_0003514_580_1338 252
183 3300042156 Ga0439446_0001019 Ga0439446_0001019_3589_4347 252
184 3300042435 Ga0439434_0002451 Ga0439434_0002451_965_1723 252
185 3300042436 Ga0439435_0000002 Ga0439435_0000002_15782_16540 252
186 3300045051 Ga0451576_0017130 Ga0451576_0017130_4443_5201 252
187 3300045976 Ga0466967_0006741 Ga0466967_0006741_6754_7512 252
188 3300046458 Ga0495591_048065 Ga0495591_048065_397_1155 252
189 3300046463 Ga0495653_0357386 Ga0495653_0357386_24_782 252
190 3300046678 Ga0495599_0317649 Ga0495599_0317649_12_770 252
191 3300046679 Ga0495623_0335799 Ga0495623_0335799_35_793 252
192 3300047322 Ga0495680_0012301 Ga0495680_0012301_23_781 252
193 3300049570 Ga0501033_0190471 Ga0501033_0190471_396_1154 252
194 3300049572 Ga0501036_0018021 Ga0501036_0018021_3147_3905 252
195 3300049575 Ga0501039_0121235 Ga0501039_0121235_485_1243 252
196 3300049576 Ga0501040_0012594 Ga0501040_0012594_3145_3903 252
197 3300049576 Ga0501040_0018457 Ga0501040_0018457_926_1684 252
198 3300049577 Ga0501041_0017024 Ga0501041_0017024_1356_2114 252
199 3300049578 Ga0501042_0567114 Ga0501042_0567114_38_796 252
200 3300049580 Ga0501046_0012829 Ga0501046_0012829_567_1325 252
201 3300049582 Ga0501048_0229114 Ga0501048_0229114_295_1053 252
202 3300049585 Ga0501069_0017442 Ga0501069_0017442_15_773 252
203 3300049586 Ga0501070_0359275 Ga0501070_0359275_113_871 252
204 3300049587 Ga0501071_0057606 Ga0501071_0057606_1980_2738 252
205 3300049587 Ga0501071_0099765 Ga0501071_0099765_777_1535 252
206 3300049588 Ga0501072_0011302 Ga0501072_0011302_624_1382 252
207 3300049588 Ga0501072_0030502 Ga0501072_0030502_1065_1823 252
208 3300049591 Ga0501075_0004734 Ga0501075_0004734_5651_6409 252
209 3300049592 Ga0501076_0001405 Ga0501076_0001405_9926_10684 252
210 3300049593 Ga0501077_0007341 Ga0501077_0007341_4086_4844 252
211 3300049741 Ga0501079_0003233 Ga0501079_0003233_9421_10179 252
212 3300049741 Ga0501079_0175830 Ga0501079_0175830_555_1313 252
213 3300049742 Ga0501080_0021206 Ga0501080_0021206_3436_4194 252
214 3300049743 Ga0501081_0001767 Ga0501081_0001767_7526_8284 252
215 3300049822 Ga0501035_0255397 Ga0501035_0255397_605_1363 252
216 3300049822 Ga0501035_0289417 Ga0501035_0289417_613_1371 252
217 3300049824 Ga0501045_0018155 Ga0501045_0018155_538_1296 252
218 3300049824 Ga0501045_0089530 Ga0501045_0089530_1268_2026 252
219 3300050507 nmdc:mga05p37_1808_c2 nmdc:mga05p37_1808_c2_5870_6628 252
220 3300050509 nmdc:mga0qj67_63707_c1 nmdc:mga0qj67_63707_c1_1288_2046 252
221 3300050510 nmdc:mga06r32_142417_c1 nmdc:mga06r32_142417_c1_1505_2296 252
222 3300050510 nmdc:mga06r32_3441_c1 nmdc:mga06r32_3441_c1_9151_9909 252
223 3300050511 nmdc:mga08y16_3146_c1 nmdc:mga08y16_3146_c1_1106_1864 252
224 3300050511 nmdc:mga08y16_9215_c1 nmdc:mga08y16_9215_c1_4647_5405 252
225 3300050512 nmdc:mga0n895_145_c1 nmdc:mga0n895_145_c1_11246_12004 252
226 3300050512 nmdc:mga0n895_30075_c1 nmdc:mga0n895_30075_c1_3671_4429 252
227 3300050512 nmdc:mga0n895_4696_c1 nmdc:mga0n895_4696_c1_6835_7593 252
228 3300050513 nmdc:mga0rr50_1966_c1 nmdc:mga0rr50_1966_c1_6975_7733 252
229 3300050513 nmdc:mga0rr50_2684_c1 nmdc:mga0rr50_2684_c1_9151_9909 252
230 3300050513 nmdc:mga0rr50_48815_c1 nmdc:mga0rr50_48815_c1_1943_2701 252
231 3300050514 nmdc:mga08x19_1133_c1 nmdc:mga08x19_1133_c1_8428_9186 252
232 3300050514 nmdc:mga08x19_127257_c1 nmdc:mga08x19_127257_c1_631_1389 252
233 3300050514 nmdc:mga08x19_46164_c1 nmdc:mga08x19_46164_c1_191_949 252
234 3300050515 nmdc:mga0a205_1921_c1 nmdc:mga0a205_1921_c1_11025_11783 252
235 3300050515 nmdc:mga0a205_2724_c1 nmdc:mga0a205_2724_c1_5014_5772 252
236 3300054114 Ga0501084_0147838 Ga0501084_0147838_342_1100 252
237 3300059421 Ga0590071_011869 Ga0590071_011869_195_953 252
238 3300060353 Ga0501082_0011829 Ga0501082_0011829_6275_7033 252
239 3300060353 Ga0501082_0120127 Ga0501082_0120127_588_1346 252
240 3300061734 Ga0530510_0000596 Ga0530510_0000596_8448_9206 252
241 3300005458 Ga0070681_10046880 Ga0070681_100468802 253
242 3300005536 Ga0070697_100441764 Ga0070697_1004417641 253
243 3300005981 Ga0081538_10047804 Ga0081538_100478042 253
244 3300006175 Ga0070712_100342684 Ga0070712_1003426842 253
245 3300007076 Ga0075435_100105730 Ga0075435_1001057302 253
246 3300025915 Ga0207693_10101245 Ga0207693_101012452 253
247 3300046526 Ga0495666_0033888 Ga0495666_0033888_32_793 253
248 3300046681 Ga0495647_0050007 Ga0495647_0050007_17_778 253
249 3300048907 Ga0496104_0005217 Ga0496104_0005217_3418_4179 253
250 3300048911 Ga0496108_0032769 Ga0496108_0032769_2226_2987 253
251 3300048912 Ga0496109_0005940 Ga0496109_0005940_2288_3049 253
252 3300048913 Ga0496110_0002357 Ga0496110_0002357_6820_7581 253
253 3300048914 Ga0496111_0023917 Ga0496111_0023917_3127_3888 253
254 3300048914 Ga0496111_0108052 Ga0496111_0108052_48_845 253
255 3300048916 Ga0496113_0002665 Ga0496113_0002665_1341_2102 253
256 3300049571 Ga0501034_0029366 Ga0501034_0029366_3158_3919 253
257 3300049573 Ga0501037_0102956 Ga0501037_0102956_1218_1979 253
258 3300049574 Ga0501038_0076041 Ga0501038_0076041_1203_1964 253
259 3300049581 Ga0501047_0018859 Ga0501047_0018859_4380_5141 253
260 3300049588 Ga0501072_0328612 Ga0501072_0328612_284_1045 253
261 3300049589 Ga0501073_0029987 Ga0501073_0029987_1482_2243 253
262 3300049744 Ga0501083_0011824 Ga0501083_0011824_4885_5646 253
263 3300050513 nmdc:mga0rr50_367066_c1 nmdc:mga0rr50_367066_c1_154_951 253
264 3300060353 Ga0501082_0013431 Ga0501082_0013431_4580_5341 253
265 3300005434 Ga0070709_10373331 Ga0070709_103733312 254
266 3300014326 Ga0157380_10864854 Ga0157380_108648541 254
267 3300025898 Ga0207692_10098281 Ga0207692_100982812 254
268 3300025929 Ga0207664_10075293 Ga0207664_100752933 254
269 3300025939 Ga0207665_10088263 Ga0207665_100882632 254
270 3300049575 Ga0501039_0188401 Ga0501039_0188401_746_1549 254
271 3300049590 Ga0501074_0099597 Ga0501074_0099597_193_996 254
272 3300001977 JGI24746J21847_1004318 JGI24746J21847_10043182 255
273 3300001991 JGI24743J22301_10002254 JGI24743J22301_100022542 255
274 3300002070 JGI24750J21931_1006717 JGI24750J21931_10067173 255
275 3300005330 Ga0070690_100046335 Ga0070690_1000463353 255
276 3300005334 Ga0068869_100022846 Ga0068869_1000228463 255
277 3300005338 Ga0068868_100031802 Ga0068868_1000318023 255
278 3300005340 Ga0070689_100028202 Ga0070689_1000282023 255
279 3300005343 Ga0070687_100037605 Ga0070687_1000376053 255
280 3300005345 Ga0070692_10142810 Ga0070692_101428102 255
281 3300005355 Ga0070671_100097382 Ga0070671_1000973822 255
282 3300005438 Ga0070701_10010726 Ga0070701_100107263 255
283 3300005440 Ga0070705_100023818 Ga0070705_1000238182 255
284 3300005441 Ga0070700_100019322 Ga0070700_1000193223 255
285 3300005444 Ga0070694_100249244 Ga0070694_1002492442 255
286 3300005455 Ga0070663_100225422 Ga0070663_1002254222 255
287 3300005456 Ga0070678_100045182 Ga0070678_1000451823 255
288 3300005459 Ga0068867_100060743 Ga0068867_1000607432 255
289 3300005466 Ga0070685_10009847 Ga0070685_100098473 255
290 3300005530 Ga0070679_100315865 Ga0070679_1003158651 255
291 3300005535 Ga0070684_100128485 Ga0070684_1001284852 255
292 3300005539 Ga0068853_100042579 Ga0068853_1000425791 255
293 3300005543 Ga0070672_100078196 Ga0070672_1000781963 255
294 3300005544 Ga0070686_100049853 Ga0070686_1000498533 255
295 3300005545 Ga0070695_100260215 Ga0070695_1002602152 255
296 3300005548 Ga0070665_100085305 Ga0070665_1000853052 255
297 3300005577 Ga0068857_100511643 Ga0068857_1005116432 255
298 3300005578 Ga0068854_100049093 Ga0068854_1000490932 255
299 3300005618 Ga0068864_100039525 Ga0068864_1000395252 255
300 3300005718 Ga0068866_10002088 Ga0068866_100020882 255
301 3300005840 Ga0068870_10001886 Ga0068870_100018867 255
302 3300005841 Ga0068863_100036918 Ga0068863_1000369184 255
303 3300005842 Ga0068858_100024112 Ga0068858_1000241125 255
304 3300005842 Ga0068858_100185868 Ga0068858_1001858682 255
305 3300005843 Ga0068860_100053505 Ga0068860_1000535053 255
306 3300006028 Ga0070717_10085547 Ga0070717_100855473 255
307 3300006237 Ga0097621_100194171 Ga0097621_1001941712 255
308 3300006844 Ga0075428_100056127 Ga0075428_1000561273 255
309 3300006871 Ga0075434_100060322 Ga0075434_1000603223 255
310 3300006881 Ga0068865_100033785 Ga0068865_1000337852 255
311 3300009094 Ga0111539_10061746 Ga0111539_100617463 255
312 3300009098 Ga0105245_10119521 Ga0105245_101195212 255
313 3300009147 Ga0114129_10011756 Ga0114129_100117561 255
314 3300009148 Ga0105243_10055144 Ga0105243_100551443 255
315 3300009174 Ga0105241_10024036 Ga0105241_100240365 255
316 3300009176 Ga0105242_10079357 Ga0105242_100793572 255
317 3300009545 Ga0105237_10153564 Ga0105237_101535642 255
318 3300009551 Ga0105238_10308501 Ga0105238_103085012 255
319 3300009553 Ga0105249_10216131 Ga0105249_102161312 255
320 3300013296 Ga0157374_10136595 Ga0157374_101365952 255
321 3300013306 Ga0163162_10402046 Ga0163162_104020461 255
322 3300013308 Ga0157375_10054327 Ga0157375_100543272 255
323 3300014325 Ga0163163_10044684 Ga0163163_100446844 255
324 3300014325 Ga0163163_10055637 Ga0163163_100556372 255
325 3300014326 Ga0157380_10644173 Ga0157380_106441732 255
326 3300014745 Ga0157377_10010127 Ga0157377_100101273 255
327 3300014968 Ga0157379_10088015 Ga0157379_100880152 255
328 3300014969 Ga0157376_10037848 Ga0157376_100378483 255
329 3300017792 Ga0163161_10078656 Ga0163161_100786562 255
330 3300025900 Ga0207710_10011401 Ga0207710_100114013 255
331 3300025901 Ga0207688_10002075 Ga0207688_100020755 255
332 3300025904 Ga0207647_10040967 Ga0207647_100409672 255
333 3300025907 Ga0207645_10085716 Ga0207645_100857161 255
334 3300025908 Ga0207643_10002314 Ga0207643_100023145 255
335 3300025911 Ga0207654_10058895 Ga0207654_100588952 255
336 3300025916 Ga0207663_10242074 Ga0207663_102420742 255
337 3300025918 Ga0207662_10037840 Ga0207662_100378402 255
338 3300025919 Ga0207657_10019458 Ga0207657_100194584 255
339 3300025920 Ga0207649_10013634 Ga0207649_100136344 255
340 3300025923 Ga0207681_10038145 Ga0207681_100381453 255
341 3300025926 Ga0207659_10070018 Ga0207659_100700182 255
342 3300025927 Ga0207687_10120981 Ga0207687_101209813 255
343 3300025928 Ga0207700_10431403 Ga0207700_104314032 255
344 3300025931 Ga0207644_10045594 Ga0207644_100455943 255
345 3300025933 Ga0207706_10037549 Ga0207706_100375493 255
346 3300025934 Ga0207686_10082565 Ga0207686_100825652 255
347 3300025936 Ga0207670_10004774 Ga0207670_100047744 255
348 3300025940 Ga0207691_10002493 Ga0207691_100024938 255
349 3300025941 Ga0207711_10192293 Ga0207711_101922932 255
350 3300025942 Ga0207689_10046437 Ga0207689_100464372 255
351 3300025944 Ga0207661_10059503 Ga0207661_100595032 255
352 3300025972 Ga0207668_10029098 Ga0207668_100290983 255
353 3300026023 Ga0207677_10019568 Ga0207677_100195683 255
354 3300026035 Ga0207703_10047628 Ga0207703_100476282 255
355 3300026067 Ga0207678_10006342 Ga0207678_100063427 255
356 3300026075 Ga0207708_10031033 Ga0207708_100310333 255
357 3300026088 Ga0207641_10169305 Ga0207641_101693052 255
358 3300026089 Ga0207648_10081728 Ga0207648_100817282 255
359 3300026095 Ga0207676_10016804 Ga0207676_100168043 255
360 3300026116 Ga0207674_10084500 Ga0207674_100845003 255
361 3300026118 Ga0207675_100001837 Ga0207675_1000018372 255
362 3300026142 Ga0207698_10072196 Ga0207698_100721963 255
363 3300028379 Ga0268266_10107574 Ga0268266_101075742 255
364 3300028380 Ga0268265_10055949 Ga0268265_100559493 255
365 3300028381 Ga0268264_10086369 Ga0268264_100863693 255
366 3300035089 Ga0373944_0003519 Ga0373944_0003519_1864_2697 255
367 3300035170 Ga0373943_0020151 Ga0373943_0020151_1262_2095 255
368 3300035170 Ga0373943_0143635 Ga0373943_0143635_95_928 255
369 3300035171 Ga0373946_0012923 Ga0373946_0012923_1012_1845 255
370 3300035171 Ga0373946_0063519 Ga0373946_0063519_688_1521 255
371 3300035692 Ga0373935_0009944 Ga0373935_0009944_3259_4092 255
372 3300035695 Ga0373927_0100049 Ga0373927_0100049_639_1472 255
373 3300035725 Ga0373947_0008738 Ga0373947_0008738_80_913 255
374 3300036401 Ga0373937_0287582 Ga0373937_0287582_695_1528 255
375 3300037068 Ga0373925_0043540 Ga0373925_0043540_1656_2489 255
376 3300037068 Ga0373925_0264489 Ga0373925_0264489_481_1314 255
377 3300039447 Ga0436361_0561320 Ga0436361_0561320_4232_5035 255
378 3300046455 Ga0495603_0050857 Ga0495603_0050857_327_1160 255
379 3300046455 Ga0495603_0102843 Ga0495603_0102843_495_1328 255
380 3300046459 Ga0495629_0100862 Ga0495629_0100862_1095_1928 255
381 3300046461 Ga0495641_0016661 Ga0495641_0016661_44_877 255
382 3300046473 Ga0495582_0032148 Ga0495582_0032148_1656_2489 255
383 3300046473 Ga0495582_0231817 Ga0495582_0231817_54_887 255
384 3300046476 Ga0495662_0068233 Ga0495662_0068233_116_949 255
385 3300046491 Ga0495584_0242075 Ga0495584_0242075_41_874 255
386 3300046517 Ga0495630_0257836 Ga0495630_0257836_34_867 255
387 3300046520 Ga0495637_0090560 Ga0495637_0090560_98_931 255
388 3300046537 Ga0495598_0087189 Ga0495598_0087189_144_977 255
389 3300046559 Ga0495667_0295836 Ga0495667_0295836_79_912 255
390 3300046674 Ga0495588_0025753 Ga0495588_0025753_1820_2653 255
391 3300046684 Ga0495669_0084935 Ga0495669_0084935_609_1442 255
392 3300046690 Ga0495624_0031182 Ga0495624_0031182_1473_2306 255
393 3300046691 Ga0495670_0047900 Ga0495670_0047900_1153_1986 255
394 3300046794 Ga0495589_0158326 Ga0495589_0158326_58_891 255
395 3300046809 Ga0495600_0312572 Ga0495600_0312572_75_908 255
396 3300047319 Ga0495674_0240133 Ga0495674_0240133_589_1422 255
397 3300047319 Ga0495674_0565763 Ga0495674_0565763_15_848 255
398 3300047445 Ga0495677_0148172 Ga0495677_0148172_41_889 255
399 3300047471 Ga0495684_0420568 Ga0495684_0420568_74_907 255
400 3300047673 Ga0495593_0037694 Ga0495593_0037694_1414_2247 255
401 3300048903 Ga0496100_0021550 Ga0496100_0021550_1091_1924 255
402 3300048904 Ga0496101_0008909 Ga0496101_0008909_3528_4361 255
403 3300048904 Ga0496101_0060493 Ga0496101_0060493_1751_2584 255
404 3300048905 Ga0496102_0047059 Ga0496102_0047059_1334_2167 255
405 3300048906 Ga0496103_0018841 Ga0496103_0018841_1168_2001 255
406 3300048906 Ga0496103_0087744 Ga0496103_0087744_706_1539 255
407 3300048907 Ga0496104_0018853 Ga0496104_0018853_3869_4702 255
408 3300048908 Ga0496105_0004562 Ga0496105_0004562_4703_5536 255
409 3300048909 Ga0496106_0009344 Ga0496106_0009344_4618_5451 255
410 3300048909 Ga0496106_0028983 Ga0496106_0028983_1352_2185 255
411 3300048910 Ga0496107_0010585 Ga0496107_0010585_1013_1846 255
412 3300048911 Ga0496108_0010045 Ga0496108_0010045_2743_3576 255
413 3300048912 Ga0496109_0000340 Ga0496109_0000340_2080_2913 255
414 3300048912 Ga0496109_0126561 Ga0496109_0126561_1013_1846 255
415 3300048913 Ga0496110_0014914 Ga0496110_0014914_5352_6185 255
416 3300048914 Ga0496111_0007077 Ga0496111_0007077_3974_4807 255
417 3300048914 Ga0496111_0012965 Ga0496111_0012965_1885_2718 255
418 3300048915 Ga0496112_0006271 Ga0496112_0006271_2878_3711 255
419 3300048915 Ga0496112_0198456 Ga0496112_0198456_1020_1853 255
420 3300048916 Ga0496113_0000463 Ga0496113_0000463_2580_3413 255
421 3300048916 Ga0496113_0053025 Ga0496113_0053025_1067_1900 255
422 3300048917 Ga0496114_0081951 Ga0496114_0081951_1253_2086 255
423 3300048917 Ga0496114_0109867 Ga0496114_0109867_1357_2190 255
424 3300048918 Ga0496115_0067163 Ga0496115_0067163_602_1435 255
425 3300050507 nmdc:mga05p37_22036_c1 nmdc:mga05p37_22036_c1_5874_6707 255
426 3300050508 nmdc:mga09592_513695_c1 nmdc:mga09592_513695_c1_151_984 255
427 3300050511 nmdc:mga08y16_172282_c1 nmdc:mga08y16_172282_c1_986_1819 255
428 3300050511 nmdc:mga08y16_89125_c1 nmdc:mga08y16_89125_c1_1819_2652 255
429 3300050516 nmdc:mga0sz30_135475_c1 nmdc:mga0sz30_135475_c1_156_989 255
430 3300053077 Ga0495601_0164506 Ga0495601_0164506_538_1371 255
431 3300053083 Ga0495655_0002363 Ga0495655_0002363_398_1231 255
432 3300053083 Ga0495655_0023126 Ga0495655_0023126_97_930 255
433 3300053085 Ga0495619_0067601 Ga0495619_0067601_363_1196 255
434 3300053085 Ga0495619_0105512 Ga0495619_0105512_978_1811 255
435 3300005290 Ga0065712_10077193 Ga0065712_100771933 256
436 3300005347 Ga0070668_100426049 Ga0070668_1004260492 256
437 3300005354 Ga0070675_100303869 Ga0070675_1003038691 256
438 3300005364 Ga0070673_100231226 Ga0070673_1002312262 256
439 3300005365 Ga0070688_100298893 Ga0070688_1002988932 256
440 3300005457 Ga0070662_100121519 Ga0070662_1001215192 256
441 3300005459 Ga0068867_100696329 Ga0068867_1006963291 256
442 3300005544 Ga0070686_100213897 Ga0070686_1002138972 256
443 3300005564 Ga0070664_100175888 Ga0070664_1001758882 256
444 3300006914 Ga0075436_100131794 Ga0075436_1001317942 256
445 3300013105 Ga0157369_10488880 Ga0157369_104888802 256
446 3300017792 Ga0163161_10112250 Ga0163161_101122502 256
447 3300025903 Ga0207680_10186825 Ga0207680_101868251 256
448 3300025926 Ga0207659_10026549 Ga0207659_100265493 256
449 3300025933 Ga0207706_10121459 Ga0207706_101214591 256
450 3300025941 Ga0207711_10041693 Ga0207711_100416933 256
451 3300025945 Ga0207679_10016049 Ga0207679_100160494 256
452 3300025972 Ga0207668_10339016 Ga0207668_103390162 256
453 3300026067 Ga0207678_10115709 Ga0207678_101157091 256
454 3300026089 Ga0207648_10347959 Ga0207648_103479592 256
455 3300026095 Ga0207676_10139552 Ga0207676_101395522 256
456 3300027617 Ga0210002_1027794 Ga0210002_10277941 256
457 3300027907 Ga0207428_10267944 Ga0207428_102679442 256
458 3300028380 Ga0268265_10173558 Ga0268265_101735581 256
459 3300031241 Ga0265325_10002536 Ga0265325_100025363 256
460 3300046514 Ga0495618_0131903 Ga0495618_0131903_494_1285 256
461 3300046663 Ga0495635_0013894 Ga0495635_0013894_1503_2294 256
462 3300046675 Ga0495657_0031463 Ga0495657_0031463_1104_1895 256
463 3300049575 Ga0501039_0193552 Ga0501039_0193552_264_1034 256
464 3300049744 Ga0501083_0146022 Ga0501083_0146022_481_1254 257
465 3300041512 Ga0451853_1447647 Ga0451853_1447647_47_847 258
466 3300006847 Ga0075431_100120887 Ga0075431_1001208872 259
467 3300025912 Ga0207707_10212418 Ga0207707_102124182 259
468 3300041408 Ga0439453_0000288 Ga0439453_0000288_1906_2685 259
469 3300042003 Ga0439443_003618 Ga0439443_003618_778_1557 259
470 3300042436 Ga0439435_0006285 Ga0439435_0006285_1667_2446 259
471 3300042437 Ga0439444_0002652 Ga0439444_0002652_1392_2171 259
472 3300042993 Ga0439440_0017585 Ga0439440_0017585_147_926 259
473 3300048909 Ga0496106_0050986 Ga0496106_0050986_811_1590 259
474 3300050492 nmdc:mga0yw44_47840_c1 nmdc:mga0yw44_47840_c1_1278_2057 259
475 3300050508 nmdc:mga09592_226707_c1 nmdc:mga09592_226707_c1_490_1269 259
476 3300050512 nmdc:mga0n895_952226_c1 nmdc:mga0n895_952226_c1_19_798 259
477 3300050513 nmdc:mga0rr50_75948_c1 nmdc:mga0rr50_75948_c1_371_1150 259
478 3300002459 JGI24751J29686_10025022 JGI24751J29686_100250222 260
479 3300005330 Ga0070690_100380229 Ga0070690_1003802291 260
480 3300005340 Ga0070689_100080413 Ga0070689_1000804133 260
481 3300005354 Ga0070675_100292551 Ga0070675_1002925513 260
482 3300005356 Ga0070674_100004009 Ga0070674_1000040096 260
483 3300005364 Ga0070673_100069361 Ga0070673_1000693612 260
484 3300005365 Ga0070688_100236361 Ga0070688_1002363611 260
485 3300005456 Ga0070678_100006186 Ga0070678_1000061866 260
486 3300005457 Ga0070662_100065940 Ga0070662_1000659402 260
487 3300005459 Ga0068867_100046946 Ga0068867_1000469463 260
488 3300005466 Ga0070685_10231391 Ga0070685_102313912 260
489 3300005535 Ga0070684_100134636 Ga0070684_1001346363 260
490 3300005539 Ga0068853_100579519 Ga0068853_1005795191 260
491 3300005544 Ga0070686_100103076 Ga0070686_1001030761 260
492 3300005564 Ga0070664_100138824 Ga0070664_1001388243 260
493 3300005564 Ga0070664_100386735 Ga0070664_1003867351 260
494 3300005577 Ga0068857_100447288 Ga0068857_1004472882 260
495 3300005840 Ga0068870_10186282 Ga0068870_101862822 260
496 3300005841 Ga0068863_100570405 Ga0068863_1005704052 260
497 3300005844 Ga0068862_100177573 Ga0068862_1001775732 260
498 3300006051 Ga0075364_10008816 Ga0075364_100088164 260
499 3300006177 Ga0075362_10000839 Ga0075362_100008394 260
500 3300006177 Ga0075362_10075317 Ga0075362_100753171 260
501 3300006178 Ga0075367_10047173 Ga0075367_100471732 260
502 3300006195 Ga0075366_10001687 Ga0075366_1000168710 260
503 3300009094 Ga0111539_10087807 Ga0111539_100878075 260
504 3300009098 Ga0105245_10215404 Ga0105245_102154043 260
505 3300009101 Ga0105247_10020997 Ga0105247_100209975 260
506 3300009148 Ga0105243_10230745 Ga0105243_102307452 260
507 3300009148 Ga0105243_10406274 Ga0105243_104062742 260
508 3300009176 Ga0105242_10246851 Ga0105242_102468511 260
509 3300009176 Ga0105242_10263768 Ga0105242_102637682 260
510 3300009545 Ga0105237_10343928 Ga0105237_103439281 260
511 3300009551 Ga0105238_10230806 Ga0105238_102308062 260
512 3300009551 Ga0105238_10410489 Ga0105238_104104893 260
513 3300013296 Ga0157374_10329981 Ga0157374_103299813 260
514 3300013297 Ga0157378_10078787 Ga0157378_100787873 260
515 3300013297 Ga0157378_10255188 Ga0157378_102551882 260
516 3300013297 Ga0157378_10690813 Ga0157378_106908131 260
517 3300013306 Ga0163162_10408190 Ga0163162_104081902 260
518 3300013308 Ga0157375_10928382 Ga0157375_109283821 260
519 3300014325 Ga0163163_10407254 Ga0163163_104072542 260
520 3300014326 Ga0157380_10091519 Ga0157380_100915193 260
521 3300014326 Ga0157380_10872934 Ga0157380_108729341 260
522 3300014969 Ga0157376_10067048 Ga0157376_100670483 260
523 3300025893 Ga0207682_10001862 Ga0207682_100018627 260
524 3300025900 Ga0207710_10025753 Ga0207710_100257533 260
525 3300025904 Ga0207647_10048394 Ga0207647_100483943 260
526 3300025908 Ga0207643_10016243 Ga0207643_100162433 260
527 3300025914 Ga0207671_10183842 Ga0207671_101838421 260
528 3300025918 Ga0207662_10047292 Ga0207662_100472922 260
529 3300025923 Ga0207681_10308190 Ga0207681_103081902 260
530 3300025925 Ga0207650_10159384 Ga0207650_101593842 260
531 3300025926 Ga0207659_10057060 Ga0207659_100570602 260
532 3300025926 Ga0207659_10401094 Ga0207659_104010942 260
533 3300025927 Ga0207687_10235753 Ga0207687_102357532 260
534 3300025933 Ga0207706_10026317 Ga0207706_100263173 260
535 3300025934 Ga0207686_10301377 Ga0207686_103013771 260
536 3300025935 Ga0207709_10161854 Ga0207709_101618542 260
537 3300025936 Ga0207670_10370567 Ga0207670_103705671 260
538 3300025937 Ga0207669_10036510 Ga0207669_100365103 260
539 3300025940 Ga0207691_10024434 Ga0207691_100244342 260
540 3300025940 Ga0207691_10128419 Ga0207691_101284192 260
541 3300025944 Ga0207661_10043667 Ga0207661_100436675 260
542 3300025945 Ga0207679_10093901 Ga0207679_100939013 260
543 3300026041 Ga0207639_10262440 Ga0207639_102624402 260
544 3300026041 Ga0207639_10514061 Ga0207639_105140611 260
545 3300026088 Ga0207641_10184921 Ga0207641_101849213 260
546 3300026089 Ga0207648_10043776 Ga0207648_100437763 260
547 3300026116 Ga0207674_10191770 Ga0207674_101917702 260
548 3300026118 Ga0207675_100069498 Ga0207675_1000694981 260
549 3300026121 Ga0207683_10006914 Ga0207683_100069147 260
550 3300027907 Ga0207428_10016308 Ga0207428_100163087 260
551 3300046474 Ga0495605_0023685 Ga0495605_0023685_784_1566 260
552 3300046525 Ga0495663_0021273 Ga0495663_0021273_974_1792 260
553 3300046539 Ga0495621_0011059 Ga0495621_0011059_349_1167 260
554 3300046615 Ga0495656_0023542 Ga0495656_0023542_1038_1856 260
555 3300047318 Ga0495636_0016055 Ga0495636_0016055_920_1702 260
556 3300048915 Ga0496112_0351325 Ga0496112_0351325_447_1229 260
557 3300049585 Ga0501069_0046105 Ga0501069_0046105_639_1421 260
558 3300049586 Ga0501070_0003185 Ga0501070_0003185_12337_13137 260
559 3300049822 Ga0501035_0000127 Ga0501035_0000127_57426_58208 260
560 3300050489 nmdc:mga03683_4783_c1 nmdc:mga03683_4783_c1_534_1316 260
561 3300050491 nmdc:mga00v17_4490_c1 nmdc:mga00v17_4490_c1_4977_5759 260
562 3300050494 nmdc:mga06z11_26428_c1 nmdc:mga06z11_26428_c1_295_1077 260
563 3300050511 nmdc:mga08y16_14675_c1 nmdc:mga08y16_14675_c1_2139_2921 260
564 3300005983 Ga0081540_1031022 Ga0081540_10310224 261
565 3300006844 Ga0075428_100007282 Ga0075428_10000728211 261
566 3300006847 Ga0075431_100001810 Ga0075431_10000181017 261
567 3300007788 Ga0099795_10093911 Ga0099795_100939112 261
568 3300009094 Ga0111539_10013539 Ga0111539_100135399 261
569 3300009147 Ga0114129_10000742 Ga0114129_1000074238 261
570 3300010159 Ga0099796_10005153 Ga0099796_100051533 261
571 3300025915 Ga0207693_10007312 Ga0207693_100073129 261
572 3300025923 Ga0207681_10228489 Ga0207681_102284892 261
573 3300025928 Ga0207700_10078894 Ga0207700_100788941 261
574 3300025939 Ga0207665_10052253 Ga0207665_100522533 261
575 3300027512 Ga0209179_1006000 Ga0209179_10060002 261
576 3300027907 Ga0207428_10013736 Ga0207428_100137366 261
577 3300028800 Ga0265338_10035331 Ga0265338_100353315 261
578 3300031235 Ga0265330_10081844 Ga0265330_100818442 261
579 3300031241 Ga0265325_10013945 Ga0265325_100139454 261
580 3300031241 Ga0265325_10019710 Ga0265325_100197103 261
581 3300031249 Ga0265339_10000091 Ga0265339_100000916 261
582 3300031595 Ga0265313_10001068 Ga0265313_100010687 261
583 3300031712 Ga0265342_10024497 Ga0265342_100244973 261
584 3300031712 Ga0265342_10063512 Ga0265342_100635122 261
585 3300035111 Ga0373923_0010802 Ga0373923_0010802_796_1587 261
586 3300035117 Ga0373953_0001444 Ga0373953_0001444_2290_3081 261
587 3300035118 Ga0373954_0008746 Ga0373954_0008746_825_1616 261
588 3300035120 Ga0373957_0005066 Ga0373957_0005066_2413_3204 261
589 3300035171 Ga0373946_0001192 Ga0373946_0001192_1684_2475 261
590 3300035172 Ga0373955_0000779 Ga0373955_0000779_11172_11963 261
591 3300035692 Ga0373935_0000053 Ga0373935_0000053_11709_12500 261
592 3300035724 Ga0373933_0001426 Ga0373933_0001426_7122_7913 261
593 3300035725 Ga0373947_0000259 Ga0373947_0000259_19849_20640 261
594 3300036401 Ga0373937_0000030 Ga0373937_0000030_27166_27957 261
595 3300036401 Ga0373937_0001504 Ga0373937_0001504_11848_12633 261
596 3300037068 Ga0373925_0000002 Ga0373925_0000002_38319_39110 261
597 3300037068 Ga0373925_0120502 Ga0373925_0120502_321_1106 261
598 3300046454 Ga0495592_0000046 Ga0495592_0000046_73962_74753 261
599 3300046459 Ga0495629_0002311 Ga0495629_0002311_12533_13324 261
600 3300046462 Ga0495651_0000822 Ga0495651_0000822_12389_13180 261
601 3300046463 Ga0495653_0000006 Ga0495653_0000006_38365_39156 261
602 3300046473 Ga0495582_0028169 Ga0495582_0028169_1842_2633 261
603 3300046476 Ga0495662_0002481 Ga0495662_0002481_1404_2195 261
604 3300046477 Ga0495664_0000002 Ga0495664_0000002_73999_74790 261
605 3300046511 Ga0495608_0000006 Ga0495608_0000006_139756_140547 261
606 3300046514 Ga0495618_0000034 Ga0495618_0000034_91178_91969 261
607 3300046516 Ga0495628_0000002 Ga0495628_0000002_38282_39073 261
608 3300046517 Ga0495630_0000662 Ga0495630_0000662_12421_13212 261
609 3300046529 Ga0495652_0000004 Ga0495652_0000004_549708_550499 261
610 3300046533 Ga0495640_0000007 Ga0495640_0000007_87442_88233 261
611 3300046536 Ga0495587_0000031 Ga0495587_0000031_38384_39175 261
612 3300046543 Ga0495645_0000003 Ga0495645_0000003_19635_20426 261
613 3300046559 Ga0495667_0000002 Ga0495667_0000002_398548_399339 261
614 3300046663 Ga0495635_0000022 Ga0495635_0000022_8667_9458 261
615 3300046663 Ga0495635_0473144 Ga0495635_0473144_28_813 261
616 3300046675 Ga0495657_0000276 Ga0495657_0000276_11763_12554 261
617 3300046678 Ga0495599_0000001 Ga0495599_0000001_177062_177853 261
618 3300046679 Ga0495623_0000094 Ga0495623_0000094_19570_20361 261
619 3300046680 Ga0495646_0000007 Ga0495646_0000007_58952_59743 261
620 3300046689 Ga0495613_0086199 Ga0495613_0086199_168_959 261
621 3300046809 Ga0495600_0000033 Ga0495600_0000033_44512_45303 261
622 3300047315 Ga0495581_0021146 Ga0495581_0021146_635_1426 261
623 3300047317 Ga0495604_0000005 Ga0495604_0000005_64028_64819 261
624 3300047319 Ga0495674_0000003 Ga0495674_0000003_522951_523742 261
625 3300047320 Ga0495672_0122114 Ga0495672_0122114_426_1211 261
626 3300047322 Ga0495680_0000091 Ga0495680_0000091_61293_62084 261
627 3300047444 Ga0495675_0000064 Ga0495675_0000064_35060_35851 261
628 3300047471 Ga0495684_0000035 Ga0495684_0000035_19537_20328 261
629 3300047673 Ga0495593_0001106 Ga0495593_0001106_12706_13497 261
630 3300048088 Ga0495602_0000029 Ga0495602_0000029_19527_20318 261
631 3300049576 Ga0501040_0213128 Ga0501040_0213128_314_1099 261
632 3300049588 Ga0501072_0310850 Ga0501072_0310850_40_825 261
633 3300049591 Ga0501075_0098564 Ga0501075_0098564_248_1033 261
634 3300049592 Ga0501076_0086410 Ga0501076_0086410_734_1525 261
635 3300049592 Ga0501076_0280921 Ga0501076_0280921_502_1287 261
636 3300049741 Ga0501079_0210955 Ga0501079_0210955_206_991 261
637 3300049824 Ga0501045_0393783 Ga0501045_0393783_121_912 261
638 3300050507 nmdc:mga05p37_508_c2 nmdc:mga05p37_508_c2_5465_6250 261
639 3300050510 nmdc:mga06r32_1960_c1 nmdc:mga06r32_1960_c1_3537_4322 261
640 3300050511 nmdc:mga08y16_2332_c1 nmdc:mga08y16_2332_c1_3536_4321 261
641 3300050514 nmdc:mga08x19_116183_c1 nmdc:mga08x19_116183_c1_953_1738 261
642 3300053077 Ga0495601_0000008 Ga0495601_0000008_283567_284358 261
643 3300053077 Ga0495601_0096670 Ga0495601_0096670_804_1592 261
644 3300053078 Ga0495612_0000026 Ga0495612_0000026_61601_62392 261
645 3300053079 Ga0500610_0135901 Ga0500610_0135901_284_1069 261
646 3300053084 Ga0495595_0000024 Ga0495595_0000024_19644_20435 261
647 3300053085 Ga0495619_0000002 Ga0495619_0000002_38387_39178 261
648 3300053085 Ga0495619_0010541 Ga0495619_0010541_5001_5789 261
649 3300053092 Ga0500583_0079978 Ga0500583_0079978_271_1056 261
650 3300053093 Ga0500651_0326092 Ga0500651_0326092_52_837 261
651 3300053146 Ga0500588_0056159 Ga0500588_0056159_406_1191 261
652 3300053727 Ga0500611_004286 Ga0500611_004286_248_1033 261
653 3300053730 Ga0500645_039412 Ga0500645_039412_90_875 261
654 3300054114 Ga0501084_0293106 Ga0501084_0293106_417_1208 261
655 3300060353 Ga0501082_0083125 Ga0501082_0083125_1590_2375 261
656 3300005329 Ga0070683_100108972 Ga0070683_1001089724 262
657 3300005336 Ga0070680_100013186 Ga0070680_1000131864 262
658 3300005340 Ga0070689_100381444 Ga0070689_1003814441 262
659 3300005341 Ga0070691_10002420 Ga0070691_100024206 262
660 3300005341 Ga0070691_10062640 Ga0070691_100626402 262
661 3300005406 Ga0070703_10002528 Ga0070703_100025283 262
662 3300005437 Ga0070710_10055864 Ga0070710_100558642 262
663 3300005439 Ga0070711_100199417 Ga0070711_1001994172 262
664 3300005440 Ga0070705_100000010 Ga0070705_10000001047 262
665 3300005441 Ga0070700_100034755 Ga0070700_1000347552 262
666 3300005444 Ga0070694_100570064 Ga0070694_1005700641 262
667 3300005459 Ga0068867_100722585 Ga0068867_1007225851 262
668 3300005518 Ga0070699_100001314 Ga0070699_1000013147 262
669 3300005530 Ga0070679_100084600 Ga0070679_1000846004 262
670 3300005530 Ga0070679_100208393 Ga0070679_1002083931 262
671 3300005530 Ga0070679_100507683 Ga0070679_1005076832 262
672 3300005536 Ga0070697_100039300 Ga0070697_1000393002 262
673 3300005545 Ga0070695_100001719 Ga0070695_1000017196 262
674 3300005546 Ga0070696_100002812 Ga0070696_1000028128 262
675 3300005577 Ga0068857_100011549 Ga0068857_1000115494 262
676 3300005617 Ga0068859_100003708 Ga0068859_10000370814 262
677 3300005618 Ga0068864_100042873 Ga0068864_1000428734 262
678 3300005842 Ga0068858_100145199 Ga0068858_1001451992 262
679 3300005843 Ga0068860_100013440 Ga0068860_1000134404 262
680 3300005844 Ga0068862_100003043 Ga0068862_10000304311 262
681 3300005937 Ga0081455_10286256 Ga0081455_102862562 262
682 3300005981 Ga0081538_10018338 Ga0081538_100183384 262
683 3300006175 Ga0070712_100095285 Ga0070712_1000952852 262
684 3300006844 Ga0075428_100173857 Ga0075428_1001738573 262
685 3300006881 Ga0068865_100251079 Ga0068865_1002510792 262
686 3300006931 Ga0097620_100003708 Ga0097620_10000370814 262
687 3300007076 Ga0075435_100228548 Ga0075435_1002285482 262
688 3300009094 Ga0111539_10518722 Ga0111539_105187222 262
689 3300009147 Ga0114129_10059035 Ga0114129_100590355 262
690 3300009551 Ga0105238_10125728 Ga0105238_101257283 262
691 3300013104 Ga0157370_10180697 Ga0157370_101806972 262
692 3300013105 Ga0157369_10220624 Ga0157369_102206243 262
693 3300013307 Ga0157372_10091294 Ga0157372_100912942 262
694 3300021384 Ga0213876_10133655 Ga0213876_101336552 262
695 3300025885 Ga0207653_10000559 Ga0207653_100005594 262
696 3300025904 Ga0207647_10083625 Ga0207647_100836252 262
697 3300025908 Ga0207643_10090843 Ga0207643_100908432 262
698 3300025915 Ga0207693_10010718 Ga0207693_100107186 262
699 3300025917 Ga0207660_10035293 Ga0207660_100352933 262
700 3300025921 Ga0207652_10050201 Ga0207652_100502012 262
701 3300025921 Ga0207652_10065031 Ga0207652_100650312 262
702 3300025935 Ga0207709_10196300 Ga0207709_101963001 262
703 3300025942 Ga0207689_10021598 Ga0207689_100215985 262
704 3300025949 Ga0207667_10088810 Ga0207667_100888104 262
705 3300025961 Ga0207712_10004065 Ga0207712_100040653 262
706 3300026075 Ga0207708_10002166 Ga0207708_100021668 262
707 3300026095 Ga0207676_10114967 Ga0207676_101149672 262
708 3300026116 Ga0207674_10003323 Ga0207674_100033234 262
709 3300026116 Ga0207674_10080241 Ga0207674_100802412 262
710 3300026118 Ga0207675_100116502 Ga0207675_1001165022 262
711 3300028380 Ga0268265_10009461 Ga0268265_100094613 262
712 3300028381 Ga0268264_10006938 Ga0268264_100069386 262
713 3300035725 Ga0373947_0191699 Ga0373947_0191699_479_1279 262
714 3300039437 Ga0436365_0733539 Ga0436365_0733539_401_1189 262
715 3300046459 Ga0495629_0117093 Ga0495629_0117093_346_1146 262
716 3300046475 Ga0495639_0030966 Ga0495639_0030966_446_1246 262
717 3300048908 Ga0496105_0015258 Ga0496105_0015258_996_1808 262
718 3300049575 Ga0501039_0237492 Ga0501039_0237492_145_951 262
719 3300050507 nmdc:mga05p37_45950_c1 nmdc:mga05p37_45950_c1_1254_2042 262
720 3300050511 nmdc:mga08y16_643609_c1 nmdc:mga08y16_643609_c1_182_970 262
721 3300050513 nmdc:mga0rr50_149655_c1 nmdc:mga0rr50_149655_c1_215_1003 262
722 3300050515 nmdc:mga0a205_18201_c1 nmdc:mga0a205_18201_c1_3358_4146 262
723 3300054114 Ga0501084_0261257 Ga0501084_0261257_597_1388 262
724 2209111006 2214772980 2213792849 263
725 3300000041 ARcpr5oldR_c000026 ARcpr5oldR_00002615 263
726 3300000042 ARSoilYngRDRAFT_c00029 ARSoilYngRDRAFT_0002915 263
727 3300000043 ARcpr5yngRDRAFT_c000044 ARcpr5yngRDRAFT_00004415 263
728 3300000044 ARSoilOldRDRAFT_c000037 ARSoilOldRDRAFT_00003719 263
729 3300000652 ARCol0yngRDRAFT_1000020 ARCol0yngRDRAFT_100002015 263
730 3300001430 JGI24032J14994_100929 JGI24032J14994_1009291 263
731 3300001989 JGI24739J22299_10004550 JGI24739J22299_100045505 263
732 3300001989 JGI24739J22299_10008850 JGI24739J22299_100088502 263
733 3300001990 JGI24737J22298_10001930 JGI24737J22298_100019304 263
734 3300001991 JGI24743J22301_10003452 JGI24743J22301_100034523 263
735 3300002070 JGI24750J21931_1000586 JGI24750J21931_10005865 263
736 3300002073 JGI24745J21846_1000864 JGI24745J21846_10008643 263
737 3300002075 JGI24738J21930_10003187 JGI24738J21930_100031876 263
738 3300002077 JGI24744J21845_10000745 JGI24744J21845_100007455 263
739 3300002077 JGI24744J21845_10031793 JGI24744J21845_100317931 263
740 3300002126 JGI24035J26624_1001145 JGI24035J26624_10011453 263
741 3300002155 JGI24033J26618_1000244 JGI24033J26618_10002442 263
742 3300002239 JGI24034J26672_10005584 JGI24034J26672_100055842 263
743 3300002244 JGI24742J22300_10000139 JGI24742J22300_1000013911 263
744 3300005276 Ga0065717_1003669 Ga0065717_10036692 263
745 3300005277 Ga0065716_1001673 Ga0065716_10016734 263
746 3300005290 Ga0065712_10036972 Ga0065712_100369721 263
747 3300005290 Ga0065712_10071735 Ga0065712_100717352 263
748 3300005293 Ga0065715_10012820 Ga0065715_100128201 263
749 3300005293 Ga0065715_10017550 Ga0065715_100175502 263
750 3300005293 Ga0065715_10092917 Ga0065715_100929173 263
751 3300005327 Ga0070658_10021114 Ga0070658_100211145 263
752 3300005328 Ga0070676_10001078 Ga0070676_100010787 263
753 3300005329 Ga0070683_100007390 Ga0070683_1000073902 263
754 3300005330 Ga0070690_100014887 Ga0070690_1000148872 263
755 3300005330 Ga0070690_100291210 Ga0070690_1002912101 263
756 3300005331 Ga0070670_100037546 Ga0070670_1000375462 263
757 3300005331 Ga0070670_100089771 Ga0070670_1000897713 263
758 3300005333 Ga0070677_10000668 Ga0070677_100006681 263
759 3300005334 Ga0068869_100013686 Ga0068869_1000136862 263
760 3300005334 Ga0068869_100502095 Ga0068869_1005020952 263
761 3300005335 Ga0070666_10085683 Ga0070666_100856832 263
762 3300005336 Ga0070680_100004715 Ga0070680_1000047157 263
763 3300005336 Ga0070680_100021923 Ga0070680_1000219233 263
764 3300005336 Ga0070680_100024576 Ga0070680_1000245765 263
765 3300005336 Ga0070680_100234127 Ga0070680_1002341271 263
766 3300005336 Ga0070680_100285286 Ga0070680_1002852862 263
767 3300005336 Ga0070680_100301660 Ga0070680_1003016601 263
768 3300005337 Ga0070682_100001091 Ga0070682_10000109117 263
769 3300005337 Ga0070682_100315815 Ga0070682_1003158152 263
770 3300005338 Ga0068868_100037790 Ga0068868_1000377902 263
771 3300005339 Ga0070660_100001398 Ga0070660_1000013987 263
772 3300005339 Ga0070660_100050299 Ga0070660_1000502993 263
773 3300005339 Ga0070660_100058854 Ga0070660_1000588542 263
774 3300005340 Ga0070689_100003399 Ga0070689_1000033994 263
775 3300005340 Ga0070689_100017677 Ga0070689_1000176772 263
776 3300005341 Ga0070691_10000769 Ga0070691_100007696 263
777 3300005341 Ga0070691_10057313 Ga0070691_100573131 263
778 3300005343 Ga0070687_100005958 Ga0070687_1000059582 263
779 3300005343 Ga0070687_100082540 Ga0070687_1000825402 263
780 3300005344 Ga0070661_100001076 Ga0070661_10000107618 263
781 3300005344 Ga0070661_100061862 Ga0070661_1000618622 263
782 3300005345 Ga0070692_10006678 Ga0070692_100066782 263
783 3300005347 Ga0070668_100012317 Ga0070668_1000123173 263
784 3300005347 Ga0070668_100222315 Ga0070668_1002223151 263
785 3300005353 Ga0070669_100005888 Ga0070669_1000058886 263
786 3300005353 Ga0070669_100086940 Ga0070669_1000869403 263
787 3300005353 Ga0070669_100161681 Ga0070669_1001616811 263
788 3300005354 Ga0070675_100000727 Ga0070675_10000072721 263
789 3300005355 Ga0070671_100000438 Ga0070671_10000043813 263
790 3300005355 Ga0070671_100017456 Ga0070671_1000174563 263
791 3300005355 Ga0070671_100018195 Ga0070671_1000181953 263
792 3300005355 Ga0070671_100384509 Ga0070671_1003845091 263
793 3300005356 Ga0070674_100001976 Ga0070674_10000197610 263
794 3300005356 Ga0070674_100037164 Ga0070674_1000371643 263
795 3300005356 Ga0070674_100076955 Ga0070674_1000769553 263
796 3300005364 Ga0070673_100001186 Ga0070673_1000011866 263
797 3300005364 Ga0070673_100064845 Ga0070673_1000648453 263
798 3300005364 Ga0070673_100308282 Ga0070673_1003082822 263
799 3300005365 Ga0070688_100003863 Ga0070688_1000038637 263
800 3300005365 Ga0070688_100022325 Ga0070688_1000223253 263
801 3300005366 Ga0070659_100005874 Ga0070659_1000058746 263
802 3300005366 Ga0070659_100058285 Ga0070659_1000582852 263
803 3300005366 Ga0070659_100159515 Ga0070659_1001595152 263
804 3300005366 Ga0070659_100536262 Ga0070659_1005362621 263
805 3300005367 Ga0070667_100005963 Ga0070667_1000059632 263
806 3300005367 Ga0070667_100141067 Ga0070667_1001410672 263
807 3300005367 Ga0070667_100150888 Ga0070667_1001508883 263
808 3300005434 Ga0070709_10015469 Ga0070709_100154693 263
809 3300005435 Ga0070714_100085977 Ga0070714_1000859773 263
810 3300005436 Ga0070713_100015791 Ga0070713_1000157913 263
811 3300005436 Ga0070713_100057053 Ga0070713_1000570532 263
812 3300005436 Ga0070713_100100725 Ga0070713_1001007252 263
813 3300005436 Ga0070713_100305905 Ga0070713_1003059052 263
814 3300005437 Ga0070710_10021397 Ga0070710_100213972 263
815 3300005437 Ga0070710_10145315 Ga0070710_101453152 263
816 3300005437 Ga0070710_10161886 Ga0070710_101618862 263
817 3300005438 Ga0070701_10000339 Ga0070701_100003396 263
818 3300005438 Ga0070701_10127112 Ga0070701_101271122 263
819 3300005439 Ga0070711_100027442 Ga0070711_1000274424 263
820 3300005439 Ga0070711_100034179 Ga0070711_1000341793 263
821 3300005439 Ga0070711_100189934 Ga0070711_1001899342 263
822 3300005439 Ga0070711_100291549 Ga0070711_1002915491 263
823 3300005440 Ga0070705_100005352 Ga0070705_1000053526 263
824 3300005441 Ga0070700_100000783 Ga0070700_10000078313 263
825 3300005441 Ga0070700_100129382 Ga0070700_1001293822 263
826 3300005444 Ga0070694_100006633 Ga0070694_1000066333 263
827 3300005444 Ga0070694_100277901 Ga0070694_1002779012 263
828 3300005444 Ga0070694_100409326 Ga0070694_1004093262 263
829 3300005444 Ga0070694_100510658 Ga0070694_1005106581 263
830 3300005445 Ga0070708_100015350 Ga0070708_1000153508 263
831 3300005455 Ga0070663_100017471 Ga0070663_1000174714 263
832 3300005455 Ga0070663_100025858 Ga0070663_1000258584 263
833 3300005455 Ga0070663_100033005 Ga0070663_1000330054 263
834 3300005455 Ga0070663_100040103 Ga0070663_1000401032 263
835 3300005455 Ga0070663_100134439 Ga0070663_1001344392 263
836 3300005456 Ga0070678_100011564 Ga0070678_1000115642 263
837 3300005456 Ga0070678_100026061 Ga0070678_1000260614 263
838 3300005456 Ga0070678_100077198 Ga0070678_1000771982 263
839 3300005456 Ga0070678_100160180 Ga0070678_1001601801 263
840 3300005457 Ga0070662_100017941 Ga0070662_1000179415 263
841 3300005457 Ga0070662_100093667 Ga0070662_1000936672 263
842 3300005457 Ga0070662_100364784 Ga0070662_1003647842 263
843 3300005458 Ga0070681_10051242 Ga0070681_100512423 263
844 3300005458 Ga0070681_10077725 Ga0070681_100777253 263
845 3300005459 Ga0068867_100031591 Ga0068867_1000315912 263
846 3300005466 Ga0070685_10005962 Ga0070685_100059623 263
847 3300005466 Ga0070685_10022940 Ga0070685_100229404 263
848 3300005466 Ga0070685_10088559 Ga0070685_100885592 263
849 3300005468 Ga0070707_100232584 Ga0070707_1002325842 263
850 3300005530 Ga0070679_100021002 Ga0070679_1000210026 263
851 3300005530 Ga0070679_100034318 Ga0070679_1000343184 263
852 3300005530 Ga0070679_100056408 Ga0070679_1000564083 263
853 3300005530 Ga0070679_100076400 Ga0070679_1000764003 263
854 3300005530 Ga0070679_100158636 Ga0070679_1001586362 263
855 3300005535 Ga0070684_100030785 Ga0070684_1000307856 263
856 3300005535 Ga0070684_100630839 Ga0070684_1006308392 263
857 3300005539 Ga0068853_100004375 Ga0068853_1000043755 263
858 3300005543 Ga0070672_100011149 Ga0070672_1000111493 263
859 3300005543 Ga0070672_100448528 Ga0070672_1004485282 263
860 3300005544 Ga0070686_100006762 Ga0070686_1000067626 263
861 3300005544 Ga0070686_100151671 Ga0070686_1001516711 263
862 3300005544 Ga0070686_100266991 Ga0070686_1002669912 263
863 3300005544 Ga0070686_100416152 Ga0070686_1004161522 263
864 3300005545 Ga0070695_100030227 Ga0070695_1000302272 263
865 3300005545 Ga0070695_100066208 Ga0070695_1000662082 263
866 3300005547 Ga0070693_100000577 Ga0070693_10000057715 263
867 3300005547 Ga0070693_100010134 Ga0070693_1000101343 263
868 3300005548 Ga0070665_100076321 Ga0070665_1000763212 263
869 3300005549 Ga0070704_100028556 Ga0070704_1000285563 263
870 3300005549 Ga0070704_100295544 Ga0070704_1002955441 263
871 3300005563 Ga0068855_100014148 Ga0068855_1000141488 263
872 3300005563 Ga0068855_100138074 Ga0068855_1001380742 263
873 3300005563 Ga0068855_100190703 Ga0068855_1001907033 263
874 3300005564 Ga0070664_100002073 Ga0070664_1000020736 263
875 3300005564 Ga0070664_100070153 Ga0070664_1000701534 263
876 3300005564 Ga0070664_100145042 Ga0070664_1001450422 263
877 3300005564 Ga0070664_100167671 Ga0070664_1001676712 263
878 3300005577 Ga0068857_100008536 Ga0068857_1000085363 263
879 3300005578 Ga0068854_100001074 Ga0068854_10000107419 263
880 3300005578 Ga0068854_100539611 Ga0068854_1005396112 263
881 3300005614 Ga0068856_100026335 Ga0068856_1000263353 263
882 3300005614 Ga0068856_100039625 Ga0068856_1000396254 263
883 3300005615 Ga0070702_100005245 Ga0070702_1000052456 263
884 3300005615 Ga0070702_100023173 Ga0070702_1000231732 263
885 3300005616 Ga0068852_100001086 Ga0068852_10000108615 263
886 3300005616 Ga0068852_100016187 Ga0068852_1000161878 263
887 3300005616 Ga0068852_100054483 Ga0068852_1000544832 263
888 3300005616 Ga0068852_100055479 Ga0068852_1000554794 263
889 3300005617 Ga0068859_100023234 Ga0068859_1000232346 263
890 3300005617 Ga0068859_100108837 Ga0068859_1001088373 263
891 3300005617 Ga0068859_100127411 Ga0068859_1001274112 263
892 3300005618 Ga0068864_100025772 Ga0068864_1000257722 263
893 3300005618 Ga0068864_100070454 Ga0068864_1000704543 263
894 3300005618 Ga0068864_100093083 Ga0068864_1000930833 263
895 3300005718 Ga0068866_10000403 Ga0068866_1000040319 263
896 3300005718 Ga0068866_10103993 Ga0068866_101039932 263
897 3300005718 Ga0068866_10334537 Ga0068866_103345372 263
898 3300005719 Ga0068861_100180454 Ga0068861_1001804542 263
899 3300005719 Ga0068861_100253512 Ga0068861_1002535122 263
900 3300005834 Ga0068851_10190099 Ga0068851_101900992 263
901 3300005840 Ga0068870_10000860 Ga0068870_100008606 263
902 3300005841 Ga0068863_100003728 Ga0068863_1000037282 263
903 3300005841 Ga0068863_100248817 Ga0068863_1002488172 263
904 3300005842 Ga0068858_100032605 Ga0068858_1000326053 263
905 3300005842 Ga0068858_100201782 Ga0068858_1002017822 263
906 3300005842 Ga0068858_100220118 Ga0068858_1002201182 263
907 3300005843 Ga0068860_100023327 Ga0068860_1000233274 263
908 3300005843 Ga0068860_100099064 Ga0068860_1000990642 263
909 3300005843 Ga0068860_100349123 Ga0068860_1003491232 263
910 3300005843 Ga0068860_100813597 Ga0068860_1008135971 263
911 3300005844 Ga0068862_100024080 Ga0068862_1000240804 263
912 3300005937 Ga0081455_10000012 Ga0081455_10000012128 263
913 3300005937 Ga0081455_10007967 Ga0081455_100079674 263
914 3300005937 Ga0081455_10119932 Ga0081455_101199322 263
915 3300005983 Ga0081540_1002413 Ga0081540_100241310 263
916 3300005983 Ga0081540_1024424 Ga0081540_10244243 263
917 3300005983 Ga0081540_1027356 Ga0081540_10273562 263
918 3300005985 Ga0081539_10080906 Ga0081539_100809062 263
919 3300006028 Ga0070717_10007114 Ga0070717_100071148 263
920 3300006028 Ga0070717_10056934 Ga0070717_100569343 263
921 3300006028 Ga0070717_10076908 Ga0070717_100769082 263
922 3300006038 Ga0075365_10048846 Ga0075365_100488462 263
923 3300006038 Ga0075365_10399680 Ga0075365_103996801 263
924 3300006058 Ga0075432_10001490 Ga0075432_100014905 263
925 3300006163 Ga0070715_10006260 Ga0070715_100062603 263
926 3300006173 Ga0070716_100009562 Ga0070716_1000095622 263
927 3300006175 Ga0070712_100025089 Ga0070712_1000250893 263
928 3300006175 Ga0070712_100063297 Ga0070712_1000632972 263
929 3300006177 Ga0075362_10050193 Ga0075362_100501932 263
930 3300006178 Ga0075367_10039470 Ga0075367_100394702 263
931 3300006237 Ga0097621_100000421 Ga0097621_1000004212 263
932 3300006237 Ga0097621_100008029 Ga0097621_1000080293 263
933 3300006237 Ga0097621_100176781 Ga0097621_1001767812 263
934 3300006358 Ga0068871_100000515 Ga0068871_10000051514 263
935 3300006358 Ga0068871_100012948 Ga0068871_1000129483 263
936 3300006358 Ga0068871_100172423 Ga0068871_1001724232 263
937 3300006844 Ga0075428_100069359 Ga0075428_1000693592 263
938 3300006844 Ga0075428_100073481 Ga0075428_1000734813 263
939 3300006844 Ga0075428_100864848 Ga0075428_1008648482 263
940 3300006846 Ga0075430_100028858 Ga0075430_1000288583 263
941 3300006847 Ga0075431_100072177 Ga0075431_1000721772 263
942 3300006847 Ga0075431_100264530 Ga0075431_1002645302 263
943 3300006852 Ga0075433_10002034 Ga0075433_1000203410 263
944 3300006852 Ga0075433_10008633 Ga0075433_100086336 263
945 3300006852 Ga0075433_10062911 Ga0075433_100629113 263
946 3300006871 Ga0075434_100000693 Ga0075434_10000069318 263
947 3300006871 Ga0075434_100042973 Ga0075434_1000429734 263
948 3300006871 Ga0075434_100128088 Ga0075434_1001280882 263
949 3300006871 Ga0075434_100152317 Ga0075434_1001523171 263
950 3300006880 Ga0075429_100240514 Ga0075429_1002405142 263
951 3300006881 Ga0068865_100002115 Ga0068865_1000021156 263
952 3300006931 Ga0097620_100023234 Ga0097620_1000232346 263
953 3300006931 Ga0097620_100108838 Ga0097620_1001088383 263
954 3300006931 Ga0097620_100127413 Ga0097620_1001274132 263
955 3300007076 Ga0075435_100032913 Ga0075435_1000329134 263
956 3300007076 Ga0075435_100039209 Ga0075435_1000392093 263
957 3300007076 Ga0075435_100260242 Ga0075435_1002602422 263
958 3300009036 Ga0105244_10049754 Ga0105244_100497542 263
959 3300009092 Ga0105250_10131030 Ga0105250_101310302 263
960 3300009093 Ga0105240_10037315 Ga0105240_100373155 263
961 3300009093 Ga0105240_10294125 Ga0105240_102941252 263
962 3300009094 Ga0111539_10004448 Ga0111539_100044489 263
963 3300009094 Ga0111539_10005607 Ga0111539_100056076 263
964 3300009094 Ga0111539_10017591 Ga0111539_100175916 263
965 3300009094 Ga0111539_10197563 Ga0111539_101975632 263
966 3300009098 Ga0105245_10002944 Ga0105245_1000294418 263
967 3300009101 Ga0105247_10011296 Ga0105247_100112963 263
968 3300009101 Ga0105247_10012837 Ga0105247_100128373 263
969 3300009147 Ga0114129_10057318 Ga0114129_100573184 263
970 3300009147 Ga0114129_10065278 Ga0114129_100652783 263
971 3300009147 Ga0114129_10090263 Ga0114129_100902634 263
972 3300009147 Ga0114129_10105879 Ga0114129_101058793 263
973 3300009148 Ga0105243_10002574 Ga0105243_100025746 263
974 3300009148 Ga0105243_10011951 Ga0105243_100119517 263
975 3300009148 Ga0105243_10363934 Ga0105243_103639342 263
976 3300009174 Ga0105241_10073396 Ga0105241_100733962 263
977 3300009174 Ga0105241_10131225 Ga0105241_101312252 263
978 3300009176 Ga0105242_10056433 Ga0105242_100564333 263
979 3300009176 Ga0105242_10058622 Ga0105242_100586223 263
980 3300009176 Ga0105242_10279010 Ga0105242_102790102 263
981 3300009176 Ga0105242_10379756 Ga0105242_103797562 263
982 3300009177 Ga0105248_10063653 Ga0105248_100636532 263
983 3300009177 Ga0105248_10084997 Ga0105248_100849974 263
984 3300009545 Ga0105237_10307346 Ga0105237_103073462 263
985 3300009551 Ga0105238_10009936 Ga0105238_100099368 263
986 3300009551 Ga0105238_10578225 Ga0105238_105782252 263
987 3300009553 Ga0105249_10015879 Ga0105249_100158796 263
988 3300009553 Ga0105249_10140512 Ga0105249_101405122 263
989 3300009553 Ga0105249_10154222 Ga0105249_101542222 263
990 3300010375 Ga0105239_10004537 Ga0105239_100045376 263
991 3300010375 Ga0105239_10414429 Ga0105239_104144292 263
992 3300010375 Ga0105239_10781048 Ga0105239_107810482 263
993 3300011119 Ga0105246_10001092 Ga0105246_1000109213 263
994 3300011119 Ga0105246_10108258 Ga0105246_101082582 263
995 3300013100 Ga0157373_10125287 Ga0157373_101252872 263
996 3300013100 Ga0157373_10217607 Ga0157373_102176072 263
997 3300013102 Ga0157371_10007315 Ga0157371_100073152 263
998 3300013102 Ga0157371_10106396 Ga0157371_101063962 263
999 3300013102 Ga0157371_10262381 Ga0157371_102623812 263
1000 3300013104 Ga0157370_10238648 Ga0157370_102386482 263
1001 3300013105 Ga0157369_10261134 Ga0157369_102611342 263
1002 3300013296 Ga0157374_10002049 Ga0157374_1000204916 263
1003 3300013297 Ga0157378_10007541 Ga0157378_100075416 263
1004 3300013306 Ga0163162_10005029 Ga0163162_100050296 263
1005 3300013306 Ga0163162_10077208 Ga0163162_100772083 263
1006 3300013306 Ga0163162_10108051 Ga0163162_101080513 263
1007 3300013306 Ga0163162_10127619 Ga0163162_101276192 263
1008 3300013307 Ga0157372_10012748 Ga0157372_100127488 263
1009 3300013307 Ga0157372_10045191 Ga0157372_100451915 263
1010 3300013307 Ga0157372_10561435 Ga0157372_105614352 263
1011 3300013308 Ga0157375_10004037 Ga0157375_1000403716 263
1012 3300013308 Ga0157375_10019784 Ga0157375_100197844 263
1013 3300013308 Ga0157375_10160750 Ga0157375_101607502 263
1014 3300013308 Ga0157375_10301436 Ga0157375_103014362 263
1015 3300014325 Ga0163163_10005574 Ga0163163_1000557410 263
1016 3300014325 Ga0163163_10024568 Ga0163163_100245682 263
1017 3300014326 Ga0157380_10001279 Ga0157380_100012796 263
1018 3300014326 Ga0157380_10257088 Ga0157380_102570882 263
1019 3300014326 Ga0157380_10699440 Ga0157380_106994402 263
1020 3300014497 Ga0182008_10032141 Ga0182008_100321413 263
1021 3300014745 Ga0157377_10000312 Ga0157377_1000031214 263
1022 3300014968 Ga0157379_10001989 Ga0157379_100019896 263
1023 3300014968 Ga0157379_10029559 Ga0157379_100295594 263
1024 3300014968 Ga0157379_10063884 Ga0157379_100638844 263
1025 3300014969 Ga0157376_10001372 Ga0157376_1000137215 263
1026 3300014969 Ga0157376_10735798 Ga0157376_107357981 263
1027 3300017792 Ga0163161_10003480 Ga0163161_1000348010 263
1028 3300017792 Ga0163161_10205986 Ga0163161_102059862 263
1029 3300025271 Ga0207666_1000038 Ga0207666_100003822 263
1030 3300025290 Ga0207673_1001708 Ga0207673_10017082 263
1031 3300025315 Ga0207697_10000373 Ga0207697_1000037317 263
1032 3300025315 Ga0207697_10039973 Ga0207697_100399731 263
1033 3300025315 Ga0207697_10145323 Ga0207697_101453232 263
1034 3300025728 Ga0207655_1085718 Ga0207655_10857182 263
1035 3300025885 Ga0207653_10005254 Ga0207653_100052543 263
1036 3300025885 Ga0207653_10072307 Ga0207653_100723071 263
1037 3300025893 Ga0207682_10000071 Ga0207682_1000007123 263
1038 3300025898 Ga0207692_10067079 Ga0207692_100670792 263
1039 3300025900 Ga0207710_10007122 Ga0207710_100071223 263
1040 3300025901 Ga0207688_10000237 Ga0207688_1000023713 263
1041 3300025901 Ga0207688_10133137 Ga0207688_101331371 263
1042 3300025903 Ga0207680_10016997 Ga0207680_100169973 263
1043 3300025903 Ga0207680_10037949 Ga0207680_100379493 263
1044 3300025904 Ga0207647_10009005 Ga0207647_100090054 263
1045 3300025904 Ga0207647_10073935 Ga0207647_100739352 263
1046 3300025905 Ga0207685_10002917 Ga0207685_100029172 263
1047 3300025906 Ga0207699_10073451 Ga0207699_100734512 263
1048 3300025907 Ga0207645_10000779 Ga0207645_1000077922 263
1049 3300025907 Ga0207645_10110454 Ga0207645_101104542 263
1050 3300025908 Ga0207643_10000276 Ga0207643_1000027612 263
1051 3300025909 Ga0207705_10062534 Ga0207705_100625342 263
1052 3300025911 Ga0207654_10014702 Ga0207654_100147022 263
1053 3300025911 Ga0207654_10183138 Ga0207654_101831382 263
1054 3300025912 Ga0207707_10000454 Ga0207707_1000045416 263
1055 3300025912 Ga0207707_10070862 Ga0207707_100708623 263
1056 3300025912 Ga0207707_10100506 Ga0207707_101005062 263
1057 3300025912 Ga0207707_10167955 Ga0207707_101679552 263
1058 3300025912 Ga0207707_10183377 Ga0207707_101833772 263
1059 3300025912 Ga0207707_10199840 Ga0207707_101998402 263
1060 3300025913 Ga0207695_10193073 Ga0207695_101930732 263
1061 3300025914 Ga0207671_10016484 Ga0207671_100164842 263
1062 3300025914 Ga0207671_10037376 Ga0207671_100373764 263
1063 3300025915 Ga0207693_10005073 Ga0207693_100050733 263
1064 3300025915 Ga0207693_10021275 Ga0207693_100212753 263
1065 3300025915 Ga0207693_10059589 Ga0207693_100595893 263
1066 3300025915 Ga0207693_10132910 Ga0207693_101329101 263
1067 3300025915 Ga0207693_10278799 Ga0207693_102787992 263
1068 3300025915 Ga0207693_10326774 Ga0207693_103267742 263
1069 3300025915 Ga0207693_10496060 Ga0207693_104960602 263
1070 3300025916 Ga0207663_10060626 Ga0207663_100606262 263
1071 3300025916 Ga0207663_10092706 Ga0207663_100927062 263
1072 3300025916 Ga0207663_10115713 Ga0207663_101157132 263
1073 3300025917 Ga0207660_10000087 Ga0207660_1000008711 263
1074 3300025917 Ga0207660_10035398 Ga0207660_100353983 263
1075 3300025917 Ga0207660_10065427 Ga0207660_100654272 263
1076 3300025917 Ga0207660_10146519 Ga0207660_101465192 263
1077 3300025917 Ga0207660_10365811 Ga0207660_103658111 263
1078 3300025917 Ga0207660_10407093 Ga0207660_104070932 263
1079 3300025917 Ga0207660_10492479 Ga0207660_104924792 263
1080 3300025918 Ga0207662_10000659 Ga0207662_1000065913 263
1081 3300025918 Ga0207662_10006900 Ga0207662_100069003 263
1082 3300025918 Ga0207662_10009020 Ga0207662_100090202 263
1083 3300025919 Ga0207657_10003101 Ga0207657_1000310110 263
1084 3300025919 Ga0207657_10005173 Ga0207657_1000517311 263
1085 3300025919 Ga0207657_10090738 Ga0207657_100907382 263
1086 3300025920 Ga0207649_10000662 Ga0207649_1000066213 263
1087 3300025920 Ga0207649_10039165 Ga0207649_100391653 263
1088 3300025920 Ga0207649_10061498 Ga0207649_100614982 263
1089 3300025920 Ga0207649_10169967 Ga0207649_101699671 263
1090 3300025921 Ga0207652_10001908 Ga0207652_1000190817 263
1091 3300025921 Ga0207652_10008147 Ga0207652_100081473 263
1092 3300025921 Ga0207652_10023549 Ga0207652_100235495 263
1093 3300025921 Ga0207652_10111416 Ga0207652_101114162 263
1094 3300025921 Ga0207652_10133337 Ga0207652_101333372 263
1095 3300025921 Ga0207652_10459726 Ga0207652_104597262 263
1096 3300025923 Ga0207681_10001262 Ga0207681_100012623 263
1097 3300025923 Ga0207681_10390820 Ga0207681_103908202 263
1098 3300025924 Ga0207694_10017984 Ga0207694_100179845 263
1099 3300025924 Ga0207694_10166488 Ga0207694_101664882 263
1100 3300025925 Ga0207650_10005107 Ga0207650_100051074 263
1101 3300025926 Ga0207659_10000143 Ga0207659_1000014323 263
1102 3300025926 Ga0207659_10202567 Ga0207659_102025672 263
1103 3300025927 Ga0207687_10000865 Ga0207687_1000086516 263
1104 3300025927 Ga0207687_10052245 Ga0207687_100522453 263
1105 3300025928 Ga0207700_10000323 Ga0207700_1000032318 263
1106 3300025928 Ga0207700_10034585 Ga0207700_100345853 263
1107 3300025928 Ga0207700_10063780 Ga0207700_100637803 263
1108 3300025928 Ga0207700_10070564 Ga0207700_100705642 263
1109 3300025928 Ga0207700_10229601 Ga0207700_102296012 263
1110 3300025931 Ga0207644_10000532 Ga0207644_1000053213 263
1111 3300025931 Ga0207644_10015181 Ga0207644_100151815 263
1112 3300025931 Ga0207644_10166963 Ga0207644_101669632 263
1113 3300025932 Ga0207690_10000409 Ga0207690_1000040914 263
1114 3300025932 Ga0207690_10074024 Ga0207690_100740243 263
1115 3300025933 Ga0207706_10001338 Ga0207706_1000133821 263
1116 3300025933 Ga0207706_10006705 Ga0207706_100067057 263
1117 3300025933 Ga0207706_10058641 Ga0207706_100586414 263
1118 3300025934 Ga0207686_10000500 Ga0207686_1000050018 263
1119 3300025934 Ga0207686_10173175 Ga0207686_101731752 263
1120 3300025935 Ga0207709_10001266 Ga0207709_1000126616 263
1121 3300025935 Ga0207709_10037338 Ga0207709_100373383 263
1122 3300025935 Ga0207709_10203809 Ga0207709_102038092 263
1123 3300025936 Ga0207670_10000689 Ga0207670_1000068918 263
1124 3300025936 Ga0207670_10007354 Ga0207670_100073543 263
1125 3300025936 Ga0207670_10064980 Ga0207670_100649803 263
1126 3300025937 Ga0207669_10001125 Ga0207669_100011259 263
1127 3300025937 Ga0207669_10051596 Ga0207669_100515963 263
1128 3300025937 Ga0207669_10409772 Ga0207669_104097722 263
1129 3300025938 Ga0207704_10000613 Ga0207704_100006139 263
1130 3300025939 Ga0207665_10001192 Ga0207665_1000119211 263
1131 3300025939 Ga0207665_10352722 Ga0207665_103527221 263
1132 3300025940 Ga0207691_10003339 Ga0207691_1000333913 263
1133 3300025941 Ga0207711_10009628 Ga0207711_100096282 263
1134 3300025941 Ga0207711_10029326 Ga0207711_100293262 263
1135 3300025941 Ga0207711_10032877 Ga0207711_100328773 263
1136 3300025941 Ga0207711_10050370 Ga0207711_100503702 263
1137 3300025942 Ga0207689_10000440 Ga0207689_1000044022 263
1138 3300025942 Ga0207689_10382488 Ga0207689_103824882 263
1139 3300025944 Ga0207661_10059018 Ga0207661_100590184 263
1140 3300025944 Ga0207661_10061762 Ga0207661_100617624 263
1141 3300025945 Ga0207679_10000131 Ga0207679_1000013132 263
1142 3300025945 Ga0207679_10052938 Ga0207679_100529383 263
1143 3300025945 Ga0207679_10156128 Ga0207679_101561282 263
1144 3300025949 Ga0207667_10028062 Ga0207667_100280622 263
1145 3300025949 Ga0207667_10040115 Ga0207667_100401152 263
1146 3300025949 Ga0207667_10092846 Ga0207667_100928463 263
1147 3300025949 Ga0207667_10659237 Ga0207667_106592372 263
1148 3300025960 Ga0207651_10000335 Ga0207651_100003356 263
1149 3300025960 Ga0207651_10734133 Ga0207651_107341331 263
1150 3300025961 Ga0207712_10002448 Ga0207712_100024486 263
1151 3300025961 Ga0207712_10030909 Ga0207712_100309093 263
1152 3300025961 Ga0207712_10048380 Ga0207712_100483803 263
1153 3300025961 Ga0207712_10220854 Ga0207712_102208542 263
1154 3300025972 Ga0207668_10000065 Ga0207668_100000656 263
1155 3300025972 Ga0207668_10104967 Ga0207668_101049672 263
1156 3300025981 Ga0207640_10000339 Ga0207640_1000033914 263
1157 3300025986 Ga0207658_10004428 Ga0207658_100044289 263
1158 3300025986 Ga0207658_10026143 Ga0207658_100261434 263
1159 3300025986 Ga0207658_10177132 Ga0207658_101771323 263
1160 3300025986 Ga0207658_10433482 Ga0207658_104334822 263
1161 3300026023 Ga0207677_10003580 Ga0207677_100035806 263
1162 3300026023 Ga0207677_10227626 Ga0207677_102276262 263
1163 3300026035 Ga0207703_10001885 Ga0207703_1000188519 263
1164 3300026035 Ga0207703_10056702 Ga0207703_100567023 263
1165 3300026035 Ga0207703_10397386 Ga0207703_103973862 263
1166 3300026041 Ga0207639_10041384 Ga0207639_100413842 263
1167 3300026041 Ga0207639_10124568 Ga0207639_101245682 263
1168 3300026067 Ga0207678_10000944 Ga0207678_100009446 263
1169 3300026067 Ga0207678_10036592 Ga0207678_100365924 263
1170 3300026067 Ga0207678_10056937 Ga0207678_100569373 263
1171 3300026067 Ga0207678_10058587 Ga0207678_100585873 263
1172 3300026067 Ga0207678_10147555 Ga0207678_101475552 263
1173 3300026067 Ga0207678_10160477 Ga0207678_101604773 263
1174 3300026075 Ga0207708_10002019 Ga0207708_100020196 263
1175 3300026075 Ga0207708_10019423 Ga0207708_100194236 263
1176 3300026078 Ga0207702_10028991 Ga0207702_100289913 263
1177 3300026078 Ga0207702_10084985 Ga0207702_100849853 263
1178 3300026088 Ga0207641_10005810 Ga0207641_100058104 263
1179 3300026088 Ga0207641_10073016 Ga0207641_100730162 263
1180 3300026088 Ga0207641_10726252 Ga0207641_107262522 263
1181 3300026089 Ga0207648_10003430 Ga0207648_1000343019 263
1182 3300026095 Ga0207676_10008134 Ga0207676_100081344 263
1183 3300026095 Ga0207676_10047064 Ga0207676_100470643 263
1184 3300026095 Ga0207676_10084878 Ga0207676_100848783 263
1185 3300026116 Ga0207674_10005364 Ga0207674_1000536413 263
1186 3300026118 Ga0207675_100000815 Ga0207675_10000081515 263
1187 3300026118 Ga0207675_100140046 Ga0207675_1001400462 263
1188 3300026121 Ga0207683_10000001 Ga0207683_10000001331 263
1189 3300026121 Ga0207683_10081084 Ga0207683_100810843 263
1190 3300026121 Ga0207683_10252232 Ga0207683_102522322 263
1191 3300026142 Ga0207698_10019683 Ga0207698_100196836 263
1192 3300026142 Ga0207698_10027837 Ga0207698_100278372 263
1193 3300026142 Ga0207698_10051342 Ga0207698_100513423 263
1194 3300027617 Ga0210002_1001135 Ga0210002_10011351 263
1195 3300027695 Ga0209966_1000743 Ga0209966_10007433 263
1196 3300027717 Ga0209998_10001042 Ga0209998_100010422 263
1197 3300027717 Ga0209998_10002206 Ga0209998_100022063 263
1198 3300027907 Ga0207428_10000172 Ga0207428_100001728 263
1199 3300027907 Ga0207428_10000255 Ga0207428_1000025533 263
1200 3300027907 Ga0207428_10003313 Ga0207428_1000331313 263
1201 3300027907 Ga0207428_10184301 Ga0207428_101843012 263
1202 3300028379 Ga0268266_10020037 Ga0268266_100200374 263
1203 3300028380 Ga0268265_10029653 Ga0268265_100296534 263
1204 3300028380 Ga0268265_10165088 Ga0268265_101650882 263
1205 3300028381 Ga0268264_10001153 Ga0268264_1000115313 263
1206 3300028381 Ga0268264_10236425 Ga0268264_102364252 263
1207 3300028556 Ga0265337_1010295 Ga0265337_10102953 263
1208 3300028800 Ga0265338_10143015 Ga0265338_101430152 263
1209 3300028800 Ga0265338_10198241 Ga0265338_101982412 263
1210 3300031235 Ga0265330_10169430 Ga0265330_101694301 263
1211 3300031241 Ga0265325_10000901 Ga0265325_100009013 263
1212 3300031242 Ga0265329_10053302 Ga0265329_100533022 263
1213 3300031247 Ga0265340_10007715 Ga0265340_100077153 263
1214 3300031249 Ga0265339_10000387 Ga0265339_100003878 263
1215 3300031250 Ga0265331_10040106 Ga0265331_100401062 263
1216 3300031344 Ga0265316_10039292 Ga0265316_100392923 263
1217 3300031595 Ga0265313_10000850 Ga0265313_1000085023 263
1218 3300031595 Ga0265313_10004004 Ga0265313_100040043 263
1219 3300031595 Ga0265313_10016620 Ga0265313_100166202 263
1220 3300031711 Ga0265314_10007897 Ga0265314_100078975 263
1221 3300031711 Ga0265314_10024428 Ga0265314_100244283 263
1222 3300031711 Ga0265314_10156525 Ga0265314_101565252 263
1223 3300031712 Ga0265342_10000196 Ga0265342_1000019661 263
1224 3300034816 Ga0373930_0000014 Ga0373930_0000014_11137_11928 263
1225 3300034817 Ga0373948_0000493 Ga0373948_0000493_1654_2445 263
1226 3300034817 Ga0373948_0000950 Ga0373948_0000950_1583_2374 263
1227 3300034817 Ga0373948_0052100 Ga0373948_0052100_16_807 263
1228 3300034818 Ga0373950_0000145 Ga0373950_0000145_3173_3964 263
1229 3300034818 Ga0373950_0018150 Ga0373950_0018150_288_1079 263
1230 3300034819 Ga0373958_0000064 Ga0373958_0000064_1179_1970 263
1231 3300034819 Ga0373958_0026549 Ga0373958_0026549_256_1047 263
1232 3300034957 Ga0373938_0000946 Ga0373938_0000946_3629_4420 263
1233 3300035083 Ga0373926_0015109 Ga0373926_0015109_992_1807 263
1234 3300035084 Ga0373928_0001389 Ga0373928_0001389_82_873 263
1235 3300035084 Ga0373928_0007010 Ga0373928_0007010_82_873 263
1236 3300035085 Ga0373929_0000101 Ga0373929_0000101_10900_11691 263
1237 3300035085 Ga0373929_0004137 Ga0373929_0004137_307_1098 263
1238 3300035086 Ga0373934_0010944 Ga0373934_0010944_1387_2178 263
1239 3300035088 Ga0373940_0003765 Ga0373940_0003765_1323_2114 263
1240 3300035090 Ga0373949_0000293 Ga0373949_0000293_6196_6987 263
1241 3300035090 Ga0373949_0000952 Ga0373949_0000952_3601_4392 263
1242 3300035091 Ga0373951_0000154 Ga0373951_0000154_896_1687 263
1243 3300035091 Ga0373951_0021677 Ga0373951_0021677_426_1217 263
1244 3300035092 Ga0373952_0000030 Ga0373952_0000030_7315_8106 263
1245 3300035092 Ga0373952_0000920 Ga0373952_0000920_957_1748 263
1246 3300035111 Ga0373923_0016379 Ga0373923_0016379_16_807 263
1247 3300035111 Ga0373923_0040531 Ga0373923_0040531_712_1503 263
1248 3300035112 Ga0373932_0001243 Ga0373932_0001243_1099_1890 263
1249 3300035112 Ga0373932_0003082 Ga0373932_0003082_87_878 263
1250 3300035112 Ga0373932_0027504 Ga0373932_0027504_739_1530 263
1251 3300035113 Ga0373936_0008164 Ga0373936_0008164_335_1150 263
1252 3300035113 Ga0373936_0017372 Ga0373936_0017372_1689_2480 263
1253 3300035114 Ga0373939_0000791 Ga0373939_0000791_5106_5897 263
1254 3300035114 Ga0373939_0003691 Ga0373939_0003691_1763_2554 263
1255 3300035114 Ga0373939_0006181 Ga0373939_0006181_1306_2106 263
1256 3300035115 Ga0373941_0000050 Ga0373941_0000050_12997_13788 263
1257 3300035116 Ga0373945_0001214 Ga0373945_0001214_86_877 263
1258 3300035117 Ga0373953_0013693 Ga0373953_0013693_1707_2498 263
1259 3300035118 Ga0373954_0001943 Ga0373954_0001943_5011_5802 263
1260 3300035118 Ga0373954_0021614 Ga0373954_0021614_150_941 263
1261 3300035118 Ga0373954_0032397 Ga0373954_0032397_1075_1866 263
1262 3300035118 Ga0373954_0083291 Ga0373954_0083291_293_1096 263
1263 3300035119 Ga0373956_0024897 Ga0373956_0024897_68_859 263
1264 3300035119 Ga0373956_0052136 Ga0373956_0052136_167_958 263
1265 3300035121 Ga0373960_0003068 Ga0373960_0003068_1974_2765 263
1266 3300035121 Ga0373960_0020400 Ga0373960_0020400_541_1332 263
1267 3300035170 Ga0373943_0000132 Ga0373943_0000132_23432_24247 263
1268 3300035170 Ga0373943_0000377 Ga0373943_0000377_17194_17985 263
1269 3300035170 Ga0373943_0001792 Ga0373943_0001792_5658_6449 263
1270 3300035170 Ga0373943_0012484 Ga0373943_0012484_2636_3427 263
1271 3300035171 Ga0373946_0000760 Ga0373946_0000760_2374_3189 263
1272 3300035171 Ga0373946_0005660 Ga0373946_0005660_2425_3216 263
1273 3300035172 Ga0373955_0069284 Ga0373955_0069284_31_822 263
1274 3300035207 Ga0373942_0000073 Ga0373942_0000073_9891_10682 263
1275 3300035241 Ga0373961_0000480 Ga0373961_0000480_79_870 263
1276 3300035242 Ga0373962_0001214 Ga0373962_0001214_1961_2752 263
1277 3300035242 Ga0373962_0001920 Ga0373962_0001920_3345_4136 263
1278 3300035242 Ga0373962_0023763 Ga0373962_0023763_815_1606 263
1279 3300035691 Ga0373931_0000537 Ga0373931_0000537_11211_12002 263
1280 3300035691 Ga0373931_0006018 Ga0373931_0006018_1509_2300 263
1281 3300035691 Ga0373931_0032608 Ga0373931_0032608_1257_2048 263
1282 3300035692 Ga0373935_0001261 Ga0373935_0001261_8069_8860 263
1283 3300035692 Ga0373935_0003568 Ga0373935_0003568_2875_3690 263
1284 3300035692 Ga0373935_0004470 Ga0373935_0004470_142_933 263
1285 3300035692 Ga0373935_0046856 Ga0373935_0046856_493_1284 263
1286 3300035695 Ga0373927_0002426 Ga0373927_0002426_993_1808 263
1287 3300035695 Ga0373927_0004260 Ga0373927_0004260_409_1200 263
1288 3300035695 Ga0373927_0032963 Ga0373927_0032963_2516_3331 263
1289 3300035695 Ga0373927_0074416 Ga0373927_0074416_736_1527 263
1290 3300035724 Ga0373933_0021557 Ga0373933_0021557_2687_3478 263
1291 3300035724 Ga0373933_0034416 Ga0373933_0034416_782_1573 263
1292 3300035724 Ga0373933_0165937 Ga0373933_0165937_172_975 263
1293 3300035725 Ga0373947_0000239 Ga0373947_0000239_8871_9686 263
1294 3300035725 Ga0373947_0009288 Ga0373947_0009288_1776_2567 263
1295 3300035725 Ga0373947_0085740 Ga0373947_0085740_1066_1881 263
1296 3300036401 Ga0373937_0000907 Ga0373937_0000907_23127_23918 263
1297 3300036401 Ga0373937_0003255 Ga0373937_0003255_5426_6217 263
1298 3300036401 Ga0373937_0029085 Ga0373937_0029085_2979_3770 263
1299 3300036401 Ga0373937_0036814 Ga0373937_0036814_78_869 263
1300 3300036401 Ga0373937_0090015 Ga0373937_0090015_668_1459 263
1301 3300036401 Ga0373937_0200872 Ga0373937_0200872_366_1169 263
1302 3300037068 Ga0373925_0000706 Ga0373925_0000706_27820_28635 263
1303 3300037068 Ga0373925_0019842 Ga0373925_0019842_1926_2717 263
1304 3300037068 Ga0373925_0024207 Ga0373925_0024207_268_1071 263
1305 3300037068 Ga0373925_0044964 Ga0373925_0044964_93_884 263
1306 3300037068 Ga0373925_0057569 Ga0373925_0057569_211_1002 263
1307 3300037068 Ga0373925_0346049 Ga0373925_0346049_331_1146 263
1308 3300037418 Ga0395900_0009186 Ga0395900_0009186_5367_6158 263
1309 3300037466 Ga0395898_0003941 Ga0395898_0003941_2239_3030 263
1310 3300037466 Ga0395898_0024197 Ga0395898_0024197_2132_2923 263
1311 3300038443 Ga0395901_0075175 Ga0395901_0075175_1187_1978 263
1312 3300038443 Ga0395901_0161489 Ga0395901_0161489_1068_1859 263
1313 3300041408 Ga0439453_0014947 Ga0439453_0014947_53_844 263
1314 3300042008 Ga0439450_051973 Ga0439450_051973_144_935 263
1315 3300042012 Ga0439455_0019342 Ga0439455_0019342_103_894 263
1316 3300042016 Ga0439463_013245 Ga0439463_013245_1017_1808 263
1317 3300044694 Ga0466963_0161577 Ga0466963_0161577_26_817 263
1318 3300044842 Ga0466957_0097636 Ga0466957_0097636_804_1595 263
1319 3300044842 Ga0466957_0380297 Ga0466957_0380297_23_814 263
1320 3300045051 Ga0451576_0117936 Ga0451576_0117936_896_1687 263
1321 3300045976 Ga0466967_0000135 Ga0466967_0000135_2066_2857 263
1322 3300046454 Ga0495592_0001393 Ga0495592_0001393_8283_9074 263
1323 3300046454 Ga0495592_0002484 Ga0495592_0002484_10092_10883 263
1324 3300046454 Ga0495592_0009550 Ga0495592_0009550_5676_6467 263
1325 3300046454 Ga0495592_0078729 Ga0495592_0078729_1038_1829 263
1326 3300046454 Ga0495592_0115815 Ga0495592_0115815_925_1716 263
1327 3300046454 Ga0495592_0168976 Ga0495592_0168976_697_1488 263
1328 3300046455 Ga0495603_0002249 Ga0495603_0002249_3543_4334 263
1329 3300046455 Ga0495603_0008354 Ga0495603_0008354_1492_2283 263
1330 3300046459 Ga0495629_0001140 Ga0495629_0001140_1186_1977 263
1331 3300046459 Ga0495629_0019080 Ga0495629_0019080_978_1793 263
1332 3300046459 Ga0495629_0024508 Ga0495629_0024508_875_1690 263
1333 3300046459 Ga0495629_0033237 Ga0495629_0033237_657_1448 263
1334 3300046459 Ga0495629_0084401 Ga0495629_0084401_635_1426 263
1335 3300046461 Ga0495641_0007754 Ga0495641_0007754_4661_5452 263
1336 3300046461 Ga0495641_0011331 Ga0495641_0011331_2019_2810 263
1337 3300046461 Ga0495641_0017820 Ga0495641_0017820_2791_3582 263
1338 3300046461 Ga0495641_0142861 Ga0495641_0142861_73_864 263
1339 3300046462 Ga0495651_0001833 Ga0495651_0001833_115_906 263
1340 3300046462 Ga0495651_0004816 Ga0495651_0004816_5994_6785 263
1341 3300046463 Ga0495653_0004798 Ga0495653_0004798_1954_2745 263
1342 3300046463 Ga0495653_0024139 Ga0495653_0024139_1143_1934 263
1343 3300046472 Ga0495580_0017640 Ga0495580_0017640_3823_4638 263
1344 3300046472 Ga0495580_0044484 Ga0495580_0044484_267_1058 263
1345 3300046473 Ga0495582_0000379 Ga0495582_0000379_73_864 263
1346 3300046473 Ga0495582_0010594 Ga0495582_0010594_2263_3054 263
1347 3300046473 Ga0495582_0141949 Ga0495582_0141949_129_920 263
1348 3300046473 Ga0495582_0284725 Ga0495582_0284725_18_818 263
1349 3300046475 Ga0495639_0004321 Ga0495639_0004321_3540_4331 263
1350 3300046475 Ga0495639_0015125 Ga0495639_0015125_190_981 263
1351 3300046475 Ga0495639_0050475 Ga0495639_0050475_55_870 263
1352 3300046476 Ga0495662_0000084 Ga0495662_0000084_27927_28718 263
1353 3300046476 Ga0495662_0000280 Ga0495662_0000280_19623_20438 263
1354 3300046476 Ga0495662_0021388 Ga0495662_0021388_31_822 263
1355 3300046476 Ga0495662_0188970 Ga0495662_0188970_155_946 263
1356 3300046477 Ga0495664_0000112 Ga0495664_0000112_31699_32514 263
1357 3300046477 Ga0495664_0007745 Ga0495664_0007745_1922_2713 263
1358 3300046491 Ga0495584_0033756 Ga0495584_0033756_893_1684 263
1359 3300046492 Ga0495585_0001932 Ga0495585_0001932_10300_11091 263
1360 3300046499 Ga0495594_0002726 Ga0495594_0002726_1639_2430 263
1361 3300046499 Ga0495594_0009110 Ga0495594_0009110_1930_2721 263
1362 3300046499 Ga0495594_0018037 Ga0495594_0018037_2281_3072 263
1363 3300046506 Ga0495583_0102989 Ga0495583_0102989_154_945 263
1364 3300046511 Ga0495608_0012927 Ga0495608_0012927_1689_2480 263
1365 3300046511 Ga0495608_0017846 Ga0495608_0017846_2170_2961 263
1366 3300046514 Ga0495618_0001016 Ga0495618_0001016_5810_6625 263
1367 3300046514 Ga0495618_0001547 Ga0495618_0001547_5192_5983 263
1368 3300046514 Ga0495618_0073148 Ga0495618_0073148_55_846 263
1369 3300046514 Ga0495618_0287857 Ga0495618_0287857_13_813 263
1370 3300046516 Ga0495628_0003624 Ga0495628_0003624_9076_9867 263
1371 3300046516 Ga0495628_0027943 Ga0495628_0027943_3218_4009 263
1372 3300046516 Ga0495628_0032270 Ga0495628_0032270_1777_2568 263
1373 3300046516 Ga0495628_0101756 Ga0495628_0101756_237_1028 263
1374 3300046517 Ga0495630_0005622 Ga0495630_0005622_5172_5963 263
1375 3300046517 Ga0495630_0027968 Ga0495630_0027968_1006_1821 263
1376 3300046517 Ga0495630_0042264 Ga0495630_0042264_1924_2715 263
1377 3300046517 Ga0495630_0095680 Ga0495630_0095680_770_1585 263
1378 3300046520 Ga0495637_0020521 Ga0495637_0020521_1011_1802 263
1379 3300046523 Ga0495644_0003085 Ga0495644_0003085_694_1485 263
1380 3300046525 Ga0495663_0013733 Ga0495663_0013733_487_1278 263
1381 3300046526 Ga0495666_0001508 Ga0495666_0001508_3541_4332 263
1382 3300046526 Ga0495666_0012392 Ga0495666_0012392_2164_2955 263
1383 3300046526 Ga0495666_0034119 Ga0495666_0034119_237_1028 263
1384 3300046529 Ga0495652_0013904 Ga0495652_0013904_5191_5982 263
1385 3300046529 Ga0495652_0019057 Ga0495652_0019057_3396_4187 263
1386 3300046529 Ga0495652_0026657 Ga0495652_0026657_2581_3396 263
1387 3300046529 Ga0495652_0307758 Ga0495652_0307758_20_811 263
1388 3300046531 Ga0495665_0003909 Ga0495665_0003909_6418_7209 263
1389 3300046531 Ga0495665_0014689 Ga0495665_0014689_1513_2304 263
1390 3300046531 Ga0495665_0017779 Ga0495665_0017779_1509_2324 263
1391 3300046531 Ga0495665_0098481 Ga0495665_0098481_265_1080 263
1392 3300046533 Ga0495640_0006199 Ga0495640_0006199_2708_3499 263
1393 3300046533 Ga0495640_0008881 Ga0495640_0008881_1038_1853 263
1394 3300046533 Ga0495640_0010455 Ga0495640_0010455_1186_1977 263
1395 3300046533 Ga0495640_0065752 Ga0495640_0065752_992_1783 263
1396 3300046535 Ga0495586_0032879 Ga0495586_0032879_1295_2086 263
1397 3300046536 Ga0495587_0002979 Ga0495587_0002979_2653_3444 263
1398 3300046536 Ga0495587_0016339 Ga0495587_0016339_1819_2610 263
1399 3300046536 Ga0495587_0018087 Ga0495587_0018087_3164_3955 263
1400 3300046536 Ga0495587_0193285 Ga0495587_0193285_310_1113 263
1401 3300046537 Ga0495598_0004396 Ga0495598_0004396_28_819 263
1402 3300046543 Ga0495645_0005275 Ga0495645_0005275_1685_2500 263
1403 3300046543 Ga0495645_0010875 Ga0495645_0010875_5151_5942 263
1404 3300046543 Ga0495645_0011025 Ga0495645_0011025_4378_5169 263
1405 3300046543 Ga0495645_0263654 Ga0495645_0263654_292_1083 263
1406 3300046557 Ga0495622_0014593 Ga0495622_0014593_2674_3465 263
1407 3300046557 Ga0495622_0049494 Ga0495622_0049494_86_877 263
1408 3300046559 Ga0495667_0000202 Ga0495667_0000202_32821_33612 263
1409 3300046559 Ga0495667_0032919 Ga0495667_0032919_2652_3443 263
1410 3300046559 Ga0495667_0330463 Ga0495667_0330463_116_931 263
1411 3300046559 Ga0495667_0330949 Ga0495667_0330949_18_821 263
1412 3300046615 Ga0495656_0000360 Ga0495656_0000360_1471_2262 263
1413 3300046642 Ga0495634_0008544 Ga0495634_0008544_4911_5702 263
1414 3300046642 Ga0495634_0021106 Ga0495634_0021106_3316_4107 263
1415 3300046642 Ga0495634_0021460 Ga0495634_0021460_349_1164 263
1416 3300046642 Ga0495634_0255009 Ga0495634_0255009_28_831 263
1417 3300046648 Ga0495611_0053456 Ga0495611_0053456_353_1144 263
1418 3300046663 Ga0495635_0002093 Ga0495635_0002093_661_1476 263
1419 3300046663 Ga0495635_0166962 Ga0495635_0166962_94_885 263
1420 3300046663 Ga0495635_0235696 Ga0495635_0235696_110_925 263
1421 3300046664 Ga0495659_0037099 Ga0495659_0037099_162_953 263
1422 3300046665 Ga0495661_0010683 Ga0495661_0010683_3319_4110 263
1423 3300046678 Ga0495599_0002835 Ga0495599_0002835_7000_7791 263
1424 3300046679 Ga0495623_0001448 Ga0495623_0001448_577_1368 263
1425 3300046680 Ga0495646_0029532 Ga0495646_0029532_1152_1967 263
1426 3300046680 Ga0495646_0033018 Ga0495646_0033018_651_1442 263
1427 3300046680 Ga0495646_0144654 Ga0495646_0144654_222_1013 263
1428 3300046681 Ga0495647_0000122 Ga0495647_0000122_8117_8908 263
1429 3300046681 Ga0495647_0000393 Ga0495647_0000393_7133_7924 263
1430 3300046681 Ga0495647_0001922 Ga0495647_0001922_3358_4149 263
1431 3300046683 Ga0495658_0000210 Ga0495658_0000210_13994_14785 263
1432 3300046683 Ga0495658_0009937 Ga0495658_0009937_1843_2634 263
1433 3300046683 Ga0495658_0026729 Ga0495658_0026729_2157_2948 263
1434 3300046683 Ga0495658_0081190 Ga0495658_0081190_1076_1867 263
1435 3300046690 Ga0495624_0000222 Ga0495624_0000222_10697_11488 263
1436 3300046690 Ga0495624_0001294 Ga0495624_0001294_11638_12453 263
1437 3300046690 Ga0495624_0029382 Ga0495624_0029382_301_1116 263
1438 3300046690 Ga0495624_0063300 Ga0495624_0063300_879_1670 263
1439 3300046690 Ga0495624_0290652 Ga0495624_0290652_128_919 263
1440 3300046691 Ga0495670_0001624 Ga0495670_0001624_3058_3849 263
1441 3300046809 Ga0495600_0000506 Ga0495600_0000506_2405_3196 263
1442 3300046809 Ga0495600_0002658 Ga0495600_0002658_1920_2711 263
1443 3300046809 Ga0495600_0030323 Ga0495600_0030323_2253_3044 263
1444 3300046809 Ga0495600_0194032 Ga0495600_0194032_381_1172 263
1445 3300047315 Ga0495581_0005193 Ga0495581_0005193_5558_6349 263
1446 3300047315 Ga0495581_0005649 Ga0495581_0005649_2124_2939 263
1447 3300047315 Ga0495581_0020808 Ga0495581_0020808_1169_1960 263
1448 3300047317 Ga0495604_0001089 Ga0495604_0001089_4425_5216 263
1449 3300047317 Ga0495604_0002751 Ga0495604_0002751_3649_4440 263
1450 3300047317 Ga0495604_0007025 Ga0495604_0007025_6989_7780 263
1451 3300047317 Ga0495604_0082269 Ga0495604_0082269_1283_2074 263
1452 3300047319 Ga0495674_0001490 Ga0495674_0001490_21899_22690 263
1453 3300047319 Ga0495674_0001513 Ga0495674_0001513_12221_13036 263
1454 3300047319 Ga0495674_0014630 Ga0495674_0014630_4428_5219 263
1455 3300047319 Ga0495674_0026272 Ga0495674_0026272_3965_4756 263
1456 3300047319 Ga0495674_0058792 Ga0495674_0058792_773_1564 263
1457 3300047319 Ga0495674_0096001 Ga0495674_0096001_489_1304 263
1458 3300047321 Ga0495676_0000289 Ga0495676_0000289_15658_16449 263
1459 3300047321 Ga0495676_0021676 Ga0495676_0021676_2189_2980 263
1460 3300047321 Ga0495676_0167572 Ga0495676_0167572_544_1359 263
1461 3300047322 Ga0495680_0001414 Ga0495680_0001414_13804_14595 263
1462 3300047444 Ga0495675_0007298 Ga0495675_0007298_5705_6496 263
1463 3300047471 Ga0495684_0000075 Ga0495684_0000075_57040_57831 263
1464 3300047471 Ga0495684_0000264 Ga0495684_0000264_27620_28435 263
1465 3300047471 Ga0495684_0001309 Ga0495684_0001309_12284_13099 263
1466 3300047673 Ga0495593_0000228 Ga0495593_0000228_1585_2376 263
1467 3300047673 Ga0495593_0014059 Ga0495593_0014059_2000_2791 263
1468 3300047673 Ga0495593_0020031 Ga0495593_0020031_2194_3009 263
1469 3300047673 Ga0495593_0215723 Ga0495593_0215723_72_887 263
1470 3300048088 Ga0495602_0002033 Ga0495602_0002033_8876_9667 263
1471 3300048088 Ga0495602_0018847 Ga0495602_0018847_2810_3601 263
1472 3300048088 Ga0495602_0147942 Ga0495602_0147942_544_1347 263
1473 3300048088 Ga0495602_0250469 Ga0495602_0250469_142_933 263
1474 3300048088 Ga0495602_0298434 Ga0495602_0298434_104_895 263
1475 3300048089 Ga0495614_0017130 Ga0495614_0017130_1478_2269 263
1476 3300048089 Ga0495614_0024948 Ga0495614_0024948_290_1081 263
1477 3300048903 Ga0496100_0000404 Ga0496100_0000404_17575_18366 263
1478 3300048904 Ga0496101_0000423 Ga0496101_0000423_17942_18733 263
1479 3300048904 Ga0496101_0051974 Ga0496101_0051974_2078_2869 263
1480 3300048905 Ga0496102_0003323 Ga0496102_0003323_12008_12799 263
1481 3300048905 Ga0496102_0149714 Ga0496102_0149714_223_1014 263
1482 3300048906 Ga0496103_0000967 Ga0496103_0000967_1880_2671 263
1483 3300048906 Ga0496103_0059818 Ga0496103_0059818_229_1020 263
1484 3300048907 Ga0496104_0000711 Ga0496104_0000711_13821_14636 263
1485 3300048907 Ga0496104_0000925 Ga0496104_0000925_5812_6627 263
1486 3300048907 Ga0496104_0005466 Ga0496104_0005466_8233_9024 263
1487 3300048907 Ga0496104_0014835 Ga0496104_0014835_3994_4785 263
1488 3300048907 Ga0496104_0086618 Ga0496104_0086618_1788_2579 263
1489 3300048907 Ga0496104_0181717 Ga0496104_0181717_340_1131 263
1490 3300048908 Ga0496105_0025218 Ga0496105_0025218_1779_2570 263
1491 3300048909 Ga0496106_0002446 Ga0496106_0002446_11997_12788 263
1492 3300048909 Ga0496106_0015174 Ga0496106_0015174_4888_5679 263
1493 3300048909 Ga0496106_0100583 Ga0496106_0100583_147_938 263
1494 3300048909 Ga0496106_0226765 Ga0496106_0226765_458_1249 263
1495 3300048910 Ga0496107_0000500 Ga0496107_0000500_11869_12660 263
1496 3300048910 Ga0496107_0022186 Ga0496107_0022186_2286_3077 263
1497 3300048910 Ga0496107_0356698 Ga0496107_0356698_40_831 263
1498 3300048911 Ga0496108_0039555 Ga0496108_0039555_1941_2732 263
1499 3300048911 Ga0496108_0054148 Ga0496108_0054148_1715_2506 263
1500 3300048911 Ga0496108_0129685 Ga0496108_0129685_443_1234 263
1501 3300048912 Ga0496109_0000359 Ga0496109_0000359_7083_7874 263
1502 3300048912 Ga0496109_0000976 Ga0496109_0000976_18609_19400 263
1503 3300048912 Ga0496109_0547656 Ga0496109_0547656_219_1010 263
1504 3300048913 Ga0496110_0027384 Ga0496110_0027384_87_878 263
1505 3300048913 Ga0496110_0054089 Ga0496110_0054089_1449_2240 263
1506 3300048913 Ga0496110_0061174 Ga0496110_0061174_771_1562 263
1507 3300048913 Ga0496110_0180349 Ga0496110_0180349_767_1558 263
1508 3300048914 Ga0496111_0069085 Ga0496111_0069085_1372_2163 263
1509 3300048914 Ga0496111_0129596 Ga0496111_0129596_286_1077 263
1510 3300048914 Ga0496111_0149808 Ga0496111_0149808_226_1017 263
1511 3300048915 Ga0496112_0167221 Ga0496112_0167221_1337_2128 263
1512 3300048915 Ga0496112_0176044 Ga0496112_0176044_899_1690 263
1513 3300048916 Ga0496113_0001950 Ga0496113_0001950_1871_2662 263
1514 3300048916 Ga0496113_0431387 Ga0496113_0431387_198_989 263
1515 3300048917 Ga0496114_0021314 Ga0496114_0021314_3918_4709 263
1516 3300048918 Ga0496115_0009234 Ga0496115_0009234_6408_7199 263
1517 3300048918 Ga0496115_0045224 Ga0496115_0045224_486_1301 263
1518 3300049568 Ga0501031_0011742 Ga0501031_0011742_616_1422 263
1519 3300049568 Ga0501031_0156179 Ga0501031_0156179_469_1260 263
1520 3300049569 Ga0501032_0019959 Ga0501032_0019959_953_1744 263
1521 3300049570 Ga0501033_0017940 Ga0501033_0017940_3482_4273 263
1522 3300049570 Ga0501033_0311955 Ga0501033_0311955_59_850 263
1523 3300049571 Ga0501034_0006692 Ga0501034_0006692_7886_8677 263
1524 3300049571 Ga0501034_0020000 Ga0501034_0020000_368_1159 263
1525 3300049571 Ga0501034_0305192 Ga0501034_0305192_288_1094 263
1526 3300049573 Ga0501037_0007895 Ga0501037_0007895_3327_4118 263
1527 3300049573 Ga0501037_0071272 Ga0501037_0071272_400_1212 263
1528 3300049573 Ga0501037_0259157 Ga0501037_0259157_38_850 263
1529 3300049574 Ga0501038_0043904 Ga0501038_0043904_2442_3233 263
1530 3300049574 Ga0501038_0064678 Ga0501038_0064678_599_1411 263
1531 3300049577 Ga0501041_0075493 Ga0501041_0075493_297_1088 263
1532 3300049578 Ga0501042_0241243 Ga0501042_0241243_368_1159 263
1533 3300049579 Ga0501043_0015891 Ga0501043_0015891_5050_5841 263
1534 3300049579 Ga0501043_0096527 Ga0501043_0096527_814_1626 263
1535 3300049579 Ga0501043_0503787 Ga0501043_0503787_70_861 263
1536 3300049580 Ga0501046_0031228 Ga0501046_0031228_264_1055 263
1537 3300049581 Ga0501047_0006347 Ga0501047_0006347_6061_6852 263
1538 3300049581 Ga0501047_0009067 Ga0501047_0009067_6191_6982 263
1539 3300049581 Ga0501047_0198550 Ga0501047_0198550_287_1099 263
1540 3300049582 Ga0501048_0004440 Ga0501048_0004440_4697_5488 263
1541 3300049583 Ga0501067_0018631 Ga0501067_0018631_2934_3725 263
1542 3300049584 Ga0501068_0043146 Ga0501068_0043146_1512_2303 263
1543 3300049584 Ga0501068_0284541 Ga0501068_0284541_102_914 263
1544 3300049586 Ga0501070_0004846 Ga0501070_0004846_2248_3039 263
1545 3300049586 Ga0501070_0014654 Ga0501070_0014654_3266_4057 263
1546 3300049586 Ga0501070_0053740 Ga0501070_0053740_208_1014 263
1547 3300049588 Ga0501072_0106796 Ga0501072_0106796_350_1141 263
1548 3300049590 Ga0501074_0049131 Ga0501074_0049131_564_1355 263
1549 3300049591 Ga0501075_0085345 Ga0501075_0085345_111_947 263
1550 3300049592 Ga0501076_0102344 Ga0501076_0102344_807_1598 263
1551 3300049592 Ga0501076_0186014 Ga0501076_0186014_109_945 263
1552 3300049593 Ga0501077_0034622 Ga0501077_0034622_1316_2107 263
1553 3300049593 Ga0501077_0349144 Ga0501077_0349144_79_870 263
1554 3300049741 Ga0501079_0016017 Ga0501079_0016017_4239_5030 263
1555 3300049741 Ga0501079_0048600 Ga0501079_0048600_1925_2716 263
1556 3300049741 Ga0501079_0323761 Ga0501079_0323761_256_1056 263
1557 3300049742 Ga0501080_0025076 Ga0501080_0025076_722_1513 263
1558 3300049742 Ga0501080_0247783 Ga0501080_0247783_109_900 263
1559 3300049743 Ga0501081_0038168 Ga0501081_0038168_893_1684 263
1560 3300049743 Ga0501081_0058154 Ga0501081_0058154_1041_1844 263
1561 3300049744 Ga0501083_0026837 Ga0501083_0026837_3137_3928 263
1562 3300049744 Ga0501083_0157043 Ga0501083_0157043_497_1288 263
1563 3300049822 Ga0501035_0068477 Ga0501035_0068477_2083_2874 263
1564 3300049823 Ga0501044_0001312 Ga0501044_0001312_24437_25228 263
1565 3300049823 Ga0501044_0008177 Ga0501044_0008177_9371_10162 263
1566 3300049823 Ga0501044_0030205 Ga0501044_0030205_1713_2504 263
1567 3300049823 Ga0501044_0083642 Ga0501044_0083642_96_890 263
1568 3300049823 Ga0501044_0117406 Ga0501044_0117406_362_1174 263
1569 3300049823 Ga0501044_0163053 Ga0501044_0163053_111_902 263
1570 3300049823 Ga0501044_0192296 Ga0501044_0192296_33_824 263
1571 3300049823 Ga0501044_0208105 Ga0501044_0208105_796_1608 263
1572 3300049823 Ga0501044_0225240 Ga0501044_0225240_143_934 263
1573 3300049824 Ga0501045_0163184 Ga0501045_0163184_334_1137 263
1574 3300049824 Ga0501045_0485933 Ga0501045_0485933_81_872 263
1575 3300050491 nmdc:mga00v17_40420_c1 nmdc:mga00v17_40420_c1_32_850 263
1576 3300050492 nmdc:mga0yw44_60962_c1 nmdc:mga0yw44_60962_c1_159_977 263
1577 3300050494 nmdc:mga06z11_23201_c1 nmdc:mga06z11_23201_c1_1279_2070 263
1578 3300050507 nmdc:mga05p37_149738_c1 nmdc:mga05p37_149738_c1_2022_2813 263
1579 3300050507 nmdc:mga05p37_193955_c1 nmdc:mga05p37_193955_c1_195_986 263
1580 3300050507 nmdc:mga05p37_35541_c1 nmdc:mga05p37_35541_c1_1362_2165 263
1581 3300050508 nmdc:mga09592_421671_c1 nmdc:mga09592_421671_c1_113_904 263
1582 3300050509 nmdc:mga0qj67_335685_c1 nmdc:mga0qj67_335685_c1_80_898 263
1583 3300050510 nmdc:mga06r32_59228_c1 nmdc:mga06r32_59228_c1_1235_2053 263
1584 3300050511 nmdc:mga08y16_272265_c1 nmdc:mga08y16_272265_c1_230_1021 263
1585 3300050511 nmdc:mga08y16_306842_c1 nmdc:mga08y16_306842_c1_313_1104 263
1586 3300050511 nmdc:mga08y16_3939_c1 nmdc:mga08y16_3939_c1_10483_11274 263
1587 3300050512 nmdc:mga0n895_37534_c1 nmdc:mga0n895_37534_c1_1936_2727 263
1588 3300050512 nmdc:mga0n895_493926_c1 nmdc:mga0n895_493926_c1_250_1041 263
1589 3300050513 nmdc:mga0rr50_25674_c1 nmdc:mga0rr50_25674_c1_2166_2957 263
1590 3300050513 nmdc:mga0rr50_42859_c1 nmdc:mga0rr50_42859_c1_2471_3262 263
1591 3300050513 nmdc:mga0rr50_435442_c1 nmdc:mga0rr50_435442_c1_92_895 263
1592 3300050514 nmdc:mga08x19_60686_c1 nmdc:mga08x19_60686_c1_1077_1880 263
1593 3300050515 nmdc:mga0a205_44400_c1 nmdc:mga0a205_44400_c1_2136_2927 263
1594 3300050515 nmdc:mga0a205_50540_c1 nmdc:mga0a205_50540_c1_1668_2459 263
1595 3300053077 Ga0495601_0001042 Ga0495601_0001042_11604_12395 263
1596 3300053077 Ga0495601_0001925 Ga0495601_0001925_10445_11236 263
1597 3300053077 Ga0495601_0004619 Ga0495601_0004619_1341_2156 263
1598 3300053077 Ga0495601_0029283 Ga0495601_0029283_958_1749 263
1599 3300053077 Ga0495601_0031011 Ga0495601_0031011_1742_2533 263
1600 3300053078 Ga0495612_0000308 Ga0495612_0000308_9779_10594 263
1601 3300053078 Ga0495612_0000858 Ga0495612_0000858_3847_4638 263
1602 3300053078 Ga0495612_0032977 Ga0495612_0032977_1039_1830 263
1603 3300053078 Ga0495612_0111205 Ga0495612_0111205_68_859 263
1604 3300053084 Ga0495595_0000879 Ga0495595_0000879_685_1476 263
1605 3300053084 Ga0495595_0006336 Ga0495595_0006336_1028_1819 263
1606 3300053084 Ga0495595_0011017 Ga0495595_0011017_1706_2497 263
1607 3300053084 Ga0495595_0014880 Ga0495595_0014880_986_1777 263
1608 3300053085 Ga0495619_0001598 Ga0495619_0001598_11369_12184 263
1609 3300053085 Ga0495619_0005795 Ga0495619_0005795_3221_4012 263
1610 3300053085 Ga0495619_0013992 Ga0495619_0013992_3650_4441 263
1611 3300053085 Ga0495619_0014059 Ga0495619_0014059_3755_4546 263
1612 3300053085 Ga0495619_0018217 Ga0495619_0018217_1527_2318 263
1613 3300053085 Ga0495619_0065633 Ga0495619_0065633_813_1604 263
1614 3300053088 Ga0500644_0002495 Ga0500644_0002495_3164_3955 263
1615 3300053093 Ga0500651_0022942 Ga0500651_0022942_1549_2340 263
1616 3300053119 Ga0500595_000010 Ga0500595_000010_63989_64780 263
1617 3300053131 Ga0500652_070981 Ga0500652_070981_548_1339 263
1618 3300053140 Ga0500573_0187135 Ga0500573_0187135_182_973 263
1619 3300053153 Ga0500616_0000001 Ga0500616_0000001_755801_756592 263
1620 3300053153 Ga0500616_0096643 Ga0500616_0096643_568_1359 263
1621 3300053730 Ga0500645_000015 Ga0500645_000015_115002_115793 263
1622 3300054114 Ga0501084_0150596 Ga0501084_0150596_80_871 263
1623 3300054114 Ga0501084_0326409 Ga0501084_0326409_417_1253 263
1624 3300054114 Ga0501084_0588322 Ga0501084_0588322_123_914 263
1625 3300060353 Ga0501082_0027888 Ga0501082_0027888_1173_1964 263
1626 3300060353 Ga0501082_0052297 Ga0501082_0052297_1456_2292 263
1627 3300060353 Ga0501082_0395969 Ga0501082_0395969_11_820 263
1628 3300061719 Ga0466962_0124513 Ga0466962_0124513_40_831 263
1629 3300061734 Ga0530510_0157817 Ga0530510_0157817_19_819 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

88

257

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7702 57 251
3dhw-assembly2.cif.gz_E crystal structure of methionine importer metni 0.7559 56 238
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7371 58 240
4tqu-assembly1.cif.gz_M crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.7268 47 250
3dhw-assembly2.cif.gz_F crystal structure of methionine importer metni 0.7165 57 240
ID Description Score Start End Superfamily
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8973 54 248 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8919 59 249 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8846 54 248 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8782 61 251 1.10.3720.10
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.872 56 254 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A537V064-F1-model_v4 ABC transporter permease 0.9117 7 258 GO:0005886
GO:0055085
AF-A0A351SMG1-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9047 8 258 GO:0005886
GO:0055085
AF-A0A4V2UWZ3-F1-model_v4 NitT/TauT family transport system permease protein/taurine transport system permease protein/sulfonate transport system permease protein 0.9042 6 258 GO:0005886
GO:0055085
AF-A0A1F4BPC8-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9038 16 258 GO:0005886
GO:0055085
AF-A0A1I0AFD3-F1-model_v4 NitT/TauT family transport system permease protein 0.9032 9 254 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
82.59 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map