F495116

General Info

Members Datasets Scaffolds Average Seq Length
1628 453 1628 141

Family's Representative Sequence

Representative Sequence 3300025936|Ga0207670_10274512|Ga0207670_102745122
Length 172
Sequence MAKKVSAMVKLQIPAGKATPAPPVGTALGPQGVNIMEFCKAFNAKTSAKDQEGLIIPVVITIFSDRSFTFITKTPPVPVLIKRAVSIAKGSAEPNKNRVGKLTLKQVEEIAKIKMPDLNSFDLEGVMNQVKGTARSMGVDALLVEKPADVTEAVRAGFDSGRPTLLELPISA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
144 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
218 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
219 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
220 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
224 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
225 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
226 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
227 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
228 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
229 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
230 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
231 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
232 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
233 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
234 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
235 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
236 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
237 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
238 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
239 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
240 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
246 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
247 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
248 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
249 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
250 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
251 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
252 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
253 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
254 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
256 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
258 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
259 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
260 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
261 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
262 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
263 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
264 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
265 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
266 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
267 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
268 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
269 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
270 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
271 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
273 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
274 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
278 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
279 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
280 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
281 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
282 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
283 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
284 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
285 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
286 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
287 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
288 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
289 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
290 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
291 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
292 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
293 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
294 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
295 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
296 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
297 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
298 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
299 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
300 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
301 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
302 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
303 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
304 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
305 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
306 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
307 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
308 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
309 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
310 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
311 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
312 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
313 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
314 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
315 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
316 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
317 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
318 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
319 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
320 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
321 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
322 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
323 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
324 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
325 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
326 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
327 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
328 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
329 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
330 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
331 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
332 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
333 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
334 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
335 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
336 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
337 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
338 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
339 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
340 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
341 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
342 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
343 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
344 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
345 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
346 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
347 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
348 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
349 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
350 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
351 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
352 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
353 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
354 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
355 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
356 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
357 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
358 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
359 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
360 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
361 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
362 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
363 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
364 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
365 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
366 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
367 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
368 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
369 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
370 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
371 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
372 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
388 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
389 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
390 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
391 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
392 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
393 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
394 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
395 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
396 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
397 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
398 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
399 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
400 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
401 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
402 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
403 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
404 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
405 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
406 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
408 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
409 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
410 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
411 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
412 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
413 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
414 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
415 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
416 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
417 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
418 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
419 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
420 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
421 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
422 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
423 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
424 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
425 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
426 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
427 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
428 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
429 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
430 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
431 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
432 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
433 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
434 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
435 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
436 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
437 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
453 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.84
Metatranscriptomes 5.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.47
Nodule 0
Rhizoplane 1.47
Rhizosphere 94.16
Stem 0
Stem Tuber 0
Unclassified 2.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3648165 2162886007 Bacteria 1043
2 JGI24741J21665_1033893 3300001915 Bacteria 760
3 JGI24737J22298_10075653 3300001990 Bacteria 1004
4 Ga0058859_11478218 3300004798 Bacteria 761
5 Ga0058859_11638471 3300004798 Bacteria 1015
6 Ga0058863_11581443 3300004799 Bacteria 1004
7 Ga0058863_11773336 3300004799 Bacteria 1148
8 Ga0058861_10045775 3300004800 Bacteria 2017
9 Ga0058861_10173322 3300004800 Bacteria 666
10 Ga0058860_10210260 3300004801 Bacteria 3080
11 Ga0058860_11763004 3300004801 Bacteria 3239
12 Ga0058862_10217184 3300004803 Bacteria 1688
13 Ga0058862_12307729 3300004803 Bacteria 609
14 Ga0065704_10095262 3300005289 Bacteria 2497
15 Ga0065715_10103339 3300005293 Bacteria 3040
16 Ga0065707_10932254 3300005295 Bacteria 557
17 Ga0070658_10016310 3300005327 Bacteria 5944
18 Ga0070658_10031526 3300005327 Bacteria 4257
19 Ga0070658_10067399 3300005327 Bacteria 2924
20 Ga0070658_10074906 3300005327 Bacteria 2776
21 Ga0070658_10163021 3300005327 Bacteria 1871
22 Ga0070658_11088690 3300005327 Bacteria 695
23 Ga0070676_10000002 3300005328 Bacteria 357662
24 Ga0070676_10016036 3300005328 Bacteria 4138
25 Ga0070676_10176212 3300005328 Bacteria 1387
26 Ga0070676_10255796 3300005328 Bacteria 1171
27 Ga0070683_100002981 3300005329 Bacteria 13577
28 Ga0070683_100029815 3300005329 Bacteria 4944
29 Ga0070683_100088449 3300005329 Bacteria 2906
30 Ga0070683_100111881 3300005329 Bacteria 2576
31 Ga0070683_100152539 3300005329 Bacteria 2191
32 Ga0070683_100560145 3300005329 Bacteria 1093
33 Ga0070683_100718798 3300005329 Bacteria 957
34 Ga0070690_100029366 3300005330 Bacteria 3410
35 Ga0070690_101425284 3300005330 Bacteria 558
36 Ga0070670_100016026 3300005331 Bacteria 6432
37 Ga0070670_100493721 3300005331 Bacteria 1088
38 Ga0068869_100013457 3300005334 Bacteria 5443
39 Ga0068869_100054244 3300005334 Bacteria 2917
40 Ga0068869_100226642 3300005334 Bacteria 1483
41 Ga0068869_100296407 3300005334 Bacteria 1304
42 Ga0068869_100981623 3300005334 Bacteria 734
43 Ga0070666_10038785 3300005335 Bacteria 3171
44 Ga0070666_10206581 3300005335 Bacteria 1382
45 Ga0070666_10237723 3300005335 Bacteria 1288
46 Ga0070666_10445556 3300005335 Bacteria 934
47 Ga0070666_10822541 3300005335 Bacteria 685
48 Ga0070680_100055226 3300005336 Bacteria 3245
49 Ga0070680_100065121 3300005336 Bacteria 2987
50 Ga0070680_100097517 3300005336 Bacteria 2437
51 Ga0070680_100197639 3300005336 Bacteria 1695
52 Ga0070680_100289189 3300005336 Bacteria 1389
53 Ga0070680_100611279 3300005336 Bacteria 936
54 Ga0070682_100060709 3300005337 Bacteria 2391
55 Ga0070682_100299058 3300005337 Bacteria 1180
56 Ga0068868_100170735 3300005338 Unclassified 1800
57 Ga0068868_100205574 3300005338 Bacteria 1643
58 Ga0068868_100312728 3300005338 Bacteria 1337
59 Ga0068868_100372630 3300005338 Bacteria 1227
60 Ga0068868_100569883 3300005338 Bacteria 1000
61 Ga0068868_100963262 3300005338 Bacteria 779
62 Ga0068868_101151115 3300005338 Bacteria 715
63 Ga0068868_101252207 3300005338 Bacteria 688
64 Ga0068868_101614268 3300005338 Bacteria 609
65 Ga0070660_100005332 3300005339 Bacteria 8896
66 Ga0070660_100081218 3300005339 Bacteria 2545
67 Ga0070660_100182693 3300005339 Bacteria 1697
68 Ga0070660_100290089 3300005339 Bacteria 1340
69 Ga0070660_100828546 3300005339 Bacteria 779
70 Ga0070660_101481411 3300005339 Bacteria 577
71 Ga0070689_100179833 3300005340 Bacteria 1717
72 Ga0070689_100289442 3300005340 Bacteria 1361
73 Ga0070689_100307037 3300005340 Bacteria 1322
74 Ga0070689_101187320 3300005340 Bacteria 684
75 Ga0070689_101277498 3300005340 Bacteria 660
76 Ga0070691_10001162 3300005341 Bacteria 10979
77 Ga0070691_10743465 3300005341 Bacteria 592
78 Ga0070687_100626167 3300005343 Bacteria 742
79 Ga0070661_100154852 3300005344 Bacteria 1734
80 Ga0070661_100166885 3300005344 Bacteria 1670
81 Ga0070661_100594716 3300005344 Bacteria 894
82 Ga0070661_101115174 3300005344 Bacteria 658
83 Ga0070692_10002909 3300005345 Bacteria 6792
84 Ga0070692_10190709 3300005345 Bacteria 1194
85 Ga0070669_100917855 3300005353 Bacteria 748
86 Ga0070675_100330358 3300005354 Bacteria 1348
87 Ga0070675_101391407 3300005354 Bacteria 647
88 Ga0070671_100150795 3300005355 Bacteria 1963
89 Ga0070671_100224240 3300005355 Bacteria 1595
90 Ga0070671_100316383 3300005355 Bacteria 1330
91 Ga0070671_101876450 3300005355 Bacteria 533
92 Ga0070674_100195020 3300005356 Bacteria 1560
93 Ga0070674_100198590 3300005356 Unclassified 1547
94 Ga0070673_100017147 3300005364 Bacteria 5141
95 Ga0070673_100047614 3300005364 Bacteria 3337
96 Ga0070673_100352989 3300005364 Bacteria 1305
97 Ga0070673_100958561 3300005364 Bacteria 795
98 Ga0070673_101088356 3300005364 Unclassified 746
99 Ga0070688_100113294 3300005365 Bacteria 1807
100 Ga0070688_100326462 3300005365 Bacteria 1117
101 Ga0070688_100898197 3300005365 Bacteria 698
102 Ga0070659_100171910 3300005366 Bacteria 1775
103 Ga0070659_100622854 3300005366 Bacteria 929
104 Ga0070659_100667005 3300005366 Bacteria 897
105 Ga0070659_101179388 3300005366 Bacteria 677
106 Ga0070667_100000132 3300005367 Bacteria 94794
107 Ga0070667_100069113 3300005367 Bacteria 3006
108 Ga0070667_100272503 3300005367 Bacteria 1518
109 Ga0070667_100344053 3300005367 Bacteria 1349
110 Ga0070667_100490960 3300005367 Bacteria 1125
111 Ga0070667_100628989 3300005367 Bacteria 990
112 Ga0070667_101011134 3300005367 Bacteria 776
113 Ga0070703_10013380 3300005406 Bacteria 2329
114 Ga0070703_10058463 3300005406 Bacteria 1255
115 Ga0070703_10066326 3300005406 Bacteria 1194
116 Ga0070703_10316328 3300005406 Bacteria 656
117 Ga0070709_10477097 3300005434 Bacteria 944
118 Ga0070709_10504015 3300005434 Bacteria 920
119 Ga0070709_10784059 3300005434 Bacteria 747
120 Ga0070714_100022737 3300005435 Bacteria 5144
121 Ga0070714_100048608 3300005435 Bacteria 3608
122 Ga0070714_100811131 3300005435 Bacteria 907
123 Ga0070714_101210173 3300005435 Bacteria 737
124 Ga0070713_100018979 3300005436 Bacteria 5237
125 Ga0070713_100038050 3300005436 Bacteria 3895
126 Ga0070713_100051702 3300005436 Bacteria 3399
127 Ga0070713_100543976 3300005436 Bacteria 1099
128 Ga0070713_100876364 3300005436 Bacteria 863
129 Ga0070713_102174219 3300005436 Bacteria 538
130 Ga0070710_11162542 3300005437 Bacteria 569
131 Ga0070701_10002390 3300005438 Bacteria 7217
132 Ga0070701_10057462 3300005438 Bacteria 2039
133 Ga0070711_100093697 3300005439 Bacteria 2169
134 Ga0070711_100151767 3300005439 Bacteria 1748
135 Ga0070711_100253776 3300005439 Bacteria 1381
136 Ga0070711_100462963 3300005439 Bacteria 1040
137 Ga0070711_100876785 3300005439 Bacteria 765
138 Ga0070711_101019603 3300005439 Bacteria 711
139 Ga0070711_101024855 3300005439 Bacteria 709
140 Ga0070711_101097070 3300005439 Bacteria 686
141 Ga0070711_101099405 3300005439 Bacteria 685
142 Ga0070705_100120288 3300005440 Bacteria 1694
143 Ga0070705_100120816 3300005440 Bacteria 1691
144 Ga0070705_100238858 3300005440 Bacteria 1269
145 Ga0070705_100686332 3300005440 Bacteria 803
146 Ga0070700_100009609 3300005441 Bacteria 5315
147 Ga0070700_100087382 3300005441 Bacteria 2026
148 Ga0070694_100033358 3300005444 Bacteria 3387
149 Ga0070694_100150838 3300005444 Bacteria 1697
150 Ga0070694_100155350 3300005444 Bacteria 1674
151 Ga0070694_100278260 3300005444 Bacteria 1275
152 Ga0070694_101240026 3300005444 Bacteria 626
153 Ga0070708_100074547 3300005445 Bacteria 3061
154 Ga0070708_100129831 3300005445 Bacteria 2331
155 Ga0070708_100784730 3300005445 Bacteria 896
156 Ga0070708_101006534 3300005445 Bacteria 781
157 Ga0070708_101126167 3300005445 Bacteria 735
158 Ga0070708_101805362 3300005445 Bacteria 567
159 Ga0070663_100145118 3300005455 Bacteria 1815
160 Ga0070678_100242814 3300005456 Bacteria 1507
161 Ga0070678_100818074 3300005456 Bacteria 847
162 Ga0070678_101031663 3300005456 Bacteria 757
163 Ga0070662_100160240 3300005457 Bacteria 1759
164 Ga0070662_100403790 3300005457 Bacteria 1128
165 Ga0070662_100499792 3300005457 Bacteria 1014
166 Ga0070662_100716786 3300005457 Bacteria 847
167 Ga0070681_10015833 3300005458 Bacteria 7517
168 Ga0070681_10030019 3300005458 Bacteria 5455
169 Ga0070681_10048985 3300005458 Bacteria 4220
170 Ga0070681_10089529 3300005458 Bacteria 3029
171 Ga0070681_10180638 3300005458 Bacteria 2032
172 Ga0070681_10213766 3300005458 Bacteria 1844
173 Ga0068867_100127890 3300005459 Bacteria 1971
174 Ga0068867_100150919 3300005459 Bacteria 1825
175 Ga0068867_100177486 3300005459 Bacteria 1691
176 Ga0068867_100309143 3300005459 Bacteria 1306
177 Ga0068867_100326184 3300005459 Bacteria 1273
178 Ga0068867_100463174 3300005459 Bacteria 1083
179 Ga0068867_100993111 3300005459 Bacteria 761
180 Ga0068867_101606186 3300005459 Bacteria 608
181 Ga0068867_101639692 3300005459 Bacteria 602
182 Ga0068867_101900621 3300005459 Bacteria 561
183 Ga0070685_10011503 3300005466 Bacteria 4632
184 Ga0070685_10040968 3300005466 Bacteria 2637
185 Ga0070706_100066634 3300005467 Bacteria 3330
186 Ga0070706_100329158 3300005467 Bacteria 1425
187 Ga0070706_100493363 3300005467 Bacteria 1139
188 Ga0070706_100947528 3300005467 Bacteria 794
189 Ga0070707_100221932 3300005468 Bacteria 1840
190 Ga0070707_100680983 3300005468 Bacteria 991
191 Ga0070698_100261630 3300005471 Bacteria 1662
192 Ga0070698_100278933 3300005471 Bacteria 1603
193 Ga0070698_100510295 3300005471 Bacteria 1140
194 Ga0070698_100681089 3300005471 Bacteria 970
195 Ga0070698_100854161 3300005471 Bacteria 855
196 Ga0070699_100028934 3300005518 Bacteria 4777
197 Ga0070699_100061001 3300005518 Bacteria 3268
198 Ga0070699_100076627 3300005518 Bacteria 2911
199 Ga0070699_100182515 3300005518 Bacteria 1862
200 Ga0070699_100588284 3300005518 Bacteria 1014
201 Ga0070679_100011561 3300005530 Bacteria 8412
202 Ga0070679_100089372 3300005530 Bacteria 3067
203 Ga0070679_100292090 3300005530 Bacteria 1581
204 Ga0070679_100704166 3300005530 Bacteria 953
205 Ga0070679_101293611 3300005530 Bacteria 675
206 Ga0070684_100061031 3300005535 Bacteria 3299
207 Ga0070684_100153008 3300005535 Bacteria 2090
208 Ga0070684_100210188 3300005535 Bacteria 1773
209 Ga0070684_100232151 3300005535 Bacteria 1685
210 Ga0070684_100421634 3300005535 Bacteria 1232
211 Ga0070684_100577216 3300005535 Bacteria 1044
212 Ga0070684_100896869 3300005535 Bacteria 830
213 Ga0070684_100984030 3300005535 Bacteria 791
214 Ga0070697_100072171 3300005536 Bacteria 2832
215 Ga0070697_100420954 3300005536 Bacteria 1161
216 Ga0070697_100879252 3300005536 Bacteria 794
217 Ga0070697_101288979 3300005536 Bacteria 652
218 Ga0070697_101642471 3300005536 Bacteria 575
219 Ga0068853_100114452 3300005539 Bacteria 2399
220 Ga0068853_100166379 3300005539 Bacteria 1993
221 Ga0068853_100200496 3300005539 Bacteria 1816
222 Ga0068853_100235159 3300005539 Bacteria 1677
223 Ga0068853_100270100 3300005539 Bacteria 1566
224 Ga0068853_100499688 3300005539 Bacteria 1148
225 Ga0068853_100687497 3300005539 Unclassified 975
226 Ga0068853_100935963 3300005539 Bacteria 833
227 Ga0070672_100007564 3300005543 Bacteria 7383
228 Ga0070672_100358507 3300005543 Bacteria 1244
229 Ga0070672_101805901 3300005543 Bacteria 550
230 Ga0070686_100072179 3300005544 Bacteria 2263
231 Ga0070686_100117212 3300005544 Unclassified 1823
232 Ga0070686_100401214 3300005544 Bacteria 1043
233 Ga0070686_100798114 3300005544 Bacteria 761
234 Ga0070695_100034336 3300005545 Bacteria 3179
235 Ga0070695_100035895 3300005545 Bacteria 3116
236 Ga0070695_100092851 3300005545 Bacteria 2018
237 Ga0070695_100116111 3300005545 Bacteria 1824
238 Ga0070695_100154106 3300005545 Bacteria 1606
239 Ga0070695_100623424 3300005545 Bacteria 849
240 Ga0070695_100860415 3300005545 Bacteria 730
241 Ga0070696_100007562 3300005546 Bacteria 7265
242 Ga0070696_100060883 3300005546 Bacteria 2640
243 Ga0070696_100130611 3300005546 Bacteria 1827
244 Ga0070696_100140894 3300005546 Bacteria 1762
245 Ga0070696_100183437 3300005546 Bacteria 1553
246 Ga0070696_100192349 3300005546 Bacteria 1519
247 Ga0070696_100215586 3300005546 Bacteria 1438
248 Ga0070696_101026562 3300005546 Bacteria 690
249 Ga0070693_100064853 3300005547 Bacteria 2133
250 Ga0070693_100109376 3300005547 Bacteria 1697
251 Ga0070693_100308782 3300005547 Bacteria 1069
252 Ga0070665_100000956 3300005548 Bacteria 36803
253 Ga0070665_100048212 3300005548 Bacteria 4277
254 Ga0070665_100307536 3300005548 Bacteria 1588
255 Ga0070665_100568406 3300005548 Bacteria 1146
256 Ga0070665_100683593 3300005548 Unclassified 1039
257 Ga0070665_100702219 3300005548 Bacteria 1024
258 Ga0070704_100016254 3300005549 Bacteria 4699
259 Ga0070704_100163554 3300005549 Bacteria 1762
260 Ga0070704_100181372 3300005549 Bacteria 1684
261 Ga0070704_100347104 3300005549 Bacteria 1252
262 Ga0070704_100380742 3300005549 Bacteria 1199
263 Ga0070704_100429662 3300005549 Bacteria 1133
264 Ga0070704_100442098 3300005549 Bacteria 1118
265 Ga0070704_101380064 3300005549 Bacteria 646
266 Ga0068855_100027078 3300005563 Bacteria 6859
267 Ga0068855_100050405 3300005563 Bacteria 4906
268 Ga0068855_100145813 3300005563 Bacteria 2695
269 Ga0068855_100325622 3300005563 Bacteria 1697
270 Ga0068855_100455335 3300005563 Bacteria 1396
271 Ga0068855_100526141 3300005563 Bacteria 1282
272 Ga0068855_101008224 3300005563 Bacteria 874
273 Ga0070664_100335375 3300005564 Bacteria 1373
274 Ga0070664_100917022 3300005564 Bacteria 822
275 Ga0070664_101606590 3300005564 Bacteria 616
276 Ga0070664_101820334 3300005564 Bacteria 577
277 Ga0068857_100012106 3300005577 Bacteria 7501
278 Ga0068857_100057320 3300005577 Bacteria 3457
279 Ga0068857_100059824 3300005577 Bacteria 3385
280 Ga0068857_100102495 3300005577 Bacteria 2569
281 Ga0068857_100243648 3300005577 Bacteria 1646
282 Ga0068857_100263859 3300005577 Bacteria 1581
283 Ga0068854_100139520 3300005578 Bacteria 1859
284 Ga0068854_100179166 3300005578 Bacteria 1654
285 Ga0068854_100575038 3300005578 Bacteria 959
286 Ga0068854_100729067 3300005578 Bacteria 858
287 Ga0068856_100067689 3300005614 Bacteria 3529
288 Ga0068856_100103633 3300005614 Bacteria 2839
289 Ga0068856_100161060 3300005614 Bacteria 2254
290 Ga0068856_100275982 3300005614 Bacteria 1697
291 Ga0068856_100568697 3300005614 Bacteria 1155
292 Ga0070702_101861160 3300005615 Bacteria 504
293 Ga0068852_100016325 3300005616 Bacteria 5786
294 Ga0068852_100053398 3300005616 Bacteria 3478
295 Ga0068852_100140852 3300005616 Bacteria 2232
296 Ga0068859_100125671 3300005617 Bacteria 2633
297 Ga0068859_100213847 3300005617 Bacteria 2015
298 Ga0068859_100301917 3300005617 Bacteria 1694
299 Ga0068859_100351175 3300005617 Bacteria 1570
300 Ga0068859_100493007 3300005617 Bacteria 1320
301 Ga0068859_100551046 3300005617 Bacteria 1247
302 Ga0068859_100587214 3300005617 Bacteria 1207
303 Ga0068859_100759850 3300005617 Unclassified 1058
304 Ga0068859_100763293 3300005617 Bacteria 1056
305 Ga0068859_101175867 3300005617 Bacteria 844
306 Ga0068859_101679303 3300005617 Bacteria 701
307 Ga0068859_101793134 3300005617 Bacteria 678
308 Ga0068864_100038611 3300005618 Bacteria 4079
309 Ga0068864_100090071 3300005618 Bacteria 2704
310 Ga0068864_100137228 3300005618 Bacteria 2203
311 Ga0068864_100209746 3300005618 Bacteria 1793
312 Ga0068864_100240032 3300005618 Bacteria 1679
313 Ga0068864_100906887 3300005618 Bacteria 870
314 Ga0068866_10253131 3300005718 Bacteria 1079
315 Ga0068866_10317409 3300005718 Bacteria 979
316 Ga0068866_10318738 3300005718 Bacteria 977
317 Ga0068861_100082107 3300005719 Bacteria 2525
318 Ga0068861_101325800 3300005719 Bacteria 701
319 Ga0068861_102198987 3300005719 Bacteria 553
320 Ga0068861_102441214 3300005719 Bacteria 526
321 Ga0068851_10732196 3300005834 Bacteria 611
322 Ga0068870_10000560 3300005840 Bacteria 14068
323 Ga0068870_10865311 3300005840 Bacteria 636
324 Ga0068863_100093573 3300005841 Bacteria 2852
325 Ga0068863_100126817 3300005841 Bacteria 2435
326 Ga0068863_100177935 3300005841 Bacteria 2042
327 Ga0068863_100223089 3300005841 Bacteria 1816
328 Ga0068863_100758322 3300005841 Bacteria 966
329 Ga0068863_100913460 3300005841 Bacteria 878
330 Ga0068863_101781746 3300005841 Bacteria 625
331 Ga0068858_100045647 3300005842 Bacteria 4061
332 Ga0068858_100069232 3300005842 Bacteria 3271
333 Ga0068858_100145469 3300005842 Bacteria 2226
334 Ga0068858_100180802 3300005842 Bacteria 1991
335 Ga0068858_100215287 3300005842 Bacteria 1819
336 Ga0068858_100236799 3300005842 Bacteria 1731
337 Ga0068858_100254153 3300005842 Bacteria 1670
338 Ga0068858_100314260 3300005842 Bacteria 1496
339 Ga0068858_100355453 3300005842 Bacteria 1404
340 Ga0068858_100495302 3300005842 Bacteria 1180
341 Ga0068858_100558114 3300005842 Bacteria 1109
342 Ga0068858_100590851 3300005842 Bacteria 1076
343 Ga0068860_100001432 3300005843 Bacteria 25835
344 Ga0068860_100025519 3300005843 Bacteria 5701
345 Ga0068860_100037244 3300005843 Bacteria 4656
346 Ga0068860_100052656 3300005843 Bacteria 3871
347 Ga0068860_100158941 3300005843 Bacteria 2178
348 Ga0068860_100274079 3300005843 Bacteria 1647
349 Ga0068860_100371164 3300005843 Bacteria 1411
350 Ga0068860_100574900 3300005843 Bacteria 1131
351 Ga0068860_101343304 3300005843 Bacteria 736
352 Ga0068862_100030715 3300005844 Bacteria 4529
353 Ga0068862_100196706 3300005844 Bacteria 1816
354 Ga0068862_100285027 3300005844 Bacteria 1515
355 Ga0068862_100394778 3300005844 Bacteria 1293
356 Ga0068862_102590031 3300005844 Bacteria 519
357 Ga0081455_10005833 3300005937 Bacteria 13401
358 Ga0081539_10001872 3300005985 Bacteria 33010
359 Ga0070717_10049261 3300006028 Bacteria 3458
360 Ga0070717_10056186 3300006028 Bacteria 3251
361 Ga0070717_10234697 3300006028 Bacteria 1616
362 Ga0070717_10275547 3300006028 Bacteria 1491
363 Ga0070717_11021466 3300006028 Bacteria 753
364 Ga0075364_10491385 3300006051 Bacteria 839
365 Ga0070715_10521029 3300006163 Bacteria 684
366 Ga0070715_10697994 3300006163 Bacteria 606
367 Ga0070715_10975008 3300006163 Bacteria 526
368 Ga0070716_100304097 3300006173 Bacteria 1111
369 Ga0070712_100042578 3300006175 Bacteria 3123
370 Ga0075367_10358711 3300006178 Bacteria 920
371 Ga0097621_100024374 3300006237 Bacteria 4724
372 Ga0097621_100050693 3300006237 Bacteria 3376
373 Ga0097621_100107171 3300006237 Bacteria 2358
374 Ga0097621_100130824 3300006237 Bacteria 2136
375 Ga0097621_100131589 3300006237 Bacteria 2130
376 Ga0097621_100154467 3300006237 Bacteria 1969
377 Ga0097621_100172262 3300006237 Bacteria 1866
378 Ga0097621_100197378 3300006237 Bacteria 1745
379 Ga0097621_100283779 3300006237 Bacteria 1458
380 Ga0097621_100446323 3300006237 Bacteria 1165
381 Ga0097621_100551091 3300006237 Bacteria 1049
382 Ga0097621_100569171 3300006237 Bacteria 1033
383 Ga0097621_100705071 3300006237 Bacteria 929
384 Ga0097621_100768582 3300006237 Bacteria 891
385 Ga0097621_101559027 3300006237 Bacteria 627
386 Ga0097621_101673966 3300006237 Bacteria 605
387 Ga0097621_102319595 3300006237 Bacteria 513
388 Ga0075370_10585878 3300006353 Bacteria 675
389 Ga0068871_100023285 3300006358 Bacteria 4788
390 Ga0068871_100034497 3300006358 Bacteria 4015
391 Ga0068871_100065515 3300006358 Bacteria 2975
392 Ga0068871_100115475 3300006358 Bacteria 2263
393 Ga0068871_100169351 3300006358 Bacteria 1871
394 Ga0068871_100212469 3300006358 Bacteria 1673
395 Ga0068871_100252988 3300006358 Bacteria 1535
396 Ga0068871_100288695 3300006358 Bacteria 1437
397 Ga0068871_100309636 3300006358 Bacteria 1388
398 Ga0068871_100318174 3300006358 Bacteria 1369
399 Ga0068871_100363237 3300006358 Bacteria 1283
400 Ga0068871_100786088 3300006358 Bacteria 877
401 Ga0068871_101671516 3300006358 Bacteria 603
402 Ga0068871_101949028 3300006358 Bacteria 559
403 Ga0075428_100013647 3300006844 Bacteria 9045
404 Ga0075428_100339381 3300006844 Bacteria 1613
405 Ga0075428_100970747 3300006844 Bacteria 900
406 Ga0075428_101266367 3300006844 Bacteria 776
407 Ga0075430_100043860 3300006846 Bacteria 3782
408 Ga0075430_100056313 3300006846 Bacteria 3306
409 Ga0075431_100001342 3300006847 Bacteria 22507
410 Ga0075431_100071481 3300006847 Bacteria 3580
411 Ga0075431_100283521 3300006847 Bacteria 1677
412 Ga0075433_10024737 3300006852 Bacteria 5071
413 Ga0075433_10062480 3300006852 Bacteria 3261
414 Ga0075433_10358116 3300006852 Bacteria 1289
415 Ga0075433_10529950 3300006852 Bacteria 1036
416 Ga0075433_10706073 3300006852 Bacteria 883
417 Ga0075434_100374162 3300006871 Bacteria 1445
418 Ga0075429_100243279 3300006880 Bacteria 1576
419 Ga0075429_100268861 3300006880 Bacteria 1493
420 Ga0068865_100475504 3300006881 Bacteria 1037
421 Ga0068865_100475982 3300006881 Unclassified 1037
422 Ga0068865_101422307 3300006881 Bacteria 620
423 Ga0075436_100176998 3300006914 Bacteria 1507
424 Ga0075436_100431729 3300006914 Bacteria 957
425 Ga0075436_100965092 3300006914 Bacteria 639
426 Ga0097620_100125671 3300006931 Bacteria 2633
427 Ga0097620_100213846 3300006931 Bacteria 2015
428 Ga0097620_100301950 3300006931 Bacteria 1694
429 Ga0097620_100351171 3300006931 Bacteria 1570
430 Ga0097620_100551056 3300006931 Bacteria 1247
431 Ga0097620_100587214 3300006931 Bacteria 1207
432 Ga0097620_100759894 3300006931 Unclassified 1058
433 Ga0097620_100763245 3300006931 Bacteria 1056
434 Ga0097620_101175896 3300006931 Bacteria 844
435 Ga0097620_101679307 3300006931 Bacteria 701
436 Ga0097620_101793153 3300006931 Bacteria 678
437 Ga0075435_100246536 3300007076 Bacteria 1520
438 Ga0075435_102069623 3300007076 Bacteria 500
439 Ga0099794_10019102 3300007265 Bacteria 3082
440 Ga0099794_10116345 3300007265 Bacteria 1342
441 Ga0099794_10241234 3300007265 Bacteria 931
442 Ga0099794_10362524 3300007265 Bacteria 755
443 Ga0105240_10000877 3300009093 Bacteria 54159
444 Ga0105240_10001306 3300009093 Bacteria 42965
445 Ga0105240_10005628 3300009093 Bacteria 18597
446 Ga0105240_10011526 3300009093 Bacteria 12304
447 Ga0105240_10012424 3300009093 Bacteria 11757
448 Ga0105240_10051605 3300009093 Bacteria 5173
449 Ga0105240_10089720 3300009093 Bacteria 3759
450 Ga0105240_10210891 3300009093 Bacteria 2270
451 Ga0105240_10237058 3300009093 Bacteria 2117
452 Ga0105240_10261841 3300009093 Bacteria 1995
453 Ga0105240_10264391 3300009093 Bacteria 1983
454 Ga0105240_10303761 3300009093 Bacteria 1825
455 Ga0105240_10470576 3300009093 Bacteria 1403
456 Ga0105240_10858755 3300009093 Bacteria 979
457 Ga0105240_10896683 3300009093 Bacteria 954
458 Ga0105240_10928192 3300009093 Bacteria 935
459 Ga0111539_10023315 3300009094 Bacteria 7604
460 Ga0111539_10179787 3300009094 Bacteria 2471
461 Ga0111539_10490847 3300009094 Bacteria 1430
462 Ga0111539_11535031 3300009094 Bacteria 772
463 Ga0105245_10017754 3300009098 Bacteria 6210
464 Ga0105245_10039480 3300009098 Bacteria 4201
465 Ga0105245_10104493 3300009098 Bacteria 2626
466 Ga0105245_10129420 3300009098 Bacteria 2366
467 Ga0105245_10148838 3300009098 Bacteria 2212
468 Ga0105245_10149293 3300009098 Bacteria 2209
469 Ga0105245_10256599 3300009098 Bacteria 1700
470 Ga0105245_10312503 3300009098 Bacteria 1546
471 Ga0105245_10346196 3300009098 Bacteria 1471
472 Ga0105245_10379204 3300009098 Bacteria 1408
473 Ga0105245_10409019 3300009098 Bacteria 1358
474 Ga0105245_11701976 3300009098 Bacteria 683
475 Ga0105245_11921349 3300009098 Bacteria 645
476 Ga0105247_10048453 3300009101 Bacteria 2609
477 Ga0105247_10054705 3300009101 Bacteria 2463
478 Ga0105247_10401618 3300009101 Bacteria 977
479 Ga0105247_10437679 3300009101 Bacteria 940
480 Ga0105247_10939367 3300009101 Bacteria 671
481 Ga0105247_11276221 3300009101 Bacteria 588
482 Ga0114129_10038278 3300009147 Bacteria 6767
483 Ga0114129_10231657 3300009147 Bacteria 2487
484 Ga0114129_10284318 3300009147 Bacteria 2209
485 Ga0114129_10586595 3300009147 Bacteria 1446
486 Ga0114129_10730698 3300009147 Bacteria 1269
487 Ga0114129_10787421 3300009147 Bacteria 1214
488 Ga0105243_10077324 3300009148 Bacteria 2706
489 Ga0105243_10213567 3300009148 Bacteria 1700
490 Ga0105243_10592635 3300009148 Bacteria 1066
491 Ga0105243_10828722 3300009148 Bacteria 914
492 Ga0105243_11411429 3300009148 Bacteria 717
493 Ga0105243_11508488 3300009148 Bacteria 696
494 Ga0105243_11607711 3300009148 Bacteria 677
495 Ga0105243_12367652 3300009148 Bacteria 569
496 Ga0105243_12635984 3300009148 Bacteria 543
497 Ga0105241_10149324 3300009174 Bacteria 1910
498 Ga0105241_10215640 3300009174 Bacteria 1610
499 Ga0105241_10406938 3300009174 Bacteria 1195
500 Ga0105241_11175611 3300009174 Bacteria 725
501 Ga0105241_11315796 3300009174 Bacteria 689
502 Ga0105241_11539105 3300009174 Bacteria 641
503 Ga0105242_10007188 3300009176 Bacteria 8588
504 Ga0105242_10017892 3300009176 Bacteria 5533
505 Ga0105242_10029508 3300009176 Unclassified 4376
506 Ga0105242_10045247 3300009176 Bacteria 3566
507 Ga0105242_10087110 3300009176 Bacteria 2622
508 Ga0105242_10101803 3300009176 Bacteria 2435
509 Ga0105242_10159358 3300009176 Bacteria 1974
510 Ga0105242_11232430 3300009176 Bacteria 769
511 Ga0105242_11256972 3300009176 Bacteria 762
512 Ga0105242_12119993 3300009176 Bacteria 606
513 Ga0105248_10048956 3300009177 Bacteria 4741
514 Ga0105248_10091261 3300009177 Bacteria 3431
515 Ga0105248_10128484 3300009177 Bacteria 2859
516 Ga0105248_10147346 3300009177 Bacteria 2656
517 Ga0105248_10189293 3300009177 Bacteria 2319
518 Ga0105248_10191864 3300009177 Bacteria 2302
519 Ga0105248_10252960 3300009177 Bacteria 1983
520 Ga0105248_10400149 3300009177 Bacteria 1546
521 Ga0105248_10454223 3300009177 Bacteria 1444
522 Ga0105248_10758693 3300009177 Bacteria 1095
523 Ga0105248_11044875 3300009177 Bacteria 923
524 Ga0105248_11113116 3300009177 Bacteria 893
525 Ga0105248_12535227 3300009177 Bacteria 584
526 Ga0105237_10008200 3300009545 Bacteria 11346
527 Ga0105237_10051788 3300009545 Bacteria 4123
528 Ga0105237_10053225 3300009545 Bacteria 4061
529 Ga0105237_10152505 3300009545 Bacteria 2307
530 Ga0105237_10202396 3300009545 Bacteria 1986
531 Ga0105237_10209685 3300009545 Bacteria 1948
532 Ga0105237_10349760 3300009545 Bacteria 1482
533 Ga0105237_10580274 3300009545 Bacteria 1128
534 Ga0105237_10665163 3300009545 Bacteria 1048
535 Ga0105237_10759439 3300009545 Bacteria 976
536 Ga0105237_10930111 3300009545 Bacteria 876
537 Ga0105237_11269133 3300009545 Bacteria 743
538 Ga0105238_10025778 3300009551 Bacteria 5995
539 Ga0105238_10042029 3300009551 Bacteria 4629
540 Ga0105238_10043331 3300009551 Bacteria 4553
541 Ga0105238_10079438 3300009551 Bacteria 3271
542 Ga0105238_10103931 3300009551 Bacteria 2822
543 Ga0105238_10121891 3300009551 Bacteria 2587
544 Ga0105238_10145691 3300009551 Bacteria 2345
545 Ga0105238_10181937 3300009551 Bacteria 2079
546 Ga0105238_10193134 3300009551 Bacteria 2012
547 Ga0105238_11624994 3300009551 Bacteria 676
548 Ga0105238_11666046 3300009551 Bacteria 668
549 Ga0105238_12122480 3300009551 Bacteria 596
550 Ga0105249_10002635 3300009553 Bacteria 15525
551 Ga0105249_10024654 3300009553 Bacteria 5407
552 Ga0105249_10077940 3300009553 Bacteria 3074
553 Ga0105249_10139643 3300009553 Bacteria 2322
554 Ga0105249_11574552 3300009553 Bacteria 730
555 Ga0105239_10001360 3300010375 Bacteria 32860
556 Ga0105239_10096569 3300010375 Bacteria 3265
557 Ga0105239_10100314 3300010375 Bacteria 3202
558 Ga0105239_10122659 3300010375 Bacteria 2887
559 Ga0105239_10372259 3300010375 Bacteria 1614
560 Ga0105239_10607484 3300010375 Bacteria 1248
561 Ga0105239_10718863 3300010375 Bacteria 1142
562 Ga0105239_11293308 3300010375 Bacteria 841
563 Ga0105239_11528422 3300010375 Bacteria 771
564 Ga0105246_10077977 3300011119 Bacteria 2352
565 Ga0105246_10099260 3300011119 Bacteria 2116
566 Ga0105246_10114492 3300011119 Bacteria 1987
567 Ga0105246_10194956 3300011119 Bacteria 1571
568 Ga0105246_10282632 3300011119 Bacteria 1332
569 Ga0105246_10561124 3300011119 Bacteria 980
570 Ga0105246_10920208 3300011119 Bacteria 786
571 Ga0105246_11066126 3300011119 Bacteria 736
572 Ga0105246_11362579 3300011119 Bacteria 660
573 Ga0105246_11602649 3300011119 Bacteria 615
574 Ga0157319_1045228 3300012497 Bacteria 529
575 Ga0157373_10005841 3300013100 Bacteria 9211
576 Ga0157373_10348386 3300013100 Bacteria 1056
577 Ga0157373_10512080 3300013100 Bacteria 868
578 Ga0157373_10693042 3300013100 Bacteria 746
579 Ga0157373_11014028 3300013100 Bacteria 620
580 Ga0157371_10707574 3300013102 Bacteria 754
581 Ga0157371_10768908 3300013102 Bacteria 724
582 Ga0157371_11104805 3300013102 Bacteria 608
583 Ga0157370_10009380 3300013104 Bacteria 10467
584 Ga0157370_10016088 3300013104 Bacteria 7582
585 Ga0157370_10060235 3300013104 Bacteria 3605
586 Ga0157370_10087501 3300013104 Bacteria 2926
587 Ga0157370_10111743 3300013104 Bacteria 2554
588 Ga0157370_10115052 3300013104 Bacteria 2513
589 Ga0157370_10220654 3300013104 Bacteria 1756
590 Ga0157370_10709121 3300013104 Bacteria 918
591 Ga0157370_10870264 3300013104 Bacteria 818
592 Ga0157369_10089419 3300013105 Bacteria 3288
593 Ga0157369_10144717 3300013105 Bacteria 2513
594 Ga0157369_10290053 3300013105 Bacteria 1703
595 Ga0157369_11928311 3300013105 Bacteria 600
596 Ga0157374_10280734 3300013296 Bacteria 1644
597 Ga0157374_10319069 3300013296 Bacteria 1539
598 Ga0157374_10330236 3300013296 Bacteria 1512
599 Ga0157374_10446725 3300013296 Bacteria 1294
600 Ga0157374_10491386 3300013296 Bacteria 1231
601 Ga0157374_10936791 3300013296 Bacteria 884
602 Ga0157374_10977597 3300013296 Bacteria 865
603 Ga0157374_11462225 3300013296 Bacteria 706
604 Ga0157374_11919559 3300013296 Bacteria 618
605 Ga0157374_12096100 3300013296 Bacteria 592
606 Ga0157378_10009845 3300013297 Bacteria 8336
607 Ga0157378_10024793 3300013297 Bacteria 5282
608 Ga0157378_10173155 3300013297 Bacteria 2026
609 Ga0157378_10363194 3300013297 Bacteria 1417
610 Ga0157378_10445060 3300013297 Bacteria 1285
611 Ga0157378_10450373 3300013297 Bacteria 1277
612 Ga0157378_10662029 3300013297 Bacteria 1061
613 Ga0157378_10888711 3300013297 Bacteria 921
614 Ga0157378_11520754 3300013297 Unclassified 714
615 Ga0157378_11595813 3300013297 Bacteria 698
616 Ga0157378_12033050 3300013297 Bacteria 625
617 Ga0157378_12695637 3300013297 Bacteria 549
618 Ga0163162_10199046 3300013306 Bacteria 2132
619 Ga0163162_10225142 3300013306 Bacteria 2005
620 Ga0163162_10255877 3300013306 Bacteria 1883
621 Ga0163162_10578563 3300013306 Bacteria 1250
622 Ga0163162_11115184 3300013306 Bacteria 894
623 Ga0163162_11629940 3300013306 Bacteria 736
624 Ga0163162_12061465 3300013306 Bacteria 654
625 Ga0163162_12680609 3300013306 Bacteria 574
626 Ga0157372_10122792 3300013307 Bacteria 2985
627 Ga0157372_10225448 3300013307 Bacteria 2173
628 Ga0157372_10242922 3300013307 Bacteria 2089
629 Ga0157372_10276972 3300013307 Bacteria 1950
630 Ga0157372_10366455 3300013307 Bacteria 1679
631 Ga0157372_10999408 3300013307 Bacteria 969
632 Ga0157372_11151609 3300013307 Bacteria 897
633 Ga0157372_11362368 3300013307 Bacteria 818
634 Ga0157372_12609069 3300013307 Bacteria 580
635 Ga0157372_13394294 3300013307 Bacteria 507
636 Ga0157375_10018698 3300013308 Bacteria 6289
637 Ga0157375_10032840 3300013308 Bacteria 4926
638 Ga0157375_10116410 3300013308 Bacteria 2777
639 Ga0157375_10126067 3300013308 Bacteria 2675
640 Ga0157375_10425489 3300013308 Bacteria 1494
641 Ga0157375_10472512 3300013308 Bacteria 1419
642 Ga0157375_10501536 3300013308 Bacteria 1378
643 Ga0157375_11706751 3300013308 Bacteria 746
644 Ga0157375_11750934 3300013308 Bacteria 736
645 Ga0157375_12682966 3300013308 Bacteria 596
646 Ga0163163_10021758 3300014325 Bacteria 6058
647 Ga0163163_10055051 3300014325 Bacteria 3931
648 Ga0163163_10073100 3300014325 Bacteria 3419
649 Ga0163163_10115863 3300014325 Bacteria 2711
650 Ga0163163_10219037 3300014325 Bacteria 1952
651 Ga0163163_10265123 3300014325 Bacteria 1769
652 Ga0163163_10406008 3300014325 Bacteria 1421
653 Ga0163163_10711542 3300014325 Bacteria 1068
654 Ga0163163_10796119 3300014325 Bacteria 1009
655 Ga0163163_10916822 3300014325 Bacteria 939
656 Ga0163163_10978368 3300014325 Bacteria 909
657 Ga0163163_11064320 3300014325 Bacteria 872
658 Ga0157380_10267691 3300014326 Bacteria 1556
659 Ga0157380_12284723 3300014326 Bacteria 605
660 Ga0157377_10282327 3300014745 Bacteria 1089
661 Ga0157377_10400044 3300014745 Bacteria 935
662 Ga0157377_11103247 3300014745 Bacteria 608
663 Ga0157379_10006057 3300014968 Bacteria 10415
664 Ga0157379_10144596 3300014968 Bacteria 2144
665 Ga0157379_10483045 3300014968 Bacteria 1147
666 Ga0157379_10663700 3300014968 Bacteria 977
667 Ga0157379_10829439 3300014968 Bacteria 874
668 Ga0157379_11022947 3300014968 Unclassified 788
669 Ga0157379_11373458 3300014968 Bacteria 684
670 Ga0157379_11615559 3300014968 Bacteria 633
671 Ga0157379_11774386 3300014968 Bacteria 606
672 Ga0157376_10000261 3300014969 Bacteria 35920
673 Ga0157376_10012722 3300014969 Bacteria 6257
674 Ga0157376_10193186 3300014969 Bacteria 1868
675 Ga0157376_10193905 3300014969 Bacteria 1865
676 Ga0157376_10912527 3300014969 Bacteria 897
677 Ga0157376_11827967 3300014969 Bacteria 644
678 Ga0157376_11899754 3300014969 Bacteria 632
679 Ga0157376_11958019 3300014969 Bacteria 623
680 Ga0157376_12202120 3300014969 Bacteria 590
681 Ga0157376_12698772 3300014969 Bacteria 537
682 Ga0182007_10079041 3300015262 Bacteria 1079
683 Ga0182007_10218614 3300015262 Bacteria 672
684 Ga0163161_10881247 3300017792 Bacteria 757
685 Ga0206356_11182845 3300020070 Bacteria 1797
686 Ga0206356_11564136 3300020070 Bacteria 648
687 Ga0206351_10681821 3300020077 Bacteria 726
688 Ga0206352_10028984 3300020078 Bacteria 583
689 Ga0206352_10470863 3300020078 Bacteria 2207
690 Ga0206352_10752238 3300020078 Bacteria 713
691 Ga0206352_11270903 3300020078 Bacteria 790
692 Ga0206353_11732501 3300020082 Bacteria 1305
693 Ga0213876_10041973 3300021384 Bacteria 2417
694 Ga0213875_10022806 3300021388 Bacteria 2994
695 Ga0224712_10000548 3300022467 Bacteria 7616
696 Ga0224572_1066287 3300024225 Bacteria 668
697 Ga0207656_10470961 3300025321 Bacteria 636
698 Ga0207653_10010608 3300025885 Bacteria 2876
699 Ga0207653_10019306 3300025885 Bacteria 2149
700 Ga0207653_10233351 3300025885 Bacteria 701
701 Ga0207692_10074593 3300025898 Bacteria 1798
702 Ga0207692_10452153 3300025898 Bacteria 809
703 Ga0207692_10462867 3300025898 Bacteria 800
704 Ga0207642_10470226 3300025899 Bacteria 765
705 Ga0207710_10050839 3300025900 Bacteria 1860
706 Ga0207710_10056828 3300025900 Bacteria 1766
707 Ga0207710_10307720 3300025900 Bacteria 801
708 Ga0207710_10487930 3300025900 Bacteria 638
709 Ga0207688_10106342 3300025901 Bacteria 1625
710 Ga0207680_10193211 3300025903 Bacteria 1383
711 Ga0207680_10194678 3300025903 Bacteria 1378
712 Ga0207680_10201701 3300025903 Bacteria 1356
713 Ga0207680_10507495 3300025903 Bacteria 859
714 Ga0207680_10799496 3300025903 Bacteria 676
715 Ga0207647_10043016 3300025904 Bacteria 2829
716 Ga0207647_10384978 3300025904 Bacteria 791
717 Ga0207685_10145305 3300025905 Bacteria 1068
718 Ga0207685_10519982 3300025905 Bacteria 629
719 Ga0207685_10532667 3300025905 Bacteria 622
720 Ga0207699_10299935 3300025906 Bacteria 1122
721 Ga0207699_10396201 3300025906 Bacteria 982
722 Ga0207699_10853605 3300025906 Bacteria 671
723 Ga0207645_10000001 3300025907 Bacteria 442754
724 Ga0207645_10127376 3300025907 Bacteria 1655
725 Ga0207645_10741378 3300025907 Bacteria 668
726 Ga0207643_10001234 3300025908 Bacteria 15095
727 Ga0207705_10027514 3300025909 Bacteria 4055
728 Ga0207705_10058265 3300025909 Bacteria 2787
729 Ga0207705_10381660 3300025909 Bacteria 1088
730 Ga0207684_10017024 3300025910 Bacteria 6244
731 Ga0207684_10088612 3300025910 Bacteria 2637
732 Ga0207684_10135015 3300025910 Bacteria 2118
733 Ga0207654_10002666 3300025911 Bacteria 9063
734 Ga0207654_10039405 3300025911 Bacteria 2657
735 Ga0207707_10039884 3300025912 Bacteria 4103
736 Ga0207707_10051420 3300025912 Bacteria 3588
737 Ga0207707_10052960 3300025912 Bacteria 3532
738 Ga0207707_10065301 3300025912 Bacteria 3170
739 Ga0207707_10142451 3300025912 Bacteria 2096
740 Ga0207707_10202549 3300025912 Bacteria 1730
741 Ga0207695_10001948 3300025913 Bacteria 32047
742 Ga0207695_10008732 3300025913 Bacteria 12637
743 Ga0207695_10009692 3300025913 Bacteria 11858
744 Ga0207695_10024901 3300025913 Bacteria 6717
745 Ga0207695_10033693 3300025913 Bacteria 5580
746 Ga0207695_10104263 3300025913 Bacteria 2826
747 Ga0207695_10121084 3300025913 Bacteria 2585
748 Ga0207695_10140626 3300025913 Bacteria 2363
749 Ga0207695_10148295 3300025913 Bacteria 2287
750 Ga0207695_10164082 3300025913 Bacteria 2151
751 Ga0207695_10482163 3300025913 Bacteria 1122
752 Ga0207695_10901946 3300025913 Bacteria 764
753 Ga0207695_10927662 3300025913 Bacteria 750
754 Ga0207695_10959222 3300025913 Bacteria 735
755 Ga0207671_10008521 3300025914 Bacteria 8682
756 Ga0207671_10010454 3300025914 Bacteria 7655
757 Ga0207671_10068243 3300025914 Bacteria 2649
758 Ga0207671_10085702 3300025914 Bacteria 2367
759 Ga0207671_10118089 3300025914 Bacteria 2025
760 Ga0207671_10163633 3300025914 Bacteria 1724
761 Ga0207671_10263012 3300025914 Bacteria 1358
762 Ga0207671_10296510 3300025914 Bacteria 1277
763 Ga0207671_10377164 3300025914 Bacteria 1126
764 Ga0207671_10496509 3300025914 Bacteria 973
765 Ga0207671_10841365 3300025914 Bacteria 727
766 Ga0207693_10088443 3300025915 Bacteria 2428
767 Ga0207663_10034350 3300025916 Bacteria 3031
768 Ga0207663_10195008 3300025916 Bacteria 1457
769 Ga0207663_10229309 3300025916 Bacteria 1356
770 Ga0207663_10276502 3300025916 Bacteria 1246
771 Ga0207663_10510796 3300025916 Bacteria 935
772 Ga0207663_10570019 3300025916 Bacteria 887
773 Ga0207663_10603209 3300025916 Bacteria 863
774 Ga0207663_11119858 3300025916 Bacteria 633
775 Ga0207663_11128813 3300025916 Bacteria 630
776 Ga0207660_10007721 3300025917 Bacteria 6962
777 Ga0207660_10042286 3300025917 Bacteria 3198
778 Ga0207660_10096570 3300025917 Bacteria 2200
779 Ga0207660_10192938 3300025917 Bacteria 1587
780 Ga0207662_10297311 3300025918 Bacteria 1072
781 Ga0207662_10629033 3300025918 Bacteria 748
782 Ga0207657_10002040 3300025919 Bacteria 21838
783 Ga0207657_10190582 3300025919 Bacteria 1654
784 Ga0207657_10337253 3300025919 Bacteria 1190
785 Ga0207657_10425210 3300025919 Bacteria 1044
786 Ga0207657_10951241 3300025919 Bacteria 660
787 Ga0207649_10137200 3300025920 Bacteria 1669
788 Ga0207649_10161490 3300025920 Bacteria 1553
789 Ga0207649_10361367 3300025920 Bacteria 1077
790 Ga0207652_10002950 3300025921 Bacteria 14218
791 Ga0207652_10101022 3300025921 Bacteria 2547
792 Ga0207652_10157853 3300025921 Bacteria 2032
793 Ga0207646_10012863 3300025922 Bacteria 8022
794 Ga0207646_10133227 3300025922 Bacteria 2237
795 Ga0207646_10432754 3300025922 Bacteria 1187
796 Ga0207646_11047304 3300025922 Bacteria 720
797 Ga0207681_10246401 3300025923 Bacteria 1393
798 Ga0207681_10858191 3300025923 Bacteria 759
799 Ga0207694_10030295 3300025924 Bacteria 4132
800 Ga0207694_10033344 3300025924 Bacteria 3944
801 Ga0207694_10038575 3300025924 Bacteria 3673
802 Ga0207694_10074283 3300025924 Bacteria 2661
803 Ga0207694_10154946 3300025924 Bacteria 1847
804 Ga0207694_10194561 3300025924 Bacteria 1648
805 Ga0207694_11716799 3300025924 Bacteria 528
806 Ga0207650_10208613 3300025925 Bacteria 1568
807 Ga0207650_10425348 3300025925 Bacteria 1102
808 Ga0207650_10931971 3300025925 Bacteria 738
809 Ga0207659_10083343 3300025926 Bacteria 2370
810 Ga0207687_10017019 3300025927 Bacteria 4780
811 Ga0207687_10019124 3300025927 Bacteria 4535
812 Ga0207687_10032379 3300025927 Bacteria 3540
813 Ga0207687_10071255 3300025927 Bacteria 2483
814 Ga0207687_10096250 3300025927 Bacteria 2169
815 Ga0207687_10129959 3300025927 Bacteria 1896
816 Ga0207687_10177359 3300025927 Bacteria 1648
817 Ga0207687_10190510 3300025927 Bacteria 1596
818 Ga0207687_10205512 3300025927 Bacteria 1542
819 Ga0207687_11643371 3300025927 Bacteria 551
820 Ga0207700_10029176 3300025928 Bacteria 3890
821 Ga0207700_10164168 3300025928 Bacteria 1847
822 Ga0207700_10446296 3300025928 Bacteria 1140
823 Ga0207700_10515366 3300025928 Bacteria 1059
824 Ga0207700_10555465 3300025928 Bacteria 1019
825 Ga0207700_10693373 3300025928 Bacteria 909
826 Ga0207664_10004267 3300025929 Bacteria 9673
827 Ga0207664_10274240 3300025929 Bacteria 1478
828 Ga0207664_10428131 3300025929 Bacteria 1179
829 Ga0207664_11302818 3300025929 Bacteria 646
830 Ga0207644_10066014 3300025931 Bacteria 2633
831 Ga0207644_10174854 3300025931 Bacteria 1679
832 Ga0207644_10553114 3300025931 Bacteria 953
833 Ga0207644_10585547 3300025931 Bacteria 925
834 Ga0207644_11131740 3300025931 Bacteria 658
835 Ga0207690_10183495 3300025932 Bacteria 1577
836 Ga0207690_10326729 3300025932 Bacteria 1207
837 Ga0207706_10070832 3300025933 Bacteria 3067
838 Ga0207686_10003970 3300025934 Bacteria 7941
839 Ga0207686_10005039 3300025934 Bacteria 7106
840 Ga0207686_10005404 3300025934 Bacteria 6851
841 Ga0207686_10019111 3300025934 Unclassified 3891
842 Ga0207686_10076510 3300025934 Bacteria 2170
843 Ga0207686_10137346 3300025934 Bacteria 1685
844 Ga0207686_10240774 3300025934 Bacteria 1317
845 Ga0207709_10115699 3300025935 Bacteria 1802
846 Ga0207709_10161771 3300025935 Bacteria 1562
847 Ga0207709_10218441 3300025935 Bacteria 1373
848 Ga0207709_10374506 3300025935 Bacteria 1081
849 Ga0207709_10557787 3300025935 Bacteria 902
850 Ga0207709_10623133 3300025935 Bacteria 856
851 Ga0207709_10728149 3300025935 Bacteria 796
852 Ga0207670_10151143 3300025936 Bacteria 1723
853 Ga0207670_10152015 3300025936 Bacteria 1719
854 Ga0207670_10274512 3300025936 Bacteria 1312
855 Ga0207670_10342167 3300025936 Bacteria 1182
856 Ga0207670_10348310 3300025936 Bacteria 1172
857 Ga0207670_10594838 3300025936 Bacteria 908
858 Ga0207669_10168175 3300025937 Unclassified 1557
859 Ga0207704_10040646 3300025938 Bacteria 2720
860 Ga0207704_10506339 3300025938 Bacteria 974
861 Ga0207704_10673673 3300025938 Bacteria 854
862 Ga0207704_11366181 3300025938 Bacteria 607
863 Ga0207665_10096123 3300025939 Bacteria 2060
864 Ga0207665_10500424 3300025939 Bacteria 939
865 Ga0207691_10011682 3300025940 Bacteria 8433
866 Ga0207691_10287124 3300025940 Bacteria 1415
867 Ga0207691_10331216 3300025940 Bacteria 1304
868 Ga0207691_10581586 3300025940 Bacteria 948
869 Ga0207691_11114821 3300025940 Bacteria 656
870 Ga0207711_10002186 3300025941 Bacteria 17573
871 Ga0207711_10122624 3300025941 Bacteria 2322
872 Ga0207711_10253474 3300025941 Bacteria 1616
873 Ga0207711_10291298 3300025941 Bacteria 1505
874 Ga0207711_10314266 3300025941 Bacteria 1447
875 Ga0207711_10360513 3300025941 Bacteria 1347
876 Ga0207711_10394295 3300025941 Bacteria 1285
877 Ga0207711_10401010 3300025941 Bacteria 1274
878 Ga0207711_10426824 3300025941 Bacteria 1233
879 Ga0207711_10493303 3300025941 Bacteria 1141
880 Ga0207711_11398284 3300025941 Bacteria 642
881 Ga0207689_10076821 3300025942 Bacteria 2745
882 Ga0207689_10129346 3300025942 Bacteria 2078
883 Ga0207689_10186020 3300025942 Bacteria 1713
884 Ga0207689_10438903 3300025942 Bacteria 1090
885 Ga0207689_10462938 3300025942 Bacteria 1060
886 Ga0207661_10007311 3300025944 Bacteria 7855
887 Ga0207661_10008612 3300025944 Bacteria 7289
888 Ga0207661_10029011 3300025944 Bacteria 4245
889 Ga0207661_10070357 3300025944 Bacteria 2856
890 Ga0207661_10143604 3300025944 Bacteria 2056
891 Ga0207661_10214715 3300025944 Bacteria 1697
892 Ga0207661_10428017 3300025944 Bacteria 1203
893 Ga0207661_10594606 3300025944 Bacteria 1015
894 Ga0207661_11598627 3300025944 Bacteria 596
895 Ga0207661_11721433 3300025944 Bacteria 572
896 Ga0207679_10147074 3300025945 Bacteria 1913
897 Ga0207679_10170041 3300025945 Bacteria 1793
898 Ga0207679_10301142 3300025945 Bacteria 1382
899 Ga0207679_10483672 3300025945 Bacteria 1102
900 Ga0207679_11309751 3300025945 Bacteria 665
901 Ga0207667_10015532 3300025949 Bacteria 8643
902 Ga0207667_10020712 3300025949 Bacteria 7307
903 Ga0207667_10021290 3300025949 Bacteria 7186
904 Ga0207667_10070161 3300025949 Bacteria 3647
905 Ga0207667_10071295 3300025949 Bacteria 3613
906 Ga0207667_10244652 3300025949 Bacteria 1835
907 Ga0207667_11811993 3300025949 Bacteria 574
908 Ga0207651_10012611 3300025960 Bacteria 4793
909 Ga0207651_10197727 3300025960 Bacteria 1608
910 Ga0207651_10971665 3300025960 Unclassified 758
911 Ga0207651_10977347 3300025960 Bacteria 756
912 Ga0207651_11598486 3300025960 Bacteria 587
913 Ga0207712_10003146 3300025961 Bacteria 10526
914 Ga0207712_10004825 3300025961 Bacteria 8520
915 Ga0207712_10092233 3300025961 Bacteria 2233
916 Ga0207712_10286248 3300025961 Bacteria 1347
917 Ga0207712_10539391 3300025961 Bacteria 1002
918 Ga0207712_10552613 3300025961 Bacteria 990
919 Ga0207712_10774951 3300025961 Bacteria 842
920 Ga0207640_10161981 3300025981 Bacteria 1656
921 Ga0207640_10183861 3300025981 Bacteria 1569
922 Ga0207640_10568825 3300025981 Bacteria 955
923 Ga0207640_10843076 3300025981 Bacteria 797
924 Ga0207658_10000049 3300025986 Bacteria 129769
925 Ga0207658_10101054 3300025986 Bacteria 2259
926 Ga0207658_10134934 3300025986 Bacteria 1988
927 Ga0207658_10462178 3300025986 Bacteria 1125
928 Ga0207658_10863586 3300025986 Bacteria 823
929 Ga0207658_10870731 3300025986 Bacteria 819
930 Ga0207658_11428116 3300025986 Bacteria 633
931 Ga0207677_10203666 3300026023 Bacteria 1575
932 Ga0207677_10224814 3300026023 Bacteria 1508
933 Ga0207677_10246308 3300026023 Unclassified 1449
934 Ga0207677_10306818 3300026023 Bacteria 1313
935 Ga0207677_10812374 3300026023 Bacteria 838
936 Ga0207703_10069669 3300026035 Bacteria 2901
937 Ga0207703_10120083 3300026035 Bacteria 2255
938 Ga0207703_10172273 3300026035 Bacteria 1905
939 Ga0207703_10194964 3300026035 Bacteria 1797
940 Ga0207703_10317015 3300026035 Bacteria 1427
941 Ga0207703_10339060 3300026035 Bacteria 1381
942 Ga0207703_10727470 3300026035 Unclassified 945
943 Ga0207703_11335727 3300026035 Bacteria 690
944 Ga0207703_11683800 3300026035 Bacteria 610
945 Ga0207639_10045508 3300026041 Bacteria 3306
946 Ga0207639_10209326 3300026041 Bacteria 1677
947 Ga0207639_10242622 3300026041 Bacteria 1567
948 Ga0207639_10341680 3300026041 Bacteria 1335
949 Ga0207639_10390135 3300026041 Bacteria 1252
950 Ga0207639_10553773 3300026041 Bacteria 1056
951 Ga0207639_10749435 3300026041 Bacteria 908
952 Ga0207639_10926269 3300026041 Unclassified 815
953 Ga0207639_10937646 3300026041 Bacteria 810
954 Ga0207639_11696704 3300026041 Bacteria 592
955 Ga0207678_11218354 3300026067 Bacteria 666
956 Ga0207708_10060638 3300026075 Bacteria 2887
957 Ga0207708_10127103 3300026075 Bacteria 1990
958 Ga0207708_11650427 3300026075 Bacteria 563
959 Ga0207702_10049903 3300026078 Bacteria 3532
960 Ga0207702_10120702 3300026078 Bacteria 2346
961 Ga0207702_10206316 3300026078 Bacteria 1825
962 Ga0207702_10238935 3300026078 Bacteria 1701
963 Ga0207702_10256020 3300026078 Bacteria 1646
964 Ga0207702_10440394 3300026078 Bacteria 1263
965 Ga0207702_10605810 3300026078 Bacteria 1075
966 Ga0207641_10082414 3300026088 Bacteria 2795
967 Ga0207641_10097869 3300026088 Bacteria 2579
968 Ga0207641_10203132 3300026088 Bacteria 1828
969 Ga0207641_10340938 3300026088 Bacteria 1426
970 Ga0207641_11168754 3300026088 Bacteria 769
971 Ga0207648_10073228 3300026089 Bacteria 2986
972 Ga0207648_10181282 3300026089 Bacteria 1864
973 Ga0207648_10197096 3300026089 Bacteria 1786
974 Ga0207648_10228338 3300026089 Bacteria 1655
975 Ga0207648_10409100 3300026089 Bacteria 1230
976 Ga0207648_10453931 3300026089 Bacteria 1167
977 Ga0207676_10006640 3300026095 Bacteria 8178
978 Ga0207676_10078610 3300026095 Bacteria 2672
979 Ga0207676_10146864 3300026095 Bacteria 2026
980 Ga0207676_10211529 3300026095 Bacteria 1721
981 Ga0207676_10642670 3300026095 Bacteria 1023
982 Ga0207676_12189824 3300026095 Bacteria 551
983 Ga0207674_10016607 3300026116 Bacteria 8049
984 Ga0207674_10052247 3300026116 Bacteria 4168
985 Ga0207674_10068105 3300026116 Bacteria 3582
986 Ga0207674_10085677 3300026116 Bacteria 3145
987 Ga0207674_10092133 3300026116 Bacteria 3021
988 Ga0207674_10267945 3300026116 Bacteria 1655
989 Ga0207674_10500098 3300026116 Bacteria 1174
990 Ga0207674_10666325 3300026116 Bacteria 1005
991 Ga0207674_11275789 3300026116 Bacteria 704
992 Ga0207675_100069431 3300026118 Bacteria 3293
993 Ga0207675_100075709 3300026118 Bacteria 3151
994 Ga0207675_100275734 3300026118 Bacteria 1633
995 Ga0207675_101389841 3300026118 Bacteria 723
996 Ga0207675_101681455 3300026118 Bacteria 655
997 Ga0207683_10151323 3300026121 Bacteria 2094
998 Ga0207683_10152334 3300026121 Bacteria 2087
999 Ga0207683_10279816 3300026121 Bacteria 1525
1000 Ga0207683_10798177 3300026121 Bacteria 876
1001 Ga0207698_10009875 3300026142 Bacteria 6103
1002 Ga0207698_10016901 3300026142 Bacteria 4933
1003 Ga0207698_10346841 3300026142 Bacteria 1401
1004 Ga0207698_10549016 3300026142 Bacteria 1132
1005 Ga0207698_11810344 3300026142 Bacteria 626
1006 Ga0209983_1129971 3300027665 Bacteria 576
1007 Ga0209588_1036300 3300027671 Bacteria 1586
1008 Ga0207428_10031589 3300027907 Bacteria 4365
1009 Ga0268266_10002958 3300028379 Bacteria 17520
1010 Ga0268266_10021412 3300028379 Bacteria 5507
1011 Ga0268266_10166783 3300028379 Bacteria 1996
1012 Ga0268266_10424516 3300028379 Bacteria 1260
1013 Ga0268265_10020775 3300028380 Bacteria 4589
1014 Ga0268265_10271219 3300028380 Bacteria 1513
1015 Ga0268265_10358419 3300028380 Bacteria 1334
1016 Ga0268265_10490284 3300028380 Bacteria 1156
1017 Ga0268265_10582846 3300028380 Bacteria 1066
1018 Ga0268265_11075304 3300028380 Bacteria 798
1019 Ga0268264_10001547 3300028381 Bacteria 21355
1020 Ga0268264_10016109 3300028381 Bacteria 6125
1021 Ga0268264_10207754 3300028381 Bacteria 1795
1022 Ga0268264_10313321 3300028381 Bacteria 1481
1023 Ga0268264_10369093 3300028381 Bacteria 1371
1024 Ga0268264_10447531 3300028381 Bacteria 1251
1025 Ga0268264_10669879 3300028381 Bacteria 1028
1026 Ga0268264_12482945 3300028381 Unclassified 524
1027 Ga0268264_12500210 3300028381 Bacteria 522
1028 Ga0265334_10094599 3300028573 Bacteria 1087
1029 Ga0265318_10011693 3300028577 Bacteria 3766
1030 Ga0265338_10054342 3300028800 Bacteria 3573
1031 Ga0265338_10206263 3300028800 Bacteria 1479
1032 Ga0265338_10302524 3300028800 Bacteria 1162
1033 Ga0265338_10692706 3300028800 Bacteria 704
1034 Ga0265338_10889284 3300028800 Bacteria 607
1035 Ga0265762_1106763 3300030760 Bacteria 627
1036 Ga0265775_103369 3300030762 Bacteria 862
1037 Ga0265760_10073850 3300031090 Bacteria 1049
1038 Ga0265760_10172429 3300031090 Bacteria 719
1039 Ga0265760_10228481 3300031090 Bacteria 637
1040 Ga0265330_10250292 3300031235 Bacteria 747
1041 Ga0265330_10251180 3300031235 Bacteria 745
1042 Ga0265332_10310353 3300031238 Bacteria 651
1043 Ga0265325_10027317 3300031241 Bacteria 3085
1044 Ga0265325_10109103 3300031241 Bacteria 1347
1045 Ga0265340_10040215 3300031247 Bacteria 2304
1046 Ga0265331_10070798 3300031250 Bacteria 1632
1047 Ga0265331_10089844 3300031250 Bacteria 1421
1048 Ga0265331_10338182 3300031250 Bacteria 674
1049 Ga0265331_10343667 3300031250 Bacteria 668
1050 Ga0265331_10445723 3300031250 Bacteria 581
1051 Ga0265327_10063515 3300031251 Bacteria 1875
1052 Ga0265316_10001314 3300031344 Bacteria 26729
1053 Ga0265316_10007548 3300031344 Bacteria 10232
1054 Ga0265316_10033449 3300031344 Bacteria 4187
1055 Ga0265316_10067016 3300031344 Bacteria 2776
1056 Ga0265316_10101319 3300031344 Bacteria 2188
1057 Ga0265316_10270427 3300031344 Bacteria 1244
1058 Ga0265316_10293198 3300031344 Bacteria 1186
1059 Ga0265316_10526766 3300031344 Bacteria 842
1060 Ga0265316_10773848 3300031344 Bacteria 674
1061 Ga0265316_10868165 3300031344 Bacteria 631
1062 Ga0265316_11073145 3300031344 Bacteria 559
1063 Ga0265316_11128060 3300031344 Bacteria 543
1064 Ga0265313_10012996 3300031595 Bacteria 5034
1065 Ga0316575_10060722 3300031665 Unclassified 1510
1066 Ga0265314_10055511 3300031711 Bacteria 2733
1067 Ga0265314_10066132 3300031711 Bacteria 2439
1068 Ga0265314_10151872 3300031711 Bacteria 1419
1069 Ga0265314_10255370 3300031711 Bacteria 1004
1070 Ga0265342_10084206 3300031712 Bacteria 1832
1071 Ga0316576_10060959 3300031727 Bacteria 2765
1072 Ga0316576_10225395 3300031727 Unclassified 1410
1073 Ga0316576_10275615 3300031727 Bacteria 1260
1074 Ga0316576_10287570 3300031727 Bacteria 1230
1075 Ga0316576_10438416 3300031727 Bacteria 966
1076 Ga0316576_10485278 3300031727 Unclassified 910
1077 Ga0316577_10024609 3300031733 Bacteria 3347
1078 Ga0316577_10058177 3300031733 Bacteria 2158
1079 Ga0316577_10193366 3300031733 Bacteria 1150
1080 Ga0307413_10133435 3300031824 Bacteria 1703
1081 Ga0307410_10000336 3300031852 Bacteria 18223
1082 Ga0307411_10002603 3300032005 Bacteria 8060
1083 Ga0316583_10049103 3300032133 Bacteria 1485
1084 Ga0316593_10000031 3300032168 Bacteria 14752
1085 Ga0316593_10000158 3300032168 Bacteria 9794
1086 Ga0316593_10000278 3300032168 Bacteria 8597
1087 Ga0316593_10000848 3300032168 Bacteria 6188
1088 Ga0316593_10001195 3300032168 Bacteria 5565
1089 Ga0316593_10002697 3300032168 Bacteria 4270
1090 Ga0316593_10010835 3300032168 Bacteria 2630
1091 Ga0316593_10011946 3300032168 Bacteria 2538
1092 Ga0316593_10018705 3300032168 Bacteria 2133
1093 Ga0316593_10041649 3300032168 Bacteria 1529
1094 Ga0316593_10043616 3300032168 Bacteria 1499
1095 Ga0316593_10055552 3300032168 Bacteria 1346
1096 Ga0316593_10151760 3300032168 Bacteria 843
1097 Ga0316593_10298255 3300032168 Bacteria 610
1098 Ga0316592_1000536 3300033524 Bacteria 5367
1099 Ga0316592_1002993 3300033524 Unclassified 2987
1100 Ga0316592_1010913 3300033524 Bacteria 1838
1101 Ga0316592_1033351 3300033524 Unclassified 1125
1102 Ga0316592_1069834 3300033524 Bacteria 794
1103 Ga0316592_1141118 3300033524 Bacteria 565
1104 Ga0316588_1015198 3300033528 Unclassified 1693
1105 Ga0316588_1080796 3300033528 Bacteria 805
1106 Ga0316588_1089361 3300033528 Bacteria 767
1107 Ga0316587_1010208 3300033529 Bacteria 1500
1108 Ga0316596_1000058 3300033541 Bacteria 12401
1109 Ga0316596_1000988 3300033541 Bacteria 5465
1110 Ga0316596_1001007 3300033541 Bacteria 5422
1111 Ga0316596_1001016 3300033541 Bacteria 5403
1112 Ga0316596_1001482 3300033541 Bacteria 4755
1113 Ga0316596_1009369 3300033541 Bacteria 2349
1114 Ga0316596_1014849 3300033541 Bacteria 1936
1115 Ga0316596_1019395 3300033541 Bacteria 1725
1116 Ga0316596_1023719 3300033541 Bacteria 1573
1117 Ga0316596_1040060 3300033541 Unclassified 1230
1118 Ga0316596_1042813 3300033541 Bacteria 1192
1119 Ga0316596_1043728 3300033541 Bacteria 1179
1120 Ga0316596_1056788 3300033541 Bacteria 1041
1121 Ga0316596_1063628 3300033541 Unclassified 985
1122 Ga0316596_1162060 3300033541 Unclassified 616
1123 Ga0316596_1178262 3300033541 Bacteria 588
1124 Ga0373930_0011058 3300034816 Bacteria 1624
1125 Ga0373959_0021787 3300034820 Bacteria 1233
1126 Ga0373926_0006956 3300035083 Bacteria 3761
1127 Ga0373926_0348587 3300035083 Bacteria 581
1128 Ga0373928_0013532 3300035084 Bacteria 1639
1129 Ga0373928_0150792 3300035084 Bacteria 643
1130 Ga0373929_0077800 3300035085 Bacteria 804
1131 Ga0373934_0021690 3300035086 Bacteria 2475
1132 Ga0373934_0045842 3300035086 Bacteria 1729
1133 Ga0373940_0202122 3300035088 Bacteria 653
1134 Ga0373944_0143572 3300035089 Bacteria 837
1135 Ga0373951_0005949 3300035091 Bacteria 2813
1136 Ga0373923_0380102 3300035111 Bacteria 677
1137 Ga0373932_0113268 3300035112 Bacteria 896
1138 Ga0373936_0100591 3300035113 Bacteria 1220
1139 Ga0373936_0472085 3300035113 Bacteria 582
1140 Ga0373939_0428529 3300035114 Bacteria 553
1141 Ga0373941_0407221 3300035115 Bacteria 564
1142 Ga0373945_0153546 3300035116 Bacteria 934
1143 Ga0373953_0186434 3300035117 Bacteria 896
1144 Ga0373953_0249603 3300035117 Bacteria 771
1145 Ga0373954_0064249 3300035118 Bacteria 1735
1146 Ga0373954_0137445 3300035118 Bacteria 1191
1147 Ga0373954_0339067 3300035118 Bacteria 742
1148 Ga0373956_0123334 3300035119 Bacteria 1211
1149 Ga0373957_0094581 3300035120 Bacteria 1191
1150 Ga0373957_0468153 3300035120 Bacteria 547
1151 Ga0373960_0003527 3300035121 Bacteria 3546
1152 Ga0373943_0006464 3300035170 Bacteria 5264
1153 Ga0373943_0366742 3300035170 Bacteria 827
1154 Ga0373943_0572436 3300035170 Bacteria 664
1155 Ga0373946_0071032 3300035171 Bacteria 1504
1156 Ga0373946_0233713 3300035171 Bacteria 892
1157 Ga0373946_0318424 3300035171 Bacteria 772
1158 Ga0373946_0418822 3300035171 Unclassified 678
1159 Ga0373955_0023160 3300035172 Bacteria 3160
1160 Ga0373955_0120824 3300035172 Bacteria 1523
1161 Ga0373955_0263653 3300035172 Bacteria 1035
1162 Ga0373942_0070132 3300035207 Bacteria 1022
1163 Ga0316574_0027877 3300035398 Bacteria 3403
1164 Ga0316574_0047264 3300035398 Bacteria 2671
1165 Ga0316574_0374240 3300035398 Unclassified 899
1166 Ga0316574_0417157 3300035398 Bacteria 844
1167 Ga0316574_0659110 3300035398 Bacteria 644
1168 Ga0316574_0751348 3300035398 Bacteria 596
1169 Ga0373931_0860368 3300035691 Bacteria 607
1170 Ga0373935_0029628 3300035692 Bacteria 3388
1171 Ga0373935_0064571 3300035692 Bacteria 2348
1172 Ga0373935_0362104 3300035692 Bacteria 1036
1173 Ga0373927_0001719 3300035695 Bacteria 16366
1174 Ga0373927_0033099 3300035695 Bacteria 3365
1175 Ga0373927_0778051 3300035695 Bacteria 632
1176 Ga0373933_0197266 3300035724 Bacteria 1287
1177 Ga0373933_0766130 3300035724 Bacteria 635
1178 Ga0373933_1185337 3300035724 Bacteria 503
1179 Ga0373947_0003896 3300035725 Bacteria 8774
1180 Ga0373947_0016431 3300035725 Bacteria 4253
1181 Ga0373947_0161506 3300035725 Bacteria 1449
1182 Ga0373947_0527159 3300035725 Bacteria 803
1183 Ga0373947_0695562 3300035725 Bacteria 694
1184 Ga0373937_0028911 3300036401 Bacteria 5019
1185 Ga0373937_0198764 3300036401 Bacteria 1884
1186 Ga0373937_0328502 3300036401 Bacteria 1447
1187 Ga0373937_0426859 3300036401 Bacteria 1258
1188 Ga0373937_0625822 3300036401 Bacteria 1021
1189 Ga0373937_1069058 3300036401 Bacteria 756
1190 Ga0265778_011924 3300036457 Bacteria 1006
1191 Ga0316582_0042688 3300036647 Unclassified 2842
1192 Ga0316582_0087611 3300036647 Bacteria 2044
1193 Ga0316582_0117881 3300036647 Bacteria 1774
1194 Ga0316582_0419163 3300036647 Bacteria 922
1195 Ga0316582_0526217 3300036647 Unclassified 815
1196 Ga0316582_0663414 3300036647 Bacteria 717
1197 Ga0316582_0791537 3300036647 Bacteria 650
1198 Ga0316582_1117031 3300036647 Bacteria 537
1199 Ga0316584_0124461 3300036712 Bacteria 1926
1200 Ga0316584_0312843 3300036712 Unclassified 1135
1201 Ga0316584_0364668 3300036712 Bacteria 1035
1202 Ga0316584_0868728 3300036712 Bacteria 609
1203 Ga0373925_0009542 3300037068 Bacteria 7067
1204 Ga0373925_0016284 3300037068 Bacteria 5382
1205 Ga0373925_0031340 3300037068 Bacteria 3906
1206 Ga0373925_0105223 3300037068 Bacteria 2174
1207 Ga0373925_0167391 3300037068 Bacteria 1734
1208 Ga0373925_0187798 3300037068 Bacteria 1639
1209 Ga0373925_0197899 3300037068 Bacteria 1597
1210 Ga0373925_0436539 3300037068 Bacteria 1071
1211 Ga0373925_0703435 3300037068 Bacteria 833
1212 Ga0373925_0849683 3300037068 Bacteria 752
1213 Ga0373925_0920895 3300037068 Bacteria 720
1214 Ga0395900_1929699 3300037418 Bacteria 501
1215 Ga0316581_0042275 3300037588 Bacteria 1391
1216 Ga0436364_0656271 3300037853 Bacteria 878
1217 Ga0436364_1088472 3300037853 Bacteria 1916
1218 Ga0436364_1149820 3300037853 Bacteria 1959
1219 Ga0400484_03429 3300038725 Bacteria 9202
1220 Ga0400484_18778 3300038725 Bacteria 13718
1221 Ga0400490_18584 3300038726 Bacteria 1761
1222 Ga0400490_18978 3300038726 Bacteria 41932
1223 Ga0400490_28208 3300038726 Bacteria 2092
1224 Ga0400491_17104 3300038727 Bacteria 2177
1225 Ga0400485_05635 3300038735 Bacteria 4210
1226 Ga0400485_13399 3300038735 Bacteria 1576
1227 Ga0400485_14867 3300038735 Bacteria 7745
1228 Ga0400488_07617 3300038741 Bacteria 1900
1229 Ga0400488_38202 3300038741 Bacteria 3358
1230 Ga0400488_59906 3300038741 Bacteria 7640
1231 Ga0400488_60637 3300038741 Bacteria 3082
1232 Ga0400486_19544 3300038742 Bacteria 14376
1233 Ga0400486_22210 3300038742 Bacteria 14238
1234 Ga0400486_30281 3300038742 Bacteria 14022
1235 Ga0400483_070291 3300039062 Bacteria 1587
1236 Ga0400483_083434 3300039062 Bacteria 1501
1237 Ga0400483_084767 3300039062 Bacteria 6332
1238 Ga0400483_120099 3300039062 Bacteria 48943
1239 Ga0400483_154386 3300039062 Bacteria 1051
1240 Ga0400483_216594 3300039062 Bacteria 3541
1241 Ga0400483_257333 3300039062 Bacteria 11342
1242 Ga0400483_261234 3300039062 Bacteria 14568
1243 Ga0400489_53490 3300039093 Bacteria 12707
1244 Ga0400489_55784 3300039093 Bacteria 1480
1245 Ga0400489_74110 3300039093 Bacteria 1903
1246 Ga0400489_74550 3300039093 Bacteria 6193
1247 Ga0400487_41192 3300039110 Bacteria 13896
1248 Ga0436365_0931713 3300039437 Bacteria 1342
1249 Ga0436360_0560131 3300039438 Bacteria 797
1250 Ga0436360_1059506 3300039438 Bacteria 723
1251 Ga0436361_0600685 3300039447 Bacteria 763
1252 Ga0436363_0310931 3300039450 Bacteria 818
1253 Ga0436363_1010169 3300039450 Bacteria 2247
1254 Ga0436363_1537811 3300039450 Bacteria 715
1255 Ga0436362_0350632 3300039453 Bacteria 1868
1256 Ga0436362_0757945 3300039453 Bacteria 519
1257 Ga0436362_1011805 3300039453 Bacteria 538
1258 Ga0436362_1230516 3300039453 Bacteria 733
1259 Ga0451795_1024431 3300041456 Bacteria 1394
1260 Ga0451795_1037796 3300041456 Bacteria 871
1261 Ga0451807_2678434 3300041486 Bacteria 1017
1262 Ga0451835_0294879 3300041492 Unclassified 718
1263 Ga0451837_1262203 3300041494 Bacteria 671
1264 Ga0451852_14943 3300041508 Bacteria 842
1265 Ga0451852_32296 3300041508 Bacteria 835
1266 Ga0451855_1247256 3300041511 Bacteria 601
1267 Ga0439441_023690 3300042001 Bacteria 1148
1268 Ga0439441_092726 3300042001 Bacteria 669
1269 Ga0439448_0049076 3300042005 Bacteria 1379
1270 Ga0450914_000417 3300042118 Bacteria 1955
1271 Ga0439444_0139755 3300042437 Bacteria 578
1272 Ga0450893_0064797 3300042532 Bacteria 703
1273 Ga0451577_0003967 3300042876 Bacteria 15959
1274 Ga0451577_0020405 3300042876 Bacteria 6082
1275 Ga0451577_0028183 3300042876 Bacteria 5081
1276 Ga0451577_0028471 3300042876 Bacteria 5053
1277 Ga0451577_0099005 3300042876 Bacteria 2604
1278 Ga0451577_0125417 3300042876 Bacteria 2301
1279 Ga0451577_0173135 3300042876 Bacteria 1945
1280 Ga0451577_0210923 3300042876 Bacteria 1754
1281 Ga0451577_0258096 3300042876 Bacteria 1578
1282 Ga0451577_0933670 3300042876 Bacteria 781
1283 Ga0453683_0000002 3300044673 Bacteria 1244396
1284 Ga0453683_0000075 3300044673 Bacteria 150395
1285 Ga0453683_0002122 3300044673 Bacteria 15802
1286 Ga0453683_0002232 3300044673 Bacteria 15321
1287 Ga0453683_0004112 3300044673 Bacteria 10455
1288 Ga0453683_0004693 3300044673 Bacteria 9642
1289 Ga0453683_0006996 3300044673 Bacteria 7690
1290 Ga0453683_0040252 3300044673 Bacteria 2935
1291 Ga0453683_0138466 3300044673 Bacteria 1535
1292 Ga0453683_0202278 3300044673 Bacteria 1261
1293 Ga0453683_0207795 3300044673 Bacteria 1243
1294 Ga0453683_0228629 3300044673 Bacteria 1184
1295 Ga0453683_0239083 3300044673 Bacteria 1156
1296 Ga0453683_0429302 3300044673 Bacteria 853
1297 Ga0453683_0443324 3300044673 Bacteria 839
1298 Ga0453684_0001225 3300044712 Bacteria 78748
1299 Ga0453684_0005920 3300044712 Bacteria 23717
1300 Ga0453684_0010338 3300044712 Bacteria 15977
1301 Ga0453684_0011463 3300044712 Bacteria 14855
1302 Ga0453684_0012653 3300044712 Bacteria 13869
1303 Ga0453684_0013713 3300044712 Bacteria 13122
1304 Ga0453684_0014912 3300044712 Bacteria 12358
1305 Ga0453684_0025712 3300044712 Bacteria 8536
1306 Ga0453684_0028706 3300044712 Bacteria 7924
1307 Ga0453684_0029890 3300044712 Bacteria 7717
1308 Ga0453684_0035204 3300044712 Bacteria 6926
1309 Ga0453684_0035213 3300044712 Bacteria 6925
1310 Ga0453684_0148240 3300044712 Bacteria 2792
1311 Ga0453684_0221982 3300044712 Bacteria 2188
1312 Ga0453684_0271517 3300044712 Bacteria 1938
1313 Ga0453684_0296692 3300044712 Bacteria 1838
1314 Ga0453684_0392328 3300044712 Bacteria 1556
1315 Ga0453684_0427169 3300044712 Bacteria 1479
1316 Ga0453684_0762724 3300044712 Bacteria 1046
1317 Ga0453684_0769817 3300044712 Bacteria 1040
1318 Ga0453684_2168520 3300044712 Bacteria 556
1319 Ga0466971_0342723 3300044719 Bacteria 722
1320 Ga0466957_0505455 3300044842 Bacteria 838
1321 Ga0466959_0475082 3300045049 Bacteria 846
1322 Ga0451576_0001727 3300045051 Bacteria 35974
1323 Ga0451576_0004781 3300045051 Bacteria 17359
1324 Ga0451576_0005241 3300045051 Bacteria 16364
1325 Ga0451576_0022705 3300045051 Bacteria 6797
1326 Ga0451576_0032803 3300045051 Bacteria 5523
1327 Ga0451576_0036131 3300045051 Bacteria 5239
1328 Ga0451576_0138590 3300045051 Bacteria 2538
1329 Ga0451576_0222858 3300045051 Bacteria 1969
1330 Ga0451576_0255239 3300045051 Bacteria 1832
1331 Ga0451576_0256198 3300045051 Bacteria 1829
1332 Ga0451576_0273269 3300045051 Bacteria 1767
1333 Ga0451576_0309752 3300045051 Bacteria 1652
1334 Ga0451576_0333268 3300045051 Bacteria 1588
1335 Ga0451576_0370125 3300045051 Bacteria 1501
1336 Ga0451576_0396796 3300045051 Bacteria 1446
1337 Ga0451576_0599502 3300045051 Bacteria 1158
1338 Ga0451576_0641954 3300045051 Unclassified 1115
1339 Ga0451576_0678999 3300045051 Bacteria 1082
1340 Ga0451576_0901347 3300045051 Bacteria 928
1341 Ga0451576_1147915 3300045051 Bacteria 812
1342 Ga0451576_1263593 3300045051 Unclassified 770
1343 Ga0451576_1321500 3300045051 Bacteria 751
1344 Ga0451576_1409929 3300045051 Bacteria 725
1345 Ga0451576_1747275 3300045051 Bacteria 644
1346 Ga0451576_2141729 3300045051 Bacteria 575
1347 Ga0466958_0042921 3300045836 Bacteria 2723
1348 Ga0466967_0178061 3300045976 Bacteria 2004
1349 Ga0466967_0606929 3300045976 Bacteria 1080
1350 Ga0466967_1425483 3300045976 Bacteria 690
1351 Ga0495592_0023757 3300046454 Bacteria 4663
1352 Ga0495592_0187843 3300046454 Bacteria 1402
1353 Ga0495603_0217457 3300046455 Bacteria 1103
1354 Ga0495651_0027888 3300046462 Bacteria 4401
1355 Ga0495651_0048591 3300046462 Bacteria 3277
1356 Ga0495653_0475312 3300046463 Bacteria 782
1357 Ga0495580_0012363 3300046472 Bacteria 6549
1358 Ga0495580_0023177 3300046472 Bacteria 4562
1359 Ga0495580_0023989 3300046472 Bacteria 4471
1360 Ga0495580_0029617 3300046472 Bacteria 3972
1361 Ga0495580_0030495 3300046472 Bacteria 3904
1362 Ga0495580_0088205 3300046472 Bacteria 2160
1363 Ga0495580_0127171 3300046472 Bacteria 1769
1364 Ga0495580_0178602 3300046472 Bacteria 1466
1365 Ga0495580_0293569 3300046472 Bacteria 1108
1366 Ga0495580_0317224 3300046472 Bacteria 1059
1367 Ga0495580_0388283 3300046472 Bacteria 942
1368 Ga0495580_0929845 3300046472 Bacteria 557
1369 Ga0495582_0022430 3300046473 Bacteria 3455
1370 Ga0495582_0918982 3300046473 Bacteria 506
1371 Ga0495605_0085624 3300046474 Bacteria 1467
1372 Ga0495639_0230055 3300046475 Bacteria 913
1373 Ga0495662_0043206 3300046476 Bacteria 2175
1374 Ga0495662_0151718 3300046476 Bacteria 1141
1375 Ga0495662_0289647 3300046476 Bacteria 806
1376 Ga0495664_0024694 3300046477 Bacteria 3494
1377 Ga0495664_0453920 3300046477 Bacteria 767
1378 Ga0495584_0110433 3300046491 Bacteria 1391
1379 Ga0495594_0308925 3300046499 Bacteria 901
1380 Ga0495608_0077894 3300046511 Bacteria 2158
1381 Ga0495608_0284462 3300046511 Bacteria 1026
1382 Ga0495618_0169570 3300046514 Bacteria 1389
1383 Ga0495628_0010572 3300046516 Bacteria 7832
1384 Ga0495628_0583777 3300046516 Bacteria 800
1385 Ga0495628_0688411 3300046516 Bacteria 723
1386 Ga0495628_0934713 3300046516 Bacteria 600
1387 Ga0495630_0094544 3300046517 Bacteria 2259
1388 Ga0495630_0610875 3300046517 Bacteria 836
1389 Ga0495666_0264501 3300046526 Bacteria 782
1390 Ga0495642_0183506 3300046528 Bacteria 911
1391 Ga0495652_0096288 3300046529 Bacteria 2411
1392 Ga0495652_0139956 3300046529 Bacteria 1904
1393 Ga0495652_0284319 3300046529 Bacteria 1210
1394 Ga0495652_0394223 3300046529 Bacteria 982
1395 Ga0495652_0529066 3300046529 Bacteria 813
1396 Ga0495652_0532377 3300046529 Bacteria 810
1397 Ga0495654_0152044 3300046530 Bacteria 1023
1398 Ga0495665_0009280 3300046531 Bacteria 5330
1399 Ga0495665_0085461 3300046531 Bacteria 1658
1400 Ga0495665_0107457 3300046531 Bacteria 1464
1401 Ga0495665_0316982 3300046531 Bacteria 797
1402 Ga0495640_0121071 3300046533 Bacteria 1701
1403 Ga0495640_0363549 3300046533 Bacteria 892
1404 Ga0495640_0963270 3300046533 Bacteria 504
1405 Ga0495587_0000336 3300046536 Bacteria 33530
1406 Ga0495587_0034621 3300046536 Bacteria 3045
1407 Ga0495587_0614109 3300046536 Bacteria 598
1408 Ga0495645_0007171 3300046543 Bacteria 7757
1409 Ga0495645_0149505 3300046543 Bacteria 1624
1410 Ga0495645_0188652 3300046543 Bacteria 1407
1411 Ga0495645_0351093 3300046543 Bacteria 950
1412 Ga0495667_0025931 3300046559 Bacteria 3948
1413 Ga0495667_0213520 3300046559 Bacteria 1233
1414 Ga0495667_0649029 3300046559 Bacteria 656
1415 Ga0495634_0068987 3300046642 Bacteria 2334
1416 Ga0495634_0407941 3300046642 Bacteria 806
1417 Ga0495635_0026942 3300046663 Bacteria 3998
1418 Ga0495635_0624136 3300046663 Bacteria 703
1419 Ga0495599_0019509 3300046678 Bacteria 4226
1420 Ga0495599_0033693 3300046678 Bacteria 3219
1421 Ga0495599_0180759 3300046678 Bacteria 1300
1422 Ga0495599_0371939 3300046678 Bacteria 854
1423 Ga0495623_0027406 3300046679 Bacteria 3666
1424 Ga0495623_0086938 3300046679 Bacteria 1926
1425 Ga0495623_0111431 3300046679 Bacteria 1658
1426 Ga0495623_0244224 3300046679 Bacteria 1013
1427 Ga0495646_0080108 3300046680 Bacteria 1905
1428 Ga0495658_0016731 3300046683 Bacteria 3777
1429 Ga0495658_0413110 3300046683 Bacteria 861
1430 Ga0495658_0908389 3300046683 Bacteria 563
1431 Ga0495669_0138369 3300046684 Bacteria 1149
1432 Ga0495613_0585565 3300046689 Bacteria 743
1433 Ga0495624_0337596 3300046690 Bacteria 907
1434 Ga0495649_0461488 3300046694 Bacteria 634
1435 Ga0495600_0013166 3300046809 Bacteria 5190
1436 Ga0495581_0376593 3300047315 Bacteria 828
1437 Ga0495604_0088514 3300047317 Bacteria 2303
1438 Ga0495604_0412952 3300047317 Bacteria 887
1439 Ga0495604_0495478 3300047317 Bacteria 793
1440 Ga0495636_0120637 3300047318 Bacteria 1160
1441 Ga0495674_0008368 3300047319 Bacteria 9858
1442 Ga0495674_0021292 3300047319 Bacteria 5998
1443 Ga0495674_0277501 3300047319 Bacteria 1374
1444 Ga0495674_0593101 3300047319 Bacteria 878
1445 Ga0495674_0753754 3300047319 Bacteria 760
1446 Ga0495674_1027410 3300047319 Bacteria 630
1447 Ga0495680_0009543 3300047322 Bacteria 8719
1448 Ga0495680_0172767 3300047322 Bacteria 1564
1449 Ga0495680_0273497 3300047322 Bacteria 1192
1450 Ga0495675_0270691 3300047444 Bacteria 1015
1451 Ga0495675_0722514 3300047444 Bacteria 556
1452 Ga0495684_0059377 3300047471 Bacteria 2913
1453 Ga0495684_0061272 3300047471 Bacteria 2862
1454 Ga0495684_0193971 3300047471 Bacteria 1500
1455 Ga0495684_0648584 3300047471 Bacteria 706
1456 Ga0495593_0408973 3300047673 Bacteria 679
1457 Ga0495602_0002172 3300048088 Bacteria 19797
1458 Ga0495602_0086900 3300048088 Bacteria 2609
1459 Ga0495602_0376090 3300048088 Bacteria 1019
1460 Ga0495602_0614631 3300048088 Bacteria 746
1461 Ga0495602_0661740 3300048088 Bacteria 712
1462 Ga0495602_1008010 3300048088 Bacteria 549
1463 Ga0496101_1610231 3300048904 Bacteria 504
1464 Ga0496102_0191714 3300048905 Bacteria 1926
1465 Ga0496104_0445908 3300048907 Bacteria 1206
1466 Ga0496104_0626248 3300048907 Bacteria 985
1467 Ga0496104_0668185 3300048907 Bacteria 947
1468 Ga0496104_0971048 3300048907 Bacteria 754
1469 Ga0496104_1349134 3300048907 Bacteria 616
1470 Ga0496106_0301046 3300048909 Bacteria 1286
1471 Ga0496106_0557531 3300048909 Bacteria 919
1472 Ga0496107_0126937 3300048910 Bacteria 1882
1473 Ga0496107_0651161 3300048910 Bacteria 777
1474 Ga0496109_0594315 3300048912 Bacteria 1043
1475 Ga0496110_0103426 3300048913 Bacteria 2555
1476 Ga0496112_0501711 3300048915 Bacteria 1149
1477 Ga0496112_0884512 3300048915 Bacteria 816
1478 Ga0496114_0021928 3300048917 Bacteria 5200
1479 Ga0496115_0134495 3300048918 Bacteria 2039
1480 Ga0496115_0152875 3300048918 Bacteria 1906
1481 Ga0496115_0501758 3300048918 Bacteria 975
1482 Ga0496115_0741324 3300048918 Bacteria 769
1483 Ga0496115_0773764 3300048918 Bacteria 749
1484 Ga0501031_0024798 3300049568 Bacteria 3910
1485 Ga0501032_0032955 3300049569 Bacteria 3550
1486 Ga0501033_0057175 3300049570 Bacteria 2883
1487 Ga0501034_0164665 3300049571 Bacteria 2186
1488 Ga0501036_0000271 3300049572 Bacteria 35394
1489 Ga0501036_0212525 3300049572 Bacteria 1625
1490 Ga0501037_0113122 3300049573 Bacteria 1954
1491 Ga0501038_0041377 3300049574 Bacteria 4018
1492 Ga0501039_0001023 3300049575 Bacteria 20395
1493 Ga0501039_0163818 3300049575 Bacteria 1748
1494 Ga0501039_1014729 3300049575 Bacteria 644
1495 Ga0501040_0081789 3300049576 Bacteria 2238
1496 Ga0501040_0208399 3300049576 Bacteria 1389
1497 Ga0501041_0096339 3300049577 Bacteria 1829
1498 Ga0501042_1096008 3300049578 Bacteria 580
1499 Ga0501043_0045931 3300049579 Bacteria 3434
1500 Ga0501043_0108308 3300049579 Bacteria 2182
1501 Ga0501046_0001715 3300049580 Bacteria 20916
1502 Ga0501046_0220371 3300049580 Bacteria 1405
1503 Ga0501046_0523886 3300049580 Bacteria 847
1504 Ga0501047_0078052 3300049581 Bacteria 3185
1505 Ga0501047_0165397 3300049581 Bacteria 2082
1506 Ga0501048_0002444 3300049582 Bacteria 14178
1507 Ga0501067_0008591 3300049583 Bacteria 5661
1508 Ga0501068_0011651 3300049584 Bacteria 4968
1509 Ga0501069_0033574 3300049585 Bacteria 2826
1510 Ga0501070_0459034 3300049586 Bacteria 1026
1511 Ga0501072_0029641 3300049588 Bacteria 4275
1512 Ga0501072_0508033 3300049588 Bacteria 953
1513 Ga0501073_0022059 3300049589 Bacteria 4588
1514 Ga0501074_0071146 3300049590 Bacteria 2500
1515 Ga0501074_0098746 3300049590 Bacteria 2090
1516 Ga0501075_0042844 3300049591 Bacteria 3394
1517 Ga0501075_0753470 3300049591 Bacteria 741
1518 Ga0501075_0894116 3300049591 Bacteria 675
1519 Ga0501076_0001624 3300049592 Bacteria 15181
1520 Ga0501076_0151568 3300049592 Bacteria 1886
1521 Ga0501076_0338085 3300049592 Bacteria 1235
1522 Ga0501077_0004653 3300049593 Bacteria 8336
1523 Ga0501077_0025080 3300049593 Bacteria 3787
1524 Ga0501077_0058407 3300049593 Bacteria 2449
1525 Ga0501235_047766 3300049669 Bacteria 987
1526 Ga0501250_032609 3300049680 Bacteria 730
1527 Ga0501257_024296 3300049686 Bacteria 1439
1528 Ga0501259_072921 3300049688 Bacteria 740
1529 Ga0501225_0052312 3300049705 Bacteria 1139
1530 Ga0501079_0014191 3300049741 Bacteria 6074
1531 Ga0501079_0017703 3300049741 Bacteria 5443
1532 Ga0501079_1355206 3300049741 Bacteria 560
1533 Ga0501080_0052114 3300049742 Bacteria 3808
1534 Ga0501080_0214540 3300049742 Bacteria 1763
1535 Ga0501080_0921413 3300049742 Bacteria 761
1536 Ga0501081_0000475 3300049743 Bacteria 22308
1537 Ga0501081_0231180 3300049743 Bacteria 1347
1538 Ga0501081_0347406 3300049743 Bacteria 1093
1539 Ga0501083_0054848 3300049744 Bacteria 2673
1540 Ga0501035_0119002 3300049822 Bacteria 2310
1541 Ga0501035_0696454 3300049822 Bacteria 820
1542 Ga0501044_0116744 3300049823 Bacteria 2673
1543 nmdc:mga03n38_17374_c1 3300050490 Bacteria 2816
1544 nmdc:mga03n38_35075_c1 3300050490 Bacteria 2146
1545 nmdc:mga06z11_312743_c1 3300050494 Bacteria 936
1546 nmdc:mga06z11_735806_c1 3300050494 Bacteria 601
1547 nmdc:mga07m45_145970_c1 3300050496 Bacteria 1371
1548 nmdc:mga07m45_539019_c1 3300050496 Bacteria 675
1549 nmdc:mga05p37_125039_c1 3300050507 Bacteria 3158
1550 nmdc:mga05p37_129768_c1 3300050507 Bacteria 3093
1551 nmdc:mga05p37_338782_c2 3300050507 Bacteria 1261
1552 nmdc:mga05p37_39379_c1 3300050507 Bacteria 5803
1553 nmdc:mga05p37_414217_c1 3300050507 Bacteria 1570
1554 nmdc:mga05p37_472763_c1 3300050507 Bacteria 1446
1555 nmdc:mga09592_262536_c1 3300050508 Bacteria 1498
1556 nmdc:mga09592_389439_c1 3300050508 Bacteria 1205
1557 nmdc:mga09592_434945_c1 3300050508 Bacteria 1132
1558 nmdc:mga09592_552004_c1 3300050508 Bacteria 989
1559 nmdc:mga09592_60333_c1 3300050508 Bacteria 3206
1560 nmdc:mga0qj67_29683_c1 3300050509 Bacteria 4248
1561 nmdc:mga0qj67_31569_c1 3300050509 Bacteria 4127
1562 nmdc:mga06r32_240_c1 3300050510 Bacteria 44888
1563 nmdc:mga06r32_464452_c1 3300050510 Bacteria 1245
1564 nmdc:mga06r32_73091_c1 3300050510 Bacteria 3321
1565 nmdc:mga08y16_50222_c1 3300050511 Bacteria 4365
1566 nmdc:mga0n895_20157_c1 3300050512 Bacteria 6212
1567 nmdc:mga0n895_310352_c1 3300050512 Bacteria 1599
1568 nmdc:mga0n895_837255_c1 3300050512 Bacteria 908
1569 nmdc:mga0rr50_132028_c1 3300050513 Bacteria 2001
1570 nmdc:mga0rr50_1353826_c1 3300050513 Bacteria 603
1571 nmdc:mga0rr50_139429_c1 3300050513 Bacteria 1949
1572 nmdc:mga0rr50_215168_c1 3300050513 Bacteria 1585
1573 nmdc:mga0rr50_448736_c1 3300050513 Bacteria 1093
1574 nmdc:mga0rr50_654789_c1 3300050513 Bacteria 896
1575 nmdc:mga0rr50_849630_c1 3300050513 Bacteria 778
1576 nmdc:mga08x19_1791_c1 3300050514 Bacteria 13199
1577 nmdc:mga08x19_231932_c1 3300050514 Bacteria 1271
1578 nmdc:mga0a205_250257_c1 3300050515 Bacteria 1652
1579 nmdc:mga0a205_306760_c1 3300050515 Bacteria 1460
1580 nmdc:mga0a205_628980_c1 3300050515 Bacteria 925
1581 nmdc:mga0a205_665473_c1 3300050515 Bacteria 892
1582 nmdc:mga0a205_739243_c1 3300050515 Bacteria 833
1583 nmdc:mga0a205_8916_c1 3300050515 Bacteria 9141
1584 nmdc:mga0a205_911109_c1 3300050515 Bacteria 726
1585 nmdc:mga0a205_961216_c1 3300050515 Bacteria 701
1586 Ga0495619_0442875 3300053085 Bacteria 896
1587 Ga0500644_0000002 3300053088 Bacteria 374631
1588 Ga0500647_0000012 3300053091 Bacteria 38564
1589 Ga0500583_0496959 3300053092 Bacteria 573
1590 Ga0500651_0002297 3300053093 Bacteria 10033
1591 Ga0500641_0001325 3300053096 Bacteria 8791
1592 Ga0500648_000006 3300053097 Bacteria 75079
1593 Ga0500650_0000070 3300053098 Bacteria 30965
1594 Ga0500642_0003400 3300053130 Bacteria 4809
1595 Ga0500568_0003342 3300053139 Bacteria 9004
1596 Ga0500577_0000003 3300053142 Bacteria 180444
1597 Ga0500588_0024291 3300053146 Bacteria 1671
1598 Ga0500604_0026223 3300053151 Bacteria 1680
1599 Ga0500637_0009880 3300053178 Bacteria 4881
1600 Ga0500649_070870 3300053722 Bacteria 1438
1601 Ga0500645_210790 3300053730 Bacteria 522
1602 Ga0501084_0022618 3300054114 Bacteria 5246
1603 Ga0501084_0088994 3300054114 Bacteria 2591
1604 Ga0501084_0437588 3300054114 Bacteria 1105
1605 Ga0587084_043643 3300059477 Bacteria 771
1606 Ga0587070_083707 3300059491 Bacteria 705
1607 Ga0587073_0060500 3300059492 Bacteria 887
1608 Ga0587083_0038110 3300059505 Bacteria 992
1609 Ga0587085_097648 3300059506 Bacteria 616
1610 Ga0587088_098636 3300059508 Bacteria 650
1611 Ga0587091_059570 3300059511 Bacteria 807
1612 Ga0587092_017348 3300059512 Bacteria 1075
1613 Ga0587092_060759 3300059512 Bacteria 706
1614 Ga0587106_017865 3300059605 Bacteria 1019
1615 Ga0587101_126038 3300059623 Bacteria 534
1616 Ga0587109_078498 3300059624 Bacteria 726
1617 Ga0587109_096569 3300059624 Bacteria 674
1618 Ga0587062_010776 3300059639 Bacteria 1141
1619 Ga0587072_061068 3300059643 Bacteria 776
1620 Ga0587114_021420 3300059655 Bacteria 915
1621 Ga0587111_0123911 3300060346 Bacteria 669
1622 Ga0501082_0000140 3300060353 Bacteria 59882
1623 Ga0501082_0035433 3300060353 Bacteria 4301
1624 Ga0501082_0142200 3300060353 Bacteria 2082
1625 Ga0501082_0253504 3300060353 Bacteria 1531
1626 Ga0530510_0003506 3300061734 Bacteria 10782
1627 Ga0530510_0071270 3300061734 Bacteria 2522
1628 Ga0530510_0219539 3300061734 Bacteria 1413

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036647 Ga0316582_0791537 Ga0316582_0791537_66_491 116
2 3300036647 Ga0316582_0526217 Ga0316582_0526217_310_732 117
3 3300031727 Ga0316576_10438416 Ga0316576_104384162 118
4 3300031727 Ga0316576_10225395 Ga0316576_102253953 119
5 3300031727 Ga0316576_10287570 Ga0316576_102875702 119
6 3300031727 Ga0316576_10485278 Ga0316576_104852782 119
7 3300033529 Ga0316587_1010208 Ga0316587_10102083 119
8 3300035398 Ga0316574_0374240 Ga0316574_0374240_73_498 119
9 3300036647 Ga0316582_0117881 Ga0316582_0117881_20_448 121
10 3300036647 Ga0316582_0419163 Ga0316582_0419163_32_460 121
11 3300050513 nmdc:mga0rr50_849630_c1 nmdc:mga0rr50_849630_c1_213_632 121
12 3300005549 Ga0070704_100442098 Ga0070704_1004420982 122
13 3300006163 Ga0070715_10521029 Ga0070715_105210292 122
14 3300007076 Ga0075435_102069623 Ga0075435_1020696231 122
15 3300032133 Ga0316583_10049103 Ga0316583_100491032 122
16 3300050507 nmdc:mga05p37_414217_c1 nmdc:mga05p37_414217_c1_901_1323 122
17 3300050512 nmdc:mga0n895_20157_c1 nmdc:mga0n895_20157_c1_5625_6047 122
18 3300050513 nmdc:mga0rr50_1353826_c1 nmdc:mga0rr50_1353826_c1_129_551 122
19 3300050513 nmdc:mga0rr50_654789_c1 nmdc:mga0rr50_654789_c1_115_537 122
20 3300050515 nmdc:mga0a205_961216_c1 nmdc:mga0a205_961216_c1_81_503 122
21 3300036647 Ga0316582_0042688 Ga0316582_0042688_179_607 124
22 3300005471 Ga0070698_100278933 Ga0070698_1002789332 127
23 3300005467 Ga0070706_100066634 Ga0070706_10006663411 129
24 3300005468 Ga0070707_100221932 Ga0070707_1002219322 129
25 3300005518 Ga0070699_100588284 Ga0070699_1005882842 129
26 3300025922 Ga0207646_10012863 Ga0207646_1001286315 129
27 3300005471 Ga0070698_100261630 Ga0070698_1002616301 132
28 3300041456 Ga0451795_1024431 Ga0451795_1024431_119_526 132
29 3300005365 Ga0070688_100113294 Ga0070688_1001132944 133
30 3300014968 Ga0157379_11022947 Ga0157379_110229471 134
31 3300033541 Ga0316596_1000058 Ga0316596_10000586 134
32 3300033524 Ga0316592_1069834 Ga0316592_10698342 135
33 3300005364 Ga0070673_101088356 Ga0070673_1010883561 137
34 3300005842 Ga0068858_100069232 Ga0068858_10006923211 137
35 3300006881 Ga0068865_100475982 Ga0068865_1004759822 137
36 3300014969 Ga0157376_10000261 Ga0157376_1000026114 137
37 3300025960 Ga0207651_10971665 Ga0207651_109716652 137
38 3300026035 Ga0207703_10194964 Ga0207703_101949646 137
39 3300033541 Ga0316596_1042813 Ga0316596_10428131 137
40 3300005335 Ga0070666_10206581 Ga0070666_102065812 138
41 3300005543 Ga0070672_100007564 Ga0070672_1000075642 138
42 3300006358 Ga0068871_100786088 Ga0068871_1007860882 138
43 3300006847 Ga0075431_100001342 Ga0075431_10000134216 138
44 3300012497 Ga0157319_1045228 Ga0157319_10452281 138
45 3300013297 Ga0157378_11520754 Ga0157378_115207542 138
46 3300025903 Ga0207680_10193211 Ga0207680_101932112 138
47 3300025905 Ga0207685_10519982 Ga0207685_105199822 138
48 3300025940 Ga0207691_10011682 Ga0207691_100116826 138
49 3300026118 Ga0207675_100075709 Ga0207675_1000757096 138
50 3300031727 Ga0316576_10275615 Ga0316576_102756152 138
51 3300031733 Ga0316577_10193366 Ga0316577_101933662 138
52 3300035171 Ga0373946_0418822 Ga0373946_0418822_59_481 138
53 3300035398 Ga0316574_0027877 Ga0316574_0027877_1200_1622 138
54 3300035398 Ga0316574_0047264 Ga0316574_0047264_1446_1868 138
55 3300035398 Ga0316574_0417157 Ga0316574_0417157_273_695 138
56 3300035398 Ga0316574_0659110 Ga0316574_0659110_193_615 138
57 3300036712 Ga0316584_0124461 Ga0316584_0124461_1009_1431 138
58 3300045051 Ga0451576_2141729 Ga0451576_2141729_18_443 138
59 3300048905 Ga0496102_0191714 Ga0496102_0191714_1356_1778 138
60 3300048910 Ga0496107_0126937 Ga0496107_0126937_347_769 138
61 3300049572 Ga0501036_0212525 Ga0501036_0212525_559_978 138
62 3300049575 Ga0501039_0163818 Ga0501039_0163818_405_824 138
63 3300049575 Ga0501039_1014729 Ga0501039_1014729_197_616 138
64 3300049576 Ga0501040_0081789 Ga0501040_0081789_1124_1543 138
65 3300049576 Ga0501040_0208399 Ga0501040_0208399_665_1084 138
66 3300049577 Ga0501041_0096339 Ga0501041_0096339_201_620 138
67 3300049578 Ga0501042_1096008 Ga0501042_1096008_96_515 138
68 3300049579 Ga0501043_0045931 Ga0501043_0045931_1472_1891 138
69 3300049580 Ga0501046_0220371 Ga0501046_0220371_459_878 138
70 3300049580 Ga0501046_0523886 Ga0501046_0523886_54_473 138
71 3300049590 Ga0501074_0098746 Ga0501074_0098746_48_467 138
72 3300049591 Ga0501075_0042844 Ga0501075_0042844_1102_1521 138
73 3300049591 Ga0501075_0753470 Ga0501075_0753470_266_685 138
74 3300049592 Ga0501076_0001624 Ga0501076_0001624_13629_14048 138
75 3300049592 Ga0501076_0151568 Ga0501076_0151568_1300_1719 138
76 3300049593 Ga0501077_0004653 Ga0501077_0004653_564_983 138
77 3300049593 Ga0501077_0058407 Ga0501077_0058407_1297_1716 138
78 3300049741 Ga0501079_0017703 Ga0501079_0017703_4503_4922 138
79 3300049741 Ga0501079_1355206 Ga0501079_1355206_108_527 138
80 3300049742 Ga0501080_0214540 Ga0501080_0214540_520_939 138
81 3300049742 Ga0501080_0921413 Ga0501080_0921413_87_506 138
82 3300049743 Ga0501081_0000475 Ga0501081_0000475_1113_1532 138
83 3300049743 Ga0501081_0347406 Ga0501081_0347406_475_894 138
84 3300049822 Ga0501035_0696454 Ga0501035_0696454_75_494 138
85 3300050510 nmdc:mga06r32_240_c1 nmdc:mga06r32_240_c1_19319_19738 138
86 3300050515 nmdc:mga0a205_739243_c1 nmdc:mga0a205_739243_c1_187_606 138
87 3300053091 Ga0500647_0000012 Ga0500647_0000012_7771_8196 138
88 3300053097 Ga0500648_000006 Ga0500648_000006_7771_8196 138
89 3300053722 Ga0500649_070870 Ga0500649_070870_214_639 138
90 3300054114 Ga0501084_0022618 Ga0501084_0022618_1572_1991 138
91 3300059505 Ga0587083_0038110 Ga0587083_0038110_468_890 138
92 3300059508 Ga0587088_098636 Ga0587088_098636_146_568 138
93 3300059605 Ga0587106_017865 Ga0587106_017865_148_570 138
94 3300059643 Ga0587072_061068 Ga0587072_061068_270_692 138
95 3300060353 Ga0501082_0035433 Ga0501082_0035433_1675_2094 138
96 3300060353 Ga0501082_0253504 Ga0501082_0253504_382_801 138
97 3300061734 Ga0530510_0003506 Ga0530510_0003506_1064_1483 138
98 3300061734 Ga0530510_0071270 Ga0530510_0071270_1000_1419 138
99 3300001915 JGI24741J21665_1033893 JGI24741J21665_10338932 139
100 3300001990 JGI24737J22298_10075653 JGI24737J22298_100756532 139
101 3300004798 Ga0058859_11478218 Ga0058859_114782182 139
102 3300004798 Ga0058859_11638471 Ga0058859_116384712 139
103 3300004799 Ga0058863_11773336 Ga0058863_117733362 139
104 3300004800 Ga0058861_10173322 Ga0058861_101733222 139
105 3300004801 Ga0058860_10210260 Ga0058860_102102602 139
106 3300004803 Ga0058862_10217184 Ga0058862_102171845 139
107 3300005293 Ga0065715_10103339 Ga0065715_101033395 139
108 3300005328 Ga0070676_10000002 Ga0070676_1000000242 139
109 3300005328 Ga0070676_10016036 Ga0070676_100160366 139
110 3300005328 Ga0070676_10176212 Ga0070676_101762122 139
111 3300005329 Ga0070683_100029815 Ga0070683_1000298155 139
112 3300005331 Ga0070670_100016026 Ga0070670_1000160265 139
113 3300005334 Ga0068869_100013457 Ga0068869_1000134575 139
114 3300005334 Ga0068869_100054244 Ga0068869_1000542446 139
115 3300005334 Ga0068869_100226642 Ga0068869_1002266422 139
116 3300005334 Ga0068869_100981623 Ga0068869_1009816232 139
117 3300005335 Ga0070666_10445556 Ga0070666_104455562 139
118 3300005336 Ga0070680_100065121 Ga0070680_1000651214 139
119 3300005336 Ga0070680_100097517 Ga0070680_1000975175 139
120 3300005336 Ga0070680_100197639 Ga0070680_1001976396 139
121 3300005336 Ga0070680_100611279 Ga0070680_1006112792 139
122 3300005337 Ga0070682_100060709 Ga0070682_1000607091 139
123 3300005338 Ga0068868_100170735 Ga0068868_1001707352 139
124 3300005338 Ga0068868_100205574 Ga0068868_1002055745 139
125 3300005339 Ga0070660_100182693 Ga0070660_1001826936 139
126 3300005340 Ga0070689_100179833 Ga0070689_1001798331 139
127 3300005340 Ga0070689_100289442 Ga0070689_1002894422 139
128 3300005341 Ga0070691_10743465 Ga0070691_107434651 139
129 3300005343 Ga0070687_100626167 Ga0070687_1006261672 139
130 3300005344 Ga0070661_100166885 Ga0070661_1001668856 139
131 3300005345 Ga0070692_10002909 Ga0070692_100029095 139
132 3300005345 Ga0070692_10190709 Ga0070692_101907092 139
133 3300005353 Ga0070669_100917855 Ga0070669_1009178552 139
134 3300005354 Ga0070675_101391407 Ga0070675_1013914072 139
135 3300005355 Ga0070671_100316383 Ga0070671_1003163832 139
136 3300005355 Ga0070671_101876450 Ga0070671_1018764501 139
137 3300005356 Ga0070674_100198590 Ga0070674_1001985903 139
138 3300005365 Ga0070688_100326462 Ga0070688_1003264622 139
139 3300005366 Ga0070659_100171910 Ga0070659_1001719106 139
140 3300005367 Ga0070667_100000132 Ga0070667_10000013210 139
141 3300005367 Ga0070667_100490960 Ga0070667_1004909602 139
142 3300005406 Ga0070703_10013380 Ga0070703_100133802 139
143 3300005406 Ga0070703_10058463 Ga0070703_100584632 139
144 3300005406 Ga0070703_10066326 Ga0070703_100663262 139
145 3300005406 Ga0070703_10316328 Ga0070703_103163281 139
146 3300005438 Ga0070701_10002390 Ga0070701_100023905 139
147 3300005438 Ga0070701_10057462 Ga0070701_100574622 139
148 3300005439 Ga0070711_100462963 Ga0070711_1004629631 139
149 3300005440 Ga0070705_100120288 Ga0070705_1001202882 139
150 3300005440 Ga0070705_100120816 Ga0070705_1001208166 139
151 3300005440 Ga0070705_100238858 Ga0070705_1002388582 139
152 3300005440 Ga0070705_100686332 Ga0070705_1006863322 139
153 3300005441 Ga0070700_100009609 Ga0070700_1000096095 139
154 3300005441 Ga0070700_100087382 Ga0070700_1000873825 139
155 3300005444 Ga0070694_100033358 Ga0070694_1000333584 139
156 3300005444 Ga0070694_100150838 Ga0070694_1001508381 139
157 3300005444 Ga0070694_100155350 Ga0070694_1001553501 139
158 3300005444 Ga0070694_101240026 Ga0070694_1012400261 139
159 3300005445 Ga0070708_100129831 Ga0070708_1001298312 139
160 3300005445 Ga0070708_100784730 Ga0070708_1007847302 139
161 3300005445 Ga0070708_101006534 Ga0070708_1010065341 139
162 3300005445 Ga0070708_101805362 Ga0070708_1018053621 139
163 3300005455 Ga0070663_100145118 Ga0070663_1001451186 139
164 3300005457 Ga0070662_100160240 Ga0070662_1001602405 139
165 3300005457 Ga0070662_100499792 Ga0070662_1004997922 139
166 3300005458 Ga0070681_10213766 Ga0070681_102137661 139
167 3300005459 Ga0068867_100127890 Ga0068867_1001278902 139
168 3300005459 Ga0068867_100150919 Ga0068867_1001509194 139
169 3300005459 Ga0068867_100177486 Ga0068867_1001774866 139
170 3300005459 Ga0068867_100309143 Ga0068867_1003091431 139
171 3300005459 Ga0068867_100463174 Ga0068867_1004631742 139
172 3300005466 Ga0070685_10011503 Ga0070685_100115039 139
173 3300005467 Ga0070706_100329158 Ga0070706_1003291583 139
174 3300005467 Ga0070706_100493363 Ga0070706_1004933632 139
175 3300005467 Ga0070706_100947528 Ga0070706_1009475281 139
176 3300005468 Ga0070707_100680983 Ga0070707_1006809832 139
177 3300005471 Ga0070698_100510295 Ga0070698_1005102951 139
178 3300005518 Ga0070699_100028934 Ga0070699_1000289345 139
179 3300005518 Ga0070699_100061001 Ga0070699_1000610014 139
180 3300005518 Ga0070699_100182515 Ga0070699_1001825152 139
181 3300005530 Ga0070679_100292090 Ga0070679_1002920901 139
182 3300005530 Ga0070679_100704166 Ga0070679_1007041662 139
183 3300005530 Ga0070679_101293611 Ga0070679_1012936111 139
184 3300005535 Ga0070684_100210188 Ga0070684_1002101881 139
185 3300005536 Ga0070697_100072171 Ga0070697_1000721715 139
186 3300005536 Ga0070697_100420954 Ga0070697_1004209542 139
187 3300005536 Ga0070697_100879252 Ga0070697_1008792521 139
188 3300005536 Ga0070697_101642471 Ga0070697_1016424711 139
189 3300005539 Ga0068853_100235159 Ga0068853_1002351595 139
190 3300005539 Ga0068853_100687497 Ga0068853_1006874971 139
191 3300005539 Ga0068853_100935963 Ga0068853_1009359631 139
192 3300005544 Ga0070686_100072179 Ga0070686_1000721792 139
193 3300005544 Ga0070686_100117212 Ga0070686_1001172123 139
194 3300005544 Ga0070686_100798114 Ga0070686_1007981141 139
195 3300005545 Ga0070695_100034336 Ga0070695_1000343364 139
196 3300005545 Ga0070695_100035895 Ga0070695_1000358952 139
197 3300005545 Ga0070695_100092851 Ga0070695_1000928512 139
198 3300005545 Ga0070695_100116111 Ga0070695_1001161116 139
199 3300005545 Ga0070695_100154106 Ga0070695_1001541065 139
200 3300005546 Ga0070696_100060883 Ga0070696_1000608833 139
201 3300005546 Ga0070696_100130611 Ga0070696_1001306116 139
202 3300005546 Ga0070696_100140894 Ga0070696_1001408942 139
203 3300005546 Ga0070696_100183437 Ga0070696_1001834371 139
204 3300005546 Ga0070696_100192349 Ga0070696_1001923491 139
205 3300005546 Ga0070696_100215586 Ga0070696_1002155862 139
206 3300005547 Ga0070693_100109376 Ga0070693_1001093761 139
207 3300005547 Ga0070693_100308782 Ga0070693_1003087822 139
208 3300005548 Ga0070665_100000956 Ga0070665_10000095620 139
209 3300005548 Ga0070665_100683593 Ga0070665_1006835932 139
210 3300005549 Ga0070704_100016254 Ga0070704_1000162545 139
211 3300005549 Ga0070704_100163554 Ga0070704_1001635546 139
212 3300005549 Ga0070704_100181372 Ga0070704_1001813726 139
213 3300005549 Ga0070704_100380742 Ga0070704_1003807421 139
214 3300005549 Ga0070704_100429662 Ga0070704_1004296622 139
215 3300005563 Ga0068855_100325622 Ga0068855_1003256221 139
216 3300005564 Ga0070664_101820334 Ga0070664_1018203341 139
217 3300005577 Ga0068857_100243648 Ga0068857_1002436481 139
218 3300005577 Ga0068857_100263859 Ga0068857_1002638591 139
219 3300005578 Ga0068854_100179166 Ga0068854_1001791661 139
220 3300005578 Ga0068854_100575038 Ga0068854_1005750382 139
221 3300005614 Ga0068856_100275982 Ga0068856_1002759821 139
222 3300005617 Ga0068859_100301917 Ga0068859_1003019171 139
223 3300005617 Ga0068859_100351175 Ga0068859_1003511754 139
224 3300005617 Ga0068859_100493007 Ga0068859_1004930073 139
225 3300005617 Ga0068859_100587214 Ga0068859_1005872141 139
226 3300005617 Ga0068859_100759850 Ga0068859_1007598502 139
227 3300005617 Ga0068859_101679303 Ga0068859_1016793032 139
228 3300005617 Ga0068859_101793134 Ga0068859_1017931342 139
229 3300005618 Ga0068864_100209746 Ga0068864_1002097466 139
230 3300005718 Ga0068866_10317409 Ga0068866_103174092 139
231 3300005719 Ga0068861_100082107 Ga0068861_1000821072 139
232 3300005719 Ga0068861_102441214 Ga0068861_1024412141 139
233 3300005834 Ga0068851_10732196 Ga0068851_107321961 139
234 3300005840 Ga0068870_10000560 Ga0068870_100005606 139
235 3300005840 Ga0068870_10865311 Ga0068870_108653111 139
236 3300005841 Ga0068863_100177935 Ga0068863_1001779355 139
237 3300005841 Ga0068863_100223089 Ga0068863_1002230891 139
238 3300005842 Ga0068858_100236799 Ga0068858_1002367995 139
239 3300005842 Ga0068858_100254153 Ga0068858_1002541536 139
240 3300005842 Ga0068858_100314260 Ga0068858_1003142603 139
241 3300005842 Ga0068858_100495302 Ga0068858_1004953021 139
242 3300005843 Ga0068860_100001432 Ga0068860_1000014325 139
243 3300005843 Ga0068860_100158941 Ga0068860_1001589416 139
244 3300005843 Ga0068860_100274079 Ga0068860_1002740796 139
245 3300005843 Ga0068860_100574900 Ga0068860_1005749002 139
246 3300005844 Ga0068862_100030715 Ga0068862_1000307155 139
247 3300005844 Ga0068862_100196706 Ga0068862_1001967061 139
248 3300005844 Ga0068862_100285027 Ga0068862_1002850272 139
249 3300005844 Ga0068862_102590031 Ga0068862_1025900311 139
250 3300005937 Ga0081455_10005833 Ga0081455_100058338 139
251 3300005985 Ga0081539_10001872 Ga0081539_1000187222 139
252 3300006051 Ga0075364_10491385 Ga0075364_104913852 139
253 3300006163 Ga0070715_10975008 Ga0070715_109750081 139
254 3300006175 Ga0070712_100042578 Ga0070712_1000425782 139
255 3300006178 Ga0075367_10358711 Ga0075367_103587112 139
256 3300006237 Ga0097621_100283779 Ga0097621_1002837792 139
257 3300006237 Ga0097621_100446323 Ga0097621_1004463232 139
258 3300006353 Ga0075370_10585878 Ga0075370_105858782 139
259 3300006358 Ga0068871_100252988 Ga0068871_1002529881 139
260 3300006844 Ga0075428_100013647 Ga0075428_1000136475 139
261 3300006844 Ga0075428_101266367 Ga0075428_1012663672 139
262 3300006846 Ga0075430_100056313 Ga0075430_1000563133 139
263 3300006852 Ga0075433_10024737 Ga0075433_100247376 139
264 3300006852 Ga0075433_10062480 Ga0075433_100624803 139
265 3300006852 Ga0075433_10358116 Ga0075433_103581162 139
266 3300006852 Ga0075433_10529950 Ga0075433_105299502 139
267 3300006852 Ga0075433_10706073 Ga0075433_107060732 139
268 3300006871 Ga0075434_100374162 Ga0075434_1003741623 139
269 3300006880 Ga0075429_100268861 Ga0075429_1002688613 139
270 3300006914 Ga0075436_100176998 Ga0075436_1001769984 139
271 3300006914 Ga0075436_100431729 Ga0075436_1004317292 139
272 3300006931 Ga0097620_100301950 Ga0097620_1003019501 139
273 3300006931 Ga0097620_100351171 Ga0097620_1003511712 139
274 3300006931 Ga0097620_100587214 Ga0097620_1005872141 139
275 3300006931 Ga0097620_100759894 Ga0097620_1007598942 139
276 3300006931 Ga0097620_101679307 Ga0097620_1016793072 139
277 3300006931 Ga0097620_101793153 Ga0097620_1017931532 139
278 3300007265 Ga0099794_10019102 Ga0099794_100191025 139
279 3300007265 Ga0099794_10241234 Ga0099794_102412342 139
280 3300007265 Ga0099794_10362524 Ga0099794_103625241 139
281 3300009093 Ga0105240_10001306 Ga0105240_1000130612 139
282 3300009093 Ga0105240_10012424 Ga0105240_100124248 139
283 3300009094 Ga0111539_10023315 Ga0111539_100233155 139
284 3300009094 Ga0111539_10179787 Ga0111539_101797872 139
285 3300009098 Ga0105245_10148838 Ga0105245_101488382 139
286 3300009098 Ga0105245_10149293 Ga0105245_101492935 139
287 3300009098 Ga0105245_10312503 Ga0105245_103125032 139
288 3300009101 Ga0105247_10048453 Ga0105247_100484536 139
289 3300009101 Ga0105247_10437679 Ga0105247_104376792 139
290 3300009101 Ga0105247_11276221 Ga0105247_112762211 139
291 3300009147 Ga0114129_10038278 Ga0114129_100382785 139
292 3300009147 Ga0114129_10231657 Ga0114129_102316572 139
293 3300009147 Ga0114129_10284318 Ga0114129_102843184 139
294 3300009147 Ga0114129_10586595 Ga0114129_105865951 139
295 3300009147 Ga0114129_10730698 Ga0114129_107306982 139
296 3300009148 Ga0105243_10077324 Ga0105243_100773243 139
297 3300009148 Ga0105243_10592635 Ga0105243_105926352 139
298 3300009148 Ga0105243_11508488 Ga0105243_115084882 139
299 3300009148 Ga0105243_11607711 Ga0105243_116077112 139
300 3300009174 Ga0105241_10215640 Ga0105241_102156401 139
301 3300009176 Ga0105242_10007188 Ga0105242_100071886 139
302 3300009176 Ga0105242_10029508 Ga0105242_100295082 139
303 3300009176 Ga0105242_10045247 Ga0105242_100452475 139
304 3300009553 Ga0105249_10024654 Ga0105249_100246545 139
305 3300009553 Ga0105249_10077940 Ga0105249_100779406 139
306 3300011119 Ga0105246_10194956 Ga0105246_101949561 139
307 3300013100 Ga0157373_10005841 Ga0157373_100058416 139
308 3300013100 Ga0157373_11014028 Ga0157373_110140282 139
309 3300013105 Ga0157369_10290053 Ga0157369_102900531 139
310 3300013296 Ga0157374_10446725 Ga0157374_104467253 139
311 3300013296 Ga0157374_10977597 Ga0157374_109775971 139
312 3300013297 Ga0157378_10024793 Ga0157378_100247935 139
313 3300013297 Ga0157378_10173155 Ga0157378_101731552 139
314 3300013297 Ga0157378_12033050 Ga0157378_120330501 139
315 3300013306 Ga0163162_10199046 Ga0163162_101990466 139
316 3300013306 Ga0163162_11629940 Ga0163162_116299401 139
317 3300013307 Ga0157372_10366455 Ga0157372_103664551 139
318 3300013308 Ga0157375_10126067 Ga0157375_101260676 139
319 3300014325 Ga0163163_10265123 Ga0163163_102651237 139
320 3300014325 Ga0163163_10978368 Ga0163163_109783682 139
321 3300014326 Ga0157380_10267691 Ga0157380_102676912 139
322 3300014745 Ga0157377_10400044 Ga0157377_104000442 139
323 3300014968 Ga0157379_10006057 Ga0157379_100060575 139
324 3300014969 Ga0157376_11958019 Ga0157376_119580192 139
325 3300015262 Ga0182007_10079041 Ga0182007_100790411 139
326 3300020070 Ga0206356_11182845 Ga0206356_111828456 139
327 3300020077 Ga0206351_10681821 Ga0206351_106818211 139
328 3300020082 Ga0206353_11732501 Ga0206353_117325012 139
329 3300022467 Ga0224712_10000548 Ga0224712_100005486 139
330 3300025321 Ga0207656_10470961 Ga0207656_104709612 139
331 3300025885 Ga0207653_10010608 Ga0207653_100106084 139
332 3300025885 Ga0207653_10019306 Ga0207653_100193064 139
333 3300025885 Ga0207653_10233351 Ga0207653_102333511 139
334 3300025900 Ga0207710_10050839 Ga0207710_100508394 139
335 3300025900 Ga0207710_10307720 Ga0207710_103077202 139
336 3300025901 Ga0207688_10106342 Ga0207688_101063421 139
337 3300025903 Ga0207680_10799496 Ga0207680_107994962 139
338 3300025904 Ga0207647_10043016 Ga0207647_100430167 139
339 3300025904 Ga0207647_10384978 Ga0207647_103849781 139
340 3300025907 Ga0207645_10000001 Ga0207645_1000000129 139
341 3300025907 Ga0207645_10127376 Ga0207645_101273761 139
342 3300025907 Ga0207645_10741378 Ga0207645_107413782 139
343 3300025908 Ga0207643_10001234 Ga0207643_100012346 139
344 3300025910 Ga0207684_10017024 Ga0207684_100170245 139
345 3300025910 Ga0207684_10088612 Ga0207684_100886123 139
346 3300025910 Ga0207684_10135015 Ga0207684_101350156 139
347 3300025911 Ga0207654_10002666 Ga0207654_100026666 139
348 3300025912 Ga0207707_10202549 Ga0207707_102025491 139
349 3300025913 Ga0207695_10001948 Ga0207695_1000194827 139
350 3300025913 Ga0207695_10009692 Ga0207695_100096928 139
351 3300025914 Ga0207671_10263012 Ga0207671_102630122 139
352 3300025914 Ga0207671_10496509 Ga0207671_104965092 139
353 3300025915 Ga0207693_10088443 Ga0207693_100884434 139
354 3300025916 Ga0207663_10603209 Ga0207663_106032092 139
355 3300025917 Ga0207660_10042286 Ga0207660_100422862 139
356 3300025917 Ga0207660_10192938 Ga0207660_101929386 139
357 3300025918 Ga0207662_10629033 Ga0207662_106290332 139
358 3300025919 Ga0207657_10190582 Ga0207657_101905826 139
359 3300025920 Ga0207649_10137200 Ga0207649_101372006 139
360 3300025921 Ga0207652_10002950 Ga0207652_100029506 139
361 3300025922 Ga0207646_10133227 Ga0207646_101332276 139
362 3300025922 Ga0207646_10432754 Ga0207646_104327542 139
363 3300025923 Ga0207681_10246401 Ga0207681_102464012 139
364 3300025923 Ga0207681_10858191 Ga0207681_108581911 139
365 3300025925 Ga0207650_10208613 Ga0207650_102086136 139
366 3300025926 Ga0207659_10083343 Ga0207659_100833434 139
367 3300025927 Ga0207687_10096250 Ga0207687_100962503 139
368 3300025927 Ga0207687_10177359 Ga0207687_101773595 139
369 3300025931 Ga0207644_10174854 Ga0207644_101748543 139
370 3300025931 Ga0207644_11131740 Ga0207644_111317401 139
371 3300025932 Ga0207690_10183495 Ga0207690_101834951 139
372 3300025933 Ga0207706_10070832 Ga0207706_100708328 139
373 3300025934 Ga0207686_10005039 Ga0207686_100050395 139
374 3300025934 Ga0207686_10019111 Ga0207686_100191112 139
375 3300025935 Ga0207709_10115699 Ga0207709_101156992 139
376 3300025935 Ga0207709_10728149 Ga0207709_107281492 139
377 3300025936 Ga0207670_10151143 Ga0207670_101511436 139
378 3300025936 Ga0207670_10342167 Ga0207670_103421672 139
379 3300025937 Ga0207669_10168175 Ga0207669_101681752 139
380 3300025938 Ga0207704_10506339 Ga0207704_105063392 139
381 3300025939 Ga0207665_10096123 Ga0207665_100961236 139
382 3300025940 Ga0207691_10287124 Ga0207691_102871242 139
383 3300025941 Ga0207711_10314266 Ga0207711_103142661 139
384 3300025941 Ga0207711_10426824 Ga0207711_104268243 139
385 3300025942 Ga0207689_10129346 Ga0207689_101293462 139
386 3300025942 Ga0207689_10186020 Ga0207689_101860201 139
387 3300025942 Ga0207689_10438903 Ga0207689_104389032 139
388 3300025944 Ga0207661_10214715 Ga0207661_102147151 139
389 3300025945 Ga0207679_10170041 Ga0207679_101700416 139
390 3300025949 Ga0207667_10244652 Ga0207667_102446521 139
391 3300025960 Ga0207651_11598486 Ga0207651_115984861 139
392 3300025961 Ga0207712_10004825 Ga0207712_1000482512 139
393 3300025961 Ga0207712_10092233 Ga0207712_100922333 139
394 3300025961 Ga0207712_10286248 Ga0207712_102862482 139
395 3300025961 Ga0207712_10552613 Ga0207712_105526131 139
396 3300025981 Ga0207640_10161981 Ga0207640_101619811 139
397 3300025981 Ga0207640_10843076 Ga0207640_108430762 139
398 3300025986 Ga0207658_10000049 Ga0207658_10000049110 139
399 3300026023 Ga0207677_10203666 Ga0207677_102036661 139
400 3300026023 Ga0207677_10246308 Ga0207677_102463083 139
401 3300026035 Ga0207703_10317015 Ga0207703_103170155 139
402 3300026035 Ga0207703_10727470 Ga0207703_107274701 139
403 3300026041 Ga0207639_10242622 Ga0207639_102426226 139
404 3300026041 Ga0207639_10553773 Ga0207639_105537732 139
405 3300026041 Ga0207639_10926269 Ga0207639_109262691 139
406 3300026067 Ga0207678_11218354 Ga0207678_112183542 139
407 3300026075 Ga0207708_10060638 Ga0207708_100606386 139
408 3300026075 Ga0207708_10127103 Ga0207708_101271032 139
409 3300026078 Ga0207702_10238935 Ga0207702_102389356 139
410 3300026089 Ga0207648_10197096 Ga0207648_101970962 139
411 3300026089 Ga0207648_10228338 Ga0207648_102283381 139
412 3300026089 Ga0207648_10453931 Ga0207648_104539312 139
413 3300026095 Ga0207676_10078610 Ga0207676_100786101 139
414 3300026095 Ga0207676_10642670 Ga0207676_106426702 139
415 3300026116 Ga0207674_10052247 Ga0207674_100522476 139
416 3300026116 Ga0207674_10267945 Ga0207674_102679451 139
417 3300026116 Ga0207674_11275789 Ga0207674_112757892 139
418 3300026118 Ga0207675_100275734 Ga0207675_1002757346 139
419 3300026121 Ga0207683_10279816 Ga0207683_102798162 139
420 3300026142 Ga0207698_11810344 Ga0207698_118103442 139
421 3300027665 Ga0209983_1129971 Ga0209983_11299712 139
422 3300027671 Ga0209588_1036300 Ga0209588_10363006 139
423 3300027907 Ga0207428_10031589 Ga0207428_100315892 139
424 3300028379 Ga0268266_10002958 Ga0268266_1000295810 139
425 3300028379 Ga0268266_10166783 Ga0268266_101667835 139
426 3300028380 Ga0268265_10020775 Ga0268265_100207756 139
427 3300028380 Ga0268265_10271219 Ga0268265_102712191 139
428 3300028380 Ga0268265_10490284 Ga0268265_104902842 139
429 3300028380 Ga0268265_10582846 Ga0268265_105828462 139
430 3300028381 Ga0268264_10001547 Ga0268264_1000154724 139
431 3300028381 Ga0268264_10313321 Ga0268264_103133211 139
432 3300028381 Ga0268264_10369093 Ga0268264_103690934 139
433 3300028381 Ga0268264_10669879 Ga0268264_106698792 139
434 3300028381 Ga0268264_12482945 Ga0268264_124829451 139
435 3300028573 Ga0265334_10094599 Ga0265334_100945991 139
436 3300031238 Ga0265332_10310353 Ga0265332_103103531 139
437 3300031665 Ga0316575_10060722 Ga0316575_100607223 139
438 3300031711 Ga0265314_10066132 Ga0265314_100661322 139
439 3300031711 Ga0265314_10255370 Ga0265314_102553702 139
440 3300031727 Ga0316576_10060959 Ga0316576_100609592 139
441 3300031733 Ga0316577_10024609 Ga0316577_100246092 139
442 3300031733 Ga0316577_10058177 Ga0316577_100581771 139
443 3300031824 Ga0307413_10133435 Ga0307413_101334352 139
444 3300031852 Ga0307410_10000336 Ga0307410_1000033618 139
445 3300032005 Ga0307411_10002603 Ga0307411_100026035 139
446 3300032168 Ga0316593_10000031 Ga0316593_100000315 139
447 3300032168 Ga0316593_10000158 Ga0316593_100001586 139
448 3300032168 Ga0316593_10000278 Ga0316593_100002786 139
449 3300032168 Ga0316593_10000848 Ga0316593_100008485 139
450 3300032168 Ga0316593_10001195 Ga0316593_100011956 139
451 3300032168 Ga0316593_10002697 Ga0316593_100026972 139
452 3300032168 Ga0316593_10010835 Ga0316593_100108352 139
453 3300032168 Ga0316593_10011946 Ga0316593_100119463 139
454 3300032168 Ga0316593_10018705 Ga0316593_100187053 139
455 3300032168 Ga0316593_10041649 Ga0316593_100416493 139
456 3300032168 Ga0316593_10043616 Ga0316593_100436162 139
457 3300032168 Ga0316593_10055552 Ga0316593_100555522 139
458 3300032168 Ga0316593_10151760 Ga0316593_101517602 139
459 3300032168 Ga0316593_10298255 Ga0316593_102982552 139
460 3300033524 Ga0316592_1000536 Ga0316592_10005365 139
461 3300033524 Ga0316592_1002993 Ga0316592_10029932 139
462 3300033524 Ga0316592_1010913 Ga0316592_10109133 139
463 3300033524 Ga0316592_1033351 Ga0316592_10333512 139
464 3300033524 Ga0316592_1141118 Ga0316592_11411181 139
465 3300033528 Ga0316588_1015198 Ga0316588_10151982 139
466 3300033528 Ga0316588_1080796 Ga0316588_10807961 139
467 3300033528 Ga0316588_1089361 Ga0316588_10893611 139
468 3300033541 Ga0316596_1000988 Ga0316596_10009885 139
469 3300033541 Ga0316596_1001007 Ga0316596_10010076 139
470 3300033541 Ga0316596_1001016 Ga0316596_10010164 139
471 3300033541 Ga0316596_1001482 Ga0316596_10014825 139
472 3300033541 Ga0316596_1009369 Ga0316596_10093692 139
473 3300033541 Ga0316596_1014849 Ga0316596_10148492 139
474 3300033541 Ga0316596_1019395 Ga0316596_10193952 139
475 3300033541 Ga0316596_1023719 Ga0316596_10237194 139
476 3300033541 Ga0316596_1040060 Ga0316596_10400602 139
477 3300033541 Ga0316596_1043728 Ga0316596_10437282 139
478 3300033541 Ga0316596_1056788 Ga0316596_10567881 139
479 3300033541 Ga0316596_1063628 Ga0316596_10636282 139
480 3300033541 Ga0316596_1162060 Ga0316596_11620601 139
481 3300033541 Ga0316596_1178262 Ga0316596_11782622 139
482 3300034816 Ga0373930_0011058 Ga0373930_0011058_800_1222 139
483 3300034820 Ga0373959_0021787 Ga0373959_0021787_30_452 139
484 3300035085 Ga0373929_0077800 Ga0373929_0077800_50_472 139
485 3300035088 Ga0373940_0202122 Ga0373940_0202122_180_602 139
486 3300035091 Ga0373951_0005949 Ga0373951_0005949_2205_2627 139
487 3300035114 Ga0373939_0428529 Ga0373939_0428529_42_464 139
488 3300035121 Ga0373960_0003527 Ga0373960_0003527_707_1129 139
489 3300035207 Ga0373942_0070132 Ga0373942_0070132_122_544 139
490 3300035398 Ga0316574_0751348 Ga0316574_0751348_10_432 139
491 3300036647 Ga0316582_0087611 Ga0316582_0087611_984_1409 139
492 3300036647 Ga0316582_0663414 Ga0316582_0663414_184_606 139
493 3300036647 Ga0316582_1117031 Ga0316582_1117031_59_481 139
494 3300036712 Ga0316584_0312843 Ga0316584_0312843_106_528 139
495 3300036712 Ga0316584_0364668 Ga0316584_0364668_126_548 139
496 3300036712 Ga0316584_0868728 Ga0316584_0868728_50_472 139
497 3300037588 Ga0316581_0042275 Ga0316581_0042275_181_603 139
498 3300038725 Ga0400484_03429 Ga0400484_03429_2242_2664 139
499 3300038725 Ga0400484_18778 Ga0400484_18778_12188_12610 139
500 3300038726 Ga0400490_18584 Ga0400490_18584_402_824 139
501 3300038726 Ga0400490_18978 Ga0400490_18978_1446_1868 139
502 3300038726 Ga0400490_28208 Ga0400490_28208_530_952 139
503 3300038727 Ga0400491_17104 Ga0400491_17104_265_687 139
504 3300038735 Ga0400485_05635 Ga0400485_05635_1443_1865 139
505 3300038735 Ga0400485_13399 Ga0400485_13399_595_1017 139
506 3300038735 Ga0400485_14867 Ga0400485_14867_6247_6669 139
507 3300038741 Ga0400488_07617 Ga0400488_07617_408_830 139
508 3300038741 Ga0400488_38202 Ga0400488_38202_2378_2800 139
509 3300038741 Ga0400488_59906 Ga0400488_59906_1009_1431 139
510 3300038741 Ga0400488_60637 Ga0400488_60637_548_970 139
511 3300038742 Ga0400486_19544 Ga0400486_19544_1446_1868 139
512 3300038742 Ga0400486_22210 Ga0400486_22210_974_1396 139
513 3300038742 Ga0400486_30281 Ga0400486_30281_1497_1919 139
514 3300039062 Ga0400483_070291 Ga0400483_070291_1042_1464 139
515 3300039062 Ga0400483_083434 Ga0400483_083434_287_709 139
516 3300039062 Ga0400483_084767 Ga0400483_084767_1489_1911 139
517 3300039062 Ga0400483_120099 Ga0400483_120099_46800_47222 139
518 3300039062 Ga0400483_154386 Ga0400483_154386_166_588 139
519 3300039062 Ga0400483_216594 Ga0400483_216594_872_1294 139
520 3300039062 Ga0400483_257333 Ga0400483_257333_9563_9985 139
521 3300039062 Ga0400483_261234 Ga0400483_261234_1289_1711 139
522 3300039093 Ga0400489_53490 Ga0400489_53490_10817_11239 139
523 3300039093 Ga0400489_55784 Ga0400489_55784_802_1227 139
524 3300039093 Ga0400489_74110 Ga0400489_74110_1174_1596 139
525 3300039093 Ga0400489_74550 Ga0400489_74550_4139_4561 139
526 3300039110 Ga0400487_41192 Ga0400487_41192_12365_12787 139
527 3300041456 Ga0451795_1037796 Ga0451795_1037796_170_673 139
528 3300041492 Ga0451835_0294879 Ga0451835_0294879_206_628 139
529 3300041494 Ga0451837_1262203 Ga0451837_1262203_103_528 139
530 3300041508 Ga0451852_14943 Ga0451852_14943_172_597 139
531 3300041508 Ga0451852_32296 Ga0451852_32296_96_527 139
532 3300042001 Ga0439441_023690 Ga0439441_023690_572_994 139
533 3300042001 Ga0439441_092726 Ga0439441_092726_66_491 139
534 3300042005 Ga0439448_0049076 Ga0439448_0049076_884_1306 139
535 3300042118 Ga0450914_000417 Ga0450914_000417_1014_1436 139
536 3300042437 Ga0439444_0139755 Ga0439444_0139755_143_568 139
537 3300042532 Ga0450893_0064797 Ga0450893_0064797_189_611 139
538 3300042876 Ga0451577_0020405 Ga0451577_0020405_3293_3718 139
539 3300042876 Ga0451577_0258096 Ga0451577_0258096_301_723 139
540 3300044673 Ga0453683_0040252 Ga0453683_0040252_1412_1834 139
541 3300044712 Ga0453684_0005920 Ga0453684_0005920_8370_8801 139
542 3300044712 Ga0453684_0012653 Ga0453684_0012653_11438_11860 139
543 3300044712 Ga0453684_0025712 Ga0453684_0025712_7320_7745 139
544 3300044712 Ga0453684_0148240 Ga0453684_0148240_1350_1772 139
545 3300045051 Ga0451576_0022705 Ga0451576_0022705_6015_6437 139
546 3300045051 Ga0451576_0255239 Ga0451576_0255239_1124_1546 139
547 3300046472 Ga0495580_0317224 Ga0495580_0317224_323_745 139
548 3300046474 Ga0495605_0085624 Ga0495605_0085624_388_813 139
549 3300046491 Ga0495584_0110433 Ga0495584_0110433_882_1304 139
550 3300048907 Ga0496104_0626248 Ga0496104_0626248_127_552 139
551 3300048909 Ga0496106_0557531 Ga0496106_0557531_285_710 139
552 3300048910 Ga0496107_0651161 Ga0496107_0651161_326_748 139
553 3300048913 Ga0496110_0103426 Ga0496110_0103426_1273_1698 139
554 3300048915 Ga0496112_0884512 Ga0496112_0884512_47_469 139
555 3300048917 Ga0496114_0021928 Ga0496114_0021928_4550_4975 139
556 3300049588 Ga0501072_0508033 Ga0501072_0508033_51_473 139
557 3300049591 Ga0501075_0894116 Ga0501075_0894116_22_447 139
558 3300049686 Ga0501257_024296 Ga0501257_024296_238_663 139
559 3300049743 Ga0501081_0231180 Ga0501081_0231180_487_912 139
560 3300050490 nmdc:mga03n38_17374_c1 nmdc:mga03n38_17374_c1_506_931 139
561 3300050490 nmdc:mga03n38_35075_c1 nmdc:mga03n38_35075_c1_1405_1830 139
562 3300050494 nmdc:mga06z11_312743_c1 nmdc:mga06z11_312743_c1_363_788 139
563 3300050494 nmdc:mga06z11_735806_c1 nmdc:mga06z11_735806_c1_148_573 139
564 3300050496 nmdc:mga07m45_145970_c1 nmdc:mga07m45_145970_c1_370_795 139
565 3300050496 nmdc:mga07m45_539019_c1 nmdc:mga07m45_539019_c1_126_551 139
566 3300050507 nmdc:mga05p37_125039_c1 nmdc:mga05p37_125039_c1_2107_2532 139
567 3300050507 nmdc:mga05p37_129768_c1 nmdc:mga05p37_129768_c1_1450_1872 139
568 3300050507 nmdc:mga05p37_338782_c2 nmdc:mga05p37_338782_c2_292_717 139
569 3300050507 nmdc:mga05p37_39379_c1 nmdc:mga05p37_39379_c1_1085_1507 139
570 3300050507 nmdc:mga05p37_472763_c1 nmdc:mga05p37_472763_c1_949_1371 139
571 3300050508 nmdc:mga09592_389439_c1 nmdc:mga09592_389439_c1_16_441 139
572 3300050508 nmdc:mga09592_60333_c1 nmdc:mga09592_60333_c1_1387_1812 139
573 3300050509 nmdc:mga0qj67_31569_c1 nmdc:mga0qj67_31569_c1_1249_1674 139
574 3300050511 nmdc:mga08y16_50222_c1 nmdc:mga08y16_50222_c1_3657_4082 139
575 3300050512 nmdc:mga0n895_310352_c1 nmdc:mga0n895_310352_c1_63_485 139
576 3300050513 nmdc:mga0rr50_132028_c1 nmdc:mga0rr50_132028_c1_1102_1524 139
577 3300050513 nmdc:mga0rr50_139429_c1 nmdc:mga0rr50_139429_c1_973_1398 139
578 3300050513 nmdc:mga0rr50_215168_c1 nmdc:mga0rr50_215168_c1_1151_1573 139
579 3300050514 nmdc:mga08x19_1791_c1 nmdc:mga08x19_1791_c1_5991_6413 139
580 3300050514 nmdc:mga08x19_231932_c1 nmdc:mga08x19_231932_c1_401_823 139
581 3300050515 nmdc:mga0a205_250257_c1 nmdc:mga0a205_250257_c1_126_551 139
582 3300050515 nmdc:mga0a205_306760_c1 nmdc:mga0a205_306760_c1_1026_1448 139
583 3300050515 nmdc:mga0a205_628980_c1 nmdc:mga0a205_628980_c1_268_696 139
584 3300050515 nmdc:mga0a205_665473_c1 nmdc:mga0a205_665473_c1_223_648 139
585 3300050515 nmdc:mga0a205_8916_c1 nmdc:mga0a205_8916_c1_7994_8416 139
586 3300050515 nmdc:mga0a205_911109_c1 nmdc:mga0a205_911109_c1_19_444 139
587 3300053088 Ga0500644_0000002 Ga0500644_0000002_361677_362099 139
588 3300053092 Ga0500583_0496959 Ga0500583_0496959_12_434 139
589 3300053093 Ga0500651_0002297 Ga0500651_0002297_1945_2370 139
590 3300053096 Ga0500641_0001325 Ga0500641_0001325_249_671 139
591 3300053098 Ga0500650_0000070 Ga0500650_0000070_115_537 139
592 3300053130 Ga0500642_0003400 Ga0500642_0003400_3814_4236 139
593 3300053142 Ga0500577_0000003 Ga0500577_0000003_77689_78111 139
594 3300053146 Ga0500588_0024291 Ga0500588_0024291_1102_1524 139
595 3300053151 Ga0500604_0026223 Ga0500604_0026223_435_857 139
596 3300053178 Ga0500637_0009880 Ga0500637_0009880_579_1001 139
597 3300053730 Ga0500645_210790 Ga0500645_210790_50_475 139
598 3300054114 Ga0501084_0437588 Ga0501084_0437588_14_436 139
599 3300059512 Ga0587092_060759 Ga0587092_060759_98_520 139
600 2162886007 SwRhRL2b_contig_3648165 SwRhRL2b_0931.00004850 140
601 3300004799 Ga0058863_11581443 Ga0058863_115814432 140
602 3300004800 Ga0058861_10045775 Ga0058861_100457751 140
603 3300004801 Ga0058860_11763004 Ga0058860_117630045 140
604 3300004803 Ga0058862_12307729 Ga0058862_123077291 140
605 3300005289 Ga0065704_10095262 Ga0065704_100952622 140
606 3300005295 Ga0065707_10932254 Ga0065707_109322541 140
607 3300005327 Ga0070658_10016310 Ga0070658_100163102 140
608 3300005327 Ga0070658_10031526 Ga0070658_100315267 140
609 3300005327 Ga0070658_10067399 Ga0070658_100673993 140
610 3300005327 Ga0070658_10074906 Ga0070658_100749066 140
611 3300005327 Ga0070658_10163021 Ga0070658_101630215 140
612 3300005327 Ga0070658_11088690 Ga0070658_110886902 140
613 3300005328 Ga0070676_10255796 Ga0070676_102557962 140
614 3300005329 Ga0070683_100002981 Ga0070683_10000298114 140
615 3300005329 Ga0070683_100088449 Ga0070683_1000884496 140
616 3300005329 Ga0070683_100111881 Ga0070683_1001118812 140
617 3300005329 Ga0070683_100152539 Ga0070683_1001525392 140
618 3300005329 Ga0070683_100560145 Ga0070683_1005601451 140
619 3300005329 Ga0070683_100718798 Ga0070683_1007187982 140
620 3300005330 Ga0070690_100029366 Ga0070690_1000293664 140
621 3300005330 Ga0070690_101425284 Ga0070690_1014252841 140
622 3300005331 Ga0070670_100493721 Ga0070670_1004937212 140
623 3300005334 Ga0068869_100296407 Ga0068869_1002964072 140
624 3300005335 Ga0070666_10038785 Ga0070666_100387854 140
625 3300005335 Ga0070666_10237723 Ga0070666_102377232 140
626 3300005335 Ga0070666_10822541 Ga0070666_108225412 140
627 3300005336 Ga0070680_100055226 Ga0070680_1000552266 140
628 3300005336 Ga0070680_100289189 Ga0070680_1002891892 140
629 3300005337 Ga0070682_100299058 Ga0070682_1002990581 140
630 3300005338 Ga0068868_100312728 Ga0068868_1003127282 140
631 3300005338 Ga0068868_100372630 Ga0068868_1003726301 140
632 3300005338 Ga0068868_100569883 Ga0068868_1005698831 140
633 3300005338 Ga0068868_100963262 Ga0068868_1009632622 140
634 3300005338 Ga0068868_101151115 Ga0068868_1011511152 140
635 3300005338 Ga0068868_101252207 Ga0068868_1012522072 140
636 3300005338 Ga0068868_101614268 Ga0068868_1016142682 140
637 3300005339 Ga0070660_100005332 Ga0070660_1000053322 140
638 3300005339 Ga0070660_100081218 Ga0070660_1000812185 140
639 3300005339 Ga0070660_100290089 Ga0070660_1002900893 140
640 3300005339 Ga0070660_100828546 Ga0070660_1008285461 140
641 3300005339 Ga0070660_101481411 Ga0070660_1014814111 140
642 3300005340 Ga0070689_100307037 Ga0070689_1003070372 140
643 3300005340 Ga0070689_101187320 Ga0070689_1011873202 140
644 3300005340 Ga0070689_101277498 Ga0070689_1012774982 140
645 3300005341 Ga0070691_10001162 Ga0070691_1000116210 140
646 3300005344 Ga0070661_100154852 Ga0070661_1001548522 140
647 3300005344 Ga0070661_100594716 Ga0070661_1005947162 140
648 3300005344 Ga0070661_101115174 Ga0070661_1011151742 140
649 3300005354 Ga0070675_100330358 Ga0070675_1003303582 140
650 3300005355 Ga0070671_100150795 Ga0070671_1001507952 140
651 3300005355 Ga0070671_100224240 Ga0070671_1002242402 140
652 3300005356 Ga0070674_100195020 Ga0070674_1001950202 140
653 3300005364 Ga0070673_100017147 Ga0070673_1000171472 140
654 3300005364 Ga0070673_100047614 Ga0070673_1000476144 140
655 3300005364 Ga0070673_100352989 Ga0070673_1003529893 140
656 3300005364 Ga0070673_100958561 Ga0070673_1009585611 140
657 3300005365 Ga0070688_100898197 Ga0070688_1008981972 140
658 3300005366 Ga0070659_100622854 Ga0070659_1006228542 140
659 3300005366 Ga0070659_100667005 Ga0070659_1006670051 140
660 3300005366 Ga0070659_101179388 Ga0070659_1011793882 140
661 3300005367 Ga0070667_100069113 Ga0070667_1000691136 140
662 3300005367 Ga0070667_100272503 Ga0070667_1002725033 140
663 3300005367 Ga0070667_100344053 Ga0070667_1003440531 140
664 3300005367 Ga0070667_100628989 Ga0070667_1006289891 140
665 3300005367 Ga0070667_101011134 Ga0070667_1010111341 140
666 3300005434 Ga0070709_10477097 Ga0070709_104770972 140
667 3300005434 Ga0070709_10504015 Ga0070709_105040152 140
668 3300005434 Ga0070709_10784059 Ga0070709_107840592 140
669 3300005435 Ga0070714_100022737 Ga0070714_1000227375 140
670 3300005435 Ga0070714_100048608 Ga0070714_1000486081 140
671 3300005435 Ga0070714_100811131 Ga0070714_1008111312 140
672 3300005435 Ga0070714_101210173 Ga0070714_1012101731 140
673 3300005436 Ga0070713_100018979 Ga0070713_1000189792 140
674 3300005436 Ga0070713_100038050 Ga0070713_1000380503 140
675 3300005436 Ga0070713_100051702 Ga0070713_1000517025 140
676 3300005436 Ga0070713_100543976 Ga0070713_1005439761 140
677 3300005436 Ga0070713_100876364 Ga0070713_1008763641 140
678 3300005436 Ga0070713_102174219 Ga0070713_1021742191 140
679 3300005437 Ga0070710_11162542 Ga0070710_111625421 140
680 3300005439 Ga0070711_100093697 Ga0070711_1000936972 140
681 3300005439 Ga0070711_100151767 Ga0070711_1001517671 140
682 3300005439 Ga0070711_100253776 Ga0070711_1002537762 140
683 3300005439 Ga0070711_100876785 Ga0070711_1008767851 140
684 3300005439 Ga0070711_101019603 Ga0070711_1010196032 140
685 3300005439 Ga0070711_101024855 Ga0070711_1010248552 140
686 3300005439 Ga0070711_101097070 Ga0070711_1010970701 140
687 3300005439 Ga0070711_101099405 Ga0070711_1010994052 140
688 3300005444 Ga0070694_100278260 Ga0070694_1002782602 140
689 3300005445 Ga0070708_100074547 Ga0070708_1000745472 140
690 3300005445 Ga0070708_101126167 Ga0070708_1011261672 140
691 3300005456 Ga0070678_100242814 Ga0070678_1002428143 140
692 3300005456 Ga0070678_100818074 Ga0070678_1008180742 140
693 3300005456 Ga0070678_101031663 Ga0070678_1010316631 140
694 3300005457 Ga0070662_100403790 Ga0070662_1004037902 140
695 3300005457 Ga0070662_100716786 Ga0070662_1007167862 140
696 3300005458 Ga0070681_10015833 Ga0070681_100158334 140
697 3300005458 Ga0070681_10030019 Ga0070681_100300196 140
698 3300005458 Ga0070681_10048985 Ga0070681_100489857 140
699 3300005458 Ga0070681_10089529 Ga0070681_100895296 140
700 3300005458 Ga0070681_10180638 Ga0070681_101806382 140
701 3300005459 Ga0068867_100326184 Ga0068867_1003261842 140
702 3300005459 Ga0068867_100993111 Ga0068867_1009931112 140
703 3300005459 Ga0068867_101606186 Ga0068867_1016061862 140
704 3300005459 Ga0068867_101639692 Ga0068867_1016396921 140
705 3300005459 Ga0068867_101900621 Ga0068867_1019006211 140
706 3300005466 Ga0070685_10040968 Ga0070685_100409682 140
707 3300005471 Ga0070698_100681089 Ga0070698_1006810892 140
708 3300005471 Ga0070698_100854161 Ga0070698_1008541611 140
709 3300005518 Ga0070699_100076627 Ga0070699_1000766273 140
710 3300005530 Ga0070679_100011561 Ga0070679_1000115615 140
711 3300005530 Ga0070679_100089372 Ga0070679_1000893722 140
712 3300005535 Ga0070684_100061031 Ga0070684_1000610312 140
713 3300005535 Ga0070684_100153008 Ga0070684_1001530086 140
714 3300005535 Ga0070684_100232151 Ga0070684_1002321512 140
715 3300005535 Ga0070684_100421634 Ga0070684_1004216342 140
716 3300005535 Ga0070684_100577216 Ga0070684_1005772162 140
717 3300005535 Ga0070684_100896869 Ga0070684_1008968692 140
718 3300005535 Ga0070684_100984030 Ga0070684_1009840302 140
719 3300005536 Ga0070697_101288979 Ga0070697_1012889791 140
720 3300005539 Ga0068853_100114452 Ga0068853_1001144521 140
721 3300005539 Ga0068853_100166379 Ga0068853_1001663792 140
722 3300005539 Ga0068853_100200496 Ga0068853_1002004963 140
723 3300005539 Ga0068853_100270100 Ga0068853_1002701004 140
724 3300005539 Ga0068853_100499688 Ga0068853_1004996882 140
725 3300005543 Ga0070672_100358507 Ga0070672_1003585072 140
726 3300005543 Ga0070672_101805901 Ga0070672_1018059011 140
727 3300005544 Ga0070686_100401214 Ga0070686_1004012142 140
728 3300005545 Ga0070695_100623424 Ga0070695_1006234241 140
729 3300005545 Ga0070695_100860415 Ga0070695_1008604152 140
730 3300005546 Ga0070696_100007562 Ga0070696_1000075627 140
731 3300005546 Ga0070696_101026562 Ga0070696_1010265621 140
732 3300005547 Ga0070693_100064853 Ga0070693_1000648533 140
733 3300005548 Ga0070665_100048212 Ga0070665_1000482126 140
734 3300005548 Ga0070665_100307536 Ga0070665_1003075362 140
735 3300005548 Ga0070665_100568406 Ga0070665_1005684061 140
736 3300005548 Ga0070665_100702219 Ga0070665_1007022192 140
737 3300005549 Ga0070704_100347104 Ga0070704_1003471042 140
738 3300005549 Ga0070704_101380064 Ga0070704_1013800641 140
739 3300005563 Ga0068855_100027078 Ga0068855_1000270786 140
740 3300005563 Ga0068855_100050405 Ga0068855_1000504054 140
741 3300005563 Ga0068855_100145813 Ga0068855_1001458134 140
742 3300005563 Ga0068855_100455335 Ga0068855_1004553353 140
743 3300005563 Ga0068855_100526141 Ga0068855_1005261412 140
744 3300005563 Ga0068855_101008224 Ga0068855_1010082242 140
745 3300005564 Ga0070664_100335375 Ga0070664_1003353752 140
746 3300005564 Ga0070664_100917022 Ga0070664_1009170222 140
747 3300005564 Ga0070664_101606590 Ga0070664_1016065902 140
748 3300005577 Ga0068857_100012106 Ga0068857_1000121068 140
749 3300005577 Ga0068857_100057320 Ga0068857_1000573202 140
750 3300005577 Ga0068857_100059824 Ga0068857_1000598246 140
751 3300005577 Ga0068857_100102495 Ga0068857_1001024952 140
752 3300005578 Ga0068854_100139520 Ga0068854_1001395202 140
753 3300005578 Ga0068854_100729067 Ga0068854_1007290672 140
754 3300005614 Ga0068856_100067689 Ga0068856_1000676896 140
755 3300005614 Ga0068856_100103633 Ga0068856_1001036333 140
756 3300005614 Ga0068856_100161060 Ga0068856_1001610602 140
757 3300005614 Ga0068856_100568697 Ga0068856_1005686972 140
758 3300005615 Ga0070702_101861160 Ga0070702_1018611601 140
759 3300005616 Ga0068852_100016325 Ga0068852_1000163256 140
760 3300005616 Ga0068852_100053398 Ga0068852_1000533982 140
761 3300005616 Ga0068852_100140852 Ga0068852_1001408522 140
762 3300005617 Ga0068859_100125671 Ga0068859_1001256716 140
763 3300005617 Ga0068859_100213847 Ga0068859_1002138474 140
764 3300005617 Ga0068859_100551046 Ga0068859_1005510462 140
765 3300005617 Ga0068859_100763293 Ga0068859_1007632932 140
766 3300005617 Ga0068859_101175867 Ga0068859_1011758672 140
767 3300005618 Ga0068864_100038611 Ga0068864_1000386114 140
768 3300005618 Ga0068864_100090071 Ga0068864_1000900716 140
769 3300005618 Ga0068864_100137228 Ga0068864_1001372283 140
770 3300005618 Ga0068864_100240032 Ga0068864_1002400323 140
771 3300005618 Ga0068864_100906887 Ga0068864_1009068871 140
772 3300005718 Ga0068866_10253131 Ga0068866_102531312 140
773 3300005718 Ga0068866_10318738 Ga0068866_103187381 140
774 3300005719 Ga0068861_101325800 Ga0068861_1013258002 140
775 3300005719 Ga0068861_102198987 Ga0068861_1021989871 140
776 3300005841 Ga0068863_100093573 Ga0068863_1000935733 140
777 3300005841 Ga0068863_100126817 Ga0068863_1001268176 140
778 3300005841 Ga0068863_100758322 Ga0068863_1007583221 140
779 3300005841 Ga0068863_100913460 Ga0068863_1009134602 140
780 3300005841 Ga0068863_101781746 Ga0068863_1017817462 140
781 3300005842 Ga0068858_100045647 Ga0068858_1000456476 140
782 3300005842 Ga0068858_100145469 Ga0068858_1001454693 140
783 3300005842 Ga0068858_100180802 Ga0068858_1001808021 140
784 3300005842 Ga0068858_100215287 Ga0068858_1002152872 140
785 3300005842 Ga0068858_100355453 Ga0068858_1003554533 140
786 3300005842 Ga0068858_100558114 Ga0068858_1005581142 140
787 3300005842 Ga0068858_100590851 Ga0068858_1005908512 140
788 3300005843 Ga0068860_100025519 Ga0068860_1000255192 140
789 3300005843 Ga0068860_100037244 Ga0068860_1000372447 140
790 3300005843 Ga0068860_100052656 Ga0068860_1000526565 140
791 3300005843 Ga0068860_100371164 Ga0068860_1003711642 140
792 3300005843 Ga0068860_101343304 Ga0068860_1013433041 140
793 3300005844 Ga0068862_100394778 Ga0068862_1003947782 140
794 3300006028 Ga0070717_10049261 Ga0070717_100492615 140
795 3300006028 Ga0070717_10056186 Ga0070717_100561866 140
796 3300006028 Ga0070717_10234697 Ga0070717_102346972 140
797 3300006028 Ga0070717_10275547 Ga0070717_102755472 140
798 3300006028 Ga0070717_11021466 Ga0070717_110214662 140
799 3300006163 Ga0070715_10697994 Ga0070715_106979942 140
800 3300006173 Ga0070716_100304097 Ga0070716_1003040972 140
801 3300006237 Ga0097621_100024374 Ga0097621_1000243746 140
802 3300006237 Ga0097621_100050693 Ga0097621_1000506932 140
803 3300006237 Ga0097621_100107171 Ga0097621_1001071712 140
804 3300006237 Ga0097621_100130824 Ga0097621_1001308243 140
805 3300006237 Ga0097621_100131589 Ga0097621_1001315893 140
806 3300006237 Ga0097621_100154467 Ga0097621_1001544672 140
807 3300006237 Ga0097621_100172262 Ga0097621_1001722624 140
808 3300006237 Ga0097621_100197378 Ga0097621_1001973782 140
809 3300006237 Ga0097621_100551091 Ga0097621_1005510912 140
810 3300006237 Ga0097621_100569171 Ga0097621_1005691711 140
811 3300006237 Ga0097621_100705071 Ga0097621_1007050712 140
812 3300006237 Ga0097621_100768582 Ga0097621_1007685822 140
813 3300006237 Ga0097621_101559027 Ga0097621_1015590271 140
814 3300006237 Ga0097621_101673966 Ga0097621_1016739661 140
815 3300006237 Ga0097621_102319595 Ga0097621_1023195951 140
816 3300006358 Ga0068871_100023285 Ga0068871_1000232856 140
817 3300006358 Ga0068871_100034497 Ga0068871_1000344971 140
818 3300006358 Ga0068871_100065515 Ga0068871_1000655151 140
819 3300006358 Ga0068871_100115475 Ga0068871_1001154754 140
820 3300006358 Ga0068871_100169351 Ga0068871_1001693511 140
821 3300006358 Ga0068871_100212469 Ga0068871_1002124692 140
822 3300006358 Ga0068871_100288695 Ga0068871_1002886952 140
823 3300006358 Ga0068871_100309636 Ga0068871_1003096362 140
824 3300006358 Ga0068871_100318174 Ga0068871_1003181742 140
825 3300006358 Ga0068871_100363237 Ga0068871_1003632372 140
826 3300006358 Ga0068871_101671516 Ga0068871_1016715162 140
827 3300006358 Ga0068871_101949028 Ga0068871_1019490281 140
828 3300006844 Ga0075428_100339381 Ga0075428_1003393812 140
829 3300006844 Ga0075428_100970747 Ga0075428_1009707472 140
830 3300006846 Ga0075430_100043860 Ga0075430_1000438602 140
831 3300006847 Ga0075431_100071481 Ga0075431_1000714815 140
832 3300006847 Ga0075431_100283521 Ga0075431_1002835212 140
833 3300006880 Ga0075429_100243279 Ga0075429_1002432794 140
834 3300006881 Ga0068865_100475504 Ga0068865_1004755042 140
835 3300006881 Ga0068865_101422307 Ga0068865_1014223072 140
836 3300006914 Ga0075436_100965092 Ga0075436_1009650921 140
837 3300006931 Ga0097620_100125671 Ga0097620_1001256716 140
838 3300006931 Ga0097620_100213846 Ga0097620_1002138462 140
839 3300006931 Ga0097620_100551056 Ga0097620_1005510562 140
840 3300006931 Ga0097620_100763245 Ga0097620_1007632452 140
841 3300006931 Ga0097620_101175896 Ga0097620_1011758962 140
842 3300007076 Ga0075435_100246536 Ga0075435_1002465361 140
843 3300007265 Ga0099794_10116345 Ga0099794_101163451 140
844 3300009093 Ga0105240_10000877 Ga0105240_100008776 140
845 3300009093 Ga0105240_10005628 Ga0105240_1000562820 140
846 3300009093 Ga0105240_10011526 Ga0105240_100115265 140
847 3300009093 Ga0105240_10051605 Ga0105240_100516056 140
848 3300009093 Ga0105240_10089720 Ga0105240_100897203 140
849 3300009093 Ga0105240_10210891 Ga0105240_102108911 140
850 3300009093 Ga0105240_10237058 Ga0105240_102370584 140
851 3300009093 Ga0105240_10261841 Ga0105240_102618416 140
852 3300009093 Ga0105240_10264391 Ga0105240_102643913 140
853 3300009093 Ga0105240_10303761 Ga0105240_103037612 140
854 3300009093 Ga0105240_10470576 Ga0105240_104705762 140
855 3300009093 Ga0105240_10858755 Ga0105240_108587552 140
856 3300009093 Ga0105240_10896683 Ga0105240_108966832 140
857 3300009093 Ga0105240_10928192 Ga0105240_109281921 140
858 3300009094 Ga0111539_10490847 Ga0111539_104908472 140
859 3300009094 Ga0111539_11535031 Ga0111539_115350312 140
860 3300009098 Ga0105245_10017754 Ga0105245_100177545 140
861 3300009098 Ga0105245_10039480 Ga0105245_100394803 140
862 3300009098 Ga0105245_10104493 Ga0105245_101044933 140
863 3300009098 Ga0105245_10129420 Ga0105245_101294201 140
864 3300009098 Ga0105245_10256599 Ga0105245_102565992 140
865 3300009098 Ga0105245_10346196 Ga0105245_103461964 140
866 3300009098 Ga0105245_10379204 Ga0105245_103792043 140
867 3300009098 Ga0105245_10409019 Ga0105245_104090191 140
868 3300009098 Ga0105245_11701976 Ga0105245_117019762 140
869 3300009098 Ga0105245_11921349 Ga0105245_119213492 140
870 3300009101 Ga0105247_10054705 Ga0105247_100547053 140
871 3300009101 Ga0105247_10401618 Ga0105247_104016182 140
872 3300009101 Ga0105247_10939367 Ga0105247_109393671 140
873 3300009147 Ga0114129_10787421 Ga0114129_107874212 140
874 3300009148 Ga0105243_10213567 Ga0105243_102135672 140
875 3300009148 Ga0105243_10828722 Ga0105243_108287222 140
876 3300009148 Ga0105243_11411429 Ga0105243_114114292 140
877 3300009148 Ga0105243_12367652 Ga0105243_123676521 140
878 3300009148 Ga0105243_12635984 Ga0105243_126359841 140
879 3300009174 Ga0105241_10149324 Ga0105241_101493243 140
880 3300009174 Ga0105241_10406938 Ga0105241_104069381 140
881 3300009174 Ga0105241_11175611 Ga0105241_111756112 140
882 3300009174 Ga0105241_11315796 Ga0105241_113157962 140
883 3300009174 Ga0105241_11539105 Ga0105241_115391052 140
884 3300009176 Ga0105242_10017892 Ga0105242_100178927 140
885 3300009176 Ga0105242_10087110 Ga0105242_100871103 140
886 3300009176 Ga0105242_10101803 Ga0105242_101018033 140
887 3300009176 Ga0105242_10159358 Ga0105242_101593582 140
888 3300009176 Ga0105242_11232430 Ga0105242_112324302 140
889 3300009176 Ga0105242_11256972 Ga0105242_112569722 140
890 3300009176 Ga0105242_12119993 Ga0105242_121199931 140
891 3300009177 Ga0105248_10048956 Ga0105248_100489567 140
892 3300009177 Ga0105248_10091261 Ga0105248_100912614 140
893 3300009177 Ga0105248_10128484 Ga0105248_101284842 140
894 3300009177 Ga0105248_10147346 Ga0105248_101473463 140
895 3300009177 Ga0105248_10189293 Ga0105248_101892933 140
896 3300009177 Ga0105248_10191864 Ga0105248_101918642 140
897 3300009177 Ga0105248_10252960 Ga0105248_102529606 140
898 3300009177 Ga0105248_10400149 Ga0105248_104001493 140
899 3300009177 Ga0105248_10454223 Ga0105248_104542232 140
900 3300009177 Ga0105248_10758693 Ga0105248_107586932 140
901 3300009177 Ga0105248_11044875 Ga0105248_110448752 140
902 3300009177 Ga0105248_11113116 Ga0105248_111131163 140
903 3300009177 Ga0105248_12535227 Ga0105248_125352271 140
904 3300009545 Ga0105237_10008200 Ga0105237_100082008 140
905 3300009545 Ga0105237_10051788 Ga0105237_100517886 140
906 3300009545 Ga0105237_10053225 Ga0105237_100532256 140
907 3300009545 Ga0105237_10152505 Ga0105237_101525056 140
908 3300009545 Ga0105237_10202396 Ga0105237_102023963 140
909 3300009545 Ga0105237_10209685 Ga0105237_102096852 140
910 3300009545 Ga0105237_10349760 Ga0105237_103497602 140
911 3300009545 Ga0105237_10580274 Ga0105237_105802742 140
912 3300009545 Ga0105237_10665163 Ga0105237_106651632 140
913 3300009545 Ga0105237_10759439 Ga0105237_107594392 140
914 3300009545 Ga0105237_10930111 Ga0105237_109301111 140
915 3300009545 Ga0105237_11269133 Ga0105237_112691331 140
916 3300009551 Ga0105238_10025778 Ga0105238_100257787 140
917 3300009551 Ga0105238_10042029 Ga0105238_100420294 140
918 3300009551 Ga0105238_10043331 Ga0105238_100433316 140
919 3300009551 Ga0105238_10079438 Ga0105238_100794383 140
920 3300009551 Ga0105238_10103931 Ga0105238_101039312 140
921 3300009551 Ga0105238_10121891 Ga0105238_101218915 140
922 3300009551 Ga0105238_10145691 Ga0105238_101456915 140
923 3300009551 Ga0105238_10181937 Ga0105238_101819372 140
924 3300009551 Ga0105238_10193134 Ga0105238_101931342 140
925 3300009551 Ga0105238_11624994 Ga0105238_116249942 140
926 3300009551 Ga0105238_11666046 Ga0105238_116660461 140
927 3300009551 Ga0105238_12122480 Ga0105238_121224802 140
928 3300009553 Ga0105249_10002635 Ga0105249_1000263516 140
929 3300009553 Ga0105249_10139643 Ga0105249_101396432 140
930 3300009553 Ga0105249_11574552 Ga0105249_115745522 140
931 3300010375 Ga0105239_10001360 Ga0105239_100013602 140
932 3300010375 Ga0105239_10096569 Ga0105239_100965692 140
933 3300010375 Ga0105239_10100314 Ga0105239_101003142 140
934 3300010375 Ga0105239_10122659 Ga0105239_101226596 140
935 3300010375 Ga0105239_10372259 Ga0105239_103722592 140
936 3300010375 Ga0105239_10607484 Ga0105239_106074842 140
937 3300010375 Ga0105239_10718863 Ga0105239_107188631 140
938 3300010375 Ga0105239_11293308 Ga0105239_112933082 140
939 3300010375 Ga0105239_11528422 Ga0105239_115284222 140
940 3300011119 Ga0105246_10077977 Ga0105246_100779772 140
941 3300011119 Ga0105246_10099260 Ga0105246_100992606 140
942 3300011119 Ga0105246_10114492 Ga0105246_101144922 140
943 3300011119 Ga0105246_10282632 Ga0105246_102826321 140
944 3300011119 Ga0105246_10561124 Ga0105246_105611242 140
945 3300011119 Ga0105246_10920208 Ga0105246_109202081 140
946 3300011119 Ga0105246_11066126 Ga0105246_110661262 140
947 3300011119 Ga0105246_11362579 Ga0105246_113625791 140
948 3300011119 Ga0105246_11602649 Ga0105246_116026492 140
949 3300013100 Ga0157373_10348386 Ga0157373_103483862 140
950 3300013100 Ga0157373_10512080 Ga0157373_105120802 140
951 3300013100 Ga0157373_10693042 Ga0157373_106930421 140
952 3300013102 Ga0157371_10707574 Ga0157371_107075741 140
953 3300013102 Ga0157371_10768908 Ga0157371_107689081 140
954 3300013102 Ga0157371_11104805 Ga0157371_111048052 140
955 3300013104 Ga0157370_10009380 Ga0157370_1000938010 140
956 3300013104 Ga0157370_10016088 Ga0157370_100160886 140
957 3300013104 Ga0157370_10060235 Ga0157370_100602356 140
958 3300013104 Ga0157370_10087501 Ga0157370_100875016 140
959 3300013104 Ga0157370_10111743 Ga0157370_101117436 140
960 3300013104 Ga0157370_10115052 Ga0157370_101150522 140
961 3300013104 Ga0157370_10220654 Ga0157370_102206542 140
962 3300013104 Ga0157370_10709121 Ga0157370_107091211 140
963 3300013104 Ga0157370_10870264 Ga0157370_108702642 140
964 3300013105 Ga0157369_10089419 Ga0157369_100894193 140
965 3300013105 Ga0157369_10144717 Ga0157369_101447175 140
966 3300013105 Ga0157369_11928311 Ga0157369_119283112 140
967 3300013296 Ga0157374_10280734 Ga0157374_102807342 140
968 3300013296 Ga0157374_10319069 Ga0157374_103190693 140
969 3300013296 Ga0157374_10330236 Ga0157374_103302363 140
970 3300013296 Ga0157374_10491386 Ga0157374_104913862 140
971 3300013296 Ga0157374_10936791 Ga0157374_109367911 140
972 3300013296 Ga0157374_11462225 Ga0157374_114622252 140
973 3300013296 Ga0157374_11919559 Ga0157374_119195591 140
974 3300013296 Ga0157374_12096100 Ga0157374_120961002 140
975 3300013297 Ga0157378_10009845 Ga0157378_100098457 140
976 3300013297 Ga0157378_10363194 Ga0157378_103631941 140
977 3300013297 Ga0157378_10445060 Ga0157378_104450602 140
978 3300013297 Ga0157378_10450373 Ga0157378_104503732 140
979 3300013297 Ga0157378_10662029 Ga0157378_106620292 140
980 3300013297 Ga0157378_10888711 Ga0157378_108887112 140
981 3300013297 Ga0157378_11595813 Ga0157378_115958131 140
982 3300013297 Ga0157378_12695637 Ga0157378_126956371 140
983 3300013306 Ga0163162_10225142 Ga0163162_102251422 140
984 3300013306 Ga0163162_10255877 Ga0163162_102558772 140
985 3300013306 Ga0163162_10578563 Ga0163162_105785632 140
986 3300013306 Ga0163162_11115184 Ga0163162_111151842 140
987 3300013306 Ga0163162_12061465 Ga0163162_120614651 140
988 3300013306 Ga0163162_12680609 Ga0163162_126806091 140
989 3300013307 Ga0157372_10122792 Ga0157372_101227926 140
990 3300013307 Ga0157372_10225448 Ga0157372_102254482 140
991 3300013307 Ga0157372_10242922 Ga0157372_102429225 140
992 3300013307 Ga0157372_10276972 Ga0157372_102769721 140
993 3300013307 Ga0157372_10999408 Ga0157372_109994082 140
994 3300013307 Ga0157372_11151609 Ga0157372_111516091 140
995 3300013307 Ga0157372_11362368 Ga0157372_113623682 140
996 3300013307 Ga0157372_12609069 Ga0157372_126090691 140
997 3300013307 Ga0157372_13394294 Ga0157372_133942941 140
998 3300013308 Ga0157375_10018698 Ga0157375_100186982 140
999 3300013308 Ga0157375_10032840 Ga0157375_100328403 140
1000 3300013308 Ga0157375_10116410 Ga0157375_101164106 140
1001 3300013308 Ga0157375_10425489 Ga0157375_104254894 140
1002 3300013308 Ga0157375_10472512 Ga0157375_104725122 140
1003 3300013308 Ga0157375_10501536 Ga0157375_105015362 140
1004 3300013308 Ga0157375_11706751 Ga0157375_117067511 140
1005 3300013308 Ga0157375_11750934 Ga0157375_117509342 140
1006 3300013308 Ga0157375_12682966 Ga0157375_126829661 140
1007 3300014325 Ga0163163_10021758 Ga0163163_100217589 140
1008 3300014325 Ga0163163_10055051 Ga0163163_100550514 140
1009 3300014325 Ga0163163_10073100 Ga0163163_100731001 140
1010 3300014325 Ga0163163_10115863 Ga0163163_101158634 140
1011 3300014325 Ga0163163_10219037 Ga0163163_102190372 140
1012 3300014325 Ga0163163_10406008 Ga0163163_104060082 140
1013 3300014325 Ga0163163_10711542 Ga0163163_107115422 140
1014 3300014325 Ga0163163_10796119 Ga0163163_107961192 140
1015 3300014325 Ga0163163_10916822 Ga0163163_109168221 140
1016 3300014325 Ga0163163_11064320 Ga0163163_110643202 140
1017 3300014326 Ga0157380_12284723 Ga0157380_122847231 140
1018 3300014745 Ga0157377_10282327 Ga0157377_102823272 140
1019 3300014745 Ga0157377_11103247 Ga0157377_111032471 140
1020 3300014968 Ga0157379_10144596 Ga0157379_101445962 140
1021 3300014968 Ga0157379_10483045 Ga0157379_104830452 140
1022 3300014968 Ga0157379_10663700 Ga0157379_106637002 140
1023 3300014968 Ga0157379_10829439 Ga0157379_108294392 140
1024 3300014968 Ga0157379_11373458 Ga0157379_113734581 140
1025 3300014968 Ga0157379_11615559 Ga0157379_116155592 140
1026 3300014968 Ga0157379_11774386 Ga0157379_117743862 140
1027 3300014969 Ga0157376_10012722 Ga0157376_100127226 140
1028 3300014969 Ga0157376_10193186 Ga0157376_101931865 140
1029 3300014969 Ga0157376_10193905 Ga0157376_101939055 140
1030 3300014969 Ga0157376_10912527 Ga0157376_109125271 140
1031 3300014969 Ga0157376_11827967 Ga0157376_118279671 140
1032 3300014969 Ga0157376_11899754 Ga0157376_118997541 140
1033 3300014969 Ga0157376_12202120 Ga0157376_122021201 140
1034 3300014969 Ga0157376_12698772 Ga0157376_126987721 140
1035 3300015262 Ga0182007_10218614 Ga0182007_102186141 140
1036 3300017792 Ga0163161_10881247 Ga0163161_108812472 140
1037 3300020070 Ga0206356_11564136 Ga0206356_115641361 140
1038 3300020078 Ga0206352_10028984 Ga0206352_100289842 140
1039 3300020078 Ga0206352_10470863 Ga0206352_104708633 140
1040 3300020078 Ga0206352_10752238 Ga0206352_107522381 140
1041 3300020078 Ga0206352_11270903 Ga0206352_112709032 140
1042 3300021384 Ga0213876_10041973 Ga0213876_100419738 140
1043 3300021388 Ga0213875_10022806 Ga0213875_100228062 140
1044 3300024225 Ga0224572_1066287 Ga0224572_10662871 140
1045 3300025898 Ga0207692_10074593 Ga0207692_100745931 140
1046 3300025898 Ga0207692_10452153 Ga0207692_104521532 140
1047 3300025898 Ga0207692_10462867 Ga0207692_104628672 140
1048 3300025899 Ga0207642_10470226 Ga0207642_104702262 140
1049 3300025900 Ga0207710_10056828 Ga0207710_100568282 140
1050 3300025900 Ga0207710_10487930 Ga0207710_104879301 140
1051 3300025903 Ga0207680_10194678 Ga0207680_101946783 140
1052 3300025903 Ga0207680_10201701 Ga0207680_102017012 140
1053 3300025903 Ga0207680_10507495 Ga0207680_105074952 140
1054 3300025905 Ga0207685_10145305 Ga0207685_101453052 140
1055 3300025905 Ga0207685_10532667 Ga0207685_105326672 140
1056 3300025906 Ga0207699_10299935 Ga0207699_102999352 140
1057 3300025906 Ga0207699_10396201 Ga0207699_103962012 140
1058 3300025906 Ga0207699_10853605 Ga0207699_108536052 140
1059 3300025909 Ga0207705_10027514 Ga0207705_100275145 140
1060 3300025909 Ga0207705_10058265 Ga0207705_100582652 140
1061 3300025909 Ga0207705_10381660 Ga0207705_103816601 140
1062 3300025911 Ga0207654_10039405 Ga0207654_100394051 140
1063 3300025912 Ga0207707_10039884 Ga0207707_100398842 140
1064 3300025912 Ga0207707_10051420 Ga0207707_100514206 140
1065 3300025912 Ga0207707_10052960 Ga0207707_100529602 140
1066 3300025912 Ga0207707_10065301 Ga0207707_100653011 140
1067 3300025912 Ga0207707_10142451 Ga0207707_101424512 140
1068 3300025913 Ga0207695_10008732 Ga0207695_100087325 140
1069 3300025913 Ga0207695_10024901 Ga0207695_100249015 140
1070 3300025913 Ga0207695_10033693 Ga0207695_100336936 140
1071 3300025913 Ga0207695_10104263 Ga0207695_101042632 140
1072 3300025913 Ga0207695_10121084 Ga0207695_101210846 140
1073 3300025913 Ga0207695_10140626 Ga0207695_101406266 140
1074 3300025913 Ga0207695_10148295 Ga0207695_101482952 140
1075 3300025913 Ga0207695_10164082 Ga0207695_101640826 140
1076 3300025913 Ga0207695_10482163 Ga0207695_104821632 140
1077 3300025913 Ga0207695_10901946 Ga0207695_109019461 140
1078 3300025913 Ga0207695_10927662 Ga0207695_109276621 140
1079 3300025913 Ga0207695_10959222 Ga0207695_109592222 140
1080 3300025914 Ga0207671_10008521 Ga0207671_1000852110 140
1081 3300025914 Ga0207671_10010454 Ga0207671_100104545 140
1082 3300025914 Ga0207671_10068243 Ga0207671_100682433 140
1083 3300025914 Ga0207671_10085702 Ga0207671_100857022 140
1084 3300025914 Ga0207671_10118089 Ga0207671_101180894 140
1085 3300025914 Ga0207671_10163633 Ga0207671_101636332 140
1086 3300025914 Ga0207671_10296510 Ga0207671_102965102 140
1087 3300025914 Ga0207671_10377164 Ga0207671_103771642 140
1088 3300025914 Ga0207671_10841365 Ga0207671_108413651 140
1089 3300025916 Ga0207663_10034350 Ga0207663_100343506 140
1090 3300025916 Ga0207663_10195008 Ga0207663_101950082 140
1091 3300025916 Ga0207663_10229309 Ga0207663_102293092 140
1092 3300025916 Ga0207663_10276502 Ga0207663_102765022 140
1093 3300025916 Ga0207663_10510796 Ga0207663_105107962 140
1094 3300025916 Ga0207663_10570019 Ga0207663_105700192 140
1095 3300025916 Ga0207663_11119858 Ga0207663_111198582 140
1096 3300025916 Ga0207663_11128813 Ga0207663_111288131 140
1097 3300025917 Ga0207660_10007721 Ga0207660_1000772113 140
1098 3300025917 Ga0207660_10096570 Ga0207660_100965702 140
1099 3300025918 Ga0207662_10297311 Ga0207662_102973112 140
1100 3300025919 Ga0207657_10002040 Ga0207657_100020404 140
1101 3300025919 Ga0207657_10337253 Ga0207657_103372532 140
1102 3300025919 Ga0207657_10425210 Ga0207657_104252102 140
1103 3300025919 Ga0207657_10951241 Ga0207657_109512411 140
1104 3300025920 Ga0207649_10161490 Ga0207649_101614902 140
1105 3300025920 Ga0207649_10361367 Ga0207649_103613672 140
1106 3300025921 Ga0207652_10101022 Ga0207652_101010226 140
1107 3300025921 Ga0207652_10157853 Ga0207652_101578531 140
1108 3300025922 Ga0207646_11047304 Ga0207646_110473041 140
1109 3300025924 Ga0207694_10030295 Ga0207694_100302954 140
1110 3300025924 Ga0207694_10033344 Ga0207694_100333446 140
1111 3300025924 Ga0207694_10038575 Ga0207694_100385752 140
1112 3300025924 Ga0207694_10074283 Ga0207694_100742832 140
1113 3300025924 Ga0207694_10154946 Ga0207694_101549466 140
1114 3300025924 Ga0207694_10194561 Ga0207694_101945612 140
1115 3300025924 Ga0207694_11716799 Ga0207694_117167991 140
1116 3300025925 Ga0207650_10425348 Ga0207650_104253482 140
1117 3300025925 Ga0207650_10931971 Ga0207650_109319712 140
1118 3300025927 Ga0207687_10017019 Ga0207687_100170193 140
1119 3300025927 Ga0207687_10019124 Ga0207687_100191243 140
1120 3300025927 Ga0207687_10032379 Ga0207687_100323794 140
1121 3300025927 Ga0207687_10071255 Ga0207687_100712553 140
1122 3300025927 Ga0207687_10129959 Ga0207687_101299592 140
1123 3300025927 Ga0207687_10190510 Ga0207687_101905101 140
1124 3300025927 Ga0207687_10205512 Ga0207687_102055122 140
1125 3300025927 Ga0207687_11643371 Ga0207687_116433711 140
1126 3300025928 Ga0207700_10029176 Ga0207700_100291763 140
1127 3300025928 Ga0207700_10164168 Ga0207700_101641682 140
1128 3300025928 Ga0207700_10446296 Ga0207700_104462961 140
1129 3300025928 Ga0207700_10515366 Ga0207700_105153662 140
1130 3300025928 Ga0207700_10555465 Ga0207700_105554652 140
1131 3300025928 Ga0207700_10693373 Ga0207700_106933732 140
1132 3300025929 Ga0207664_10004267 Ga0207664_100042676 140
1133 3300025929 Ga0207664_10274240 Ga0207664_102742402 140
1134 3300025929 Ga0207664_10428131 Ga0207664_104281312 140
1135 3300025929 Ga0207664_11302818 Ga0207664_113028181 140
1136 3300025931 Ga0207644_10066014 Ga0207644_100660143 140
1137 3300025931 Ga0207644_10553114 Ga0207644_105531142 140
1138 3300025931 Ga0207644_10585547 Ga0207644_105855472 140
1139 3300025932 Ga0207690_10326729 Ga0207690_103267292 140
1140 3300025934 Ga0207686_10003970 Ga0207686_100039706 140
1141 3300025934 Ga0207686_10005404 Ga0207686_100054045 140
1142 3300025934 Ga0207686_10076510 Ga0207686_100765104 140
1143 3300025934 Ga0207686_10137346 Ga0207686_101373464 140
1144 3300025934 Ga0207686_10240774 Ga0207686_102407741 140
1145 3300025935 Ga0207709_10161771 Ga0207709_101617713 140
1146 3300025935 Ga0207709_10218441 Ga0207709_102184412 140
1147 3300025935 Ga0207709_10374506 Ga0207709_103745062 140
1148 3300025935 Ga0207709_10557787 Ga0207709_105577871 140
1149 3300025935 Ga0207709_10623133 Ga0207709_106231332 140
1150 3300025936 Ga0207670_10152015 Ga0207670_101520153 140
1151 3300025936 Ga0207670_10274512 Ga0207670_102745122 140
1152 3300025936 Ga0207670_10348310 Ga0207670_103483102 140
1153 3300025936 Ga0207670_10594838 Ga0207670_105948382 140
1154 3300025938 Ga0207704_10040646 Ga0207704_100406465 140
1155 3300025938 Ga0207704_10673673 Ga0207704_106736732 140
1156 3300025938 Ga0207704_11366181 Ga0207704_113661811 140
1157 3300025939 Ga0207665_10500424 Ga0207665_105004241 140
1158 3300025940 Ga0207691_10331216 Ga0207691_103312162 140
1159 3300025940 Ga0207691_10581586 Ga0207691_105815861 140
1160 3300025940 Ga0207691_11114821 Ga0207691_111148211 140
1161 3300025941 Ga0207711_10002186 Ga0207711_100021867 140
1162 3300025941 Ga0207711_10122624 Ga0207711_101226244 140
1163 3300025941 Ga0207711_10253474 Ga0207711_102534744 140
1164 3300025941 Ga0207711_10291298 Ga0207711_102912982 140
1165 3300025941 Ga0207711_10360513 Ga0207711_103605132 140
1166 3300025941 Ga0207711_10394295 Ga0207711_103942953 140
1167 3300025941 Ga0207711_10401010 Ga0207711_104010101 140
1168 3300025941 Ga0207711_10493303 Ga0207711_104933031 140
1169 3300025941 Ga0207711_11398284 Ga0207711_113982841 140
1170 3300025942 Ga0207689_10076821 Ga0207689_100768215 140
1171 3300025942 Ga0207689_10462938 Ga0207689_104629382 140
1172 3300025944 Ga0207661_10007311 Ga0207661_100073114 140
1173 3300025944 Ga0207661_10008612 Ga0207661_100086126 140
1174 3300025944 Ga0207661_10029011 Ga0207661_100290116 140
1175 3300025944 Ga0207661_10070357 Ga0207661_100703574 140
1176 3300025944 Ga0207661_10143604 Ga0207661_101436042 140
1177 3300025944 Ga0207661_10428017 Ga0207661_104280172 140
1178 3300025944 Ga0207661_10594606 Ga0207661_105946062 140
1179 3300025944 Ga0207661_11598627 Ga0207661_115986271 140
1180 3300025944 Ga0207661_11721433 Ga0207661_117214331 140
1181 3300025945 Ga0207679_10147074 Ga0207679_101470742 140
1182 3300025945 Ga0207679_10301142 Ga0207679_103011422 140
1183 3300025945 Ga0207679_10483672 Ga0207679_104836721 140
1184 3300025945 Ga0207679_11309751 Ga0207679_113097512 140
1185 3300025949 Ga0207667_10015532 Ga0207667_100155328 140
1186 3300025949 Ga0207667_10020712 Ga0207667_100207126 140
1187 3300025949 Ga0207667_10021290 Ga0207667_100212907 140
1188 3300025949 Ga0207667_10070161 Ga0207667_100701616 140
1189 3300025949 Ga0207667_10071295 Ga0207667_100712956 140
1190 3300025949 Ga0207667_11811993 Ga0207667_118119931 140
1191 3300025960 Ga0207651_10012611 Ga0207651_100126116 140
1192 3300025960 Ga0207651_10197727 Ga0207651_101977271 140
1193 3300025960 Ga0207651_10977347 Ga0207651_109773472 140
1194 3300025961 Ga0207712_10003146 Ga0207712_100031469 140
1195 3300025961 Ga0207712_10539391 Ga0207712_105393912 140
1196 3300025961 Ga0207712_10774951 Ga0207712_107749511 140
1197 3300025981 Ga0207640_10183861 Ga0207640_101838612 140
1198 3300025981 Ga0207640_10568825 Ga0207640_105688252 140
1199 3300025986 Ga0207658_10101054 Ga0207658_101010543 140
1200 3300025986 Ga0207658_10134934 Ga0207658_101349342 140
1201 3300025986 Ga0207658_10462178 Ga0207658_104621782 140
1202 3300025986 Ga0207658_10863586 Ga0207658_108635861 140
1203 3300025986 Ga0207658_10870731 Ga0207658_108707311 140
1204 3300025986 Ga0207658_11428116 Ga0207658_114281161 140
1205 3300026023 Ga0207677_10224814 Ga0207677_102248144 140
1206 3300026023 Ga0207677_10306818 Ga0207677_103068182 140
1207 3300026023 Ga0207677_10812374 Ga0207677_108123741 140
1208 3300026035 Ga0207703_10069669 Ga0207703_100696692 140
1209 3300026035 Ga0207703_10120083 Ga0207703_101200833 140
1210 3300026035 Ga0207703_10172273 Ga0207703_101722732 140
1211 3300026035 Ga0207703_10339060 Ga0207703_103390602 140
1212 3300026035 Ga0207703_11335727 Ga0207703_113357272 140
1213 3300026035 Ga0207703_11683800 Ga0207703_116838001 140
1214 3300026041 Ga0207639_10045508 Ga0207639_100455084 140
1215 3300026041 Ga0207639_10209326 Ga0207639_102093261 140
1216 3300026041 Ga0207639_10341680 Ga0207639_103416802 140
1217 3300026041 Ga0207639_10390135 Ga0207639_103901352 140
1218 3300026041 Ga0207639_10749435 Ga0207639_107494351 140
1219 3300026041 Ga0207639_10937646 Ga0207639_109376461 140
1220 3300026041 Ga0207639_11696704 Ga0207639_116967041 140
1221 3300026075 Ga0207708_11650427 Ga0207708_116504271 140
1222 3300026078 Ga0207702_10049903 Ga0207702_100499036 140
1223 3300026078 Ga0207702_10120702 Ga0207702_101207022 140
1224 3300026078 Ga0207702_10206316 Ga0207702_102063161 140
1225 3300026078 Ga0207702_10256020 Ga0207702_102560202 140
1226 3300026078 Ga0207702_10440394 Ga0207702_104403942 140
1227 3300026078 Ga0207702_10605810 Ga0207702_106058102 140
1228 3300026088 Ga0207641_10082414 Ga0207641_100824143 140
1229 3300026088 Ga0207641_10097869 Ga0207641_100978696 140
1230 3300026088 Ga0207641_10203132 Ga0207641_102031322 140
1231 3300026088 Ga0207641_10340938 Ga0207641_103409382 140
1232 3300026088 Ga0207641_11168754 Ga0207641_111687542 140
1233 3300026089 Ga0207648_10073228 Ga0207648_100732284 140
1234 3300026089 Ga0207648_10181282 Ga0207648_101812825 140
1235 3300026089 Ga0207648_10409100 Ga0207648_104091002 140
1236 3300026095 Ga0207676_10006640 Ga0207676_100066406 140
1237 3300026095 Ga0207676_10146864 Ga0207676_101468642 140
1238 3300026095 Ga0207676_10211529 Ga0207676_102115292 140
1239 3300026095 Ga0207676_12189824 Ga0207676_121898241 140
1240 3300026116 Ga0207674_10016607 Ga0207674_100166077 140
1241 3300026116 Ga0207674_10068105 Ga0207674_100681056 140
1242 3300026116 Ga0207674_10085677 Ga0207674_100856773 140
1243 3300026116 Ga0207674_10092133 Ga0207674_100921336 140
1244 3300026116 Ga0207674_10500098 Ga0207674_105000982 140
1245 3300026116 Ga0207674_10666325 Ga0207674_106663251 140
1246 3300026118 Ga0207675_100069431 Ga0207675_10006943110 140
1247 3300026118 Ga0207675_101389841 Ga0207675_1013898412 140
1248 3300026118 Ga0207675_101681455 Ga0207675_1016814551 140
1249 3300026121 Ga0207683_10151323 Ga0207683_101513232 140
1250 3300026121 Ga0207683_10152334 Ga0207683_101523342 140
1251 3300026121 Ga0207683_10798177 Ga0207683_107981771 140
1252 3300026142 Ga0207698_10009875 Ga0207698_100098756 140
1253 3300026142 Ga0207698_10016901 Ga0207698_100169014 140
1254 3300026142 Ga0207698_10346841 Ga0207698_103468412 140
1255 3300026142 Ga0207698_10549016 Ga0207698_105490162 140
1256 3300028379 Ga0268266_10021412 Ga0268266_100214126 140
1257 3300028379 Ga0268266_10424516 Ga0268266_104245162 140
1258 3300028380 Ga0268265_10358419 Ga0268265_103584192 140
1259 3300028380 Ga0268265_11075304 Ga0268265_110753042 140
1260 3300028381 Ga0268264_10016109 Ga0268264_100161092 140
1261 3300028381 Ga0268264_10207754 Ga0268264_102077542 140
1262 3300028381 Ga0268264_10447531 Ga0268264_104475312 140
1263 3300028381 Ga0268264_12500210 Ga0268264_125002101 140
1264 3300028577 Ga0265318_10011693 Ga0265318_100116933 140
1265 3300028800 Ga0265338_10054342 Ga0265338_100543423 140
1266 3300028800 Ga0265338_10206263 Ga0265338_102062632 140
1267 3300028800 Ga0265338_10302524 Ga0265338_103025243 140
1268 3300028800 Ga0265338_10692706 Ga0265338_106927062 140
1269 3300028800 Ga0265338_10889284 Ga0265338_108892841 140
1270 3300030760 Ga0265762_1106763 Ga0265762_11067631 140
1271 3300030762 Ga0265775_103369 Ga0265775_1033692 140
1272 3300031090 Ga0265760_10073850 Ga0265760_100738502 140
1273 3300031090 Ga0265760_10172429 Ga0265760_101724291 140
1274 3300031090 Ga0265760_10228481 Ga0265760_102284811 140
1275 3300031235 Ga0265330_10250292 Ga0265330_102502921 140
1276 3300031235 Ga0265330_10251180 Ga0265330_102511802 140
1277 3300031241 Ga0265325_10027317 Ga0265325_100273174 140
1278 3300031241 Ga0265325_10109103 Ga0265325_101091032 140
1279 3300031247 Ga0265340_10040215 Ga0265340_100402152 140
1280 3300031250 Ga0265331_10070798 Ga0265331_100707981 140
1281 3300031250 Ga0265331_10089844 Ga0265331_100898442 140
1282 3300031250 Ga0265331_10338182 Ga0265331_103381821 140
1283 3300031250 Ga0265331_10343667 Ga0265331_103436672 140
1284 3300031250 Ga0265331_10445723 Ga0265331_104457232 140
1285 3300031251 Ga0265327_10063515 Ga0265327_100635152 140
1286 3300031344 Ga0265316_10001314 Ga0265316_1000131425 140
1287 3300031344 Ga0265316_10007548 Ga0265316_100075487 140
1288 3300031344 Ga0265316_10033449 Ga0265316_100334495 140
1289 3300031344 Ga0265316_10067016 Ga0265316_100670166 140
1290 3300031344 Ga0265316_10101319 Ga0265316_101013192 140
1291 3300031344 Ga0265316_10270427 Ga0265316_102704272 140
1292 3300031344 Ga0265316_10293198 Ga0265316_102931982 140
1293 3300031344 Ga0265316_10526766 Ga0265316_105267661 140
1294 3300031344 Ga0265316_10773848 Ga0265316_107738481 140
1295 3300031344 Ga0265316_10868165 Ga0265316_108681651 140
1296 3300031344 Ga0265316_11073145 Ga0265316_110731451 140
1297 3300031344 Ga0265316_11128060 Ga0265316_111280601 140
1298 3300031595 Ga0265313_10012996 Ga0265313_100129962 140
1299 3300031711 Ga0265314_10055511 Ga0265314_100555112 140
1300 3300031711 Ga0265314_10151872 Ga0265314_101518723 140
1301 3300031712 Ga0265342_10084206 Ga0265342_100842063 140
1302 3300035083 Ga0373926_0006956 Ga0373926_0006956_1769_2206 140
1303 3300035083 Ga0373926_0348587 Ga0373926_0348587_48_476 140
1304 3300035084 Ga0373928_0013532 Ga0373928_0013532_291_713 140
1305 3300035084 Ga0373928_0150792 Ga0373928_0150792_44_466 140
1306 3300035086 Ga0373934_0021690 Ga0373934_0021690_398_826 140
1307 3300035086 Ga0373934_0045842 Ga0373934_0045842_1130_1558 140
1308 3300035089 Ga0373944_0143572 Ga0373944_0143572_304_732 140
1309 3300035111 Ga0373923_0380102 Ga0373923_0380102_138_566 140
1310 3300035112 Ga0373932_0113268 Ga0373932_0113268_417_839 140
1311 3300035113 Ga0373936_0100591 Ga0373936_0100591_193_621 140
1312 3300035113 Ga0373936_0472085 Ga0373936_0472085_69_503 140
1313 3300035115 Ga0373941_0407221 Ga0373941_0407221_102_539 140
1314 3300035116 Ga0373945_0153546 Ga0373945_0153546_453_884 140
1315 3300035117 Ga0373953_0186434 Ga0373953_0186434_115_537 140
1316 3300035117 Ga0373953_0249603 Ga0373953_0249603_55_483 140
1317 3300035118 Ga0373954_0064249 Ga0373954_0064249_799_1227 140
1318 3300035118 Ga0373954_0137445 Ga0373954_0137445_73_501 140
1319 3300035118 Ga0373954_0339067 Ga0373954_0339067_14_442 140
1320 3300035119 Ga0373956_0123334 Ga0373956_0123334_463_894 140
1321 3300035120 Ga0373957_0094581 Ga0373957_0094581_226_654 140
1322 3300035120 Ga0373957_0468153 Ga0373957_0468153_102_530 140
1323 3300035170 Ga0373943_0006464 Ga0373943_0006464_1959_2387 140
1324 3300035170 Ga0373943_0366742 Ga0373943_0366742_33_464 140
1325 3300035170 Ga0373943_0572436 Ga0373943_0572436_37_465 140
1326 3300035171 Ga0373946_0071032 Ga0373946_0071032_836_1264 140
1327 3300035171 Ga0373946_0233713 Ga0373946_0233713_305_733 140
1328 3300035171 Ga0373946_0318424 Ga0373946_0318424_129_557 140
1329 3300035172 Ga0373955_0023160 Ga0373955_0023160_1289_1717 140
1330 3300035172 Ga0373955_0120824 Ga0373955_0120824_253_681 140
1331 3300035172 Ga0373955_0263653 Ga0373955_0263653_74_502 140
1332 3300035691 Ga0373931_0860368 Ga0373931_0860368_38_466 140
1333 3300035692 Ga0373935_0029628 Ga0373935_0029628_2336_2764 140
1334 3300035692 Ga0373935_0064571 Ga0373935_0064571_1599_2027 140
1335 3300035692 Ga0373935_0362104 Ga0373935_0362104_400_828 140
1336 3300035695 Ga0373927_0001719 Ga0373927_0001719_10860_11291 140
1337 3300035695 Ga0373927_0033099 Ga0373927_0033099_1942_2379 140
1338 3300035695 Ga0373927_0778051 Ga0373927_0778051_19_447 140
1339 3300035724 Ga0373933_0197266 Ga0373933_0197266_838_1266 140
1340 3300035724 Ga0373933_0766130 Ga0373933_0766130_45_473 140
1341 3300035724 Ga0373933_1185337 Ga0373933_1185337_58_486 140
1342 3300035725 Ga0373947_0003896 Ga0373947_0003896_1369_1800 140
1343 3300035725 Ga0373947_0016431 Ga0373947_0016431_2831_3259 140
1344 3300035725 Ga0373947_0161506 Ga0373947_0161506_349_777 140
1345 3300035725 Ga0373947_0527159 Ga0373947_0527159_77_514 140
1346 3300035725 Ga0373947_0695562 Ga0373947_0695562_185_613 140
1347 3300036401 Ga0373937_0028911 Ga0373937_0028911_3475_3903 140
1348 3300036401 Ga0373937_0198764 Ga0373937_0198764_1026_1454 140
1349 3300036401 Ga0373937_0328502 Ga0373937_0328502_111_539 140
1350 3300036401 Ga0373937_0426859 Ga0373937_0426859_593_1021 140
1351 3300036401 Ga0373937_0625822 Ga0373937_0625822_512_940 140
1352 3300036401 Ga0373937_1069058 Ga0373937_1069058_282_710 140
1353 3300036457 Ga0265778_011924 Ga0265778_011924_439_867 140
1354 3300037068 Ga0373925_0009542 Ga0373925_0009542_4892_5320 140
1355 3300037068 Ga0373925_0016284 Ga0373925_0016284_1499_1930 140
1356 3300037068 Ga0373925_0031340 Ga0373925_0031340_2350_2778 140
1357 3300037068 Ga0373925_0105223 Ga0373925_0105223_649_1080 140
1358 3300037068 Ga0373925_0167391 Ga0373925_0167391_103_531 140
1359 3300037068 Ga0373925_0187798 Ga0373925_0187798_427_855 140
1360 3300037068 Ga0373925_0197899 Ga0373925_0197899_698_1126 140
1361 3300037068 Ga0373925_0436539 Ga0373925_0436539_440_877 140
1362 3300037068 Ga0373925_0703435 Ga0373925_0703435_263_694 140
1363 3300037068 Ga0373925_0849683 Ga0373925_0849683_172_600 140
1364 3300037068 Ga0373925_0920895 Ga0373925_0920895_145_573 140
1365 3300037418 Ga0395900_1929699 Ga0395900_1929699_54_482 140
1366 3300037853 Ga0436364_0656271 Ga0436364_0656271_384_812 140
1367 3300037853 Ga0436364_1088472 Ga0436364_1088472_1094_1522 140
1368 3300037853 Ga0436364_1149820 Ga0436364_1149820_21_449 140
1369 3300039437 Ga0436365_0931713 Ga0436365_0931713_335_763 140
1370 3300039438 Ga0436360_0560131 Ga0436360_0560131_27_455 140
1371 3300039438 Ga0436360_1059506 Ga0436360_1059506_100_528 140
1372 3300039447 Ga0436361_0600685 Ga0436361_0600685_297_725 140
1373 3300039450 Ga0436363_0310931 Ga0436363_0310931_112_540 140
1374 3300039450 Ga0436363_1010169 Ga0436363_1010169_54_482 140
1375 3300039450 Ga0436363_1537811 Ga0436363_1537811_96_524 140
1376 3300039453 Ga0436362_0350632 Ga0436362_0350632_1038_1466 140
1377 3300039453 Ga0436362_0757945 Ga0436362_0757945_68_496 140
1378 3300039453 Ga0436362_1011805 Ga0436362_1011805_87_515 140
1379 3300039453 Ga0436362_1230516 Ga0436362_1230516_106_534 140
1380 3300041486 Ga0451807_2678434 Ga0451807_2678434_309_734 140
1381 3300041511 Ga0451855_1247256 Ga0451855_1247256_39_467 140
1382 3300042876 Ga0451577_0003967 Ga0451577_0003967_1629_2051 140
1383 3300042876 Ga0451577_0028183 Ga0451577_0028183_1320_1769 140
1384 3300042876 Ga0451577_0028471 Ga0451577_0028471_162_584 140
1385 3300042876 Ga0451577_0099005 Ga0451577_0099005_1219_1641 140
1386 3300042876 Ga0451577_0125417 Ga0451577_0125417_425_847 140
1387 3300042876 Ga0451577_0173135 Ga0451577_0173135_1292_1714 140
1388 3300042876 Ga0451577_0210923 Ga0451577_0210923_409_831 140
1389 3300042876 Ga0451577_0933670 Ga0451577_0933670_86_514 140
1390 3300044673 Ga0453683_0000002 Ga0453683_0000002_921174_921596 140
1391 3300044673 Ga0453683_0000075 Ga0453683_0000075_101799_102221 140
1392 3300044673 Ga0453683_0002122 Ga0453683_0002122_1376_1798 140
1393 3300044673 Ga0453683_0002232 Ga0453683_0002232_13645_14094 140
1394 3300044673 Ga0453683_0004112 Ga0453683_0004112_1348_1770 140
1395 3300044673 Ga0453683_0004693 Ga0453683_0004693_9055_9477 140
1396 3300044673 Ga0453683_0006996 Ga0453683_0006996_5991_6413 140
1397 3300044673 Ga0453683_0138466 Ga0453683_0138466_1079_1501 140
1398 3300044673 Ga0453683_0202278 Ga0453683_0202278_135_557 140
1399 3300044673 Ga0453683_0207795 Ga0453683_0207795_151_573 140
1400 3300044673 Ga0453683_0228629 Ga0453683_0228629_612_1034 140
1401 3300044673 Ga0453683_0239083 Ga0453683_0239083_408_830 140
1402 3300044673 Ga0453683_0429302 Ga0453683_0429302_373_795 140
1403 3300044673 Ga0453683_0443324 Ga0453683_0443324_253_675 140
1404 3300044712 Ga0453684_0001225 Ga0453684_0001225_64765_65187 140
1405 3300044712 Ga0453684_0010338 Ga0453684_0010338_1629_2051 140
1406 3300044712 Ga0453684_0011463 Ga0453684_0011463_13588_14010 140
1407 3300044712 Ga0453684_0013713 Ga0453684_0013713_10907_11329 140
1408 3300044712 Ga0453684_0014912 Ga0453684_0014912_10236_10658 140
1409 3300044712 Ga0453684_0028706 Ga0453684_0028706_1201_1650 140
1410 3300044712 Ga0453684_0029890 Ga0453684_0029890_914_1336 140
1411 3300044712 Ga0453684_0035204 Ga0453684_0035204_1210_1632 140
1412 3300044712 Ga0453684_0035213 Ga0453684_0035213_5203_5625 140
1413 3300044712 Ga0453684_0221982 Ga0453684_0221982_1311_1733 140
1414 3300044712 Ga0453684_0271517 Ga0453684_0271517_781_1203 140
1415 3300044712 Ga0453684_0296692 Ga0453684_0296692_1283_1705 140
1416 3300044712 Ga0453684_0392328 Ga0453684_0392328_335_757 140
1417 3300044712 Ga0453684_0427169 Ga0453684_0427169_1009_1431 140
1418 3300044712 Ga0453684_0762724 Ga0453684_0762724_507_935 140
1419 3300044712 Ga0453684_0769817 Ga0453684_0769817_466_888 140
1420 3300044712 Ga0453684_2168520 Ga0453684_2168520_31_453 140
1421 3300044719 Ga0466971_0342723 Ga0466971_0342723_109_537 140
1422 3300044842 Ga0466957_0505455 Ga0466957_0505455_158_586 140
1423 3300045049 Ga0466959_0475082 Ga0466959_0475082_31_459 140
1424 3300045051 Ga0451576_0001727 Ga0451576_0001727_1324_1746 140
1425 3300045051 Ga0451576_0004781 Ga0451576_0004781_8916_9365 140
1426 3300045051 Ga0451576_0005241 Ga0451576_0005241_943_1365 140
1427 3300045051 Ga0451576_0032803 Ga0451576_0032803_3702_4124 140
1428 3300045051 Ga0451576_0036131 Ga0451576_0036131_2780_3202 140
1429 3300045051 Ga0451576_0138590 Ga0451576_0138590_190_612 140
1430 3300045051 Ga0451576_0222858 Ga0451576_0222858_435_863 140
1431 3300045051 Ga0451576_0256198 Ga0451576_0256198_497_925 140
1432 3300045051 Ga0451576_0273269 Ga0451576_0273269_665_1087 140
1433 3300045051 Ga0451576_0309752 Ga0451576_0309752_943_1371 140
1434 3300045051 Ga0451576_0333268 Ga0451576_0333268_274_696 140
1435 3300045051 Ga0451576_0370125 Ga0451576_0370125_473_895 140
1436 3300045051 Ga0451576_0396796 Ga0451576_0396796_641_1069 140
1437 3300045051 Ga0451576_0599502 Ga0451576_0599502_542_964 140
1438 3300045051 Ga0451576_0641954 Ga0451576_0641954_634_1056 140
1439 3300045051 Ga0451576_0678999 Ga0451576_0678999_590_1012 140
1440 3300045051 Ga0451576_0901347 Ga0451576_0901347_288_719 140
1441 3300045051 Ga0451576_1147915 Ga0451576_1147915_376_798 140
1442 3300045051 Ga0451576_1263593 Ga0451576_1263593_322_744 140
1443 3300045051 Ga0451576_1321500 Ga0451576_1321500_278_700 140
1444 3300045051 Ga0451576_1409929 Ga0451576_1409929_66_494 140
1445 3300045051 Ga0451576_1747275 Ga0451576_1747275_32_454 140
1446 3300045836 Ga0466958_0042921 Ga0466958_0042921_459_887 140
1447 3300045976 Ga0466967_0178061 Ga0466967_0178061_1173_1601 140
1448 3300045976 Ga0466967_0606929 Ga0466967_0606929_455_883 140
1449 3300045976 Ga0466967_1425483 Ga0466967_1425483_118_546 140
1450 3300046454 Ga0495592_0023757 Ga0495592_0023757_1322_1750 140
1451 3300046454 Ga0495592_0187843 Ga0495592_0187843_713_1141 140
1452 3300046455 Ga0495603_0217457 Ga0495603_0217457_427_855 140
1453 3300046462 Ga0495651_0027888 Ga0495651_0027888_1920_2348 140
1454 3300046462 Ga0495651_0048591 Ga0495651_0048591_2592_3020 140
1455 3300046463 Ga0495653_0475312 Ga0495653_0475312_69_497 140
1456 3300046472 Ga0495580_0012363 Ga0495580_0012363_4213_4641 140
1457 3300046472 Ga0495580_0023177 Ga0495580_0023177_1409_1840 140
1458 3300046472 Ga0495580_0023989 Ga0495580_0023989_3424_3861 140
1459 3300046472 Ga0495580_0029617 Ga0495580_0029617_2128_2556 140
1460 3300046472 Ga0495580_0030495 Ga0495580_0030495_2961_3392 140
1461 3300046472 Ga0495580_0088205 Ga0495580_0088205_1559_1987 140
1462 3300046472 Ga0495580_0127171 Ga0495580_0127171_573_1001 140
1463 3300046472 Ga0495580_0178602 Ga0495580_0178602_285_713 140
1464 3300046472 Ga0495580_0293569 Ga0495580_0293569_615_1052 140
1465 3300046472 Ga0495580_0388283 Ga0495580_0388283_26_454 140
1466 3300046472 Ga0495580_0929845 Ga0495580_0929845_90_527 140
1467 3300046473 Ga0495582_0022430 Ga0495582_0022430_1464_1892 140
1468 3300046473 Ga0495582_0918982 Ga0495582_0918982_10_438 140
1469 3300046475 Ga0495639_0230055 Ga0495639_0230055_103_531 140
1470 3300046476 Ga0495662_0043206 Ga0495662_0043206_675_1103 140
1471 3300046476 Ga0495662_0151718 Ga0495662_0151718_579_1010 140
1472 3300046476 Ga0495662_0289647 Ga0495662_0289647_251_679 140
1473 3300046477 Ga0495664_0024694 Ga0495664_0024694_686_1114 140
1474 3300046477 Ga0495664_0453920 Ga0495664_0453920_273_701 140
1475 3300046499 Ga0495594_0308925 Ga0495594_0308925_222_650 140
1476 3300046511 Ga0495608_0077894 Ga0495608_0077894_812_1240 140
1477 3300046511 Ga0495608_0284462 Ga0495608_0284462_241_669 140
1478 3300046514 Ga0495618_0169570 Ga0495618_0169570_445_873 140
1479 3300046516 Ga0495628_0010572 Ga0495628_0010572_6015_6443 140
1480 3300046516 Ga0495628_0583777 Ga0495628_0583777_148_576 140
1481 3300046516 Ga0495628_0688411 Ga0495628_0688411_281_709 140
1482 3300046516 Ga0495628_0934713 Ga0495628_0934713_77_505 140
1483 3300046517 Ga0495630_0094544 Ga0495630_0094544_578_1006 140
1484 3300046517 Ga0495630_0610875 Ga0495630_0610875_189_617 140
1485 3300046526 Ga0495666_0264501 Ga0495666_0264501_228_659 140
1486 3300046528 Ga0495642_0183506 Ga0495642_0183506_30_464 140
1487 3300046529 Ga0495652_0096288 Ga0495652_0096288_1199_1627 140
1488 3300046529 Ga0495652_0139956 Ga0495652_0139956_454_882 140
1489 3300046529 Ga0495652_0284319 Ga0495652_0284319_316_744 140
1490 3300046529 Ga0495652_0394223 Ga0495652_0394223_299_727 140
1491 3300046529 Ga0495652_0529066 Ga0495652_0529066_165_593 140
1492 3300046529 Ga0495652_0532377 Ga0495652_0532377_282_710 140
1493 3300046530 Ga0495654_0152044 Ga0495654_0152044_71_499 140
1494 3300046531 Ga0495665_0009280 Ga0495665_0009280_3966_4394 140
1495 3300046531 Ga0495665_0085461 Ga0495665_0085461_106_534 140
1496 3300046531 Ga0495665_0107457 Ga0495665_0107457_157_585 140
1497 3300046531 Ga0495665_0316982 Ga0495665_0316982_227_658 140
1498 3300046533 Ga0495640_0121071 Ga0495640_0121071_561_989 140
1499 3300046533 Ga0495640_0363549 Ga0495640_0363549_179_607 140
1500 3300046533 Ga0495640_0963270 Ga0495640_0963270_30_461 140
1501 3300046536 Ga0495587_0000336 Ga0495587_0000336_19603_20031 140
1502 3300046536 Ga0495587_0034621 Ga0495587_0034621_2574_3002 140
1503 3300046536 Ga0495587_0614109 Ga0495587_0614109_26_454 140
1504 3300046543 Ga0495645_0007171 Ga0495645_0007171_5946_6374 140
1505 3300046543 Ga0495645_0149505 Ga0495645_0149505_1068_1496 140
1506 3300046543 Ga0495645_0188652 Ga0495645_0188652_919_1347 140
1507 3300046543 Ga0495645_0351093 Ga0495645_0351093_156_584 140
1508 3300046559 Ga0495667_0025931 Ga0495667_0025931_956_1384 140
1509 3300046559 Ga0495667_0213520 Ga0495667_0213520_669_1097 140
1510 3300046559 Ga0495667_0649029 Ga0495667_0649029_194_622 140
1511 3300046642 Ga0495634_0068987 Ga0495634_0068987_1352_1780 140
1512 3300046642 Ga0495634_0407941 Ga0495634_0407941_168_596 140
1513 3300046663 Ga0495635_0026942 Ga0495635_0026942_1115_1543 140
1514 3300046663 Ga0495635_0624136 Ga0495635_0624136_62_490 140
1515 3300046678 Ga0495599_0019509 Ga0495599_0019509_179_607 140
1516 3300046678 Ga0495599_0033693 Ga0495599_0033693_1748_2176 140
1517 3300046678 Ga0495599_0180759 Ga0495599_0180759_691_1119 140
1518 3300046678 Ga0495599_0371939 Ga0495599_0371939_135_563 140
1519 3300046679 Ga0495623_0027406 Ga0495623_0027406_2550_2978 140
1520 3300046679 Ga0495623_0086938 Ga0495623_0086938_1279_1707 140
1521 3300046679 Ga0495623_0111431 Ga0495623_0111431_980_1408 140
1522 3300046679 Ga0495623_0244224 Ga0495623_0244224_56_484 140
1523 3300046680 Ga0495646_0080108 Ga0495646_0080108_97_525 140
1524 3300046683 Ga0495658_0016731 Ga0495658_0016731_2869_3297 140
1525 3300046683 Ga0495658_0413110 Ga0495658_0413110_304_732 140
1526 3300046683 Ga0495658_0908389 Ga0495658_0908389_113_550 140
1527 3300046684 Ga0495669_0138369 Ga0495669_0138369_206_634 140
1528 3300046689 Ga0495613_0585565 Ga0495613_0585565_72_500 140
1529 3300046690 Ga0495624_0337596 Ga0495624_0337596_291_719 140
1530 3300046694 Ga0495649_0461488 Ga0495649_0461488_13_441 140
1531 3300046809 Ga0495600_0013166 Ga0495600_0013166_3683_4111 140
1532 3300047315 Ga0495581_0376593 Ga0495581_0376593_208_636 140
1533 3300047317 Ga0495604_0088514 Ga0495604_0088514_303_731 140
1534 3300047317 Ga0495604_0412952 Ga0495604_0412952_53_481 140
1535 3300047317 Ga0495604_0495478 Ga0495604_0495478_101_529 140
1536 3300047318 Ga0495636_0120637 Ga0495636_0120637_144_572 140
1537 3300047319 Ga0495674_0008368 Ga0495674_0008368_2274_2702 140
1538 3300047319 Ga0495674_0021292 Ga0495674_0021292_3960_4388 140
1539 3300047319 Ga0495674_0277501 Ga0495674_0277501_337_765 140
1540 3300047319 Ga0495674_0593101 Ga0495674_0593101_389_817 140
1541 3300047319 Ga0495674_0753754 Ga0495674_0753754_224_652 140
1542 3300047319 Ga0495674_1027410 Ga0495674_1027410_31_459 140
1543 3300047322 Ga0495680_0009543 Ga0495680_0009543_4838_5266 140
1544 3300047322 Ga0495680_0172767 Ga0495680_0172767_959_1387 140
1545 3300047322 Ga0495680_0273497 Ga0495680_0273497_54_482 140
1546 3300047444 Ga0495675_0270691 Ga0495675_0270691_371_799 140
1547 3300047444 Ga0495675_0722514 Ga0495675_0722514_35_463 140
1548 3300047471 Ga0495684_0059377 Ga0495684_0059377_1536_1964 140
1549 3300047471 Ga0495684_0061272 Ga0495684_0061272_1446_1874 140
1550 3300047471 Ga0495684_0193971 Ga0495684_0193971_337_765 140
1551 3300047471 Ga0495684_0648584 Ga0495684_0648584_67_495 140
1552 3300047673 Ga0495593_0408973 Ga0495593_0408973_74_502 140
1553 3300048088 Ga0495602_0002172 Ga0495602_0002172_17861_18289 140
1554 3300048088 Ga0495602_0086900 Ga0495602_0086900_636_1064 140
1555 3300048088 Ga0495602_0376090 Ga0495602_0376090_356_784 140
1556 3300048088 Ga0495602_0614631 Ga0495602_0614631_108_536 140
1557 3300048088 Ga0495602_0661740 Ga0495602_0661740_210_638 140
1558 3300048088 Ga0495602_1008010 Ga0495602_1008010_22_450 140
1559 3300048904 Ga0496101_1610231 Ga0496101_1610231_25_453 140
1560 3300048907 Ga0496104_0445908 Ga0496104_0445908_195_623 140
1561 3300048907 Ga0496104_0668185 Ga0496104_0668185_356_784 140
1562 3300048907 Ga0496104_0971048 Ga0496104_0971048_144_572 140
1563 3300048907 Ga0496104_1349134 Ga0496104_1349134_89_517 140
1564 3300048909 Ga0496106_0301046 Ga0496106_0301046_63_491 140
1565 3300048912 Ga0496109_0594315 Ga0496109_0594315_48_488 140
1566 3300048915 Ga0496112_0501711 Ga0496112_0501711_690_1127 140
1567 3300048918 Ga0496115_0134495 Ga0496115_0134495_1171_1608 140
1568 3300048918 Ga0496115_0152875 Ga0496115_0152875_1448_1876 140
1569 3300048918 Ga0496115_0501758 Ga0496115_0501758_367_795 140
1570 3300048918 Ga0496115_0741324 Ga0496115_0741324_320_748 140
1571 3300048918 Ga0496115_0773764 Ga0496115_0773764_11_445 140
1572 3300049568 Ga0501031_0024798 Ga0501031_0024798_1349_1777 140
1573 3300049569 Ga0501032_0032955 Ga0501032_0032955_1668_2096 140
1574 3300049570 Ga0501033_0057175 Ga0501033_0057175_1001_1429 140
1575 3300049571 Ga0501034_0164665 Ga0501034_0164665_373_801 140
1576 3300049572 Ga0501036_0000271 Ga0501036_0000271_1455_1883 140
1577 3300049573 Ga0501037_0113122 Ga0501037_0113122_1455_1883 140
1578 3300049574 Ga0501038_0041377 Ga0501038_0041377_1455_1883 140
1579 3300049575 Ga0501039_0001023 Ga0501039_0001023_100_528 140
1580 3300049579 Ga0501043_0108308 Ga0501043_0108308_1455_1883 140
1581 3300049580 Ga0501046_0001715 Ga0501046_0001715_1320_1748 140
1582 3300049581 Ga0501047_0078052 Ga0501047_0078052_1395_1823 140
1583 3300049581 Ga0501047_0165397 Ga0501047_0165397_200_628 140
1584 3300049582 Ga0501048_0002444 Ga0501048_0002444_11849_12277 140
1585 3300049583 Ga0501067_0008591 Ga0501067_0008591_1455_1883 140
1586 3300049584 Ga0501068_0011651 Ga0501068_0011651_2591_3019 140
1587 3300049585 Ga0501069_0033574 Ga0501069_0033574_1010_1438 140
1588 3300049586 Ga0501070_0459034 Ga0501070_0459034_171_599 140
1589 3300049588 Ga0501072_0029641 Ga0501072_0029641_2484_2912 140
1590 3300049589 Ga0501073_0022059 Ga0501073_0022059_2769_3197 140
1591 3300049590 Ga0501074_0071146 Ga0501074_0071146_618_1046 140
1592 3300049592 Ga0501076_0338085 Ga0501076_0338085_211_639 140
1593 3300049593 Ga0501077_0025080 Ga0501077_0025080_2283_2711 140
1594 3300049669 Ga0501235_047766 Ga0501235_047766_431_859 140
1595 3300049680 Ga0501250_032609 Ga0501250_032609_103_531 140
1596 3300049688 Ga0501259_072921 Ga0501259_072921_173_601 140
1597 3300049705 Ga0501225_0052312 Ga0501225_0052312_214_642 140
1598 3300049741 Ga0501079_0014191 Ga0501079_0014191_1454_1882 140
1599 3300049742 Ga0501080_0052114 Ga0501080_0052114_1989_2417 140
1600 3300049744 Ga0501083_0054848 Ga0501083_0054848_791_1219 140
1601 3300049822 Ga0501035_0119002 Ga0501035_0119002_1455_1883 140
1602 3300049823 Ga0501044_0116744 Ga0501044_0116744_791_1219 140
1603 3300050508 nmdc:mga09592_262536_c1 nmdc:mga09592_262536_c1_10_435 140
1604 3300050508 nmdc:mga09592_434945_c1 nmdc:mga09592_434945_c1_47_472 140
1605 3300050508 nmdc:mga09592_552004_c1 nmdc:mga09592_552004_c1_168_599 140
1606 3300050509 nmdc:mga0qj67_29683_c1 nmdc:mga0qj67_29683_c1_2627_3058 140
1607 3300050510 nmdc:mga06r32_464452_c1 nmdc:mga06r32_464452_c1_689_1120 140
1608 3300050510 nmdc:mga06r32_73091_c1 nmdc:mga06r32_73091_c1_1174_1599 140
1609 3300050512 nmdc:mga0n895_837255_c1 nmdc:mga0n895_837255_c1_63_491 140
1610 3300050513 nmdc:mga0rr50_448736_c1 nmdc:mga0rr50_448736_c1_645_1067 140
1611 3300053085 Ga0495619_0442875 Ga0495619_0442875_269_697 140
1612 3300053139 Ga0500568_0003342 Ga0500568_0003342_1404_1841 140
1613 3300054114 Ga0501084_0088994 Ga0501084_0088994_777_1205 140
1614 3300059477 Ga0587084_043643 Ga0587084_043643_299_730 140
1615 3300059491 Ga0587070_083707 Ga0587070_083707_188_619 140
1616 3300059492 Ga0587073_0060500 Ga0587073_0060500_349_774 140
1617 3300059506 Ga0587085_097648 Ga0587085_097648_55_486 140
1618 3300059511 Ga0587091_059570 Ga0587091_059570_282_710 140
1619 3300059512 Ga0587092_017348 Ga0587092_017348_299_730 140
1620 3300059623 Ga0587101_126038 Ga0587101_126038_14_451 140
1621 3300059624 Ga0587109_078498 Ga0587109_078498_210_641 140
1622 3300059624 Ga0587109_096569 Ga0587109_096569_89_517 140
1623 3300059639 Ga0587062_010776 Ga0587062_010776_393_824 140
1624 3300059655 Ga0587114_021420 Ga0587114_021420_306_734 140
1625 3300060346 Ga0587111_0123911 Ga0587111_0123911_57_488 140
1626 3300060353 Ga0501082_0000140 Ga0501082_0000140_10335_10763 140
1627 3300060353 Ga0501082_0142200 Ga0501082_0142200_1455_1883 140
1628 3300061734 Ga0530510_0219539 Ga0530510_0219539_393_821 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00298

Ribosomal_L11

Ribosomal protein L11, RNA binding domain

73

140

0.99

PF03946

Ribosomal_L11_N

Ribosomal protein L11, N-terminal domain

9

68

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hc8-assembly2.cif.gz_B crystal structure of a conserved ribosomal protein-rna complex 0.9961 71 140
1mms-assembly2.cif.gz_B crystal structure of the ribosomal protein l11-rna complex 0.9917 71 140
1y39-assembly2.cif.gz_B co-evolution of protein and rna structures within a highly conserved ribosomal domain 0.9884 70 140
1hc8-assembly2.cif.gz_B crystal structure of a conserved ribosomal protein-rna complex 0.9821 71 140
1mms-assembly2.cif.gz_B crystal structure of the ribosomal protein l11-rna complex 0.9779 71 140
ID Description Score Start End Superfamily
af_I1J9L7_135_215_1.10.10.250 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9956 72 139 1.10.10.250
af_P54030_78_161_1.10.10.250 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9956 80 139 1.10.10.250
af_A0A0R4J4M9_4_71_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.977 3 67 3.30.1550.10
1hc8A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9765 67 140 1.10.10.250
1vq4I00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9725 73 140 1.10.10.250
ID Description Score Start End GO Terms
AF-A0A2S7TEL3-F1-model_v4 deleted 1.002 73 140
AF-A0A645A187-F1-model_v4 50S ribosomal protein L11 1.002 78 140 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A3C2CCG8-F1-model_v4 deleted 1.002 80 140
AF-A0A5N9EE46-F1-model_v4 50S ribosomal protein L11 1.001 1 67 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A2D7JF69-F1-model_v4 50S ribosomal protein L11 1 1 71 GO:0003735
GO:0006412
GO:0022625
GO:0070180

Feature Viewer

pLDDT pTM Quality
86.93 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map