metagRoot

F495003

General Info

Members	Datasets	Scaffolds	Average Seq Length
1603	591	1514	226

Family's Representative Sequence

Representative Sequence	3300025913\|Ga0207695_10000107\|Ga0207695_1000010741
Length	259
Sequence	MVSCEWRMALRSIRLFAIRYSPLTICHSMLILAIDTALEACAAAVLDTDAGELLAQEQLLMKRGHAEALMPMIARVMQSADLAFTALDRIAVTVGPGSFTGLRVGISAARGLALAAGRPAIGLSTLSAYAAAIVGQSGPAPVISAIDARHDHVYFQIVGGDGRQLERPKIAPIDEAIAASQFGAPHLVGNAAKILAERWPKDAPQPVAVDAQPAPDINWVAWLGAAADPGTNPARPFYLKAPDAKPAAQPLFAAQAATS

Samples

	Sample ID	Description	Type	Environment
1	2209111006	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1	Metagenome	Rhizosphere
2	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
3	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
4	2508501042	Bradyrhizobium sp. WSM1253	Isolate	Nodule
5	2513237094	Bradyrhizobium sp. WSM3983	Isolate	Nodule
6	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
7	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
8	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
9	2515154112	Bradyrhizobium sp. WSM4349	Isolate	Nodule
10	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
11	2791355196	Bradyrhizobium sp. Y36	Isolate	Nodule
12	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
13	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
14	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
15	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
16	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
17	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
18	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
19	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
20	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
21	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
22	2841941048	Bradyrhizobium sp. SBR1B	Isolate	Nodule
23	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
24	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
25	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
26	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
27	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
28	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
29	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
30	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
31	2874590934	Bradyrhizobium canariense UBMA181	Isolate	Nodule
32	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
33	2874645413	Bradyrhizobium canariense UBMA122	Isolate	Nodule
34	2876771140	Bradyrhizobium canariense UBMA192	Isolate	Nodule
35	2876818435	Bradyrhizobium canariense UBMA195	Isolate	Nodule
36	2879074833	Bradyrhizobium canariense UBMA171	Isolate	Nodule
37	2879127579	Bradyrhizobium canariense UBMA052	Isolate	Nodule
38	2879142872	Bradyrhizobium canariense UBMA061	Isolate	Nodule
39	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
40	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
41	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
42	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
43	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
44	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
45	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
46	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
47	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
48	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
49	2935769743	Bradyrhizobium sp. LB12.1	Isolate	Nodule
50	2935777560	Bradyrhizobium sp. LB14.3	Isolate	Nodule
51	2935785616	Bradyrhizobium sp. LB5.2	Isolate	Nodule
52	2935793552	Bradyrhizobium sp. LB8.2	Isolate	Nodule
53	2935819856	Bradyrhizobium sp. RT3b	Isolate	Nodule
54	2935847175	Bradyrhizobium sp. RT5a	Isolate	Nodule
55	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
56	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
57	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
58	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
59	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
60	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
61	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
62	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
63	2935975950	Bradyrhizobium sp. GM2.2	Isolate	Nodule
64	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
65	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
66	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
67	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
68	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
69	2936055302	Bradyrhizobium sp. JR4.1	Isolate	Nodule
70	2941531003	Bradyrhizobium sp. LB11.1	Isolate	Nodule
71	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
72	3300000043	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere	Metagenome	Rhizosphere
73	3300000044	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old	Metagenome	Rhizosphere
74	3300000045	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere	Metagenome	Rhizosphere
75	3300000652	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA	Metagenome	Rhizosphere
76	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
77	3300001976	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7	Metagenome	Rhizosphere
78	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
79	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
80	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
81	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
82	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
83	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
84	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
85	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
86	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
87	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
88	3300002126	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5	Metagenome	Rhizosphere
89	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
90	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
91	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
92	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
93	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
94	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
95	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
96	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
97	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
98	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
99	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
100	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
101	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
102	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
103	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
104	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
105	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
106	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
107	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
108	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
109	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
110	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
111	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
112	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
113	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
114	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
115	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
116	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
117	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
118	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
119	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
120	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
121	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
122	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
123	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
124	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
125	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
126	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
127	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
128	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
129	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
130	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
131	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
132	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
133	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
134	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
135	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
136	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
137	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
138	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
139	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
140	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
141	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
142	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
143	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
144	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
145	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
146	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
147	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
148	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
149	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
150	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
151	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
152	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
153	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
154	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
155	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
156	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
157	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
158	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
159	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
160	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
161	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
162	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
163	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
164	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
165	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
166	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
167	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
168	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
169	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
170	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
171	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
172	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
173	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
174	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
175	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
176	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
177	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
178	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
179	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
180	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
181	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
182	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
183	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
184	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
185	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
186	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
187	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
188	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
189	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
190	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
191	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
192	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
193	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
194	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
195	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
196	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
197	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
198	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
199	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
200	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
201	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
202	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
203	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
204	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
205	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
206	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
207	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
208	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
209	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
210	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
211	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
212	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
213	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
214	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
215	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
216	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
217	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
218	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
219	3300012503	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R	Metagenome	Rhizosphere
220	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
221	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
222	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
223	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
224	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
225	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
226	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
227	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
228	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
229	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
230	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
231	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
232	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
233	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
234	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
235	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
236	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
237	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
238	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2)	Metagenome	Rhizosphere
240	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
241	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
242	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
243	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
283	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
284	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
285	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
286	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
287	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
288	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
289	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
290	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
291	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
292	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
293	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
294	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
295	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
296	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
297	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
298	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
299	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
300	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
301	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
302	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
303	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
304	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
305	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
306	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
307	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
308	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
309	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
310	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
311	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
312	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
313	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
314	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
315	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
316	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
317	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
318	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
319	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
320	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
321	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
322	3300028023	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5	Metagenome	Rhizosphere
323	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
324	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
325	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
326	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
327	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
328	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
329	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
330	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
331	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
332	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
333	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
334	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
335	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
336	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
337	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
338	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
339	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
340	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
341	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
342	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
343	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
344	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
345	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
346	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
347	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
348	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
349	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
350	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
351	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
352	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
353	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
354	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
355	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
356	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
357	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
358	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
359	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
360	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
361	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
362	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
363	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
364	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
365	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
366	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
367	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
368	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
369	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
370	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
371	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
372	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
373	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
374	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
375	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
376	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
377	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
378	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
379	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
380	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
381	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
382	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
383	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
384	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
385	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
386	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
387	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
388	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
389	3300038996	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19	Metagenome	Rhizosphere
390	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
391	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
392	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
393	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
394	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
395	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
396	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
397	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
398	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
399	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
400	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
401	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
402	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
403	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
404	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
405	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
406	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
407	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
408	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
409	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
410	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
411	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
412	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
413	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
414	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
415	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
416	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
417	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
418	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
419	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
420	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
421	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
422	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
423	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
424	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
425	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
426	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
427	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
428	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
429	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
430	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
431	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
432	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
433	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
434	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
435	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
436	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
437	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
438	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
439	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
440	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
441	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
442	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
443	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
444	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
445	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
446	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
447	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
448	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
449	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
450	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
451	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
452	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
453	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
454	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
455	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
456	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
457	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
458	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
459	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
460	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
461	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
462	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
463	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
464	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
465	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
466	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
467	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
468	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
469	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
470	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
471	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
472	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
473	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
474	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
475	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
476	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
477	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
478	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
479	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
480	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
481	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
482	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
483	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
484	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
485	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
486	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
487	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
488	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
489	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
490	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
491	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
492	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
493	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
494	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
495	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
496	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
497	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
498	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
499	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
500	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
501	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
502	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
503	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
504	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
505	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
506	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
507	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
508	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
509	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
510	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
511	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
512	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
513	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
514	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
515	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
516	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
517	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
518	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
519	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
520	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
521	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
522	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
523	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
524	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
525	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
526	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
527	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
528	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
529	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
530	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
531	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
532	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
533	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
534	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
535	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
536	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
537	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
538	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
539	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
540	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
541	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
542	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
543	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
544	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
545	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
546	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
547	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
548	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
549	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
550	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
551	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
552	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
553	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
554	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
555	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
556	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
557	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
558	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
559	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
560	3300053099	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere	Metagenome	Endosphere
561	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
562	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
563	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
564	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
565	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
566	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
567	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
568	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
569	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
570	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
571	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
572	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
573	8016522445	Bradyrhizobium sp. LM6.9	Isolate	Nodule
574	8016557553	Bradyrhizobium sp. LM3.4	Isolate	Nodule
575	8016566248	Bradyrhizobium sp. LM3.2	Isolate	Nodule
576	8016575299	Bradyrhizobium sp. LM2.9	Isolate	Nodule
577	8016595262	Bradyrhizobium sp. LM2.3	Isolate	Nodule
578	8016613128	Bradyrhizobium sp. LB7.1	Isolate	Nodule
579	8016622563	Bradyrhizobium sp. LB13.1	Isolate	Nodule
580	8016630954	Bradyrhizobium sp. F1.13.1	Isolate	Nodule
581	8019530166	Bradyrhizobium sp. LM4.3	Isolate	Nodule
582	8019538911	Bradyrhizobium sp. LB9.1b	Isolate	Nodule
583	8019619141	Bradyrhizobium sp. GM7.3	Isolate	Nodule
584	8019629233	Bradyrhizobium sp. GM6.1	Isolate	Nodule
585	8019638758	Bradyrhizobium sp. GM5.1	Isolate	Nodule
586	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
587	8019659431	Bradyrhizobium sp. GM22.5	Isolate	Nodule
588	8019668869	Bradyrhizobium sp. GM2.4	Isolate	Nodule
589	8019678201	Bradyrhizobium sp. GM0.4	Isolate	Nodule
590	8019687851	Bradyrhizobium sp. F1.13.4	Isolate	Nodule
591	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	94.39
Metatranscriptomes	0.06
Isolates	5.55

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	3.74
Nodule	4.62
Rhizoplane	8.92
Rhizosphere	80.85
Stem	0
Stem Tuber	0
Unclassified	1.87

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	2214756331	2209111006	Bacteria	3114
2	ARcpr5yngRDRAFT_c000052	3300000043	Bacteria	18395
3	ARSoilOldRDRAFT_c000001	3300000044	Bacteria	104759
4	ARCol0oldRDRAFT_c00112	3300000045	Bacteria	7027
5	ARCol0yngRDRAFT_1000001	3300000652	Bacteria	73871
6	JGI24741J21665_1007670	3300001915	Bacteria	2081
7	JGI24752J21851_1001356	3300001976	Bacteria	3307
8	JGI24746J21847_1000477	3300001977	Bacteria	5976
9	JGI24739J22299_10000177	3300001989	Bacteria	21227
10	JGI24737J22298_10000967	3300001990	Bacteria	10195
11	JGI24737J22298_10006515	3300001990	Bacteria	3985
12	JGI24743J22301_10001361	3300001991	Bacteria	3357
13	JGI24750J21931_1000547	3300002070	Bacteria	5778
14	JGI24750J21931_1003185	3300002070	Bacteria	1968
15	JGI24745J21846_1001306	3300002073	Bacteria	2404
16	JGI24748J21848_1000209	3300002074	Bacteria	7317
17	JGI24738J21930_10000256	3300002075	Bacteria	14438
18	JGI24738J21930_10000437	3300002075	Bacteria	11794
19	JGI24749J21850_1000857	3300002076	Bacteria	4387
20	JGI24744J21845_10000555	3300002077	Bacteria	6730
21	JGI24744J21845_10001216	3300002077	Bacteria	5049
22	JGI24035J26624_1000009	3300002126	Bacteria	13802
23	JGI24034J26672_10000760	3300002239	Bacteria	4166
24	JGI24742J22300_10001007	3300002244	Bacteria	4339
25	JGI25153J46596_10007997	3300003215	Bacteria	5116
26	Ga0055531_10004894	3300003794	Bacteria	7975
27	JGI25405J52794_10028701	3300003911	Bacteria	1149
28	Ga0055543_1022841	3300004625	Bacteria	1132
29	Ga0065165_1006357	3300005262	Bacteria	6230
30	Ga0065165_1020376	3300005262	Bacteria	2334
31	Ga0065704_10160483	3300005289	Bacteria	1358
32	Ga0065712_10082879	3300005290	Bacteria	2878
33	Ga0065715_10001850	3300005293	Bacteria	10231
34	Ga0065715_10100237	3300005293	Bacteria	3324
35	Ga0070676_10000076	3300005328	Bacteria	33400
36	Ga0070676_10022801	3300005328	Bacteria	3513
37	Ga0070676_10024250	3300005328	Bacteria	3416
38	Ga0070676_10031130	3300005328	Bacteria	3046
39	Ga0070683_100002997	3300005329	Bacteria	13548
40	Ga0070683_100067661	3300005329	Bacteria	3327
41	Ga0070690_100002546	3300005330	Bacteria	9809
42	Ga0070690_100003545	3300005330	Bacteria	8557
43	Ga0070690_100022196	3300005330	Bacteria	3881
44	Ga0070690_100194638	3300005330	Bacteria	1407
45	Ga0070690_100218798	3300005330	Bacteria	1333
46	Ga0070690_100313120	3300005330	Bacteria	1129
47	Ga0070690_100551954	3300005330	Unclassified	869
48	Ga0070670_100001544	3300005331	Bacteria	18563
49	Ga0070670_100005236	3300005331	Bacteria	10920
50	Ga0070670_100154002	3300005331	Bacteria	1990
51	Ga0070670_100812982	3300005331	Bacteria	844
52	Ga0070677_10000038	3300005333	Bacteria	40055
53	Ga0070677_10016774	3300005333	Bacteria	2612
54	Ga0070677_10029474	3300005333	Bacteria	2081
55	Ga0070677_10104839	3300005333	Bacteria	1253
56	Ga0068869_100000054	3300005334	Bacteria	49952
57	Ga0068869_100169330	3300005334	Bacteria	1706
58	Ga0068869_100450057	3300005334	Bacteria	1067
59	Ga0068869_100650715	3300005334	Bacteria	895
60	Ga0070666_10046576	3300005335	Bacteria	2909
61	Ga0070666_10127785	3300005335	Bacteria	1765
62	Ga0070666_10139406	3300005335	Bacteria	1689
63	Ga0070680_100004742	3300005336	Bacteria	10235
64	Ga0070680_100191245	3300005336	Bacteria	1724
65	Ga0070682_100000181	3300005337	Bacteria	47168
66	Ga0070682_100083595	3300005337	Bacteria	2072
67	Ga0070682_100091649	3300005337	Bacteria	1990
68	Ga0070682_100123788	3300005337	Bacteria	1740
69	Ga0068868_100002127	3300005338	Bacteria	13663
70	Ga0068868_100003086	3300005338	Bacteria	11592
71	Ga0068868_100087352	3300005338	Bacteria	2507
72	Ga0068868_100171033	3300005338	Bacteria	1799
73	Ga0068868_100181563	3300005338	Bacteria	1746
74	Ga0070660_100000660	3300005339	Bacteria	22766
75	Ga0070660_100062555	3300005339	Bacteria	2892
76	Ga0070660_100064473	3300005339	Bacteria	2850
77	Ga0070660_100278485	3300005339	Bacteria	1368
78	Ga0070660_100452990	3300005339	Bacteria	1065
79	Ga0070689_100003434	3300005340	Bacteria	10545
80	Ga0070689_100003508	3300005340	Bacteria	10425
81	Ga0070689_100004183	3300005340	Bacteria	9729
82	Ga0070689_100025050	3300005340	Bacteria	4480
83	Ga0070689_100029697	3300005340	Bacteria	4141
84	Ga0070689_100182206	3300005340	Bacteria	1706
85	Ga0070691_10000491	3300005341	Bacteria	14859
86	Ga0070691_10109721	3300005341	Bacteria	1379
87	Ga0070687_100000358	3300005343	Bacteria	15563
88	Ga0070687_100011228	3300005343	Bacteria	3911
89	Ga0070687_100011387	3300005343	Bacteria	3889
90	Ga0070687_100034735	3300005343	Bacteria	2498
91	Ga0070687_100064142	3300005343	Bacteria	1951
92	Ga0070687_100118747	3300005343	Bacteria	1509
93	Ga0070687_100148142	3300005343	Bacteria	1375
94	Ga0070687_100595184	3300005343	Bacteria	759
95	Ga0070661_100000797	3300005344	Bacteria	22658
96	Ga0070661_100047671	3300005344	Bacteria	3136
97	Ga0070661_100091588	3300005344	Bacteria	2252
98	Ga0070661_100321610	3300005344	Bacteria	1208
99	Ga0070661_100488577	3300005344	Bacteria	984
100	Ga0070692_10000320	3300005345	Bacteria	13809
101	Ga0070692_10008804	3300005345	Bacteria	4517
102	Ga0070692_10038825	3300005345	Bacteria	2429
103	Ga0070668_100004777	3300005347	Bacteria	10049
104	Ga0070668_100044390	3300005347	Bacteria	3410
105	Ga0070668_100123028	3300005347	Bacteria	2076
106	Ga0070669_100001643	3300005353	Bacteria	16208
107	Ga0070669_100027609	3300005353	Bacteria	4086
108	Ga0070669_100353257	3300005353	Bacteria	1194
109	Ga0070675_100005771	3300005354	Bacteria	9470
110	Ga0070675_100111785	3300005354	Bacteria	2312
111	Ga0070671_100003232	3300005355	Bacteria	12704
112	Ga0070671_100031220	3300005355	Bacteria	4399
113	Ga0070671_100041035	3300005355	Bacteria	3845
114	Ga0070671_100089793	3300005355	Bacteria	2572
115	Ga0070671_100555295	3300005355	Bacteria	990
116	Ga0070671_100632121	3300005355	Unclassified	926
117	Ga0070674_100000140	3300005356	Bacteria	33405
118	Ga0070674_100226858	3300005356	Bacteria	1456
119	Ga0070673_100007770	3300005364	Bacteria	7094
120	Ga0070673_100029834	3300005364	Bacteria	4072
121	Ga0070673_100067400	3300005364	Bacteria	2862
122	Ga0070673_100503104	3300005364	Bacteria	1096
123	Ga0070673_100525476	3300005364	Bacteria	1073
124	Ga0070688_100002076	3300005365	Bacteria	10116
125	Ga0070688_100005196	3300005365	Bacteria	6837
126	Ga0070688_100026043	3300005365	Bacteria	3470
127	Ga0070659_100004532	3300005366	Bacteria	9922
128	Ga0070659_100032102	3300005366	Bacteria	4070
129	Ga0070659_100038432	3300005366	Bacteria	3733
130	Ga0070659_100042897	3300005366	Bacteria	3537
131	Ga0070667_100001305	3300005367	Bacteria	22468
132	Ga0070667_100165388	3300005367	Bacteria	1951
133	Ga0070667_100355091	3300005367	Bacteria	1328
134	Ga0070667_100556513	3300005367	Bacteria	1054
135	Ga0070703_10001982	3300005406	Bacteria	6000
136	Ga0070703_10005800	3300005406	Bacteria	3459
137	Ga0070703_10029695	3300005406	Bacteria	1643
138	Ga0070709_10004597	3300005434	Bacteria	7455
139	Ga0070709_10007654	3300005434	Bacteria	5928
140	Ga0070714_100054238	3300005435	Bacteria	3424
141	Ga0070714_100058840	3300005435	Bacteria	3294
142	Ga0070714_100293538	3300005435	Bacteria	1514
143	Ga0070713_100010421	3300005436	Bacteria	6712
144	Ga0070713_100021777	3300005436	Bacteria	4940
145	Ga0070713_100024821	3300005436	Bacteria	4677
146	Ga0070713_100326724	3300005436	Bacteria	1418
147	Ga0070710_10004200	3300005437	Bacteria	6828
148	Ga0070710_10014806	3300005437	Bacteria	3931
149	Ga0070710_10062090	3300005437	Bacteria	2130
150	Ga0070701_10000297	3300005438	Bacteria	16259
151	Ga0070701_10001300	3300005438	Bacteria	9184
152	Ga0070701_10020956	3300005438	Bacteria	3112
153	Ga0070711_100076631	3300005439	Bacteria	2371
154	Ga0070711_100128769	3300005439	Bacteria	1882
155	Ga0070711_100304595	3300005439	Bacteria	1268
156	Ga0070705_100000989	3300005440	Bacteria	15855
157	Ga0070705_100070844	3300005440	Bacteria	2106
158	Ga0070700_100002276	3300005441	Bacteria	9754
159	Ga0070700_100011750	3300005441	Bacteria	4860
160	Ga0070700_100070030	3300005441	Bacteria	2235
161	Ga0070694_100000444	3300005444	Bacteria	22578
162	Ga0070694_100003236	3300005444	Bacteria	9721
163	Ga0070694_100268192	3300005444	Bacteria	1297
164	Ga0070694_100407529	3300005444	Bacteria	1066
165	Ga0070708_100031469	3300005445	Bacteria	4592
166	Ga0070663_100000436	3300005455	Bacteria	22024
167	Ga0070663_100028875	3300005455	Bacteria	3782
168	Ga0070663_100067556	3300005455	Bacteria	2593
169	Ga0070663_100215216	3300005455	Bacteria	1506
170	Ga0070678_100000382	3300005456	Bacteria	20769
171	Ga0070678_100003875	3300005456	Bacteria	8404
172	Ga0070678_100050943	3300005456	Bacteria	2998
173	Ga0070662_100003913	3300005457	Bacteria	9340
174	Ga0070662_100005358	3300005457	Bacteria	8191
175	Ga0070662_100006339	3300005457	Bacteria	7621
176	Ga0070662_100222459	3300005457	Bacteria	1507
177	Ga0070662_100286958	3300005457	Bacteria	1333
178	Ga0070681_10005795	3300005458	Bacteria	11955
179	Ga0070681_10044092	3300005458	Bacteria	4464
180	Ga0070681_10104858	3300005458	Bacteria	2769
181	Ga0070681_10118502	3300005458	Bacteria	2584
182	Ga0070681_10320906	3300005458	Bacteria	1458
183	Ga0070681_10349941	3300005458	Bacteria	1388
184	Ga0070681_11014279	3300005458	Bacteria	750
185	Ga0068867_100004037	3300005459	Bacteria	10325
186	Ga0068867_100031738	3300005459	Bacteria	3816
187	Ga0068867_100049962	3300005459	Bacteria	3080
188	Ga0068867_100115286	3300005459	Bacteria	2069
189	Ga0070685_10011992	3300005466	Bacteria	4544
190	Ga0070685_10019254	3300005466	Bacteria	3680
191	Ga0070685_10053921	3300005466	Bacteria	2331
192	Ga0070685_10090723	3300005466	Bacteria	1849
193	Ga0070685_10099640	3300005466	Bacteria	1772
194	Ga0070706_100142059	3300005467	Bacteria	2241
195	Ga0070698_100206822	3300005471	Bacteria	1898
196	Ga0070699_100234039	3300005518	Bacteria	1638
197	Ga0070679_100001204	3300005530	Bacteria	22768
198	Ga0070679_100096291	3300005530	Bacteria	2947
199	Ga0070684_100004481	3300005535	Bacteria	10635
200	Ga0070684_100031381	3300005535	Bacteria	4523
201	Ga0070684_100063427	3300005535	Bacteria	3239
202	Ga0070697_100291756	3300005536	Bacteria	1401
203	Ga0068853_100001615	3300005539	Bacteria	16456
204	Ga0068853_100004372	3300005539	Bacteria	10934
205	Ga0070672_100003461	3300005543	Bacteria	10231
206	Ga0070672_100083198	3300005543	Bacteria	2568
207	Ga0070672_100337527	3300005543	Bacteria	1283
208	Ga0070686_100002518	3300005544	Bacteria	10097
209	Ga0070686_100009403	3300005544	Bacteria	5495
210	Ga0070686_100293445	3300005544	Bacteria	1203
211	Ga0070695_100002937	3300005545	Bacteria	9928
212	Ga0070695_100004993	3300005545	Bacteria	7823
213	Ga0070695_100417542	3300005545	Bacteria	1021
214	Ga0070696_100009850	3300005546	Bacteria	6392
215	Ga0070696_100309863	3300005546	Bacteria	1212
216	Ga0070696_100328530	3300005546	Bacteria	1179
217	Ga0070693_100000628	3300005547	Bacteria	15686
218	Ga0070665_100112704	3300005548	Bacteria	2722
219	Ga0070665_100153502	3300005548	Bacteria	2305
220	Ga0070665_100207924	3300005548	Bacteria	1958
221	Ga0070665_100298035	3300005548	Bacteria	1615
222	Ga0070665_100580933	3300005548	Bacteria	1133
223	Ga0070704_100055623	3300005549	Bacteria	2806
224	Ga0070704_100058274	3300005549	Bacteria	2750
225	Ga0070704_100223496	3300005549	Bacteria	1532
226	Ga0070704_100256179	3300005549	Bacteria	1439
227	Ga0070704_100347552	3300005549	Bacteria	1251
228	Ga0070704_100831568	3300005549	Bacteria	827
229	Ga0068855_100023116	3300005563	Bacteria	7449
230	Ga0068855_100095264	3300005563	Bacteria	3431
231	Ga0068855_100380532	3300005563	Bacteria	1550
232	Ga0070664_100004566	3300005564	Bacteria	11109
233	Ga0070664_100063082	3300005564	Bacteria	3159
234	Ga0070664_100085062	3300005564	Bacteria	2731
235	Ga0070664_100382548	3300005564	Unclassified	1285
236	Ga0070664_100598894	3300005564	Bacteria	1022
237	Ga0070664_100676981	3300005564	Bacteria	960
238	Ga0068857_100006169	3300005577	Bacteria	10247
239	Ga0068857_100016920	3300005577	Bacteria	6388
240	Ga0068857_100043816	3300005577	Bacteria	3969
241	Ga0068857_100210605	3300005577	Bacteria	1774
242	Ga0068854_100003262	3300005578	Bacteria	10104
243	Ga0068854_100015505	3300005578	Bacteria	5051
244	Ga0068854_100041635	3300005578	Bacteria	3247
245	Ga0068854_100064618	3300005578	Bacteria	2659
246	Ga0068854_100705520	3300005578	Bacteria	871
247	Ga0068856_100004644	3300005614	Bacteria	13644
248	Ga0068856_100155865	3300005614	Bacteria	2294
249	Ga0068856_100177921	3300005614	Bacteria	2140
250	Ga0068856_100331265	3300005614	Bacteria	1540
251	Ga0068856_100409452	3300005614	Bacteria	1376
252	Ga0070702_100000041	3300005615	Bacteria	34639
253	Ga0070702_100002073	3300005615	Bacteria	8492
254	Ga0070702_100064308	3300005615	Bacteria	2146
255	Ga0070702_100080293	3300005615	Bacteria	1951
256	Ga0070702_100096687	3300005615	Bacteria	1803
257	Ga0070702_100427359	3300005615	Bacteria	955
258	Ga0070702_100594342	3300005615	Unclassified	828
259	Ga0068852_100038957	3300005616	Bacteria	3998
260	Ga0068852_100109132	3300005616	Bacteria	2512
261	Ga0068852_100214847	3300005616	Bacteria	1826
262	Ga0068852_100384529	3300005616	Bacteria	1377
263	Ga0068859_100014564	3300005617	Bacteria	7899
264	Ga0068859_100046546	3300005617	Bacteria	4356
265	Ga0068859_100058549	3300005617	Bacteria	3881
266	Ga0068859_100063160	3300005617	Bacteria	3734
267	Ga0068859_100538324	3300005617	Bacteria	1262
268	Ga0068859_100635760	3300005617	Bacteria	1159
269	Ga0068859_100825974	3300005617	Bacteria	1013
270	Ga0068864_100000172	3300005618	Bacteria	59525
271	Ga0068864_100005707	3300005618	Bacteria	10206
272	Ga0068864_100038825	3300005618	Bacteria	4067
273	Ga0068864_100146517	3300005618	Bacteria	2135
274	Ga0068864_100596999	3300005618	Unclassified	1071
275	Ga0068866_10000209	3300005718	Bacteria	27638
276	Ga0068866_10044664	3300005718	Bacteria	2217
277	Ga0068861_100001340	3300005719	Bacteria	15459
278	Ga0068851_10193464	3300005834	Bacteria	1132
279	Ga0068870_10000652	3300005840	Bacteria	13237
280	Ga0068870_10002924	3300005840	Bacteria	7197
281	Ga0068870_10503266	3300005840	Bacteria	808
282	Ga0068863_100001541	3300005841	Bacteria	22740
283	Ga0068863_100030974	3300005841	Bacteria	5108
284	Ga0068863_100077872	3300005841	Bacteria	3138
285	Ga0068858_100014295	3300005842	Bacteria	7485
286	Ga0068858_100120659	3300005842	Bacteria	2451
287	Ga0068858_100309409	3300005842	Bacteria	1508
288	Ga0068858_100348362	3300005842	Bacteria	1419
289	Ga0068860_100007995	3300005843	Bacteria	10543
290	Ga0068860_100059288	3300005843	Bacteria	3639
291	Ga0068860_100577100	3300005843	Bacteria	1128
292	Ga0068860_100666320	3300005843	Bacteria	1049
293	Ga0068862_100003247	3300005844	Bacteria	14065
294	Ga0068862_100005613	3300005844	Bacteria	10485
295	Ga0068862_100010836	3300005844	Bacteria	7527
296	Ga0068862_100214860	3300005844	Bacteria	1739
297	Ga0081455_10000002	3300005937	Bacteria	460472
298	Ga0081455_10011036	3300005937	Bacteria	9099
299	Ga0081455_10011972	3300005937	Bacteria	8683
300	Ga0081455_10096499	3300005937	Bacteria	2383
301	Ga0081538_10002134	3300005981	Bacteria	19697
302	Ga0081540_1011265	3300005983	Bacteria	5989
303	Ga0081539_10001661	3300005985	Bacteria	36064
304	Ga0070717_10004108	3300006028	Bacteria	10499
305	Ga0070717_10009760	3300006028	Bacteria	7228
306	Ga0070717_10276089	3300006028	Bacteria	1489
307	Ga0070717_10414929	3300006028	Bacteria	1211
308	Ga0075365_10135490	3300006038	Bacteria	1706
309	Ga0075365_10292781	3300006038	Bacteria	1145
310	Ga0075368_10009240	3300006042	Bacteria	3542
311	Ga0075363_100013123	3300006048	Bacteria	4007
312	Ga0075363_100158075	3300006048	Bacteria	1282
313	Ga0075363_100304050	3300006048	Bacteria	926
314	Ga0075364_10408328	3300006051	Bacteria	927
315	Ga0075432_10049484	3300006058	Bacteria	1481
316	Ga0070715_10000720	3300006163	Bacteria	8912
317	Ga0070715_10117210	3300006163	Bacteria	1264
318	Ga0070716_100010508	3300006173	Bacteria	4642
319	Ga0070716_100328235	3300006173	Bacteria	1075
320	Ga0070712_100000460	3300006175	Bacteria	23354
321	Ga0070712_100070971	3300006175	Bacteria	2490
322	Ga0070712_100158873	3300006175	Bacteria	1744
323	Ga0070712_100177873	3300006175	Bacteria	1656
324	Ga0070712_100211580	3300006175	Bacteria	1529
325	Ga0075362_10021323	3300006177	Bacteria	2717
326	Ga0075367_10019074	3300006178	Bacteria	3797
327	Ga0075367_10267614	3300006178	Bacteria	1073
328	Ga0075369_10011405	3300006186	Bacteria	3496
329	Ga0075366_10010047	3300006195	Bacteria	5305
330	Ga0075366_10012444	3300006195	Bacteria	4826
331	Ga0097621_100000565	3300006237	Bacteria	25981
332	Ga0097621_100385545	3300006237	Bacteria	1252
333	Ga0075370_10077261	3300006353	Bacteria	1910
334	Ga0075370_10409502	3300006353	Unclassified	814
335	Ga0068871_100000303	3300006358	Bacteria	34296
336	Ga0068871_100005491	3300006358	Bacteria	8893
337	Ga0068871_100074783	3300006358	Bacteria	2795
338	Ga0075428_100030184	3300006844	Bacteria	5997
339	Ga0075428_100325676	3300006844	Bacteria	1651
340	Ga0075428_100396918	3300006844	Bacteria	1478
341	Ga0075428_100592657	3300006844	Bacteria	1184
342	Ga0075430_100000492	3300006846	Bacteria	29679
343	Ga0075430_100013197	3300006846	Bacteria	7039
344	Ga0075430_100156711	3300006846	Bacteria	1896
345	Ga0075430_100204326	3300006846	Bacteria	1640
346	Ga0075431_100040575	3300006847	Bacteria	4798
347	Ga0075431_100116984	3300006847	Bacteria	2751
348	Ga0075431_100220767	3300006847	Bacteria	1933
349	Ga0075433_10053274	3300006852	Bacteria	3527
350	Ga0075433_10554797	3300006852	Unclassified	1010
351	Ga0075434_100000412	3300006871	Bacteria	31664
352	Ga0075434_100032747	3300006871	Bacteria	5126
353	Ga0075434_100033742	3300006871	Bacteria	5052
354	Ga0075434_100050156	3300006871	Bacteria	4146
355	Ga0075434_100098202	3300006871	Bacteria	2934
356	Ga0075434_100103939	3300006871	Bacteria	2849
357	Ga0075434_100156042	3300006871	Bacteria	2302
358	Ga0075434_100240904	3300006871	Bacteria	1829
359	Ga0075434_100253868	3300006871	Bacteria	1777
360	Ga0075434_100267351	3300006871	Bacteria	1729
361	Ga0075434_100716376	3300006871	Bacteria	1018
362	Ga0075429_100099929	3300006880	Bacteria	2532
363	Ga0068865_100000682	3300006881	Bacteria	19141
364	Ga0068865_100069839	3300006881	Bacteria	2487
365	Ga0068865_100182153	3300006881	Bacteria	1618
366	Ga0075436_100070943	3300006914	Bacteria	2408
367	Ga0097620_100014563	3300006931	Bacteria	7899
368	Ga0097620_100046544	3300006931	Bacteria	4356
369	Ga0097620_100058549	3300006931	Bacteria	3881
370	Ga0097620_100063160	3300006931	Bacteria	3734
371	Ga0097620_100538302	3300006931	Bacteria	1262
372	Ga0097620_100635779	3300006931	Bacteria	1159
373	Ga0097620_100825969	3300006931	Bacteria	1013
374	Ga0075435_100040717	3300007076	Bacteria	3711
375	Ga0075435_100102310	3300007076	Bacteria	2374
376	Ga0075435_100280083	3300007076	Bacteria	1423
377	Ga0075435_100736870	3300007076	Bacteria	857
378	Ga0099794_10038823	3300007265	Bacteria	2257
379	Ga0105251_10137861	3300009011	Bacteria	1104
380	Ga0105240_10056226	3300009093	Bacteria	4924
381	Ga0105240_10069601	3300009093	Bacteria	4355
382	Ga0105240_10239587	3300009093	Bacteria	2104
383	Ga0105240_10249173	3300009093	Bacteria	2055
384	Ga0105240_10798219	3300009093	Bacteria	1023
385	Ga0111539_10002657	3300009094	Bacteria	23686
386	Ga0111539_10002897	3300009094	Bacteria	22777
387	Ga0111539_10108622	3300009094	Bacteria	3256
388	Ga0111539_10132079	3300009094	Bacteria	2923
389	Ga0111539_10183045	3300009094	Bacteria	2447
390	Ga0111539_10201052	3300009094	Bacteria	2324
391	Ga0111539_10507741	3300009094	Bacteria	1404
392	Ga0111539_10683689	3300009094	Bacteria	1195
393	Ga0105245_10000882	3300009098	Bacteria	27254
394	Ga0105245_10037434	3300009098	Bacteria	4313
395	Ga0105245_10106664	3300009098	Bacteria	2600
396	Ga0105245_10271015	3300009098	Bacteria	1656
397	Ga0105247_10001969	3300009101	Bacteria	14264
398	Ga0105247_10004828	3300009101	Bacteria	8579
399	Ga0105247_10289542	3300009101	Bacteria	1132
400	Ga0114129_10008610	3300009147	Bacteria	14548
401	Ga0114129_10021090	3300009147	Bacteria	9252
402	Ga0114129_10061242	3300009147	Bacteria	5259
403	Ga0114129_10095382	3300009147	Bacteria	4120
404	Ga0114129_10104552	3300009147	Bacteria	3913
405	Ga0114129_10157533	3300009147	Bacteria	3104
406	Ga0114129_10586182	3300009147	Bacteria	1446
407	Ga0114129_10605105	3300009147	Bacteria	1419
408	Ga0114129_11902180	3300009147	Unclassified	721
409	Ga0105243_10001029	3300009148	Bacteria	25692
410	Ga0105243_10009289	3300009148	Bacteria	7502
411	Ga0105243_10023731	3300009148	Bacteria	4675
412	Ga0105243_10230935	3300009148	Bacteria	1641
413	Ga0105243_10262535	3300009148	Bacteria	1547
414	Ga0105243_10428274	3300009148	Bacteria	1236
415	Ga0105241_10006660	3300009174	Bacteria	8501
416	Ga0105241_10181648	3300009174	Bacteria	1746
417	Ga0105241_10350024	3300009174	Bacteria	1282
418	Ga0105241_10427289	3300009174	Bacteria	1167
419	Ga0105241_10725696	3300009174	Bacteria	909
420	Ga0105242_10002177	3300009176	Bacteria	15458
421	Ga0105242_10027348	3300009176	Bacteria	4527
422	Ga0105242_10294895	3300009176	Bacteria	1478
423	Ga0105248_10002945	3300009177	Bacteria	18879
424	Ga0105248_10012305	3300009177	Bacteria	9437
425	Ga0105248_10014996	3300009177	Bacteria	8532
426	Ga0105248_10074990	3300009177	Bacteria	3802
427	Ga0105248_10074998	3300009177	Bacteria	3801
428	Ga0105248_10097925	3300009177	Bacteria	3305
429	Ga0105237_10003304	3300009545	Bacteria	19235
430	Ga0105237_10063614	3300009545	Bacteria	3687
431	Ga0105237_10112977	3300009545	Bacteria	2708
432	Ga0105237_10208332	3300009545	Bacteria	1955
433	Ga0105237_10341732	3300009545	Bacteria	1501
434	Ga0105238_10066156	3300009551	Bacteria	3616
435	Ga0105238_10171734	3300009551	Bacteria	2144
436	Ga0105238_10282647	3300009551	Bacteria	1641
437	Ga0105238_10644735	3300009551	Unclassified	1069
438	Ga0105249_10006632	3300009553	Bacteria	10072
439	Ga0105249_10028570	3300009553	Bacteria	5034
440	Ga0105249_10032153	3300009553	Bacteria	4745
441	Ga0105249_10175965	3300009553	Bacteria	2078
442	Ga0099796_10005397	3300010159	Bacteria	3188
443	Ga0105239_10021993	3300010375	Bacteria	7030
444	Ga0105239_10032680	3300010375	Bacteria	5717
445	Ga0105239_10094993	3300010375	Bacteria	3293
446	Ga0105239_10132130	3300010375	Bacteria	2777
447	Ga0105239_10207875	3300010375	Bacteria	2193
448	Ga0105239_10329989	3300010375	Bacteria	1721
449	Ga0105246_10000463	3300011119	Bacteria	21809
450	Ga0105246_10033093	3300011119	Bacteria	3433
451	Ga0105246_10048040	3300011119	Bacteria	2917
452	Ga0105246_10399843	3300011119	Bacteria	1140
453	Ga0105246_10541243	3300011119	Bacteria	996
454	Ga0157313_1000926	3300012503	Bacteria	1471
455	Ga0157373_10015583	3300013100	Bacteria	5555
456	Ga0157371_10115937	3300013102	Bacteria	1903
457	Ga0157370_10173108	3300013104	Bacteria	2006
458	Ga0157370_10256887	3300013104	Bacteria	1615
459	Ga0157369_10427420	3300013105	Bacteria	1373
460	Ga0157374_10000614	3300013296	Bacteria	31520
461	Ga0157374_10065462	3300013296	Bacteria	3413
462	Ga0157374_10495888	3300013296	Bacteria	1225
463	Ga0157374_11165826	3300013296	Bacteria	791
464	Ga0157378_10000701	3300013297	Bacteria	31354
465	Ga0157378_10027642	3300013297	Bacteria	5003
466	Ga0157378_10154419	3300013297	Bacteria	2141
467	Ga0157378_10415059	3300013297	Bacteria	1329
468	Ga0157378_10472828	3300013297	Bacteria	1247
469	Ga0163162_10008098	3300013306	Bacteria	10258
470	Ga0163162_10108282	3300013306	Bacteria	2875
471	Ga0163162_10186391	3300013306	Bacteria	2202
472	Ga0163162_10458816	3300013306	Bacteria	1406
473	Ga0163162_10722294	3300013306	Bacteria	1117
474	Ga0157372_10016291	3300013307	Bacteria	7979
475	Ga0157372_10098111	3300013307	Bacteria	3342
476	Ga0157372_10140711	3300013307	Bacteria	2779
477	Ga0157372_10594965	3300013307	Bacteria	1289
478	Ga0157375_10005857	3300013308	Bacteria	10698
479	Ga0157375_10022311	3300013308	Bacteria	5825
480	Ga0163163_10004757	3300014325	Bacteria	11644
481	Ga0163163_10017614	3300014325	Bacteria	6668
482	Ga0163163_10053547	3300014325	Bacteria	3984
483	Ga0163163_10063537	3300014325	Bacteria	3661
484	Ga0163163_10135712	3300014325	Bacteria	2502
485	Ga0163163_10183790	3300014325	Bacteria	2138
486	Ga0163163_11085892	3300014325	Unclassified	863
487	Ga0157380_10001646	3300014326	Bacteria	14707
488	Ga0157380_10069598	3300014326	Bacteria	2840
489	Ga0157380_10165606	3300014326	Bacteria	1926
490	Ga0182008_10166078	3300014497	Bacteria	1113
491	Ga0157377_10000514	3300014745	Bacteria	16439
492	Ga0157379_10000792	3300014968	Bacteria	25616
493	Ga0157379_10010974	3300014968	Bacteria	7901
494	Ga0157379_10057501	3300014968	Bacteria	3475
495	Ga0157379_10072154	3300014968	Bacteria	3089
496	Ga0157379_10096732	3300014968	Bacteria	2650
497	Ga0157379_10293592	3300014968	Bacteria	1481
498	Ga0157379_10983242	3300014968	Bacteria	804
499	Ga0157376_10000352	3300014969	Bacteria	30620
500	Ga0157376_10063069	3300014969	Bacteria	3121
501	Ga0157376_10211676	3300014969	Bacteria	1790
502	Ga0157376_10511043	3300014969	Bacteria	1182
503	Ga0157376_10827550	3300014969	Bacteria	940
504	Ga0182005_1087240	3300015265	Bacteria	865
505	Ga0163161_10000956	3300017792	Bacteria	22176
506	Ga0163161_10079514	3300017792	Bacteria	2411
507	Ga0163161_10089657	3300017792	Bacteria	2274
508	Ga0163161_10143176	3300017792	Bacteria	1811
509	Ga0206353_10376412	3300020082	Bacteria	3399
510	Ga0207666_1000043	3300025271	Bacteria	24939
511	Ga0207673_1000044	3300025290	Bacteria	9940
512	Ga0209758_1000182	3300025297	Bacteria	140630
513	Ga0209758_1000293	3300025297	Bacteria	98643
514	Ga0209758_1019701	3300025297	Bacteria	3237
515	Ga0209758_1056344	3300025297	Bacteria	1328
516	Ga0207426_1007081	3300025302	Bacteria	4746
517	Ga0207426_1031401	3300025302	Bacteria	1733
518	Ga0209257_1000390	3300025304	Bacteria	87532
519	Ga0207697_10001136	3300025315	Bacteria	14657
520	Ga0207697_10012548	3300025315	Bacteria	3551
521	Ga0207656_10038144	3300025321	Bacteria	2025
522	Ga0207656_10077332	3300025321	Bacteria	1490
523	Ga0207655_1061275	3300025728	Unclassified	1453
524	Ga0207682_10000021	3300025893	Bacteria	63904
525	Ga0207682_10000660	3300025893	Bacteria	16114
526	Ga0207682_10203212	3300025893	Bacteria	912
527	Ga0207692_10002654	3300025898	Bacteria	6883
528	Ga0207692_10008133	3300025898	Bacteria	4330
529	Ga0207642_10000623	3300025899	Bacteria	10867
530	Ga0207642_10046441	3300025899	Bacteria	1935
531	Ga0207642_10100529	3300025899	Bacteria	1451
532	Ga0207642_10141871	3300025899	Bacteria	1268
533	Ga0207710_10001214	3300025900	Bacteria	13078
534	Ga0207710_10020661	3300025900	Bacteria	2817
535	Ga0207710_10025361	3300025900	Bacteria	2558
536	Ga0207688_10000949	3300025901	Bacteria	14704
537	Ga0207688_10002814	3300025901	Bacteria	9448
538	Ga0207688_10071997	3300025901	Bacteria	1963
539	Ga0207688_10131402	3300025901	Bacteria	1468
540	Ga0207688_10179547	3300025901	Bacteria	1262
541	Ga0207680_10003232	3300025903	Bacteria	7665
542	Ga0207680_10077406	3300025903	Bacteria	2080
543	Ga0207680_10110291	3300025903	Bacteria	1783
544	Ga0207680_10111466	3300025903	Bacteria	1775
545	Ga0207680_10131464	3300025903	Bacteria	1650
546	Ga0207647_10007234	3300025904	Bacteria	8037
547	Ga0207647_10011184	3300025904	Bacteria	6305
548	Ga0207647_10046289	3300025904	Bacteria	2711
549	Ga0207647_10122033	3300025904	Bacteria	1536
550	Ga0207685_10011541	3300025905	Bacteria	2660
551	Ga0207685_10045199	3300025905	Bacteria	1669
552	Ga0207685_10055572	3300025905	Bacteria	1546
553	Ga0207699_10020713	3300025906	Bacteria	3530
554	Ga0207699_10045331	3300025906	Bacteria	2566
555	Ga0207699_10152742	3300025906	Bacteria	1529
556	Ga0207645_10002488	3300025907	Bacteria	14456
557	Ga0207645_10002945	3300025907	Bacteria	13153
558	Ga0207645_10023617	3300025907	Bacteria	3992
559	Ga0207645_10045340	3300025907	Bacteria	2810
560	Ga0207645_10063944	3300025907	Bacteria	2351
561	Ga0207643_10000108	3300025908	Bacteria	56497
562	Ga0207643_10002845	3300025908	Bacteria	9348
563	Ga0207643_10014351	3300025908	Bacteria	4301
564	Ga0207684_10002963	3300025910	Bacteria	16822
565	Ga0207654_10002719	3300025911	Bacteria	8977
566	Ga0207654_10011794	3300025911	Bacteria	4463
567	Ga0207654_10235793	3300025911	Bacteria	1220
568	Ga0207707_10000691	3300025912	Bacteria	33408
569	Ga0207707_10040215	3300025912	Bacteria	4083
570	Ga0207707_10128051	3300025912	Bacteria	2220
571	Ga0207695_10000107	3300025913	Bacteria	252606
572	Ga0207695_10039943	3300025913	Bacteria	5038
573	Ga0207671_10003167	3300025914	Bacteria	16626
574	Ga0207671_10086869	3300025914	Bacteria	2351
575	Ga0207671_10100478	3300025914	Bacteria	2190
576	Ga0207671_10295710	3300025914	Bacteria	1279
577	Ga0207693_10000825	3300025915	Bacteria	27536
578	Ga0207693_10007085	3300025915	Bacteria	9254
579	Ga0207693_10009090	3300025915	Bacteria	8110
580	Ga0207693_10021699	3300025915	Bacteria	5104
581	Ga0207693_10115971	3300025915	Bacteria	2103
582	Ga0207693_10147296	3300025915	Bacteria	1851
583	Ga0207693_10203547	3300025915	Bacteria	1556
584	Ga0207663_10022199	3300025916	Bacteria	3625
585	Ga0207660_10000014	3300025917	Bacteria	79328
586	Ga0207660_10293877	3300025917	Bacteria	1292
587	Ga0207662_10006062	3300025918	Bacteria	6501
588	Ga0207662_10008927	3300025918	Bacteria	5499
589	Ga0207662_10019625	3300025918	Bacteria	3850
590	Ga0207662_10096544	3300025918	Bacteria	1826
591	Ga0207662_10202160	3300025918	Bacteria	1286
592	Ga0207662_10231465	3300025918	Bacteria	1207
593	Ga0207657_10037081	3300025919	Bacteria	4359
594	Ga0207657_10046349	3300025919	Bacteria	3808
595	Ga0207657_10046352	3300025919	Bacteria	3808
596	Ga0207657_10077327	3300025919	Bacteria	2805
597	Ga0207657_10228097	3300025919	Bacteria	1490
598	Ga0207649_10000086	3300025920	Bacteria	79546
599	Ga0207649_10043035	3300025920	Bacteria	2758
600	Ga0207649_10076337	3300025920	Bacteria	2156
601	Ga0207649_10086928	3300025920	Bacteria	2038
602	Ga0207652_10000255	3300025921	Bacteria	55415
603	Ga0207652_10044044	3300025921	Bacteria	3801
604	Ga0207652_10161000	3300025921	Bacteria	2012
605	Ga0207652_10398264	3300025921	Bacteria	1242
606	Ga0207681_10000024	3300025923	Bacteria	206607
607	Ga0207694_10361708	3300025924	Bacteria	1203
608	Ga0207650_10002572	3300025925	Bacteria	12563
609	Ga0207650_10012030	3300025925	Bacteria	5965
610	Ga0207650_10119105	3300025925	Bacteria	2053
611	Ga0207650_10140734	3300025925	Bacteria	1897
612	Ga0207650_10174839	3300025925	Bacteria	1708
613	Ga0207650_10414781	3300025925	Bacteria	1116
614	Ga0207659_10000034	3300025926	Bacteria	108227
615	Ga0207659_10018147	3300025926	Bacteria	4608
616	Ga0207659_10047389	3300025926	Bacteria	3040
617	Ga0207687_10000110	3300025927	Bacteria	58672
618	Ga0207687_10008628	3300025927	Bacteria	6663
619	Ga0207687_10119758	3300025927	Bacteria	1967
620	Ga0207700_10035453	3300025928	Bacteria	3594
621	Ga0207700_10068719	3300025928	Bacteria	2716
622	Ga0207700_10090236	3300025928	Bacteria	2418
623	Ga0207700_10133338	3300025928	Bacteria	2031
624	Ga0207700_10151584	3300025928	Bacteria	1916
625	Ga0207700_10303672	3300025928	Bacteria	1379
626	Ga0207700_10324076	3300025928	Bacteria	1336
627	Ga0207664_10007232	3300025929	Bacteria	7689
628	Ga0207664_10023737	3300025929	Bacteria	4599
629	Ga0207664_10027533	3300025929	Bacteria	4310
630	Ga0207644_10000642	3300025931	Bacteria	22154
631	Ga0207644_10003006	3300025931	Bacteria	10851
632	Ga0207644_10047247	3300025931	Bacteria	3070
633	Ga0207644_10112084	3300025931	Bacteria	2064
634	Ga0207690_10000270	3300025932	Bacteria	36976
635	Ga0207690_10022682	3300025932	Bacteria	3907
636	Ga0207690_10051466	3300025932	Bacteria	2754
637	Ga0207690_10168676	3300025932	Bacteria	1638
638	Ga0207690_10189827	3300025932	Bacteria	1553
639	Ga0207706_10001336	3300025933	Bacteria	24661
640	Ga0207706_10005854	3300025933	Bacteria	11434
641	Ga0207706_10007295	3300025933	Bacteria	10222
642	Ga0207706_10007337	3300025933	Bacteria	10195
643	Ga0207706_10108352	3300025933	Bacteria	2445
644	Ga0207706_10109295	3300025933	Bacteria	2433
645	Ga0207706_10341353	3300025933	Bacteria	1303
646	Ga0207706_10403529	3300025933	Bacteria	1185
647	Ga0207706_10479894	3300025933	Bacteria	1074
648	Ga0207686_10000214	3300025934	Bacteria	44245
649	Ga0207686_10044726	3300025934	Bacteria	2721
650	Ga0207686_10275477	3300025934	Bacteria	1240
651	Ga0207709_10000344	3300025935	Bacteria	48058
652	Ga0207709_10003540	3300025935	Bacteria	9237
653	Ga0207709_10165987	3300025935	Bacteria	1545
654	Ga0207670_10000461	3300025936	Bacteria	22671
655	Ga0207670_10002631	3300025936	Bacteria	9445
656	Ga0207670_10111337	3300025936	Bacteria	1973
657	Ga0207670_10151846	3300025936	Bacteria	1720
658	Ga0207670_10243822	3300025936	Unclassified	1386
659	Ga0207669_10000295	3300025937	Bacteria	22936
660	Ga0207669_10001111	3300025937	Bacteria	11514
661	Ga0207669_10029074	3300025937	Bacteria	3051
662	Ga0207704_10000343	3300025938	Bacteria	21644
663	Ga0207704_10052137	3300025938	Bacteria	2478
664	Ga0207704_10060299	3300025938	Bacteria	2347
665	Ga0207665_10001068	3300025939	Bacteria	18420
666	Ga0207665_10003817	3300025939	Bacteria	10071
667	Ga0207665_10109985	3300025939	Bacteria	1935
668	Ga0207665_10129375	3300025939	Bacteria	1790
669	Ga0207691_10000635	3300025940	Bacteria	34764
670	Ga0207691_10003768	3300025940	Bacteria	14723
671	Ga0207691_10012880	3300025940	Bacteria	8006
672	Ga0207711_10007313	3300025941	Bacteria	9244
673	Ga0207711_10093487	3300025941	Bacteria	2649
674	Ga0207711_10186767	3300025941	Bacteria	1887
675	Ga0207711_10223596	3300025941	Bacteria	1723
676	Ga0207689_10002655	3300025942	Bacteria	16537
677	Ga0207689_10003641	3300025942	Bacteria	14070
678	Ga0207689_10024648	3300025942	Bacteria	5045
679	Ga0207689_10043531	3300025942	Bacteria	3711
680	Ga0207689_10213810	3300025942	Bacteria	1593
681	Ga0207661_10000036	3300025944	Bacteria	149720
682	Ga0207661_10135662	3300025944	Bacteria	2113
683	Ga0207661_10672300	3300025944	Bacteria	952
684	Ga0207679_10000025	3300025945	Bacteria	203699
685	Ga0207679_10014282	3300025945	Bacteria	5216
686	Ga0207679_10082518	3300025945	Bacteria	2461
687	Ga0207679_10374527	3300025945	Bacteria	1247
688	Ga0207679_10556082	3300025945	Bacteria	1030
689	Ga0207679_10823092	3300025945	Bacteria	847
690	Ga0207667_10007960	3300025949	Bacteria	12642
691	Ga0207667_10463367	3300025949	Bacteria	1287
692	Ga0207651_10000028	3300025960	Bacteria	68962
693	Ga0207651_10013440	3300025960	Bacteria	4686
694	Ga0207651_10053292	3300025960	Bacteria	2764
695	Ga0207651_10153312	3300025960	Bacteria	1797
696	Ga0207651_10224029	3300025960	Bacteria	1522
697	Ga0207651_10441443	3300025960	Bacteria	1115
698	Ga0207712_10000558	3300025961	Bacteria	30161
699	Ga0207712_10002399	3300025961	Bacteria	12137
700	Ga0207712_10089239	3300025961	Bacteria	2266
701	Ga0207712_10372855	3300025961	Bacteria	1192
702	Ga0207668_10000538	3300025972	Bacteria	23787
703	Ga0207668_10013637	3300025972	Bacteria	5013
704	Ga0207668_10031104	3300025972	Bacteria	3512
705	Ga0207640_10006541	3300025981	Bacteria	6398
706	Ga0207640_10041977	3300025981	Bacteria	2913
707	Ga0207640_10043342	3300025981	Bacteria	2875
708	Ga0207640_10170042	3300025981	Bacteria	1623
709	Ga0207640_10691598	3300025981	Bacteria	873
710	Ga0207640_10804095	3300025981	Bacteria	815
711	Ga0207658_10000795	3300025986	Bacteria	26521
712	Ga0207658_10046077	3300025986	Bacteria	3182
713	Ga0207658_10197400	3300025986	Bacteria	1677
714	Ga0207658_10370139	3300025986	Bacteria	1252
715	Ga0207677_10001822	3300026023	Bacteria	11259
716	Ga0207677_10015703	3300026023	Bacteria	4463
717	Ga0207677_10043555	3300026023	Bacteria	2985
718	Ga0207677_10099423	3300026023	Bacteria	2136
719	Ga0207703_10008768	3300026035	Bacteria	7975
720	Ga0207703_10012768	3300026035	Bacteria	6549
721	Ga0207703_10041098	3300026035	Bacteria	3703
722	Ga0207703_10401509	3300026035	Bacteria	1272
723	Ga0207703_10556570	3300026035	Bacteria	1082
724	Ga0207703_11072959	3300026035	Bacteria	773
725	Ga0207639_10000925	3300026041	Bacteria	19873
726	Ga0207639_10018222	3300026041	Bacteria	4986
727	Ga0207639_10045906	3300026041	Bacteria	3293
728	Ga0207639_10238405	3300026041	Bacteria	1580
729	Ga0207639_10276924	3300026041	Bacteria	1474
730	Ga0207639_10316368	3300026041	Bacteria	1385
731	Ga0207678_10003256	3300026067	Bacteria	14657
732	Ga0207678_10004902	3300026067	Bacteria	12024
733	Ga0207678_10006940	3300026067	Bacteria	10052
734	Ga0207678_10010341	3300026067	Bacteria	8190
735	Ga0207678_10016580	3300026067	Bacteria	6470
736	Ga0207678_10248247	3300026067	Bacteria	1524
737	Ga0207708_10004521	3300026075	Bacteria	10234
738	Ga0207708_10019050	3300026075	Bacteria	5168
739	Ga0207708_10037218	3300026075	Bacteria	3707
740	Ga0207702_10004638	3300026078	Bacteria	12166
741	Ga0207702_10065787	3300026078	Bacteria	3105
742	Ga0207702_10069314	3300026078	Bacteria	3032
743	Ga0207702_10073820	3300026078	Bacteria	2942
744	Ga0207641_10001294	3300026088	Bacteria	24893
745	Ga0207648_10003105	3300026089	Bacteria	17542
746	Ga0207648_10004307	3300026089	Bacteria	14659
747	Ga0207648_10011750	3300026089	Bacteria	8232
748	Ga0207648_10076986	3300026089	Bacteria	2908
749	Ga0207648_10553353	3300026089	Bacteria	1057
750	Ga0207676_10000640	3300026095	Bacteria	28116
751	Ga0207676_10024382	3300026095	Bacteria	4475
752	Ga0207676_10042058	3300026095	Bacteria	3513
753	Ga0207676_10313281	3300026095	Bacteria	1437
754	Ga0207674_10005795	3300026116	Bacteria	14657
755	Ga0207674_10074975	3300026116	Bacteria	3394
756	Ga0207674_10104935	3300026116	Bacteria	2804
757	Ga0207674_10253632	3300026116	Bacteria	1706
758	Ga0207674_10489740	3300026116	Bacteria	1188
759	Ga0207675_100003849	3300026118	Bacteria	14589
760	Ga0207675_100004255	3300026118	Bacteria	13848
761	Ga0207683_10000001	3300026121	Bacteria	352047
762	Ga0207683_10004806	3300026121	Bacteria	11633
763	Ga0207683_10007077	3300026121	Bacteria	9617
764	Ga0207683_10023723	3300026121	Bacteria	5278
765	Ga0207683_10044817	3300026121	Bacteria	3867
766	Ga0207698_10014590	3300026142	Bacteria	5230
767	Ga0207698_10026697	3300026142	Bacteria	4088
768	Ga0207698_10127971	3300026142	Bacteria	2164
769	Ga0207698_10291971	3300026142	Bacteria	1513
770	Ga0207698_10458495	3300026142	Bacteria	1232
771	Ga0207698_10996118	3300026142	Bacteria	848
772	Ga0209995_1017210	3300027471	Bacteria	1189
773	Ga0209179_1029153	3300027512	Bacteria	1122
774	Ga0209968_1030175	3300027526	Bacteria	905
775	Ga0209982_1002600	3300027552	Bacteria	2541
776	Ga0209970_1012282	3300027614	Bacteria	1415
777	Ga0210002_1001810	3300027617	Bacteria	3044
778	Ga0209983_1035560	3300027665	Bacteria	1069
779	Ga0209971_1037950	3300027682	Bacteria	1160
780	Ga0209966_1001479	3300027695	Bacteria	4079
781	Ga0209966_1001617	3300027695	Bacteria	3849
782	Ga0209998_10001115	3300027717	Bacteria	6677
783	Ga0209998_10001190	3300027717	Bacteria	6421
784	Ga0209813_10001830	3300027866	Bacteria	4791
785	Ga0209974_10000991	3300027876	Bacteria	9982
786	Ga0209974_10123482	3300027876	Bacteria	919
787	Ga0207428_10000823	3300027907	Bacteria	34987
788	Ga0207428_10001512	3300027907	Bacteria	24323
789	Ga0207428_10105356	3300027907	Bacteria	2175
790	Ga0265357_1001253	3300028023	Bacteria	1813
791	Ga0268266_10026518	3300028379	Bacteria	4930
792	Ga0268266_10135900	3300028379	Bacteria	2202
793	Ga0268266_10153292	3300028379	Bacteria	2079
794	Ga0268266_10167713	3300028379	Bacteria	1991
795	Ga0268266_10311633	3300028379	Bacteria	1471
796	Ga0268265_10001288	3300028380	Bacteria	21569
797	Ga0268265_10086490	3300028380	Bacteria	2491
798	Ga0268265_10555025	3300028380	Bacteria	1091
799	Ga0268264_10000456	3300028381	Bacteria	55761
800	Ga0268264_10005325	3300028381	Bacteria	10898
801	Ga0268264_10074026	3300028381	Bacteria	2892
802	Ga0268264_10128105	3300028381	Bacteria	2246
803	Ga0268264_10354635	3300028381	Bacteria	1397
804	Ga0268264_10559966	3300028381	Bacteria	1122
805	Ga0265318_10004032	3300028577	Bacteria	7212
806	Ga0265330_10007771	3300031235	Bacteria	5206
807	Ga0265330_10053496	3300031235	Bacteria	1767
808	Ga0265332_10012389	3300031238	Bacteria	3785
809	Ga0265320_10018493	3300031240	Bacteria	3834
810	Ga0265325_10004992	3300031241	Bacteria	8267
811	Ga0265329_10012587	3300031242	Bacteria	3036
812	Ga0265340_10004865	3300031247	Bacteria	7472
813	Ga0265340_10020868	3300031247	Bacteria	3362
814	Ga0265339_10004645	3300031249	Bacteria	9336
815	Ga0265339_10013807	3300031249	Bacteria	4887
816	Ga0265331_10012924	3300031250	Bacteria	4501
817	Ga0265331_10051231	3300031250	Bacteria	1976
818	Ga0265316_10025046	3300031344	Bacteria	4984
819	Ga0265316_10070106	3300031344	Bacteria	2704
820	Ga0265316_10129850	3300031344	Bacteria	1898
821	Ga0307513_10115927	3300031456	Bacteria	2660
822	Ga0265313_10022841	3300031595	Bacteria	3383
823	Ga0265314_10008306	3300031711	Bacteria	8906
824	Ga0265342_10000092	3300031712	Bacteria	99040
825	Ga0265342_10014308	3300031712	Bacteria	5271
826	Ga0307410_10730951	3300031852	Bacteria	837
827	Ga0316583_10000594	3300032133	Bacteria	10995
828	Ga0307510_10192420	3300033180	Bacteria	1586
829	Ga0373930_0000196	3300034816	Bacteria	7356
830	Ga0373948_0000861	3300034817	Bacteria	4040
831	Ga0373948_0001041	3300034817	Bacteria	3733
832	Ga0373948_0001761	3300034817	Bacteria	3079
833	Ga0373950_0000297	3300034818	Bacteria	6238
834	Ga0373950_0005679	3300034818	Bacteria	1872
835	Ga0373958_0002061	3300034819	Bacteria	2777
836	Ga0373958_0006709	3300034819	Bacteria	1806
837	Ga0373958_0008200	3300034819	Bacteria	1686
838	Ga0373959_0001177	3300034820	Bacteria	4225
839	Ga0373959_0002292	3300034820	Bacteria	3042
840	Ga0373938_0000046	3300034957	Bacteria	16304
841	Ga0373938_0002402	3300034957	Bacteria	3017
842	Ga0373938_0020342	3300034957	Bacteria	1336
843	Ga0373926_0021975	3300035083	Bacteria	2212
844	Ga0373926_0046822	3300035083	Bacteria	1552
845	Ga0373928_0001726	3300035084	Bacteria	4244
846	Ga0373928_0046076	3300035084	Unclassified	1016
847	Ga0373929_0000284	3300035085	Bacteria	9427
848	Ga0373929_0002711	3300035085	Bacteria	3232
849	Ga0373934_0022290	3300035086	Bacteria	2443
850	Ga0373934_0076615	3300035086	Bacteria	1341
851	Ga0373940_0001045	3300035088	Bacteria	4772
852	Ga0373940_0001289	3300035088	Bacteria	4460
853	Ga0373944_0003559	3300035089	Bacteria	4028
854	Ga0373944_0005088	3300035089	Bacteria	3453
855	Ga0373944_0040433	3300035089	Bacteria	1439
856	Ga0373949_0000546	3300035090	Bacteria	12423
857	Ga0373949_0001599	3300035090	Bacteria	6378
858	Ga0373949_0024744	3300035090	Bacteria	1397
859	Ga0373951_0000608	3300035091	Bacteria	9852
860	Ga0373951_0001694	3300035091	Bacteria	5757
861	Ga0373951_0020605	3300035091	Bacteria	1510
862	Ga0373952_0000574	3300035092	Bacteria	6477
863	Ga0373952_0004003	3300035092	Bacteria	2662
864	Ga0373923_0016264	3300035111	Bacteria	2823
865	Ga0373923_0066038	3300035111	Bacteria	1545
866	Ga0373923_0094372	3300035111	Bacteria	1312
867	Ga0373932_0000577	3300035112	Bacteria	11181
868	Ga0373932_0001670	3300035112	Bacteria	6058
869	Ga0373932_0011388	3300035112	Bacteria	2172
870	Ga0373936_0005473	3300035113	Bacteria	4790
871	Ga0373936_0122148	3300035113	Bacteria	1113
872	Ga0373939_0000691	3300035114	Bacteria	8369
873	Ga0373939_0001452	3300035114	Bacteria	5734
874	Ga0373939_0002354	3300035114	Bacteria	4469
875	Ga0373941_0003673	3300035115	Bacteria	3493
876	Ga0373941_0007450	3300035115	Bacteria	2677
877	Ga0373945_0021266	3300035116	Bacteria	2228
878	Ga0373945_0021839	3300035116	Bacteria	2202
879	Ga0373945_0036414	3300035116	Bacteria	1763
880	Ga0373945_0095753	3300035116	Bacteria	1155
881	Ga0373945_0134297	3300035116	Bacteria	994
882	Ga0373953_0007986	3300035117	Bacteria	3573
883	Ga0373953_0014564	3300035117	Bacteria	2832
884	Ga0373953_0105645	3300035117	Bacteria	1188
885	Ga0373954_0004076	3300035118	Bacteria	6261
886	Ga0373954_0128019	3300035118	Bacteria	1235
887	Ga0373956_0001739	3300035119	Bacteria	8964
888	Ga0373956_0001917	3300035119	Bacteria	8598
889	Ga0373956_0024511	3300035119	Bacteria	2600
890	Ga0373957_0006573	3300035120	Bacteria	3671
891	Ga0373957_0006843	3300035120	Bacteria	3614
892	Ga0373960_0000587	3300035121	Bacteria	7449
893	Ga0373960_0011868	3300035121	Bacteria	2155
894	Ga0373960_0058946	3300035121	Unclassified	1159
895	Ga0373943_0002330	3300035170	Bacteria	8635
896	Ga0373943_0011524	3300035170	Bacteria	3979
897	Ga0373943_0084121	3300035170	Bacteria	1636
898	Ga0373946_0008539	3300035171	Bacteria	3759
899	Ga0373946_0011321	3300035171	Bacteria	3325
900	Ga0373946_0036676	3300035171	Bacteria	1989
901	Ga0373955_0001883	3300035172	Bacteria	9050
902	Ga0373955_0021582	3300035172	Bacteria	3253
903	Ga0373955_0150546	3300035172	Bacteria	1369
904	Ga0373955_0416613	3300035172	Bacteria	817
905	Ga0373955_0440854	3300035172	Bacteria	793
906	Ga0373942_0001465	3300035207	Bacteria	6062
907	Ga0373942_0004097	3300035207	Bacteria	3396
908	Ga0373942_0010473	3300035207	Bacteria	2182
909	Ga0373961_0000385	3300035241	Bacteria	18617
910	Ga0373961_0000869	3300035241	Bacteria	10181
911	Ga0373961_0051776	3300035241	Bacteria	1220
912	Ga0373961_0054494	3300035241	Bacteria	1196
913	Ga0373962_0003613	3300035242	Bacteria	3718
914	Ga0373962_0006217	3300035242	Bacteria	2888
915	Ga0373962_0062480	3300035242	Bacteria	1096
916	Ga0373962_0073279	3300035242	Bacteria	1027
917	Ga0373924_0223256	3300035410	Bacteria	832
918	Ga0373931_0001882	3300035691	Bacteria	9166
919	Ga0373931_0003354	3300035691	Bacteria	7175
920	Ga0373931_0012617	3300035691	Bacteria	4097
921	Ga0373935_0002676	3300035692	Bacteria	10246
922	Ga0373935_0257719	3300035692	Bacteria	1222
923	Ga0373927_0010750	3300035695	Bacteria	6096
924	Ga0373927_0122790	3300035695	Bacteria	1695
925	Ga0373927_0179285	3300035695	Bacteria	1389
926	Ga0373933_0000125	3300035724	Bacteria	49268
927	Ga0373933_0002112	3300035724	Bacteria	11410
928	Ga0373933_0010711	3300035724	Bacteria	5029
929	Ga0373933_0017319	3300035724	Bacteria	4041
930	Ga0373947_0001553	3300035725	Bacteria	14063
931	Ga0373947_0080026	3300035725	Bacteria	2020
932	Ga0373947_0170067	3300035725	Bacteria	1414
933	Ga0373947_0436927	3300035725	Bacteria	885
934	Ga0373937_0002048	3300036401	Bacteria	16856
935	Ga0373937_0188820	3300036401	Bacteria	1936
936	Ga0373937_0223998	3300036401	Bacteria	1770
937	Ga0373937_0511460	3300036401	Bacteria	1141
938	Ga0373925_0008896	3300037068	Bacteria	7316
939	Ga0373925_0033160	3300037068	Bacteria	3806
940	Ga0373925_0125619	3300037068	Bacteria	1995
941	Ga0373925_0256122	3300037068	Bacteria	1405
942	Ga0373925_0640801	3300037068	Bacteria	875
943	Ga0395899_0097748	3300037312	Bacteria	2122
944	Ga0395900_0003627	3300037418	Bacteria	16600
945	Ga0395898_0174352	3300037466	Bacteria	2055
946	Ga0395898_0931075	3300037466	Bacteria	806
947	Ga0395905_0014986	3300037471	Bacteria	7393
948	Ga0436364_0794080	3300037853	Bacteria	1792
949	Ga0395901_0040521	3300038443	Bacteria	4825
950	Ga0395901_0048746	3300038443	Bacteria	4399
951	Ga0395901_0152787	3300038443	Bacteria	2425
952	Ga0242420_015440	3300038996	Unclassified	1320
953	Ga0436365_0657686	3300039437	Bacteria	27042
954	Ga0436365_1898637	3300039437	Bacteria	5776
955	Ga0436361_0256491	3300039447	Bacteria	1036
956	Ga0436361_0950726	3300039447	Bacteria	11725
957	Ga0436362_0287115	3300039453	Bacteria	1021
958	Ga0436362_1090515	3300039453	Bacteria	1191
959	Ga0439453_0001852	3300041408	Bacteria	2812
960	Ga0439435_0015895	3300042436	Bacteria	1879
961	Ga0439464_0021214	3300042439	Bacteria	1783
962	Ga0451577_0297987	3300042876	Bacteria	1461
963	Ga0466972_0052403	3300044658	Bacteria	1967
964	Ga0466965_0052201	3300044683	Bacteria	2030
965	Ga0466965_0148285	3300044683	Bacteria	1225
966	Ga0466965_0205969	3300044683	Bacteria	1045
967	Ga0466963_0009295	3300044694	Bacteria	5920
968	Ga0466968_0059735	3300044735	Bacteria	1642
969	Ga0466968_0078596	3300044735	Bacteria	1446
970	Ga0466960_0126038	3300044901	Bacteria	1346
971	Ga0466959_0433853	3300045049	Bacteria	891
972	Ga0451576_0021183	3300045051	Bacteria	7067
973	Ga0466967_0076147	3300045976	Bacteria	3017
974	Ga0495617_076952	3300046452	Bacteria	1094
975	Ga0495592_0004699	3300046454	Bacteria	10018
976	Ga0495592_0014796	3300046454	Bacteria	5923
977	Ga0495592_0041714	3300046454	Bacteria	3439
978	Ga0495592_0156492	3300046454	Bacteria	1571
979	Ga0495592_0192099	3300046454	Bacteria	1383
980	Ga0495603_0025855	3300046455	Bacteria	3548
981	Ga0495603_0082710	3300046455	Bacteria	1880
982	Ga0495629_0003044	3300046459	Bacteria	12743
983	Ga0495629_0014934	3300046459	Bacteria	5580
984	Ga0495629_0142612	3300046459	Bacteria	1666
985	Ga0495629_0157088	3300046459	Bacteria	1580
986	Ga0495629_0188613	3300046459	Bacteria	1427
987	Ga0495638_0046393	3300046460	Bacteria	2729
988	Ga0495641_0016811	3300046461	Bacteria	3839
989	Ga0495641_0036035	3300046461	Bacteria	2327
990	Ga0495641_0084391	3300046461	Bacteria	1422
991	Ga0495651_0002035	3300046462	Bacteria	15618
992	Ga0495651_0010719	3300046462	Bacteria	7049
993	Ga0495651_0036349	3300046462	Bacteria	3835
994	Ga0495651_0098800	3300046462	Bacteria	2177
995	Ga0495651_0164118	3300046462	Bacteria	1588
996	Ga0495653_0035187	3300046463	Bacteria	3954
997	Ga0495653_0065475	3300046463	Bacteria	2735
998	Ga0495653_0089810	3300046463	Bacteria	2250
999	Ga0495653_0223012	3300046463	Bacteria	1266
1000	Ga0495653_0359077	3300046463	Bacteria	935
1001	Ga0495580_0152763	3300046472	Bacteria	1599
1002	Ga0495580_0199102	3300046472	Bacteria	1380
1003	Ga0495582_0003239	3300046473	Bacteria	9143
1004	Ga0495582_0028856	3300046473	Bacteria	3046
1005	Ga0495582_0084807	3300046473	Bacteria	1761
1006	Ga0495582_0104126	3300046473	Bacteria	1590
1007	Ga0495605_0035609	3300046474	Bacteria	2515
1008	Ga0495639_0121074	3300046475	Bacteria	1248
1009	Ga0495662_0048090	3300046476	Bacteria	2059
1010	Ga0495662_0107218	3300046476	Bacteria	1368
1011	Ga0495664_0016212	3300046477	Bacteria	4244
1012	Ga0495664_0030072	3300046477	Bacteria	3180
1013	Ga0495664_0101108	3300046477	Bacteria	1737
1014	Ga0495664_0110833	3300046477	Bacteria	1656
1015	Ga0495584_0007023	3300046491	Bacteria	5881
1016	Ga0495584_0018261	3300046491	Bacteria	3566
1017	Ga0495584_0111683	3300046491	Bacteria	1383
1018	Ga0495584_0177029	3300046491	Bacteria	1084
1019	Ga0495585_0000856	3300046492	Bacteria	26041
1020	Ga0495585_0007417	3300046492	Bacteria	6716
1021	Ga0495585_0028456	3300046492	Bacteria	3188
1022	Ga0495585_0111422	3300046492	Bacteria	1455
1023	Ga0495594_0008038	3300046499	Bacteria	5424
1024	Ga0495594_0011796	3300046499	Bacteria	4544
1025	Ga0495594_0096793	3300046499	Bacteria	1658
1026	Ga0495594_0110433	3300046499	Bacteria	1550
1027	Ga0495607_0027202	3300046501	Bacteria	3540
1028	Ga0495607_0195196	3300046501	Bacteria	1006
1029	Ga0495606_0009508	3300046507	Bacteria	8211
1030	Ga0495606_0134135	3300046507	Bacteria	1468
1031	Ga0495608_0000915	3300046511	Bacteria	20676
1032	Ga0495608_0050572	3300046511	Bacteria	2757
1033	Ga0495608_0058533	3300046511	Bacteria	2540
1034	Ga0495608_0066508	3300046511	Bacteria	2359
1035	Ga0495608_0076902	3300046511	Bacteria	2173
1036	Ga0495610_0053992	3300046512	Bacteria	1943
1037	Ga0495618_0052960	3300046514	Bacteria	2566
1038	Ga0495628_0008958	3300046516	Bacteria	8558
1039	Ga0495628_0032827	3300046516	Bacteria	4187
1040	Ga0495628_0082672	3300046516	Bacteria	2494
1041	Ga0495628_0112489	3300046516	Bacteria	2093
1042	Ga0495628_0184642	3300046516	Bacteria	1576
1043	Ga0495630_0126393	3300046517	Bacteria	1940
1044	Ga0495630_0130219	3300046517	Bacteria	1911
1045	Ga0495630_0238275	3300046517	Bacteria	1390
1046	Ga0495630_0541043	3300046517	Bacteria	893
1047	Ga0495630_0659536	3300046517	Bacteria	801
1048	Ga0495630_1022742	3300046517	Bacteria	628
1049	Ga0495631_0094340	3300046518	Bacteria	1288
1050	Ga0495637_0044734	3300046520	Bacteria	1883
1051	Ga0495637_0113199	3300046520	Bacteria	1050
1052	Ga0495644_0011268	3300046523	Bacteria	3444
1053	Ga0495644_0033593	3300046523	Bacteria	1937
1054	Ga0495648_0002380	3300046524	Bacteria	17465
1055	Ga0495663_0021146	3300046525	Bacteria	1873
1056	Ga0495666_0014396	3300046526	Bacteria	3938
1057	Ga0495666_0018752	3300046526	Bacteria	3437
1058	Ga0495666_0136415	3300046526	Bacteria	1145
1059	Ga0495642_0167641	3300046528	Bacteria	954
1060	Ga0495652_0005789	3300046529	Bacteria	11570
1061	Ga0495652_0020937	3300046529	Bacteria	5812
1062	Ga0495652_0063623	3300046529	Bacteria	3105
1063	Ga0495652_0076458	3300046529	Bacteria	2777
1064	Ga0495652_0261233	3300046529	Bacteria	1278
1065	Ga0495652_0352001	3300046529	Bacteria	1055
1066	Ga0495665_0061258	3300046531	Bacteria	1987
1067	Ga0495665_0082559	3300046531	Bacteria	1690
1068	Ga0495665_0097718	3300046531	Bacteria	1541
1069	Ga0495640_0071044	3300046533	Bacteria	2336
1070	Ga0495640_0101573	3300046533	Bacteria	1887
1071	Ga0495640_0209888	3300046533	Bacteria	1231
1072	Ga0495640_0348910	3300046533	Bacteria	914
1073	Ga0495640_0486745	3300046533	Bacteria	751
1074	Ga0495586_0075875	3300046535	Bacteria	1841
1075	Ga0495587_0001734	3300046536	Bacteria	14559
1076	Ga0495587_0018262	3300046536	Bacteria	4351
1077	Ga0495587_0076892	3300046536	Bacteria	1938
1078	Ga0495587_0116350	3300046536	Bacteria	1533
1079	Ga0495598_0000233	3300046537	Bacteria	9950
1080	Ga0495598_0020531	3300046537	Bacteria	1745
1081	Ga0495609_0039144	3300046538	Bacteria	2135
1082	Ga0495621_0008367	3300046539	Bacteria	3100
1083	Ga0495621_0050241	3300046539	Bacteria	1490
1084	Ga0495621_0091691	3300046539	Bacteria	1146
1085	Ga0495645_0011672	3300046543	Bacteria	6184
1086	Ga0495645_0086453	3300046543	Bacteria	2244
1087	Ga0495622_0024440	3300046557	Bacteria	2821
1088	Ga0495622_0141676	3300046557	Bacteria	1091
1089	Ga0495633_0017034	3300046558	Bacteria	3727
1090	Ga0495667_0000259	3300046559	Bacteria	34280
1091	Ga0495667_0018366	3300046559	Bacteria	4723
1092	Ga0495667_0070601	3300046559	Bacteria	2278
1093	Ga0495656_0000215	3300046615	Bacteria	20636
1094	Ga0495668_0039909	3300046616	Bacteria	2620
1095	Ga0495668_0046683	3300046616	Bacteria	2406
1096	Ga0495634_0008814	3300046642	Bacteria	7480
1097	Ga0495634_0180235	3300046642	Bacteria	1323
1098	Ga0495611_0003842	3300046648	Bacteria	6552
1099	Ga0495611_0078575	3300046648	Bacteria	1515
1100	Ga0495611_0277951	3300046648	Bacteria	774
1101	Ga0495625_0017744	3300046660	Bacteria	5567
1102	Ga0495635_0010301	3300046663	Bacteria	6538
1103	Ga0495635_0015969	3300046663	Bacteria	5243
1104	Ga0495635_0026638	3300046663	Bacteria	4021
1105	Ga0495635_0445479	3300046663	Bacteria	856
1106	Ga0495635_0523152	3300046663	Bacteria	779
1107	Ga0495659_0002574	3300046664	Bacteria	5848
1108	Ga0495659_0054558	3300046664	Bacteria	1462
1109	Ga0495661_0063130	3300046665	Bacteria	2191
1110	Ga0495661_0222522	3300046665	Bacteria	977
1111	Ga0495588_0020179	3300046674	Bacteria	3272
1112	Ga0495588_0131939	3300046674	Bacteria	1318
1113	Ga0495588_0243427	3300046674	Bacteria	948
1114	Ga0495657_0015814	3300046675	Bacteria	5511
1115	Ga0495657_0091756	3300046675	Bacteria	1947
1116	Ga0495599_0002681	3300046678	Bacteria	10394
1117	Ga0495599_0017056	3300046678	Bacteria	4512
1118	Ga0495599_0042653	3300046678	Bacteria	2847
1119	Ga0495599_0115730	3300046678	Bacteria	1668
1120	Ga0495623_0020755	3300046679	Bacteria	4245
1121	Ga0495623_0064743	3300046679	Bacteria	2287
1122	Ga0495623_0132012	3300046679	Bacteria	1494
1123	Ga0495646_0010194	3300046680	Bacteria	5975
1124	Ga0495646_0026632	3300046680	Bacteria	3629
1125	Ga0495646_0059772	3300046680	Bacteria	2275
1126	Ga0495647_0020437	3300046681	Bacteria	2376
1127	Ga0495658_0000360	3300046683	Bacteria	25675
1128	Ga0495658_0005781	3300046683	Bacteria	6071
1129	Ga0495658_0094433	3300046683	Bacteria	1776
1130	Ga0495613_0006693	3300046689	Bacteria	8606
1131	Ga0495613_0027827	3300046689	Bacteria	4207
1132	Ga0495613_0033307	3300046689	Bacteria	3829
1133	Ga0495613_0065362	3300046689	Bacteria	2658
1134	Ga0495613_0207131	3300046689	Bacteria	1380
1135	Ga0495624_0155778	3300046690	Bacteria	1396
1136	Ga0495624_0227022	3300046690	Bacteria	1131
1137	Ga0495624_0240543	3300046690	Bacteria	1095
1138	Ga0495624_0256231	3300046690	Bacteria	1058
1139	Ga0495624_0260707	3300046690	Bacteria	1047
1140	Ga0495670_0000213	3300046691	Bacteria	26531
1141	Ga0495670_0033566	3300046691	Bacteria	2553
1142	Ga0495670_0144478	3300046691	Bacteria	1246
1143	Ga0495671_0062082	3300046692	Bacteria	1842
1144	Ga0495671_0301809	3300046692	Bacteria	770
1145	Ga0495649_0040385	3300046694	Bacteria	2555
1146	Ga0495649_0368703	3300046694	Bacteria	724
1147	Ga0495600_0006046	3300046809	Bacteria	7331
1148	Ga0495600_0025897	3300046809	Bacteria	3782
1149	Ga0495600_0052146	3300046809	Bacteria	2671
1150	Ga0495600_0280197	3300046809	Bacteria	1055
1151	Ga0495581_0049437	3300047315	Bacteria	2428
1152	Ga0495581_0057033	3300047315	Bacteria	2254
1153	Ga0495581_0059837	3300047315	Bacteria	2201
1154	Ga0495581_0064661	3300047315	Bacteria	2114
1155	Ga0495604_0002294	3300047317	Bacteria	15322
1156	Ga0495604_0006070	3300047317	Bacteria	9587
1157	Ga0495604_0009049	3300047317	Bacteria	7879
1158	Ga0495604_0057607	3300047317	Bacteria	2987
1159	Ga0495604_0215008	3300047317	Bacteria	1326
1160	Ga0495636_0138265	3300047318	Bacteria	1087
1161	Ga0495674_0116513	3300047319	Bacteria	2260
1162	Ga0495674_0138581	3300047319	Bacteria	2046
1163	Ga0495674_0252836	3300047319	Bacteria	1450
1164	Ga0495674_0338640	3300047319	Bacteria	1223
1165	Ga0495674_0371609	3300047319	Bacteria	1158
1166	Ga0495674_0627891	3300047319	Bacteria	849
1167	Ga0495676_0103110	3300047321	Bacteria	2107
1168	Ga0495676_0142975	3300047321	Bacteria	1712
1169	Ga0495680_0002446	3300047322	Bacteria	19009
1170	Ga0495680_0004222	3300047322	Bacteria	13790
1171	Ga0495680_0006606	3300047322	Bacteria	10758
1172	Ga0495680_0012206	3300047322	Bacteria	7577
1173	Ga0495680_0018853	3300047322	Bacteria	5846
1174	Ga0495683_0102690	3300047323	Bacteria	1373
1175	Ga0495683_0107894	3300047323	Bacteria	1332
1176	Ga0495675_0000147	3300047444	Bacteria	49274
1177	Ga0495675_0001653	3300047444	Bacteria	13342
1178	Ga0495675_0156734	3300047444	Bacteria	1404
1179	Ga0495675_0226208	3300047444	Bacteria	1130
1180	Ga0495673_0089310	3300047469	Bacteria	1262
1181	Ga0495684_0028528	3300047471	Bacteria	4284
1182	Ga0495684_0047645	3300047471	Bacteria	3278
1183	Ga0495684_0133969	3300047471	Bacteria	1859
1184	Ga0495686_0108062	3300047472	Bacteria	1671
1185	Ga0495593_0014970	3300047673	Bacteria	4403
1186	Ga0495593_0039262	3300047673	Bacteria	2553
1187	Ga0495593_0050848	3300047673	Bacteria	2194
1188	Ga0495593_0059876	3300047673	Bacteria	1994
1189	Ga0495593_0090251	3300047673	Bacteria	1578
1190	Ga0495593_0091642	3300047673	Bacteria	1565
1191	Ga0495602_0017376	3300048088	Bacteria	7212
1192	Ga0495602_0017828	3300048088	Bacteria	7109
1193	Ga0495602_0021291	3300048088	Bacteria	6387
1194	Ga0495602_0032133	3300048088	Bacteria	4947
1195	Ga0495602_0371326	3300048088	Bacteria	1027
1196	Ga0495614_0016270	3300048089	Bacteria	3239
1197	Ga0495614_0103831	3300048089	Bacteria	1244
1198	Ga0495614_0162082	3300048089	Bacteria	1001
1199	Ga0495615_0052303	3300048090	Bacteria	1055
1200	Ga0495626_0096330	3300048091	Bacteria	1295
1201	Ga0495626_0155680	3300048091	Bacteria	961
1202	Ga0495626_0185251	3300048091	Bacteria	861
1203	Ga0496100_0006594	3300048903	Bacteria	6342
1204	Ga0496100_0013961	3300048903	Bacteria	4650
1205	Ga0496100_0017287	3300048903	Bacteria	4254
1206	Ga0496100_0019150	3300048903	Bacteria	4077
1207	Ga0496100_0027597	3300048903	Bacteria	3493
1208	Ga0496100_0055392	3300048903	Bacteria	2590
1209	Ga0496100_0155297	3300048903	Bacteria	1636
1210	Ga0496100_0654765	3300048903	Bacteria	818
1211	Ga0496101_0000079	3300048904	Bacteria	107673
1212	Ga0496101_0008107	3300048904	Bacteria	6853
1213	Ga0496101_0040176	3300048904	Bacteria	3331
1214	Ga0496101_0042859	3300048904	Bacteria	3231
1215	Ga0496101_0207438	3300048904	Unclassified	1517
1216	Ga0496101_0494469	3300048904	Bacteria	966
1217	Ga0496102_0000942	3300048905	Bacteria	27472
1218	Ga0496102_0008860	3300048905	Bacteria	8634
1219	Ga0496102_0032833	3300048905	Bacteria	4664
1220	Ga0496102_0045286	3300048905	Bacteria	3994
1221	Ga0496102_0058807	3300048905	Bacteria	3513
1222	Ga0496102_0062689	3300048905	Bacteria	3404
1223	Ga0496102_0065998	3300048905	Bacteria	3317
1224	Ga0496102_0240279	3300048905	Bacteria	1708
1225	Ga0496102_0484428	3300048905	Bacteria	1158
1226	Ga0496102_0570034	3300048905	Bacteria	1055
1227	Ga0496102_0634479	3300048905	Bacteria	991
1228	Ga0496103_0002375	3300048906	Bacteria	11868
1229	Ga0496103_0003062	3300048906	Bacteria	10279
1230	Ga0496103_0003997	3300048906	Bacteria	8957
1231	Ga0496103_0019249	3300048906	Bacteria	4099
1232	Ga0496103_0127351	3300048906	Bacteria	1624
1233	Ga0496103_0181710	3300048906	Bacteria	1352
1234	Ga0496104_0000431	3300048907	Bacteria	36365
1235	Ga0496104_0001836	3300048907	Bacteria	18358
1236	Ga0496104_0004143	3300048907	Bacteria	12587
1237	Ga0496104_0004191	3300048907	Bacteria	12522
1238	Ga0496104_0004953	3300048907	Bacteria	11622
1239	Ga0496104_0048661	3300048907	Bacteria	3996
1240	Ga0496104_0057612	3300048907	Bacteria	3676
1241	Ga0496104_0119489	3300048907	Bacteria	2530
1242	Ga0496104_0121646	3300048907	Bacteria	2506
1243	Ga0496105_0003143	3300048908	Bacteria	12154
1244	Ga0496105_0010944	3300048908	Bacteria	7147
1245	Ga0496105_0023618	3300048908	Bacteria	4989
1246	Ga0496105_0030941	3300048908	Bacteria	4387
1247	Ga0496105_0106414	3300048908	Bacteria	2315
1248	Ga0496105_0198022	3300048908	Bacteria	1640
1249	Ga0496105_0269708	3300048908	Bacteria	1375
1250	Ga0496105_0482244	3300048908	Bacteria	975
1251	Ga0496106_0001143	3300048909	Bacteria	19671
1252	Ga0496106_0003554	3300048909	Bacteria	11610
1253	Ga0496106_0005844	3300048909	Bacteria	9101
1254	Ga0496106_0006633	3300048909	Bacteria	8570
1255	Ga0496106_0020095	3300048909	Bacteria	4953
1256	Ga0496106_0025502	3300048909	Bacteria	4400
1257	Ga0496106_0045494	3300048909	Bacteria	3296
1258	Ga0496106_0161002	3300048909	Bacteria	1775
1259	Ga0496106_0210718	3300048909	Bacteria	1548
1260	Ga0496106_0243728	3300048909	Bacteria	1436
1261	Ga0496106_0263203	3300048909	Bacteria	1380
1262	Ga0496107_0000359	3300048910	Bacteria	24907
1263	Ga0496107_0000436	3300048910	Bacteria	22636
1264	Ga0496107_0001363	3300048910	Bacteria	15012
1265	Ga0496107_0015236	3300048910	Bacteria	5387
1266	Ga0496107_0031502	3300048910	Bacteria	3784
1267	Ga0496107_0070373	3300048910	Bacteria	2540
1268	Ga0496107_0426888	3300048910	Bacteria	985
1269	Ga0496107_0641522	3300048910	Bacteria	783
1270	Ga0496108_0002867	3300048911	Bacteria	13838
1271	Ga0496108_0004006	3300048911	Bacteria	11815
1272	Ga0496108_0005147	3300048911	Bacteria	10572
1273	Ga0496108_0009582	3300048911	Bacteria	7848
1274	Ga0496108_0014038	3300048911	Bacteria	6535
1275	Ga0496108_0026663	3300048911	Bacteria	4768
1276	Ga0496108_0049594	3300048911	Bacteria	3511
1277	Ga0496108_0070596	3300048911	Bacteria	2948
1278	Ga0496108_0539247	3300048911	Bacteria	1018
1279	Ga0496109_0000223	3300048912	Bacteria	56008
1280	Ga0496109_0000404	3300048912	Bacteria	38842
1281	Ga0496109_0003116	3300048912	Bacteria	13828
1282	Ga0496109_0003557	3300048912	Bacteria	13009
1283	Ga0496109_0011617	3300048912	Bacteria	7572
1284	Ga0496109_0018871	3300048912	Bacteria	6069
1285	Ga0496109_0032437	3300048912	Bacteria	4695
1286	Ga0496109_0043419	3300048912	Bacteria	4074
1287	Ga0496109_0062763	3300048912	Bacteria	3398
1288	Ga0496109_0129345	3300048912	Bacteria	2356
1289	Ga0496109_0160862	3300048912	Bacteria	2104
1290	Ga0496109_0353838	3300048912	Bacteria	1387
1291	Ga0496109_0433724	3300048912	Bacteria	1241
1292	Ga0496110_0001910	3300048913	Bacteria	15419
1293	Ga0496110_0002394	3300048913	Bacteria	14052
1294	Ga0496110_0003653	3300048913	Bacteria	11834
1295	Ga0496110_0016589	3300048913	Bacteria	6151
1296	Ga0496110_0018162	3300048913	Bacteria	5892
1297	Ga0496110_0021793	3300048913	Bacteria	5431
1298	Ga0496110_0156603	3300048913	Bacteria	2064
1299	Ga0496110_0216741	3300048913	Bacteria	1741
1300	Ga0496110_0224907	3300048913	Bacteria	1707
1301	Ga0496110_0352580	3300048913	Bacteria	1340
1302	Ga0496110_0382159	3300048913	Bacteria	1283
1303	Ga0496110_0393332	3300048913	Unclassified	1263
1304	Ga0496111_0001774	3300048914	Bacteria	12653
1305	Ga0496111_0002312	3300048914	Bacteria	11466
1306	Ga0496111_0010932	3300048914	Bacteria	6105
1307	Ga0496111_0019333	3300048914	Bacteria	4729
1308	Ga0496111_0031701	3300048914	Bacteria	3765
1309	Ga0496111_0042841	3300048914	Bacteria	3251
1310	Ga0496111_0052032	3300048914	Bacteria	2957
1311	Ga0496111_0224552	3300048914	Bacteria	1395
1312	Ga0496112_0002963	3300048915	Bacteria	13850
1313	Ga0496112_0003601	3300048915	Bacteria	12888
1314	Ga0496112_0011928	3300048915	Bacteria	7962
1315	Ga0496112_0013071	3300048915	Bacteria	7658
1316	Ga0496112_0016019	3300048915	Bacteria	7009
1317	Ga0496112_0033447	3300048915	Bacteria	4998
1318	Ga0496112_0041430	3300048915	Bacteria	4506
1319	Ga0496112_0067614	3300048915	Bacteria	3527
1320	Ga0496112_0153304	3300048915	Bacteria	2271
1321	Ga0496112_0421394	3300048915	Bacteria	1274
1322	Ga0496112_0961166	3300048915	Bacteria	775
1323	Ga0496112_0991408	3300048915	Bacteria	760
1324	Ga0496113_0000624	3300048916	Bacteria	17779
1325	Ga0496113_0001396	3300048916	Bacteria	13436
1326	Ga0496113_0001735	3300048916	Bacteria	12339
1327	Ga0496113_0019330	3300048916	Bacteria	4763
1328	Ga0496113_0024186	3300048916	Bacteria	4314
1329	Ga0496113_0055173	3300048916	Bacteria	2977
1330	Ga0496113_0084102	3300048916	Bacteria	2443
1331	Ga0496113_0179025	3300048916	Bacteria	1680
1332	Ga0496113_0183840	3300048916	Bacteria	1657
1333	Ga0496113_0194380	3300048916	Bacteria	1611
1334	Ga0496113_0466813	3300048916	Bacteria	1014
1335	Ga0496113_0553775	3300048916	Bacteria	922
1336	Ga0496114_0003222	3300048917	Bacteria	12516
1337	Ga0496114_0003326	3300048917	Bacteria	12354
1338	Ga0496114_0026647	3300048917	Bacteria	4734
1339	Ga0496114_0030663	3300048917	Bacteria	4425
1340	Ga0496114_0104819	3300048917	Bacteria	2418
1341	Ga0496115_0000547	3300048918	Bacteria	29281
1342	Ga0496115_0008495	3300048918	Bacteria	7594
1343	Ga0496115_0011806	3300048918	Bacteria	6561
1344	Ga0496115_0269700	3300048918	Bacteria	1398
1345	Ga0496115_0616009	3300048918	Unclassified	861
1346	Ga0496116_0244215	3300048919	Bacteria	899
1347	Ga0496118_0158767	3300048921	Bacteria	1402
1348	Ga0496119_0004123	3300048922	Bacteria	14637
1349	Ga0496119_0044953	3300048922	Bacteria	2774
1350	Ga0496120_0006519	3300048923	Bacteria	8945
1351	Ga0496120_0051081	3300048923	Bacteria	2364
1352	Ga0496121_0041733	3300048924	Bacteria	4005
1353	Ga0496122_0081141	3300048925	Bacteria	2259
1354	Ga0496125_0033107	3300048928	Bacteria	4580
1355	Ga0496126_0040330	3300048929	Bacteria	4328
1356	Ga0501033_0076983	3300049570	Bacteria	2448
1357	Ga0501034_0112807	3300049571	Bacteria	2708
1358	Ga0501034_0418822	3300049571	Bacteria	1261
1359	Ga0501034_0485901	3300049571	Bacteria	1150
1360	Ga0501036_0027820	3300049572	Bacteria	4779
1361	Ga0501036_0364034	3300049572	Bacteria	1207
1362	Ga0501038_0196245	3300049574	Bacteria	1622
1363	Ga0501038_0285339	3300049574	Bacteria	1298
1364	Ga0501039_0092711	3300049575	Bacteria	2354
1365	Ga0501039_0435483	3300049575	Bacteria	1030
1366	Ga0501039_0517843	3300049575	Bacteria	936
1367	Ga0501040_0100563	3300049576	Bacteria	2016
1368	Ga0501042_0248800	3300049578	Bacteria	1283
1369	Ga0501043_0017209	3300049579	Bacteria	5670
1370	Ga0501047_0038971	3300049581	Bacteria	4596
1371	Ga0501047_0252772	3300049581	Bacteria	1611
1372	Ga0501047_0534621	3300049581	Bacteria	997
1373	Ga0501048_0165489	3300049582	Bacteria	1566
1374	Ga0501068_0015903	3300049584	Bacteria	4333
1375	Ga0501068_0297176	3300049584	Bacteria	1033
1376	Ga0501070_0019024	3300049586	Bacteria	5760
1377	Ga0501070_0084044	3300049586	Bacteria	2635
1378	Ga0501071_0049958	3300049587	Bacteria	3012
1379	Ga0501071_0285310	3300049587	Bacteria	1250
1380	Ga0501072_0002712	3300049588	Bacteria	13291
1381	Ga0501072_0004481	3300049588	Bacteria	10608
1382	Ga0501072_0334990	3300049588	Bacteria	1202
1383	Ga0501073_0033637	3300049589	Bacteria	3649
1384	Ga0501073_0135204	3300049589	Bacteria	1709
1385	Ga0501075_0083915	3300049591	Bacteria	2413
1386	Ga0501076_0062530	3300049592	Bacteria	2965
1387	Ga0501077_0018282	3300049593	Bacteria	4436
1388	Ga0501077_0342582	3300049593	Bacteria	953
1389	Ga0501079_0087588	3300049741	Bacteria	2410
1390	Ga0501079_0152376	3300049741	Bacteria	1802
1391	Ga0501079_0195043	3300049741	Bacteria	1581
1392	Ga0501079_0232621	3300049741	Bacteria	1440
1393	Ga0501079_0872822	3300049741	Bacteria	708
1394	Ga0501080_0235329	3300049742	Bacteria	1673
1395	Ga0501080_0239470	3300049742	Bacteria	1656
1396	Ga0501080_0266948	3300049742	Bacteria	1558
1397	Ga0501081_0050631	3300049743	Bacteria	2861
1398	Ga0501081_0245361	3300049743	Unclassified	1306
1399	Ga0501083_0185812	3300049744	Bacteria	1357
1400	Ga0501083_0290466	3300049744	Bacteria	1063
1401	Ga0501035_0001940	3300049822	Bacteria	20709
1402	Ga0501035_0061568	3300049822	Bacteria	3340
1403	Ga0501044_0063861	3300049823	Bacteria	3759
1404	Ga0501044_0065573	3300049823	Bacteria	3703
1405	Ga0501044_0145089	3300049823	Bacteria	2360
1406	Ga0501044_0387481	3300049823	Bacteria	1312
1407	Ga0501045_0212135	3300049824	Bacteria	1442
1408	Ga0501045_0341272	3300049824	Unclassified	1115
1409	nmdc:mga03683_14084_c2	3300050489	Bacteria	1938
1410	nmdc:mga03683_29136_c1	3300050489	Bacteria	2199
1411	nmdc:mga03n38_20855_c1	3300050490	Bacteria	2628
1412	nmdc:mga03n38_29865_c1	3300050490	Bacteria	2286
1413	nmdc:mga00v17_135626_c1	3300050491	Bacteria	1575
1414	nmdc:mga00v17_23425_c1	3300050491	Bacteria	3571
1415	nmdc:mga00v17_52949_c1	3300050491	Bacteria	2472
1416	nmdc:mga0yw44_1437_c1	3300050492	Bacteria	9099
1417	nmdc:mga0yw44_480014_c1	3300050492	Bacteria	843
1418	nmdc:mga0yw44_9426_c1	3300050492	Bacteria	4936
1419	nmdc:mga0k408_2858_c1	3300050493	Bacteria	9168
1420	nmdc:mga0k408_8431_c1	3300050493	Bacteria	5532
1421	nmdc:mga06z11_23264_c1	3300050494	Bacteria	2908
1422	nmdc:mga06z11_25302_c1	3300050494	Bacteria	2811
1423	nmdc:mga04h51_8211_c1	3300050495	Bacteria	2787
1424	nmdc:mga07m45_23396_c1	3300050496	Bacteria	3377
1425	nmdc:mga07m45_5426_c1	3300050496	Bacteria	6346
1426	nmdc:mga05p37_14557_c1	3300050507	Bacteria	9445
1427	nmdc:mga05p37_210565_c1	3300050507	Bacteria	2350
1428	nmdc:mga05p37_31120_c1	3300050507	Bacteria	6517
1429	nmdc:mga05p37_36596_c1	3300050507	Bacteria	6020
1430	nmdc:mga05p37_775316_c1	3300050507	Bacteria	1053
1431	nmdc:mga05p37_884548_c1	3300050507	Bacteria	965
1432	nmdc:mga09592_84725_c1	3300050508	Bacteria	2703
1433	nmdc:mga0qj67_150426_c1	3300050509	Bacteria	1888
1434	nmdc:mga0qj67_18_c1	3300050509	Bacteria	120268
1435	nmdc:mga0qj67_563395_c1	3300050509	Bacteria	913
1436	nmdc:mga06r32_100936_c1	3300050510	Bacteria	2831
1437	nmdc:mga06r32_40585_c1	3300050510	Bacteria	4419
1438	nmdc:mga06r32_64510_c1	3300050510	Bacteria	3532
1439	nmdc:mga08y16_110772_c1	3300050511	Bacteria	2859
1440	nmdc:mga08y16_133176_c1	3300050511	Bacteria	2584
1441	nmdc:mga08y16_226164_c1	3300050511	Bacteria	1936
1442	nmdc:mga08y16_319526_c1	3300050511	Unclassified	1599
1443	nmdc:mga08y16_468887_c1	3300050511	Bacteria	1282
1444	nmdc:mga08y16_939725_c1	3300050511	Bacteria	848
1445	nmdc:mga0n895_1039522_c1	3300050512	Unclassified	799
1446	nmdc:mga0n895_225470_c1	3300050512	Bacteria	1902
1447	nmdc:mga0n895_280338_c1	3300050512	Bacteria	1690
1448	nmdc:mga0n895_330737_c1	3300050512	Bacteria	1544
1449	nmdc:mga0n895_35380_c1	3300050512	Bacteria	4815
1450	nmdc:mga0n895_52081_c1	3300050512	Bacteria	4017
1451	nmdc:mga0n895_622_c1	3300050512	Bacteria	24660
1452	nmdc:mga0n895_64950_c2	3300050512	Bacteria	1635
1453	nmdc:mga0n895_94521_c1	3300050512	Bacteria	2993
1454	nmdc:mga0n895_946020_c1	3300050512	Bacteria	845
1455	nmdc:mga0rr50_221431_c1	3300050513	Bacteria	1563
1456	nmdc:mga0rr50_259688_c1	3300050513	Bacteria	1445
1457	nmdc:mga0rr50_50061_c1	3300050513	Bacteria	3094
1458	nmdc:mga0rr50_68530_c1	3300050513	Bacteria	2698
1459	nmdc:mga0rr50_711847_c1	3300050513	Bacteria	857
1460	nmdc:mga0rr50_79217_c1	3300050513	Bacteria	2530
1461	nmdc:mga08x19_38629_c1	3300050514	Bacteria	3032
1462	nmdc:mga0a205_27052_c1	3300050515	Bacteria	5476
1463	nmdc:mga0a205_368579_c1	3300050515	Bacteria	1302
1464	nmdc:mga0a205_7768_c1	3300050515	Bacteria	9737
1465	nmdc:mga0sz30_12769_c1	3300050516	Bacteria	3273
1466	nmdc:mga0sz30_96175_c1	3300050516	Bacteria	1291
1467	Ga0495601_0001750	3300053077	Bacteria	12016
1468	Ga0495601_0002382	3300053077	Bacteria	10661
1469	Ga0495601_0017376	3300053077	Bacteria	4365
1470	Ga0495601_0025698	3300053077	Bacteria	3632
1471	Ga0495601_0063960	3300053077	Bacteria	2338
1472	Ga0495601_0120741	3300053077	Bacteria	1702
1473	Ga0495601_0153457	3300053077	Bacteria	1504
1474	Ga0495612_0008869	3300053078	Bacteria	4073
1475	Ga0495612_0010274	3300053078	Bacteria	3787
1476	Ga0495612_0043535	3300053078	Bacteria	1835
1477	Ga0495612_0064139	3300053078	Bacteria	1524
1478	Ga0495655_0003016	3300053083	Bacteria	2733
1479	Ga0495655_0008381	3300053083	Bacteria	1961
1480	Ga0495655_0019962	3300053083	Bacteria	1497
1481	Ga0495595_0000576	3300053084	Bacteria	14034
1482	Ga0495595_0004751	3300053084	Bacteria	5466
1483	Ga0495595_0032435	3300053084	Bacteria	2353
1484	Ga0495595_0037073	3300053084	Bacteria	2215
1485	Ga0495595_0090029	3300053084	Bacteria	1471
1486	Ga0495619_0000132	3300053085	Bacteria	55452
1487	Ga0495619_0000178	3300053085	Bacteria	46773
1488	Ga0495619_0011281	3300053085	Bacteria	5621
1489	Ga0495619_0031232	3300053085	Bacteria	3450
1490	Ga0495619_0037425	3300053085	Bacteria	3161
1491	Ga0495619_0037480	3300053085	Bacteria	3159
1492	Ga0495619_0055466	3300053085	Bacteria	2624
1493	Ga0495619_0249010	3300053085	Bacteria	1231
1494	Ga0500646_0039137	3300053090	Bacteria	1329
1495	Ga0500647_0077257	3300053091	Bacteria	1597
1496	Ga0500641_0024406	3300053096	Bacteria	2331
1497	Ga0500654_074863	3300053099	Bacteria	1623
1498	Ga0500557_000012	3300053105	Bacteria	115728
1499	Ga0500595_014887	3300053119	Bacteria	2938
1500	Ga0500614_064498	3300053123	Bacteria	992
1501	Ga0500642_0000232	3300053130	Bacteria	21724
1502	Ga0500568_0098276	3300053139	Bacteria	1100
1503	Ga0500590_182758	3300053148	Bacteria	908
1504	Ga0500604_0232428	3300053151	Unclassified	637
1505	Ga0500625_028959	3300053729	Bacteria	2628
1506	Ga0501084_0170578	3300054114	Bacteria	1836
1507	Ga0501084_0336545	3300054114	Bacteria	1275
1508	Ga0500661_004079	3300055283	Bacteria	2730
1509	Ga0501082_0000145	3300060353	Bacteria	58967
1510	Ga0501082_0077631	3300060353	Bacteria	2864
1511	Ga0501082_0155815	3300060353	Bacteria	1985
1512	Ga0501082_0156230	3300060353	Bacteria	1982
1513	Ga0501082_0259839	3300060353	Bacteria	1510
1514	Ga0530510_0340487	3300061734	Bacteria	1126

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046517	Ga0495630_1022742	Ga0495630_1022742_52_609	185
2	3300049744	Ga0501083_0290466	Ga0501083_0290466_496_1053	185
3	3300009177	Ga0105248_10097925	Ga0105248_100979252	188
4	3300053151	Ga0500604_0232428	Ga0500604_0232428_39_623	194
5	3300046523	Ga0495644_0011268	Ga0495644_0011268_21_608	195
6	3300046694	Ga0495649_0368703	Ga0495649_0368703_20_607	195
7	3300049741	Ga0501079_0195043	Ga0501079_0195043_30_617	195
8	3300015265	Ga0182005_1087240	Ga0182005_10872401	199
9	3300005458	Ga0070681_10349941	Ga0070681_103499411	200
10	3300005328	Ga0070676_10022801	Ga0070676_100228014	201
11	3300005333	Ga0070677_10029474	Ga0070677_100294743	201
12	3300005334	Ga0068869_100650715	Ga0068869_1006507151	201
13	3300005338	Ga0068868_100181563	Ga0068868_1001815632	201
14	3300005343	Ga0070687_100064142	Ga0070687_1000641423	201
15	3300005343	Ga0070687_100148142	Ga0070687_1001481422	201
16	3300005353	Ga0070669_100353257	Ga0070669_1003532571	201
17	3300005355	Ga0070671_100031220	Ga0070671_1000312206	201
18	3300005364	Ga0070673_100029834	Ga0070673_1000298343	201
19	3300005456	Ga0070678_100003875	Ga0070678_1000038752	201
20	3300005457	Ga0070662_100222459	Ga0070662_1002224591	201
21	3300005459	Ga0068867_100115286	Ga0068867_1001152862	201
22	3300005466	Ga0070685_10099640	Ga0070685_100996402	201
23	3300005543	Ga0070672_100083198	Ga0070672_1000831982	201
24	3300005564	Ga0070664_100598894	Ga0070664_1005988942	201
25	3300005577	Ga0068857_100016920	Ga0068857_1000169204	201
26	3300005615	Ga0070702_100096687	Ga0070702_1000966872	201
27	3300005617	Ga0068859_100825974	Ga0068859_1008259742	201
28	3300005618	Ga0068864_100038825	Ga0068864_1000388255	201
29	3300005840	Ga0068870_10503266	Ga0068870_105032661	201
30	3300005841	Ga0068863_100077872	Ga0068863_1000778722	201
31	3300006931	Ga0097620_100825969	Ga0097620_1008259692	201
32	3300009148	Ga0105243_10262535	Ga0105243_102625353	201
33	3300011119	Ga0105246_10399843	Ga0105246_103998432	201
34	3300011119	Ga0105246_10541243	Ga0105246_105412432	201
35	3300013297	Ga0157378_10472828	Ga0157378_104728282	201
36	3300014326	Ga0157380_10069598	Ga0157380_100695985	201
37	3300014969	Ga0157376_10063069	Ga0157376_100630695	201
38	3300017792	Ga0163161_10079514	Ga0163161_100795142	201
39	3300025893	Ga0207682_10000660	Ga0207682_1000066010	201
40	3300025899	Ga0207642_10100529	Ga0207642_101005293	201
41	3300025907	Ga0207645_10063944	Ga0207645_100639444	201
42	3300025908	Ga0207643_10014351	Ga0207643_100143516	201
43	3300025918	Ga0207662_10202160	Ga0207662_102021602	201
44	3300025925	Ga0207650_10119105	Ga0207650_101191051	201
45	3300025927	Ga0207687_10119758	Ga0207687_101197584	201
46	3300025931	Ga0207644_10112084	Ga0207644_101120843	201
47	3300025933	Ga0207706_10479894	Ga0207706_104798942	201
48	3300025937	Ga0207669_10001111	Ga0207669_100011115	201
49	3300025940	Ga0207691_10012880	Ga0207691_100128809	201
50	3300025942	Ga0207689_10043531	Ga0207689_100435312	201
51	3300026023	Ga0207677_10043555	Ga0207677_100435554	201
52	3300026041	Ga0207639_10316368	Ga0207639_103163683	201
53	3300026089	Ga0207648_10011750	Ga0207648_100117502	201
54	3300026116	Ga0207674_10104935	Ga0207674_101049354	201
55	3300026121	Ga0207683_10044817	Ga0207683_100448174	201
56	3300028381	Ga0268264_10354635	Ga0268264_103546352	201
57	3300046539	Ga0495621_0008367	Ga0495621_0008367_451_1131	201
58	3300046674	Ga0495588_0131939	Ga0495588_0131939_379_1059	201
59	3300005355	Ga0070671_100632121	Ga0070671_1006321211	202
60	3300005615	Ga0070702_100427359	Ga0070702_1004273592	202
61	3300005330	Ga0070690_100313120	Ga0070690_1003131201	203
62	3300005457	Ga0070662_100005358	Ga0070662_1000053584	203
63	3300005578	Ga0068854_100705520	Ga0068854_1007055202	203
64	3300048912	Ga0496109_0353838	Ga0496109_0353838_761_1372	203
65	3300025932	Ga0207690_10189827	Ga0207690_101898272	204
66	3300025933	Ga0207706_10005854	Ga0207706_100058544	204
67	3300006173	Ga0070716_100328235	Ga0070716_1003282352	206
68	3300009148	Ga0105243_10023731	Ga0105243_100237313	206
69	3300025925	Ga0207650_10140734	Ga0207650_101407343	206
70	3300048915	Ga0496112_0991408	Ga0496112_0991408_108_740	210
71	3300035170	Ga0373943_0084121	Ga0373943_0084121_27_662	211
72	3300037068	Ga0373925_0640801	Ga0373925_0640801_27_662	211
73	3300046520	Ga0495637_0113199	Ga0495637_0113199_267_902	211
74	3300046533	Ga0495640_0486745	Ga0495640_0486745_10_645	211
75	3300048903	Ga0496100_0654765	Ga0496100_0654765_173_808	211
76	3300053123	Ga0500614_064498	Ga0500614_064498_342_977	211
77	3300036401	Ga0373937_0511460	Ga0373937_0511460_405_1088	214
78	3300046514	Ga0495618_0052960	Ga0495618_0052960_751_1404	216
79	3300005340	Ga0070689_100182206	Ga0070689_1001822063	218
80	3300005343	Ga0070687_100011387	Ga0070687_1000113874	218
81	3300005466	Ga0070685_10090723	Ga0070685_100907232	218
82	3300005615	Ga0070702_100594342	Ga0070702_1005943421	218
83	3300005618	Ga0068864_100596999	Ga0068864_1005969991	218
84	3300005842	Ga0068858_100348362	Ga0068858_1003483623	218
85	3300009098	Ga0105245_10037434	Ga0105245_100374345	218
86	3300013297	Ga0157378_10415059	Ga0157378_104150592	218
87	3300026142	Ga0207698_10996118	Ga0207698_109961181	218
88	3300025918	Ga0207662_10096544	Ga0207662_100965443	221
89	3300037853	Ga0436364_0794080	Ga0436364_0794080_237_995	221
90	3300048913	Ga0496110_0224907	Ga0496110_0224907_108_788	221
91	iso_pu_bacteria	2517093001	2517102161	221
92	iso_pu_bacteria	2824600985	2824608313	221
93	iso_pu_bacteria	2824609381	2824617217	221
94	iso_pu_bacteria	2824653114	2824660117	221
95	iso_pu_bacteria	2824763712	2824772602	221
96	iso_pu_bacteria	2888419890	2888420491	221
97	iso_pu_bacteria	2904711408	2904715762	221
98	iso_pu_bacteria	3005710791	3005710820	221
99	iso_pu_bacteria	8056967851	8056971101	221
100	iso_pu_bacteria	2507262055	2507505059	222
101	iso_pu_bacteria	2508501009	2508538995	222
102	iso_pu_bacteria	2508501042	2508695310	222
103	iso_pu_bacteria	2513237094	2513639744	222
104	iso_pu_bacteria	2513237095	2513647769	222
105	iso_pu_bacteria	2513237139	2513873717	222
106	iso_pu_bacteria	2513237161	2514015235	222
107	iso_pu_bacteria	2515154112	2515625673	222
108	iso_pu_bacteria	2791355196	2793064970	222
109	iso_pu_bacteria	2802429603	2805915800	222
110	iso_pu_bacteria	2816332527	2818237476	222
111	iso_pu_bacteria	2824696289	2824700583	222
112	iso_pu_bacteria	2842038055	2842043684	222
113	iso_pu_bacteria	2842045827	2842052326	222
114	iso_pu_bacteria	2847939898	2847941954	222
115	iso_pu_bacteria	2849076700	2849082864	222
116	iso_pu_bacteria	2874590934	2874597058	222
117	iso_pu_bacteria	2874620515	2874624606	222
118	iso_pu_bacteria	2874645413	2874648094	222
119	iso_pu_bacteria	2876771140	2876777522	222
120	iso_pu_bacteria	2876818435	2876825604	222
121	iso_pu_bacteria	2879074833	2879077782	222
122	iso_pu_bacteria	2879127579	2879127856	222
123	iso_pu_bacteria	2879142872	2879148877	222
124	iso_pu_bacteria	2881364244	2881365853	222
125	iso_pu_bacteria	2885366525	2885371215	222
126	iso_pu_bacteria	2904666416	2904672055	222
127	iso_pu_bacteria	2932794094	2932794500	222
128	iso_pu_bacteria	2932801729	2932806781	222
129	iso_pu_bacteria	2935608549	2935615366	222
130	iso_pu_bacteria	2935648319	2935654813	222
131	iso_pu_bacteria	2935656913	2935663754	222
132	iso_pu_bacteria	2935769743	2935773427	222
133	iso_pu_bacteria	2935777560	2935782301	222
134	iso_pu_bacteria	2935785616	2935789253	222
135	iso_pu_bacteria	2935793552	2935797190	222
136	iso_pu_bacteria	2935819856	2935825256	222
137	iso_pu_bacteria	2935847175	2935853090	222
138	iso_pu_bacteria	2935883170	2935888552	222
139	iso_pu_bacteria	2935908558	2935910162	222
140	iso_pu_bacteria	2935916978	2935918541	222
141	iso_pu_bacteria	2935926038	2935927927	222
142	iso_pu_bacteria	2935934488	2935936201	222
143	iso_pu_bacteria	2935942939	2935944246	222
144	iso_pu_bacteria	2935951376	2935952683	222
145	iso_pu_bacteria	2935967501	2935969523	222
146	iso_pu_bacteria	2935975950	2935977715	222
147	iso_pu_bacteria	2935984226	2935984968	222
148	iso_pu_bacteria	2936011229	2936017849	222
149	iso_pu_bacteria	2936019824	2936026352	222
150	iso_pu_bacteria	2936028420	2936031600	222
151	iso_pu_bacteria	2936046547	2936053386	222
152	iso_pu_bacteria	2936055302	2936056137	222
153	iso_pu_bacteria	2941531003	2941532513	222
154	iso_pu_bacteria	8016522445	8016525954	222
155	iso_pu_bacteria	8016557553	8016557871	222
156	iso_pu_bacteria	8016566248	8016569251	222
157	iso_pu_bacteria	8016575299	8016581886	222
158	iso_pu_bacteria	8016595262	8016595890	222
159	iso_pu_bacteria	8016613128	8016618659	222
160	iso_pu_bacteria	8016622563	8016623402	222
161	iso_pu_bacteria	8016630954	8016635860	222
162	iso_pu_bacteria	8019530166	8019530838	222
163	iso_pu_bacteria	8019538911	8019540744	222
164	iso_pu_bacteria	8019619141	8019622772	222
165	iso_pu_bacteria	8019629233	8019630334	222
166	iso_pu_bacteria	8019638758	8019640278	222
167	iso_pu_bacteria	8019648815	8019652671	222
168	iso_pu_bacteria	8019659431	8019667163	222
169	iso_pu_bacteria	8019668869	8019676948	222
170	iso_pu_bacteria	8019678201	8019679040	222
171	iso_pu_bacteria	8019687851	8019696486	222
172	iso_pu_bacteria	2824671348	2824677769	224
173	iso_pu_bacteria	2824687955	2824692046	224
174	iso_pu_bacteria	2838122688	2838124323	224
175	iso_pu_bacteria	2841941048	2841948865	224
176	iso_pu_bacteria	2841949485	2841951801	224
177	iso_pu_bacteria	2841966195	2841973822	224
178	iso_pu_bacteria	2841974524	2841980148	224
179	iso_pu_bacteria	2841983080	2841985331	224
180	3300025981	Ga0207640_10804095	Ga0207640_108040951	225
181	3300039447	Ga0436361_0256491	Ga0436361_0256491_232_909	225
182	3300044683	Ga0466965_0052201	Ga0466965_0052201_1092_1784	225
183	3300044694	Ga0466963_0009295	Ga0466963_0009295_1324_2016	225
184	3300044735	Ga0466968_0059735	Ga0466968_0059735_929_1621	225
185	3300044735	Ga0466968_0078596	Ga0466968_0078596_439_1131	225
186	3300045976	Ga0466967_0076147	Ga0466967_0076147_2276_2968	225
187	3300003215	JGI25153J46596_10007997	JGI25153J46596_100079974	226
188	3300003794	Ga0055531_10004894	Ga0055531_100048945	226
189	3300004625	Ga0055543_1022841	Ga0055543_10228412	226
190	3300005262	Ga0065165_1006357	Ga0065165_10063573	226
191	3300005262	Ga0065165_1020376	Ga0065165_10203762	226
192	3300005329	Ga0070683_100067661	Ga0070683_1000676613	226
193	3300005330	Ga0070690_100194638	Ga0070690_1001946382	226
194	3300005338	Ga0068868_100171033	Ga0068868_1001710332	226
195	3300005343	Ga0070687_100595184	Ga0070687_1005951841	226
196	3300005344	Ga0070661_100321610	Ga0070661_1003216102	226
197	3300005344	Ga0070661_100488577	Ga0070661_1004885772	226
198	3300005347	Ga0070668_100123028	Ga0070668_1001230283	226
199	3300005355	Ga0070671_100041035	Ga0070671_1000410352	226
200	3300005434	Ga0070709_10004597	Ga0070709_100045973	226
201	3300005435	Ga0070714_100054238	Ga0070714_1000542382	226
202	3300005436	Ga0070713_100010421	Ga0070713_1000104211	226
203	3300005436	Ga0070713_100024821	Ga0070713_1000248215	226
204	3300005437	Ga0070710_10004200	Ga0070710_100042005	226
205	3300005439	Ga0070711_100076631	Ga0070711_1000766312	226
206	3300005455	Ga0070663_100067556	Ga0070663_1000675564	226
207	3300005457	Ga0070662_100286958	Ga0070662_1002869582	226
208	3300005458	Ga0070681_10118502	Ga0070681_101185021	226
209	3300005467	Ga0070706_100142059	Ga0070706_1001420592	226
210	3300005471	Ga0070698_100206822	Ga0070698_1002068222	226
211	3300005518	Ga0070699_100234039	Ga0070699_1002340392	226
212	3300005535	Ga0070684_100031381	Ga0070684_1000313813	226
213	3300005548	Ga0070665_100153502	Ga0070665_1001535022	226
214	3300005549	Ga0070704_100058274	Ga0070704_1000582744	226
215	3300005549	Ga0070704_100256179	Ga0070704_1002561792	226
216	3300005577	Ga0068857_100210605	Ga0068857_1002106053	226
217	3300005614	Ga0068856_100177921	Ga0068856_1001779213	226
218	3300005616	Ga0068852_100214847	Ga0068852_1002148472	226
219	3300005616	Ga0068852_100384529	Ga0068852_1003845292	226
220	3300005617	Ga0068859_100635760	Ga0068859_1006357601	226
221	3300005843	Ga0068860_100666320	Ga0068860_1006663202	226
222	3300005844	Ga0068862_100214860	Ga0068862_1002148603	226
223	3300005937	Ga0081455_10096499	Ga0081455_100964993	226
224	3300005983	Ga0081540_1011265	Ga0081540_10112655	226
225	3300005985	Ga0081539_10001661	Ga0081539_1000166114	226
226	3300006028	Ga0070717_10004108	Ga0070717_100041088	226
227	3300006042	Ga0075368_10009240	Ga0075368_100092404	226
228	3300006048	Ga0075363_100013123	Ga0075363_1000131236	226
229	3300006048	Ga0075363_100158075	Ga0075363_1001580751	226
230	3300006163	Ga0070715_10000720	Ga0070715_100007206	226
231	3300006173	Ga0070716_100010508	Ga0070716_1000105084	226
232	3300006175	Ga0070712_100070971	Ga0070712_1000709712	226
233	3300006175	Ga0070712_100211580	Ga0070712_1002115802	226
234	3300006178	Ga0075367_10267614	Ga0075367_102676142	226
235	3300006186	Ga0075369_10011405	Ga0075369_100114052	226
236	3300006195	Ga0075366_10010047	Ga0075366_100100474	226
237	3300006195	Ga0075366_10012444	Ga0075366_100124445	226
238	3300006353	Ga0075370_10077261	Ga0075370_100772613	226
239	3300006353	Ga0075370_10409502	Ga0075370_104095021	226
240	3300006844	Ga0075428_100325676	Ga0075428_1003256763	226
241	3300006844	Ga0075428_100592657	Ga0075428_1005926571	226
242	3300006847	Ga0075431_100040575	Ga0075431_1000405756	226
243	3300006871	Ga0075434_100032747	Ga0075434_1000327473	226
244	3300006871	Ga0075434_100033742	Ga0075434_1000337426	226
245	3300006871	Ga0075434_100098202	Ga0075434_1000982024	226
246	3300006871	Ga0075434_100267351	Ga0075434_1002673513	226
247	3300006931	Ga0097620_100635779	Ga0097620_1006357791	226
248	3300007076	Ga0075435_100040717	Ga0075435_1000407175	226
249	3300007076	Ga0075435_100102310	Ga0075435_1001023102	226
250	3300007076	Ga0075435_100736870	Ga0075435_1007368701	226
251	3300007265	Ga0099794_10038823	Ga0099794_100388234	226
252	3300009093	Ga0105240_10069601	Ga0105240_100696013	226
253	3300009093	Ga0105240_10798219	Ga0105240_107982191	226
254	3300009094	Ga0111539_10132079	Ga0111539_101320794	226
255	3300009094	Ga0111539_10201052	Ga0111539_102010522	226
256	3300009147	Ga0114129_10008610	Ga0114129_100086108	226
257	3300009147	Ga0114129_10021090	Ga0114129_100210907	226
258	3300009147	Ga0114129_10157533	Ga0114129_101575334	226
259	3300009147	Ga0114129_10586182	Ga0114129_105861822	226
260	3300009147	Ga0114129_11902180	Ga0114129_119021801	226
261	3300009174	Ga0105241_10181648	Ga0105241_101816482	226
262	3300009545	Ga0105237_10003304	Ga0105237_100033049	226
263	3300009551	Ga0105238_10282647	Ga0105238_102826472	226
264	3300009553	Ga0105249_10175965	Ga0105249_101759652	226
265	3300010375	Ga0105239_10132130	Ga0105239_101321302	226
266	3300010375	Ga0105239_10329989	Ga0105239_103299893	226
267	3300013104	Ga0157370_10256887	Ga0157370_102568872	226
268	3300013306	Ga0163162_10722294	Ga0163162_107222941	226
269	3300013307	Ga0157372_10098111	Ga0157372_100981112	226
270	3300014325	Ga0163163_10135712	Ga0163163_101357122	226
271	3300014968	Ga0157379_10293592	Ga0157379_102935921	226
272	3300014968	Ga0157379_10983242	Ga0157379_109832421	226
273	3300025297	Ga0209758_1000182	Ga0209758_100018293	226
274	3300025297	Ga0209758_1000293	Ga0209758_100029324	226
275	3300025297	Ga0209758_1019701	Ga0209758_10197015	226
276	3300025297	Ga0209758_1056344	Ga0209758_10563442	226
277	3300025302	Ga0207426_1007081	Ga0207426_10070815	226
278	3300025302	Ga0207426_1031401	Ga0207426_10314012	226
279	3300025304	Ga0209257_1000390	Ga0209257_100039017	226
280	3300025321	Ga0207656_10077332	Ga0207656_100773322	226
281	3300025898	Ga0207692_10008133	Ga0207692_100081332	226
282	3300025901	Ga0207688_10131402	Ga0207688_101314022	226
283	3300025903	Ga0207680_10077406	Ga0207680_100774062	226
284	3300025904	Ga0207647_10122033	Ga0207647_101220332	226
285	3300025905	Ga0207685_10011541	Ga0207685_100115412	226
286	3300025906	Ga0207699_10045331	Ga0207699_100453312	226
287	3300025910	Ga0207684_10002963	Ga0207684_100029634	226
288	3300025913	Ga0207695_10000107	Ga0207695_1000010741	226
289	3300025914	Ga0207671_10003167	Ga0207671_1000316715	226
290	3300025915	Ga0207693_10000825	Ga0207693_100008256	226
291	3300025915	Ga0207693_10021699	Ga0207693_100216995	226
292	3300025916	Ga0207663_10022199	Ga0207663_100221994	226
293	3300025919	Ga0207657_10037081	Ga0207657_100370814	226
294	3300025920	Ga0207649_10076337	Ga0207649_100763372	226
295	3300025928	Ga0207700_10090236	Ga0207700_100902363	226
296	3300025928	Ga0207700_10151584	Ga0207700_101515843	226
297	3300025929	Ga0207664_10023737	Ga0207664_100237374	226
298	3300025933	Ga0207706_10341353	Ga0207706_103413532	226
299	3300025933	Ga0207706_10403529	Ga0207706_104035292	226
300	3300025939	Ga0207665_10003817	Ga0207665_100038177	226
301	3300025939	Ga0207665_10109985	Ga0207665_101099853	226
302	3300025944	Ga0207661_10135662	Ga0207661_101356622	226
303	3300025945	Ga0207679_10823092	Ga0207679_108230921	226
304	3300025972	Ga0207668_10013637	Ga0207668_100136372	226
305	3300025981	Ga0207640_10691598	Ga0207640_106915981	226
306	3300025986	Ga0207658_10197400	Ga0207658_101974003	226
307	3300026023	Ga0207677_10099423	Ga0207677_100994232	226
308	3300026035	Ga0207703_11072959	Ga0207703_110729591	226
309	3300026041	Ga0207639_10238405	Ga0207639_102384052	226
310	3300026041	Ga0207639_10276924	Ga0207639_102769242	226
311	3300026067	Ga0207678_10248247	Ga0207678_102482472	226
312	3300026078	Ga0207702_10073820	Ga0207702_100738203	226
313	3300026116	Ga0207674_10253632	Ga0207674_102536322	226
314	3300026142	Ga0207698_10127971	Ga0207698_101279712	226
315	3300026142	Ga0207698_10458495	Ga0207698_104584952	226
316	3300027866	Ga0209813_10001830	Ga0209813_100018305	226
317	3300027907	Ga0207428_10105356	Ga0207428_101053562	226
318	3300028379	Ga0268266_10311633	Ga0268266_103116332	226
319	3300028381	Ga0268264_10559966	Ga0268264_105599662	226
320	3300028577	Ga0265318_10004032	Ga0265318_100040324	226
321	3300031235	Ga0265330_10007771	Ga0265330_100077714	226
322	3300031235	Ga0265330_10053496	Ga0265330_100534962	226
323	3300031238	Ga0265332_10012389	Ga0265332_100123892	226
324	3300031240	Ga0265320_10018493	Ga0265320_100184934	226
325	3300031241	Ga0265325_10004992	Ga0265325_100049925	226
326	3300031242	Ga0265329_10012587	Ga0265329_100125873	226
327	3300031247	Ga0265340_10020868	Ga0265340_100208683	226
328	3300031249	Ga0265339_10013807	Ga0265339_100138074	226
329	3300031250	Ga0265331_10012924	Ga0265331_100129244	226
330	3300031344	Ga0265316_10025046	Ga0265316_100250463	226
331	3300031344	Ga0265316_10070106	Ga0265316_100701063	226
332	3300031456	Ga0307513_10115927	Ga0307513_101159271	226
333	3300031595	Ga0265313_10022841	Ga0265313_100228415	226
334	3300031712	Ga0265342_10014308	Ga0265342_100143084	226
335	3300033180	Ga0307510_10192420	Ga0307510_101924202	226
336	3300035172	Ga0373955_0440854	Ga0373955_0440854_86_781	226
337	3300037068	Ga0373925_0256122	Ga0373925_0256122_684_1379	226
338	3300037312	Ga0395899_0097748	Ga0395899_0097748_400_1095	226
339	3300037418	Ga0395900_0003627	Ga0395900_0003627_9897_10592	226
340	3300037466	Ga0395898_0174352	Ga0395898_0174352_988_1683	226
341	3300037466	Ga0395898_0931075	Ga0395898_0931075_90_770	226
342	3300037471	Ga0395905_0014986	Ga0395905_0014986_6399_7094	226
343	3300038443	Ga0395901_0040521	Ga0395901_0040521_818_1513	226
344	3300038443	Ga0395901_0048746	Ga0395901_0048746_37_717	226
345	3300038443	Ga0395901_0152787	Ga0395901_0152787_1499_2194	226
346	3300039437	Ga0436365_1898637	Ga0436365_1898637_1253_1933	226
347	3300039447	Ga0436361_0950726	Ga0436361_0950726_2700_3380	226
348	3300039453	Ga0436362_0287115	Ga0436362_0287115_54_734	226
349	3300041408	Ga0439453_0001852	Ga0439453_0001852_946_1626	226
350	3300042436	Ga0439435_0015895	Ga0439435_0015895_1039_1719	226
351	3300042439	Ga0439464_0021214	Ga0439464_0021214_550_1230	226
352	3300044658	Ga0466972_0052403	Ga0466972_0052403_795_1490	226
353	3300044683	Ga0466965_0148285	Ga0466965_0148285_351_1046	226
354	3300044683	Ga0466965_0205969	Ga0466965_0205969_68_763	226
355	3300044901	Ga0466960_0126038	Ga0466960_0126038_131_826	226
356	3300045049	Ga0466959_0433853	Ga0466959_0433853_12_707	226
357	3300046454	Ga0495592_0192099	Ga0495592_0192099_441_1136	226
358	3300046459	Ga0495629_0014934	Ga0495629_0014934_4628_5323	226
359	3300046460	Ga0495638_0046393	Ga0495638_0046393_584_1264	226
360	3300046462	Ga0495651_0098800	Ga0495651_0098800_877_1572	226
361	3300046463	Ga0495653_0223012	Ga0495653_0223012_91_786	226
362	3300046463	Ga0495653_0359077	Ga0495653_0359077_25_720	226
363	3300046477	Ga0495664_0016212	Ga0495664_0016212_2934_3629	226
364	3300046477	Ga0495664_0101108	Ga0495664_0101108_278_973	226
365	3300046491	Ga0495584_0111683	Ga0495584_0111683_565_1245	226
366	3300046492	Ga0495585_0111422	Ga0495585_0111422_630_1325	226
367	3300046507	Ga0495606_0009508	Ga0495606_0009508_4243_4938	226
368	3300046507	Ga0495606_0134135	Ga0495606_0134135_526_1221	226
369	3300046511	Ga0495608_0050572	Ga0495608_0050572_1174_1869	226
370	3300046512	Ga0495610_0053992	Ga0495610_0053992_1184_1879	226
371	3300046516	Ga0495628_0082672	Ga0495628_0082672_1506_2201	226
372	3300046516	Ga0495628_0112489	Ga0495628_0112489_893_1588	226
373	3300046517	Ga0495630_0659536	Ga0495630_0659536_71_766	226
374	3300046524	Ga0495648_0002380	Ga0495648_0002380_12951_13646	226
375	3300046526	Ga0495666_0136415	Ga0495666_0136415_228_923	226
376	3300046529	Ga0495652_0020937	Ga0495652_0020937_3152_3847	226
377	3300046529	Ga0495652_0076458	Ga0495652_0076458_1701_2396	226
378	3300046529	Ga0495652_0352001	Ga0495652_0352001_302_997	226
379	3300046533	Ga0495640_0101573	Ga0495640_0101573_605_1300	226
380	3300046536	Ga0495587_0018262	Ga0495587_0018262_1138_1833	226
381	3300046557	Ga0495622_0024440	Ga0495622_0024440_1903_2598	226
382	3300046616	Ga0495668_0046683	Ga0495668_0046683_164_859	226
383	3300046642	Ga0495634_0180235	Ga0495634_0180235_466_1161	226
384	3300046648	Ga0495611_0078575	Ga0495611_0078575_598_1293	226
385	3300046660	Ga0495625_0017744	Ga0495625_0017744_3989_4684	226
386	3300046663	Ga0495635_0445479	Ga0495635_0445479_59_754	226
387	3300046663	Ga0495635_0523152	Ga0495635_0523152_60_755	226
388	3300046674	Ga0495588_0243427	Ga0495588_0243427_142_837	226
389	3300046675	Ga0495657_0015814	Ga0495657_0015814_4179_4874	226
390	3300046678	Ga0495599_0115730	Ga0495599_0115730_298_993	226
391	3300046679	Ga0495623_0132012	Ga0495623_0132012_399_1094	226
392	3300046680	Ga0495646_0059772	Ga0495646_0059772_802_1497	226
393	3300046689	Ga0495613_0207131	Ga0495613_0207131_165_860	226
394	3300046690	Ga0495624_0240543	Ga0495624_0240543_313_1008	226
395	3300046694	Ga0495649_0040385	Ga0495649_0040385_977_1672	226
396	3300046809	Ga0495600_0025897	Ga0495600_0025897_1910_2605	226
397	3300046809	Ga0495600_0280197	Ga0495600_0280197_259_954	226
398	3300047315	Ga0495581_0049437	Ga0495581_0049437_994_1689	226
399	3300047317	Ga0495604_0002294	Ga0495604_0002294_12544_13239	226
400	3300047317	Ga0495604_0215008	Ga0495604_0215008_262_957	226
401	3300047319	Ga0495674_0116513	Ga0495674_0116513_1232_1927	226
402	3300047319	Ga0495674_0627891	Ga0495674_0627891_33_728	226
403	3300047322	Ga0495680_0006606	Ga0495680_0006606_588_1283	226
404	3300047323	Ga0495683_0102690	Ga0495683_0102690_172_930	226
405	3300047323	Ga0495683_0107894	Ga0495683_0107894_465_1160	226
406	3300047444	Ga0495675_0001653	Ga0495675_0001653_10539_11234	226
407	3300047469	Ga0495673_0089310	Ga0495673_0089310_56_751	226
408	3300047472	Ga0495686_0108062	Ga0495686_0108062_889_1584	226
409	3300047673	Ga0495593_0050848	Ga0495593_0050848_240_935	226
410	3300048088	Ga0495602_0032133	Ga0495602_0032133_3145_3840	226
411	3300048091	Ga0495626_0096330	Ga0495626_0096330_317_1012	226
412	3300048091	Ga0495626_0185251	Ga0495626_0185251_38_733	226
413	3300048903	Ga0496100_0027597	Ga0496100_0027597_1143_1823	226
414	3300048904	Ga0496101_0494469	Ga0496101_0494469_206_901	226
415	3300048905	Ga0496102_0484428	Ga0496102_0484428_381_1061	226
416	3300048907	Ga0496104_0004191	Ga0496104_0004191_11446_12141	226
417	3300048907	Ga0496104_0121646	Ga0496104_0121646_367_1062	226
418	3300048909	Ga0496106_0025502	Ga0496106_0025502_117_797	226
419	3300048910	Ga0496107_0070373	Ga0496107_0070373_897_1592	226
420	3300048912	Ga0496109_0018871	Ga0496109_0018871_1484_2179	226
421	3300048913	Ga0496110_0018162	Ga0496110_0018162_4953_5633	226
422	3300048913	Ga0496110_0216741	Ga0496110_0216741_621_1301	226
423	3300048913	Ga0496110_0382159	Ga0496110_0382159_552_1247	226
424	3300048914	Ga0496111_0001774	Ga0496111_0001774_11113_11793	226
425	3300048915	Ga0496112_0153304	Ga0496112_0153304_318_1013	226
426	3300048915	Ga0496112_0421394	Ga0496112_0421394_214_894	226
427	3300048915	Ga0496112_0961166	Ga0496112_0961166_43_738	226
428	3300048916	Ga0496113_0179025	Ga0496113_0179025_490_1185	226
429	3300048916	Ga0496113_0183840	Ga0496113_0183840_774_1469	226
430	3300048918	Ga0496115_0011806	Ga0496115_0011806_4840_5535	226
431	3300048919	Ga0496116_0244215	Ga0496116_0244215_28_723	226
432	3300048921	Ga0496118_0158767	Ga0496118_0158767_587_1282	226
433	3300048922	Ga0496119_0004123	Ga0496119_0004123_12947_13642	226
434	3300048922	Ga0496119_0044953	Ga0496119_0044953_205_900	226
435	3300048923	Ga0496120_0006519	Ga0496120_0006519_4063_4758	226
436	3300048923	Ga0496120_0051081	Ga0496120_0051081_588_1283	226
437	3300048924	Ga0496121_0041733	Ga0496121_0041733_2718_3413	226
438	3300048925	Ga0496122_0081141	Ga0496122_0081141_678_1373	226
439	3300048928	Ga0496125_0033107	Ga0496125_0033107_133_828	226
440	3300048929	Ga0496126_0040330	Ga0496126_0040330_174_869	226
441	3300049588	Ga0501072_0004481	Ga0501072_0004481_7137_7844	226
442	3300049741	Ga0501079_0872822	Ga0501079_0872822_14_694	226
443	3300049743	Ga0501081_0050631	Ga0501081_0050631_2056_2736	226
444	3300049744	Ga0501083_0185812	Ga0501083_0185812_36_716	226
445	3300050489	nmdc:mga03683_14084_c2	nmdc:mga03683_14084_c2_880_1560	226
446	3300050490	nmdc:mga03n38_20855_c1	nmdc:mga03n38_20855_c1_223_903	226
447	3300050490	nmdc:mga03n38_29865_c1	nmdc:mga03n38_29865_c1_317_1012	226
448	3300050491	nmdc:mga00v17_23425_c1	nmdc:mga00v17_23425_c1_1287_1967	226
449	3300050491	nmdc:mga00v17_52949_c1	nmdc:mga00v17_52949_c1_180_875	226
450	3300050493	nmdc:mga0k408_2858_c1	nmdc:mga0k408_2858_c1_4549_5229	226
451	3300050493	nmdc:mga0k408_8431_c1	nmdc:mga0k408_8431_c1_4722_5417	226
452	3300050495	nmdc:mga04h51_8211_c1	nmdc:mga04h51_8211_c1_66_761	226
453	3300050496	nmdc:mga07m45_23396_c1	nmdc:mga07m45_23396_c1_1185_1880	226
454	3300050496	nmdc:mga07m45_5426_c1	nmdc:mga07m45_5426_c1_1789_2484	226
455	3300050507	nmdc:mga05p37_14557_c1	nmdc:mga05p37_14557_c1_5857_6537	226
456	3300050507	nmdc:mga05p37_210565_c1	nmdc:mga05p37_210565_c1_639_1319	226
457	3300050507	nmdc:mga05p37_31120_c1	nmdc:mga05p37_31120_c1_444_1124	226
458	3300050509	nmdc:mga0qj67_150426_c1	nmdc:mga0qj67_150426_c1_277_957	226
459	3300050510	nmdc:mga06r32_40585_c1	nmdc:mga06r32_40585_c1_484_1164	226
460	3300050511	nmdc:mga08y16_133176_c1	nmdc:mga08y16_133176_c1_1175_1855	226
461	3300050512	nmdc:mga0n895_225470_c1	nmdc:mga0n895_225470_c1_319_999	226
462	3300050512	nmdc:mga0n895_280338_c1	nmdc:mga0n895_280338_c1_851_1531	226
463	3300050512	nmdc:mga0n895_94521_c1	nmdc:mga0n895_94521_c1_232_912	226
464	3300050513	nmdc:mga0rr50_68530_c1	nmdc:mga0rr50_68530_c1_1623_2303	226
465	3300050513	nmdc:mga0rr50_711847_c1	nmdc:mga0rr50_711847_c1_150_830	226
466	3300050513	nmdc:mga0rr50_79217_c1	nmdc:mga0rr50_79217_c1_522_1202	226
467	3300050516	nmdc:mga0sz30_12769_c1	nmdc:mga0sz30_12769_c1_2525_3220	226
468	3300050516	nmdc:mga0sz30_96175_c1	nmdc:mga0sz30_96175_c1_170_850	226
469	3300053083	Ga0495655_0003016	Ga0495655_0003016_702_1397	226
470	3300053083	Ga0495655_0019962	Ga0495655_0019962_239_919	226
471	3300053090	Ga0500646_0039137	Ga0500646_0039137_563_1243	226
472	3300053091	Ga0500647_0077257	Ga0500647_0077257_781_1476	226
473	3300053096	Ga0500641_0024406	Ga0500641_0024406_170_850	226
474	3300053099	Ga0500654_074863	Ga0500654_074863_296_976	226
475	3300053105	Ga0500557_000012	Ga0500557_000012_17627_18322	226
476	3300053119	Ga0500595_014887	Ga0500595_014887_1664_2359	226
477	3300053130	Ga0500642_0000232	Ga0500642_0000232_3454_4149	226
478	3300053139	Ga0500568_0098276	Ga0500568_0098276_91_786	226
479	3300053148	Ga0500590_182758	Ga0500590_182758_164_859	226
480	3300053729	Ga0500625_028959	Ga0500625_028959_1779_2474	226
481	3300054114	Ga0501084_0170578	Ga0501084_0170578_808_1515	226
482	3300054114	Ga0501084_0336545	Ga0501084_0336545_215_895	226
483	3300055283	Ga0500661_004079	Ga0500661_004079_1365_2060	226
484	3300060353	Ga0501082_0000145	Ga0501082_0000145_20833_21513	226
485	2209111006	2214756331	2213770190	227
486	3300000043	ARcpr5yngRDRAFT_c000052	ARcpr5yngRDRAFT_0000525	227
487	3300000044	ARSoilOldRDRAFT_c000001	ARSoilOldRDRAFT_00000154	227
488	3300000045	ARCol0oldRDRAFT_c00112	ARCol0oldRDRAFT_001125	227
489	3300000652	ARCol0yngRDRAFT_1000001	ARCol0yngRDRAFT_100000122	227
490	3300001915	JGI24741J21665_1007670	JGI24741J21665_10076702	227
491	3300001976	JGI24752J21851_1001356	JGI24752J21851_10013565	227
492	3300001977	JGI24746J21847_1000477	JGI24746J21847_10004776	227
493	3300001989	JGI24739J22299_10000177	JGI24739J22299_1000017710	227
494	3300001990	JGI24737J22298_10000967	JGI24737J22298_100009673	227
495	3300001990	JGI24737J22298_10006515	JGI24737J22298_100065155	227
496	3300001991	JGI24743J22301_10001361	JGI24743J22301_100013615	227
497	3300002070	JGI24750J21931_1000547	JGI24750J21931_10005475	227
498	3300002070	JGI24750J21931_1003185	JGI24750J21931_10031852	227
499	3300002073	JGI24745J21846_1001306	JGI24745J21846_10013062	227
500	3300002074	JGI24748J21848_1000209	JGI24748J21848_10002092	227
501	3300002075	JGI24738J21930_10000256	JGI24738J21930_1000025615	227
502	3300002075	JGI24738J21930_10000437	JGI24738J21930_100004377	227
503	3300002076	JGI24749J21850_1000857	JGI24749J21850_10008573	227
504	3300002077	JGI24744J21845_10000555	JGI24744J21845_100005555	227
505	3300002077	JGI24744J21845_10001216	JGI24744J21845_100012164	227
506	3300002126	JGI24035J26624_1000009	JGI24035J26624_10000099	227
507	3300002239	JGI24034J26672_10000760	JGI24034J26672_100007602	227
508	3300002244	JGI24742J22300_10001007	JGI24742J22300_100010071	227
509	3300003911	JGI25405J52794_10028701	JGI25405J52794_100287012	227
510	3300005289	Ga0065704_10160483	Ga0065704_101604832	227
511	3300005290	Ga0065712_10082879	Ga0065712_100828795	227
512	3300005293	Ga0065715_10001850	Ga0065715_1000185011	227
513	3300005293	Ga0065715_10100237	Ga0065715_101002375	227
514	3300005328	Ga0070676_10000076	Ga0070676_1000007611	227
515	3300005328	Ga0070676_10024250	Ga0070676_100242503	227
516	3300005328	Ga0070676_10031130	Ga0070676_100311302	227
517	3300005329	Ga0070683_100002997	Ga0070683_1000029976	227
518	3300005330	Ga0070690_100002546	Ga0070690_1000025465	227
519	3300005330	Ga0070690_100003545	Ga0070690_1000035459	227
520	3300005330	Ga0070690_100022196	Ga0070690_1000221963	227
521	3300005330	Ga0070690_100218798	Ga0070690_1002187981	227
522	3300005330	Ga0070690_100551954	Ga0070690_1005519542	227
523	3300005331	Ga0070670_100001544	Ga0070670_10000154414	227
524	3300005331	Ga0070670_100005236	Ga0070670_1000052363	227
525	3300005331	Ga0070670_100154002	Ga0070670_1001540023	227
526	3300005331	Ga0070670_100812982	Ga0070670_1008129821	227
527	3300005333	Ga0070677_10000038	Ga0070677_1000003812	227
528	3300005333	Ga0070677_10016774	Ga0070677_100167742	227
529	3300005333	Ga0070677_10104839	Ga0070677_101048391	227
530	3300005334	Ga0068869_100000054	Ga0068869_10000005413	227
531	3300005334	Ga0068869_100169330	Ga0068869_1001693302	227
532	3300005334	Ga0068869_100450057	Ga0068869_1004500571	227
533	3300005335	Ga0070666_10046576	Ga0070666_100465765	227
534	3300005335	Ga0070666_10127785	Ga0070666_101277853	227
535	3300005335	Ga0070666_10139406	Ga0070666_101394062	227
536	3300005336	Ga0070680_100004742	Ga0070680_10000474210	227
537	3300005336	Ga0070680_100191245	Ga0070680_1001912453	227
538	3300005337	Ga0070682_100000181	Ga0070682_10000018115	227
539	3300005337	Ga0070682_100083595	Ga0070682_1000835951	227
540	3300005337	Ga0070682_100091649	Ga0070682_1000916492	227
541	3300005337	Ga0070682_100123788	Ga0070682_1001237882	227
542	3300005338	Ga0068868_100002127	Ga0068868_1000021279	227
543	3300005338	Ga0068868_100003086	Ga0068868_1000030869	227
544	3300005338	Ga0068868_100087352	Ga0068868_1000873524	227
545	3300005339	Ga0070660_100000660	Ga0070660_10000066010	227
546	3300005339	Ga0070660_100062555	Ga0070660_1000625554	227
547	3300005339	Ga0070660_100064473	Ga0070660_1000644731	227
548	3300005339	Ga0070660_100278485	Ga0070660_1002784851	227
549	3300005339	Ga0070660_100452990	Ga0070660_1004529902	227
550	3300005340	Ga0070689_100003434	Ga0070689_1000034342	227
551	3300005340	Ga0070689_100003508	Ga0070689_10000350811	227
552	3300005340	Ga0070689_100004183	Ga0070689_1000041834	227
553	3300005340	Ga0070689_100025050	Ga0070689_1000250502	227
554	3300005340	Ga0070689_100029697	Ga0070689_1000296974	227
555	3300005341	Ga0070691_10000491	Ga0070691_1000049110	227
556	3300005341	Ga0070691_10109721	Ga0070691_101097212	227
557	3300005343	Ga0070687_100000358	Ga0070687_1000003587	227
558	3300005343	Ga0070687_100011228	Ga0070687_1000112285	227
559	3300005343	Ga0070687_100034735	Ga0070687_1000347351	227
560	3300005343	Ga0070687_100118747	Ga0070687_1001187472	227
561	3300005344	Ga0070661_100000797	Ga0070661_10000079716	227
562	3300005344	Ga0070661_100047671	Ga0070661_1000476713	227
563	3300005344	Ga0070661_100091588	Ga0070661_1000915882	227
564	3300005345	Ga0070692_10000320	Ga0070692_1000032015	227
565	3300005345	Ga0070692_10008804	Ga0070692_100088044	227
566	3300005345	Ga0070692_10038825	Ga0070692_100388252	227
567	3300005347	Ga0070668_100004777	Ga0070668_10000477710	227
568	3300005347	Ga0070668_100044390	Ga0070668_1000443904	227
569	3300005353	Ga0070669_100001643	Ga0070669_1000016437	227
570	3300005353	Ga0070669_100027609	Ga0070669_1000276095	227
571	3300005354	Ga0070675_100005771	Ga0070675_1000057719	227
572	3300005354	Ga0070675_100111785	Ga0070675_1001117852	227
573	3300005355	Ga0070671_100003232	Ga0070671_1000032327	227
574	3300005355	Ga0070671_100089793	Ga0070671_1000897934	227
575	3300005355	Ga0070671_100555295	Ga0070671_1005552952	227
576	3300005356	Ga0070674_100000140	Ga0070674_10000014010	227
577	3300005356	Ga0070674_100226858	Ga0070674_1002268582	227
578	3300005364	Ga0070673_100007770	Ga0070673_1000077707	227
579	3300005364	Ga0070673_100067400	Ga0070673_1000674003	227
580	3300005364	Ga0070673_100503104	Ga0070673_1005031042	227
581	3300005364	Ga0070673_100525476	Ga0070673_1005254762	227
582	3300005365	Ga0070688_100002076	Ga0070688_1000020763	227
583	3300005365	Ga0070688_100005196	Ga0070688_1000051966	227
584	3300005365	Ga0070688_100026043	Ga0070688_1000260433	227
585	3300005366	Ga0070659_100004532	Ga0070659_10000453210	227
586	3300005366	Ga0070659_100032102	Ga0070659_1000321021	227
587	3300005366	Ga0070659_100038432	Ga0070659_1000384324	227
588	3300005366	Ga0070659_100042897	Ga0070659_1000428975	227
589	3300005367	Ga0070667_100001305	Ga0070667_10000130510	227
590	3300005367	Ga0070667_100165388	Ga0070667_1001653883	227
591	3300005367	Ga0070667_100355091	Ga0070667_1003550912	227
592	3300005367	Ga0070667_100556513	Ga0070667_1005565132	227
593	3300005406	Ga0070703_10001982	Ga0070703_100019821	227
594	3300005406	Ga0070703_10005800	Ga0070703_100058004	227
595	3300005406	Ga0070703_10029695	Ga0070703_100296953	227
596	3300005434	Ga0070709_10007654	Ga0070709_100076543	227
597	3300005435	Ga0070714_100058840	Ga0070714_1000588402	227
598	3300005435	Ga0070714_100293538	Ga0070714_1002935382	227
599	3300005436	Ga0070713_100021777	Ga0070713_1000217775	227
600	3300005436	Ga0070713_100326724	Ga0070713_1003267242	227
601	3300005437	Ga0070710_10014806	Ga0070710_100148064	227
602	3300005437	Ga0070710_10062090	Ga0070710_100620904	227
603	3300005438	Ga0070701_10000297	Ga0070701_1000029710	227
604	3300005438	Ga0070701_10001300	Ga0070701_100013005	227
605	3300005438	Ga0070701_10020956	Ga0070701_100209563	227
606	3300005439	Ga0070711_100128769	Ga0070711_1001287692	227
607	3300005439	Ga0070711_100304595	Ga0070711_1003045952	227
608	3300005440	Ga0070705_100000989	Ga0070705_1000009899	227
609	3300005440	Ga0070705_100070844	Ga0070705_1000708444	227
610	3300005441	Ga0070700_100002276	Ga0070700_1000022762	227
611	3300005441	Ga0070700_100011750	Ga0070700_1000117504	227
612	3300005441	Ga0070700_100070030	Ga0070700_1000700303	227
613	3300005444	Ga0070694_100000444	Ga0070694_10000044413	227
614	3300005444	Ga0070694_100003236	Ga0070694_1000032364	227
615	3300005444	Ga0070694_100268192	Ga0070694_1002681922	227
616	3300005444	Ga0070694_100407529	Ga0070694_1004075292	227
617	3300005445	Ga0070708_100031469	Ga0070708_1000314695	227
618	3300005455	Ga0070663_100000436	Ga0070663_10000043613	227
619	3300005455	Ga0070663_100028875	Ga0070663_1000288754	227
620	3300005455	Ga0070663_100215216	Ga0070663_1002152162	227
621	3300005456	Ga0070678_100000382	Ga0070678_10000038216	227
622	3300005456	Ga0070678_100050943	Ga0070678_1000509434	227
623	3300005457	Ga0070662_100003913	Ga0070662_1000039139	227
624	3300005457	Ga0070662_100006339	Ga0070662_1000063398	227
625	3300005458	Ga0070681_10005795	Ga0070681_100057959	227
626	3300005458	Ga0070681_10044092	Ga0070681_100440923	227
627	3300005458	Ga0070681_10104858	Ga0070681_101048583	227
628	3300005458	Ga0070681_10320906	Ga0070681_103209062	227
629	3300005458	Ga0070681_11014279	Ga0070681_110142791	227
630	3300005459	Ga0068867_100004037	Ga0068867_10000403711	227
631	3300005459	Ga0068867_100031738	Ga0068867_1000317383	227
632	3300005459	Ga0068867_100049962	Ga0068867_1000499624	227
633	3300005466	Ga0070685_10011992	Ga0070685_100119924	227
634	3300005466	Ga0070685_10019254	Ga0070685_100192544	227
635	3300005466	Ga0070685_10053921	Ga0070685_100539213	227
636	3300005530	Ga0070679_100001204	Ga0070679_10000120413	227
637	3300005530	Ga0070679_100096291	Ga0070679_1000962912	227
638	3300005535	Ga0070684_100004481	Ga0070684_1000044814	227
639	3300005535	Ga0070684_100063427	Ga0070684_1000634273	227
640	3300005536	Ga0070697_100291756	Ga0070697_1002917562	227
641	3300005539	Ga0068853_100001615	Ga0068853_1000016153	227
642	3300005539	Ga0068853_100004372	Ga0068853_10000437210	227
643	3300005543	Ga0070672_100003461	Ga0070672_1000034613	227
644	3300005543	Ga0070672_100337527	Ga0070672_1003375272	227
645	3300005544	Ga0070686_100002518	Ga0070686_10000251810	227
646	3300005544	Ga0070686_100009403	Ga0070686_1000094035	227
647	3300005544	Ga0070686_100293445	Ga0070686_1002934451	227
648	3300005545	Ga0070695_100002937	Ga0070695_10000293710	227
649	3300005545	Ga0070695_100004993	Ga0070695_1000049934	227
650	3300005545	Ga0070695_100417542	Ga0070695_1004175421	227
651	3300005546	Ga0070696_100009850	Ga0070696_1000098507	227
652	3300005546	Ga0070696_100309863	Ga0070696_1003098632	227
653	3300005546	Ga0070696_100328530	Ga0070696_1003285302	227
654	3300005547	Ga0070693_100000628	Ga0070693_1000006288	227
655	3300005548	Ga0070665_100112704	Ga0070665_1001127042	227
656	3300005548	Ga0070665_100207924	Ga0070665_1002079242	227
657	3300005548	Ga0070665_100298035	Ga0070665_1002980352	227
658	3300005548	Ga0070665_100580933	Ga0070665_1005809332	227
659	3300005549	Ga0070704_100055623	Ga0070704_1000556233	227
660	3300005549	Ga0070704_100223496	Ga0070704_1002234962	227
661	3300005549	Ga0070704_100347552	Ga0070704_1003475521	227
662	3300005549	Ga0070704_100831568	Ga0070704_1008315681	227
663	3300005563	Ga0068855_100023116	Ga0068855_1000231167	227
664	3300005563	Ga0068855_100095264	Ga0068855_1000952644	227
665	3300005563	Ga0068855_100380532	Ga0068855_1003805323	227
666	3300005564	Ga0070664_100004566	Ga0070664_1000045664	227
667	3300005564	Ga0070664_100063082	Ga0070664_1000630822	227
668	3300005564	Ga0070664_100085062	Ga0070664_1000850624	227
669	3300005564	Ga0070664_100382548	Ga0070664_1003825481	227
670	3300005564	Ga0070664_100676981	Ga0070664_1006769811	227
671	3300005577	Ga0068857_100006169	Ga0068857_1000061693	227
672	3300005577	Ga0068857_100043816	Ga0068857_1000438165	227
673	3300005578	Ga0068854_100003262	Ga0068854_10000326211	227
674	3300005578	Ga0068854_100015505	Ga0068854_1000155055	227
675	3300005578	Ga0068854_100041635	Ga0068854_1000416354	227
676	3300005578	Ga0068854_100064618	Ga0068854_1000646182	227
677	3300005614	Ga0068856_100004644	Ga0068856_10000464411	227
678	3300005614	Ga0068856_100155865	Ga0068856_1001558652	227
679	3300005614	Ga0068856_100331265	Ga0068856_1003312652	227
680	3300005614	Ga0068856_100409452	Ga0068856_1004094522	227
681	3300005615	Ga0070702_100000041	Ga0070702_10000004111	227
682	3300005615	Ga0070702_100002073	Ga0070702_1000020735	227
683	3300005615	Ga0070702_100064308	Ga0070702_1000643084	227
684	3300005615	Ga0070702_100080293	Ga0070702_1000802933	227
685	3300005616	Ga0068852_100038957	Ga0068852_1000389573	227
686	3300005616	Ga0068852_100109132	Ga0068852_1001091321	227
687	3300005617	Ga0068859_100014564	Ga0068859_1000145648	227
688	3300005617	Ga0068859_100046546	Ga0068859_1000465465	227
689	3300005617	Ga0068859_100058549	Ga0068859_1000585493	227
690	3300005617	Ga0068859_100063160	Ga0068859_1000631604	227
691	3300005617	Ga0068859_100538324	Ga0068859_1005383242	227
692	3300005618	Ga0068864_100000172	Ga0068864_1000001724	227
693	3300005618	Ga0068864_100005707	Ga0068864_1000057079	227
694	3300005618	Ga0068864_100146517	Ga0068864_1001465171	227
695	3300005718	Ga0068866_10000209	Ga0068866_100002093	227
696	3300005718	Ga0068866_10044664	Ga0068866_100446642	227
697	3300005719	Ga0068861_100001340	Ga0068861_10000134011	227
698	3300005834	Ga0068851_10193464	Ga0068851_101934641	227
699	3300005840	Ga0068870_10000652	Ga0068870_100006527	227
700	3300005840	Ga0068870_10002924	Ga0068870_100029245	227
701	3300005841	Ga0068863_100001541	Ga0068863_10000154113	227
702	3300005841	Ga0068863_100030974	Ga0068863_1000309745	227
703	3300005842	Ga0068858_100014295	Ga0068858_1000142954	227
704	3300005842	Ga0068858_100120659	Ga0068858_1001206592	227
705	3300005842	Ga0068858_100309409	Ga0068858_1003094092	227
706	3300005843	Ga0068860_100007995	Ga0068860_10000799510	227
707	3300005843	Ga0068860_100059288	Ga0068860_1000592884	227
708	3300005843	Ga0068860_100577100	Ga0068860_1005771001	227
709	3300005844	Ga0068862_100003247	Ga0068862_10000324712	227
710	3300005844	Ga0068862_100005613	Ga0068862_1000056134	227
711	3300005844	Ga0068862_100010836	Ga0068862_1000108365	227
712	3300005937	Ga0081455_10000002	Ga0081455_10000002138	227
713	3300005937	Ga0081455_10011036	Ga0081455_100110363	227
714	3300005937	Ga0081455_10011972	Ga0081455_100119727	227
715	3300005981	Ga0081538_10002134	Ga0081538_1000213419	227
716	3300006028	Ga0070717_10009760	Ga0070717_100097603	227
717	3300006028	Ga0070717_10276089	Ga0070717_102760892	227
718	3300006028	Ga0070717_10414929	Ga0070717_104149292	227
719	3300006038	Ga0075365_10135490	Ga0075365_101354902	227
720	3300006038	Ga0075365_10292781	Ga0075365_102927812	227
721	3300006048	Ga0075363_100304050	Ga0075363_1003040501	227
722	3300006051	Ga0075364_10408328	Ga0075364_104083282	227
723	3300006058	Ga0075432_10049484	Ga0075432_100494842	227
724	3300006163	Ga0070715_10117210	Ga0070715_101172102	227
725	3300006175	Ga0070712_100000460	Ga0070712_1000004602	227
726	3300006175	Ga0070712_100158873	Ga0070712_1001588733	227
727	3300006175	Ga0070712_100177873	Ga0070712_1001778732	227
728	3300006177	Ga0075362_10021323	Ga0075362_100213234	227
729	3300006178	Ga0075367_10019074	Ga0075367_100190744	227
730	3300006237	Ga0097621_100000565	Ga0097621_1000005658	227
731	3300006237	Ga0097621_100385545	Ga0097621_1003855452	227
732	3300006358	Ga0068871_100000303	Ga0068871_10000030310	227
733	3300006358	Ga0068871_100005491	Ga0068871_1000054916	227
734	3300006358	Ga0068871_100074783	Ga0068871_1000747834	227
735	3300006844	Ga0075428_100030184	Ga0075428_1000301843	227
736	3300006844	Ga0075428_100396918	Ga0075428_1003969182	227
737	3300006846	Ga0075430_100000492	Ga0075430_10000049221	227
738	3300006846	Ga0075430_100013197	Ga0075430_1000131972	227
739	3300006846	Ga0075430_100156711	Ga0075430_1001567114	227
740	3300006846	Ga0075430_100204326	Ga0075430_1002043262	227
741	3300006847	Ga0075431_100116984	Ga0075431_1001169842	227
742	3300006847	Ga0075431_100220767	Ga0075431_1002207672	227
743	3300006852	Ga0075433_10053274	Ga0075433_100532742	227
744	3300006852	Ga0075433_10554797	Ga0075433_105547972	227
745	3300006871	Ga0075434_100000412	Ga0075434_10000041216	227
746	3300006871	Ga0075434_100050156	Ga0075434_1000501565	227
747	3300006871	Ga0075434_100103939	Ga0075434_1001039394	227
748	3300006871	Ga0075434_100156042	Ga0075434_1001560424	227
749	3300006871	Ga0075434_100240904	Ga0075434_1002409043	227
750	3300006871	Ga0075434_100253868	Ga0075434_1002538683	227
751	3300006871	Ga0075434_100716376	Ga0075434_1007163761	227
752	3300006880	Ga0075429_100099929	Ga0075429_1000999293	227
753	3300006881	Ga0068865_100000682	Ga0068865_1000006827	227
754	3300006881	Ga0068865_100069839	Ga0068865_1000698392	227
755	3300006881	Ga0068865_100182153	Ga0068865_1001821531	227
756	3300006914	Ga0075436_100070943	Ga0075436_1000709433	227
757	3300006931	Ga0097620_100014563	Ga0097620_1000145638	227
758	3300006931	Ga0097620_100046544	Ga0097620_1000465445	227
759	3300006931	Ga0097620_100058549	Ga0097620_1000585495	227
760	3300006931	Ga0097620_100063160	Ga0097620_1000631604	227
761	3300006931	Ga0097620_100538302	Ga0097620_1005383022	227
762	3300007076	Ga0075435_100280083	Ga0075435_1002800832	227
763	3300009011	Ga0105251_10137861	Ga0105251_101378612	227
764	3300009093	Ga0105240_10056226	Ga0105240_100562266	227
765	3300009093	Ga0105240_10239587	Ga0105240_102395873	227
766	3300009093	Ga0105240_10249173	Ga0105240_102491732	227
767	3300009094	Ga0111539_10002657	Ga0111539_1000265711	227
768	3300009094	Ga0111539_10002897	Ga0111539_1000289711	227
769	3300009094	Ga0111539_10108622	Ga0111539_101086223	227
770	3300009094	Ga0111539_10183045	Ga0111539_101830452	227
771	3300009094	Ga0111539_10507741	Ga0111539_105077412	227
772	3300009094	Ga0111539_10683689	Ga0111539_106836891	227
773	3300009098	Ga0105245_10000882	Ga0105245_1000088215	227
774	3300009098	Ga0105245_10106664	Ga0105245_101066643	227
775	3300009098	Ga0105245_10271015	Ga0105245_102710153	227
776	3300009101	Ga0105247_10001969	Ga0105247_100019692	227
777	3300009101	Ga0105247_10004828	Ga0105247_100048283	227
778	3300009101	Ga0105247_10289542	Ga0105247_102895422	227
779	3300009147	Ga0114129_10061242	Ga0114129_100612425	227
780	3300009147	Ga0114129_10095382	Ga0114129_100953822	227
781	3300009147	Ga0114129_10104552	Ga0114129_101045525	227
782	3300009147	Ga0114129_10605105	Ga0114129_106051051	227
783	3300009148	Ga0105243_10001029	Ga0105243_1000102911	227
784	3300009148	Ga0105243_10009289	Ga0105243_100092896	227
785	3300009148	Ga0105243_10230935	Ga0105243_102309352	227
786	3300009148	Ga0105243_10428274	Ga0105243_104282742	227
787	3300009174	Ga0105241_10006660	Ga0105241_100066605	227
788	3300009174	Ga0105241_10350024	Ga0105241_103500241	227
789	3300009174	Ga0105241_10427289	Ga0105241_104272892	227
790	3300009174	Ga0105241_10725696	Ga0105241_107256961	227
791	3300009176	Ga0105242_10002177	Ga0105242_1000217711	227
792	3300009176	Ga0105242_10027348	Ga0105242_100273482	227
793	3300009176	Ga0105242_10294895	Ga0105242_102948952	227
794	3300009177	Ga0105248_10002945	Ga0105248_100029457	227
795	3300009177	Ga0105248_10012305	Ga0105248_100123053	227
796	3300009177	Ga0105248_10014996	Ga0105248_100149966	227
797	3300009177	Ga0105248_10074990	Ga0105248_100749903	227
798	3300009177	Ga0105248_10074998	Ga0105248_100749982	227
799	3300009545	Ga0105237_10063614	Ga0105237_100636142	227
800	3300009545	Ga0105237_10112977	Ga0105237_101129773	227
801	3300009545	Ga0105237_10208332	Ga0105237_102083322	227
802	3300009545	Ga0105237_10341732	Ga0105237_103417321	227
803	3300009551	Ga0105238_10066156	Ga0105238_100661563	227
804	3300009551	Ga0105238_10171734	Ga0105238_101717343	227
805	3300009551	Ga0105238_10644735	Ga0105238_106447352	227
806	3300009553	Ga0105249_10006632	Ga0105249_1000663210	227
807	3300009553	Ga0105249_10028570	Ga0105249_100285703	227
808	3300009553	Ga0105249_10032153	Ga0105249_100321534	227
809	3300010159	Ga0099796_10005397	Ga0099796_100053974	227
810	3300010375	Ga0105239_10021993	Ga0105239_100219936	227
811	3300010375	Ga0105239_10032680	Ga0105239_100326806	227
812	3300010375	Ga0105239_10094993	Ga0105239_100949934	227
813	3300010375	Ga0105239_10207875	Ga0105239_102078752	227
814	3300011119	Ga0105246_10000463	Ga0105246_1000046310	227
815	3300011119	Ga0105246_10033093	Ga0105246_100330934	227
816	3300011119	Ga0105246_10048040	Ga0105246_100480404	227
817	3300012503	Ga0157313_1000926	Ga0157313_10009262	227
818	3300013100	Ga0157373_10015583	Ga0157373_100155836	227
819	3300013102	Ga0157371_10115937	Ga0157371_101159372	227
820	3300013104	Ga0157370_10173108	Ga0157370_101731082	227
821	3300013105	Ga0157369_10427420	Ga0157369_104274202	227
822	3300013296	Ga0157374_10000614	Ga0157374_1000061417	227
823	3300013296	Ga0157374_10065462	Ga0157374_100654622	227
824	3300013296	Ga0157374_10495888	Ga0157374_104958882	227
825	3300013296	Ga0157374_11165826	Ga0157374_111658261	227
826	3300013297	Ga0157378_10000701	Ga0157378_1000070121	227
827	3300013297	Ga0157378_10027642	Ga0157378_100276424	227
828	3300013297	Ga0157378_10154419	Ga0157378_101544192	227
829	3300013306	Ga0163162_10008098	Ga0163162_100080983	227
830	3300013306	Ga0163162_10108282	Ga0163162_101082823	227
831	3300013306	Ga0163162_10186391	Ga0163162_101863912	227
832	3300013306	Ga0163162_10458816	Ga0163162_104588162	227
833	3300013307	Ga0157372_10016291	Ga0157372_100162915	227
834	3300013307	Ga0157372_10140711	Ga0157372_101407112	227
835	3300013307	Ga0157372_10594965	Ga0157372_105949651	227
836	3300013308	Ga0157375_10005857	Ga0157375_1000585711	227
837	3300013308	Ga0157375_10022311	Ga0157375_100223117	227
838	3300014325	Ga0163163_10004757	Ga0163163_100047578	227
839	3300014325	Ga0163163_10017614	Ga0163163_100176144	227
840	3300014325	Ga0163163_10053547	Ga0163163_100535475	227
841	3300014325	Ga0163163_10063537	Ga0163163_100635374	227
842	3300014325	Ga0163163_10183790	Ga0163163_101837904	227
843	3300014325	Ga0163163_11085892	Ga0163163_110858921	227
844	3300014326	Ga0157380_10001646	Ga0157380_100016463	227
845	3300014326	Ga0157380_10165606	Ga0157380_101656062	227
846	3300014497	Ga0182008_10166078	Ga0182008_101660782	227
847	3300014745	Ga0157377_10000514	Ga0157377_100005143	227
848	3300014968	Ga0157379_10000792	Ga0157379_1000079210	227
849	3300014968	Ga0157379_10010974	Ga0157379_100109745	227
850	3300014968	Ga0157379_10057501	Ga0157379_100575012	227
851	3300014968	Ga0157379_10072154	Ga0157379_100721544	227
852	3300014968	Ga0157379_10096732	Ga0157379_100967324	227
853	3300014969	Ga0157376_10000352	Ga0157376_100003522	227
854	3300014969	Ga0157376_10211676	Ga0157376_102116763	227
855	3300014969	Ga0157376_10511043	Ga0157376_105110432	227
856	3300014969	Ga0157376_10827550	Ga0157376_108275501	227
857	3300017792	Ga0163161_10000956	Ga0163161_100009568	227
858	3300017792	Ga0163161_10089657	Ga0163161_100896573	227
859	3300017792	Ga0163161_10143176	Ga0163161_101431762	227
860	3300020082	Ga0206353_10376412	Ga0206353_103764122	227
861	3300025271	Ga0207666_1000043	Ga0207666_100004315	227
862	3300025290	Ga0207673_1000044	Ga0207673_10000445	227
863	3300025315	Ga0207697_10001136	Ga0207697_1000113615	227
864	3300025315	Ga0207697_10012548	Ga0207697_100125485	227
865	3300025321	Ga0207656_10038144	Ga0207656_100381442	227
866	3300025728	Ga0207655_1061275	Ga0207655_10612751	227
867	3300025893	Ga0207682_10000021	Ga0207682_1000002123	227
868	3300025893	Ga0207682_10203212	Ga0207682_102032122	227
869	3300025898	Ga0207692_10002654	Ga0207692_100026546	227
870	3300025899	Ga0207642_10000623	Ga0207642_100006234	227
871	3300025899	Ga0207642_10046441	Ga0207642_100464411	227
872	3300025899	Ga0207642_10141871	Ga0207642_101418711	227
873	3300025900	Ga0207710_10001214	Ga0207710_1000121412	227
874	3300025900	Ga0207710_10020661	Ga0207710_100206614	227
875	3300025900	Ga0207710_10025361	Ga0207710_100253613	227
876	3300025901	Ga0207688_10000949	Ga0207688_1000094915	227
877	3300025901	Ga0207688_10002814	Ga0207688_100028142	227
878	3300025901	Ga0207688_10071997	Ga0207688_100719971	227
879	3300025901	Ga0207688_10179547	Ga0207688_101795472	227
880	3300025903	Ga0207680_10003232	Ga0207680_100032324	227
881	3300025903	Ga0207680_10110291	Ga0207680_101102913	227
882	3300025903	Ga0207680_10111466	Ga0207680_101114662	227
883	3300025903	Ga0207680_10131464	Ga0207680_101314642	227
884	3300025904	Ga0207647_10007234	Ga0207647_100072349	227
885	3300025904	Ga0207647_10011184	Ga0207647_100111843	227
886	3300025904	Ga0207647_10046289	Ga0207647_100462892	227
887	3300025905	Ga0207685_10045199	Ga0207685_100451992	227
888	3300025905	Ga0207685_10055572	Ga0207685_100555722	227
889	3300025906	Ga0207699_10020713	Ga0207699_100207132	227
890	3300025906	Ga0207699_10152742	Ga0207699_101527422	227
891	3300025907	Ga0207645_10002488	Ga0207645_1000248811	227
892	3300025907	Ga0207645_10002945	Ga0207645_1000294510	227
893	3300025907	Ga0207645_10023617	Ga0207645_100236172	227
894	3300025907	Ga0207645_10045340	Ga0207645_100453405	227
895	3300025908	Ga0207643_10000108	Ga0207643_1000010817	227
896	3300025908	Ga0207643_10002845	Ga0207643_100028457	227
897	3300025911	Ga0207654_10002719	Ga0207654_100027194	227
898	3300025911	Ga0207654_10011794	Ga0207654_100117945	227
899	3300025911	Ga0207654_10235793	Ga0207654_102357932	227
900	3300025912	Ga0207707_10000691	Ga0207707_1000069122	227
901	3300025912	Ga0207707_10040215	Ga0207707_100402154	227
902	3300025912	Ga0207707_10128051	Ga0207707_101280512	227
903	3300025913	Ga0207695_10039943	Ga0207695_100399432	227
904	3300025914	Ga0207671_10086869	Ga0207671_100868694	227
905	3300025914	Ga0207671_10100478	Ga0207671_101004782	227
906	3300025914	Ga0207671_10295710	Ga0207671_102957102	227
907	3300025915	Ga0207693_10007085	Ga0207693_100070855	227
908	3300025915	Ga0207693_10009090	Ga0207693_100090904	227
909	3300025915	Ga0207693_10115971	Ga0207693_101159713	227
910	3300025915	Ga0207693_10147296	Ga0207693_101472963	227
911	3300025915	Ga0207693_10203547	Ga0207693_102035472	227
912	3300025917	Ga0207660_10000014	Ga0207660_1000001456	227
913	3300025917	Ga0207660_10293877	Ga0207660_102938771	227
914	3300025918	Ga0207662_10006062	Ga0207662_100060627	227
915	3300025918	Ga0207662_10008927	Ga0207662_100089274	227
916	3300025918	Ga0207662_10019625	Ga0207662_100196253	227
917	3300025918	Ga0207662_10231465	Ga0207662_102314651	227
918	3300025919	Ga0207657_10046349	Ga0207657_100463494	227
919	3300025919	Ga0207657_10046352	Ga0207657_100463525	227
920	3300025919	Ga0207657_10077327	Ga0207657_100773274	227
921	3300025919	Ga0207657_10228097	Ga0207657_102280972	227
922	3300025920	Ga0207649_10000086	Ga0207649_100000867	227
923	3300025920	Ga0207649_10043035	Ga0207649_100430353	227
924	3300025920	Ga0207649_10086928	Ga0207649_100869283	227
925	3300025921	Ga0207652_10000255	Ga0207652_1000025546	227
926	3300025921	Ga0207652_10044044	Ga0207652_100440444	227
927	3300025921	Ga0207652_10161000	Ga0207652_101610002	227
928	3300025921	Ga0207652_10398264	Ga0207652_103982642	227
929	3300025923	Ga0207681_10000024	Ga0207681_1000002418	227
930	3300025924	Ga0207694_10361708	Ga0207694_103617082	227
931	3300025925	Ga0207650_10002572	Ga0207650_100025724	227
932	3300025925	Ga0207650_10012030	Ga0207650_100120305	227
933	3300025925	Ga0207650_10174839	Ga0207650_101748392	227
934	3300025925	Ga0207650_10414781	Ga0207650_104147811	227
935	3300025926	Ga0207659_10000034	Ga0207659_1000003490	227
936	3300025926	Ga0207659_10018147	Ga0207659_100181474	227
937	3300025926	Ga0207659_10047389	Ga0207659_100473893	227
938	3300025927	Ga0207687_10000110	Ga0207687_1000011018	227
939	3300025927	Ga0207687_10008628	Ga0207687_100086283	227
940	3300025928	Ga0207700_10035453	Ga0207700_100354533	227
941	3300025928	Ga0207700_10068719	Ga0207700_100687194	227
942	3300025928	Ga0207700_10133338	Ga0207700_101333381	227
943	3300025928	Ga0207700_10303672	Ga0207700_103036722	227
944	3300025928	Ga0207700_10324076	Ga0207700_103240762	227
945	3300025929	Ga0207664_10007232	Ga0207664_100072321	227
946	3300025929	Ga0207664_10027533	Ga0207664_100275333	227
947	3300025931	Ga0207644_10000642	Ga0207644_1000064213	227
948	3300025931	Ga0207644_10003006	Ga0207644_100030063	227
949	3300025931	Ga0207644_10047247	Ga0207644_100472474	227
950	3300025932	Ga0207690_10000270	Ga0207690_100002703	227
951	3300025932	Ga0207690_10022682	Ga0207690_100226824	227
952	3300025932	Ga0207690_10051466	Ga0207690_100514664	227
953	3300025932	Ga0207690_10168676	Ga0207690_101686762	227
954	3300025933	Ga0207706_10001336	Ga0207706_100013366	227
955	3300025933	Ga0207706_10007295	Ga0207706_100072953	227
956	3300025933	Ga0207706_10007337	Ga0207706_1000733711	227
957	3300025933	Ga0207706_10108352	Ga0207706_101083522	227
958	3300025933	Ga0207706_10109295	Ga0207706_101092952	227
959	3300025934	Ga0207686_10000214	Ga0207686_1000021420	227
960	3300025934	Ga0207686_10044726	Ga0207686_100447262	227
961	3300025934	Ga0207686_10275477	Ga0207686_102754772	227
962	3300025935	Ga0207709_10000344	Ga0207709_1000034446	227
963	3300025935	Ga0207709_10003540	Ga0207709_100035409	227
964	3300025935	Ga0207709_10165987	Ga0207709_101659873	227
965	3300025936	Ga0207670_10000461	Ga0207670_1000046113	227
966	3300025936	Ga0207670_10002631	Ga0207670_100026315	227
967	3300025936	Ga0207670_10111337	Ga0207670_101113373	227
968	3300025936	Ga0207670_10151846	Ga0207670_101518463	227
969	3300025936	Ga0207670_10243822	Ga0207670_102438221	227
970	3300025937	Ga0207669_10000295	Ga0207669_1000029517	227
971	3300025937	Ga0207669_10029074	Ga0207669_100290744	227
972	3300025938	Ga0207704_10000343	Ga0207704_100003433	227
973	3300025938	Ga0207704_10052137	Ga0207704_100521374	227
974	3300025938	Ga0207704_10060299	Ga0207704_100602992	227
975	3300025939	Ga0207665_10001068	Ga0207665_1000106815	227
976	3300025939	Ga0207665_10129375	Ga0207665_101293752	227
977	3300025940	Ga0207691_10000635	Ga0207691_1000063528	227
978	3300025940	Ga0207691_10003768	Ga0207691_1000376815	227
979	3300025941	Ga0207711_10007313	Ga0207711_100073136	227
980	3300025941	Ga0207711_10093487	Ga0207711_100934871	227
981	3300025941	Ga0207711_10186767	Ga0207711_101867672	227
982	3300025941	Ga0207711_10223596	Ga0207711_102235962	227
983	3300025942	Ga0207689_10002655	Ga0207689_1000265516	227
984	3300025942	Ga0207689_10003641	Ga0207689_100036416	227
985	3300025942	Ga0207689_10024648	Ga0207689_100246485	227
986	3300025942	Ga0207689_10213810	Ga0207689_102138102	227
987	3300025944	Ga0207661_10000036	Ga0207661_100000368	227
988	3300025944	Ga0207661_10672300	Ga0207661_106723001	227
989	3300025945	Ga0207679_10000025	Ga0207679_10000025120	227
990	3300025945	Ga0207679_10014282	Ga0207679_100142825	227
991	3300025945	Ga0207679_10082518	Ga0207679_100825183	227
992	3300025945	Ga0207679_10374527	Ga0207679_103745272	227
993	3300025945	Ga0207679_10556082	Ga0207679_105560822	227
994	3300025949	Ga0207667_10007960	Ga0207667_100079605	227
995	3300025949	Ga0207667_10463367	Ga0207667_104633672	227
996	3300025960	Ga0207651_10000028	Ga0207651_1000002822	227
997	3300025960	Ga0207651_10013440	Ga0207651_100134402	227
998	3300025960	Ga0207651_10053292	Ga0207651_100532922	227
999	3300025960	Ga0207651_10153312	Ga0207651_101533123	227
1000	3300025960	Ga0207651_10224029	Ga0207651_102240293	227
1001	3300025960	Ga0207651_10441443	Ga0207651_104414432	227
1002	3300025961	Ga0207712_10000558	Ga0207712_1000055816	227
1003	3300025961	Ga0207712_10002399	Ga0207712_1000239913	227
1004	3300025961	Ga0207712_10089239	Ga0207712_100892393	227
1005	3300025961	Ga0207712_10372855	Ga0207712_103728552	227
1006	3300025972	Ga0207668_10000538	Ga0207668_1000053811	227
1007	3300025972	Ga0207668_10031104	Ga0207668_100311044	227
1008	3300025981	Ga0207640_10006541	Ga0207640_100065415	227
1009	3300025981	Ga0207640_10041977	Ga0207640_100419773	227
1010	3300025981	Ga0207640_10043342	Ga0207640_100433424	227
1011	3300025981	Ga0207640_10170042	Ga0207640_101700422	227
1012	3300025986	Ga0207658_10000795	Ga0207658_1000079517	227
1013	3300025986	Ga0207658_10046077	Ga0207658_100460772	227
1014	3300025986	Ga0207658_10370139	Ga0207658_103701391	227
1015	3300026023	Ga0207677_10001822	Ga0207677_100018225	227
1016	3300026023	Ga0207677_10015703	Ga0207677_100157032	227
1017	3300026035	Ga0207703_10008768	Ga0207703_100087687	227
1018	3300026035	Ga0207703_10012768	Ga0207703_100127685	227
1019	3300026035	Ga0207703_10041098	Ga0207703_100410984	227
1020	3300026035	Ga0207703_10401509	Ga0207703_104015092	227
1021	3300026035	Ga0207703_10556570	Ga0207703_105565702	227
1022	3300026041	Ga0207639_10000925	Ga0207639_1000092513	227
1023	3300026041	Ga0207639_10018222	Ga0207639_100182225	227
1024	3300026041	Ga0207639_10045906	Ga0207639_100459063	227
1025	3300026067	Ga0207678_10003256	Ga0207678_1000325615	227
1026	3300026067	Ga0207678_10004902	Ga0207678_100049028	227
1027	3300026067	Ga0207678_10006940	Ga0207678_100069405	227
1028	3300026067	Ga0207678_10010341	Ga0207678_100103415	227
1029	3300026067	Ga0207678_10016580	Ga0207678_100165807	227
1030	3300026075	Ga0207708_10004521	Ga0207708_100045213	227
1031	3300026075	Ga0207708_10019050	Ga0207708_100190505	227
1032	3300026075	Ga0207708_10037218	Ga0207708_100372183	227
1033	3300026078	Ga0207702_10004638	Ga0207702_100046385	227
1034	3300026078	Ga0207702_10065787	Ga0207702_100657874	227
1035	3300026078	Ga0207702_10069314	Ga0207702_100693144	227
1036	3300026088	Ga0207641_10001294	Ga0207641_1000129412	227
1037	3300026089	Ga0207648_10003105	Ga0207648_100031057	227
1038	3300026089	Ga0207648_10004307	Ga0207648_1000430715	227
1039	3300026089	Ga0207648_10076986	Ga0207648_100769865	227
1040	3300026089	Ga0207648_10553353	Ga0207648_105533531	227
1041	3300026095	Ga0207676_10000640	Ga0207676_1000064021	227
1042	3300026095	Ga0207676_10024382	Ga0207676_100243824	227
1043	3300026095	Ga0207676_10042058	Ga0207676_100420581	227
1044	3300026095	Ga0207676_10313281	Ga0207676_103132812	227
1045	3300026116	Ga0207674_10005795	Ga0207674_100057953	227
1046	3300026116	Ga0207674_10074975	Ga0207674_100749753	227
1047	3300026116	Ga0207674_10489740	Ga0207674_104897401	227
1048	3300026118	Ga0207675_100003849	Ga0207675_10000384915	227
1049	3300026118	Ga0207675_100004255	Ga0207675_1000042557	227
1050	3300026121	Ga0207683_10000001	Ga0207683_10000001120	227
1051	3300026121	Ga0207683_10004806	Ga0207683_1000480611	227
1052	3300026121	Ga0207683_10007077	Ga0207683_100070778	227
1053	3300026121	Ga0207683_10023723	Ga0207683_100237236	227
1054	3300026142	Ga0207698_10014590	Ga0207698_100145905	227
1055	3300026142	Ga0207698_10026697	Ga0207698_100266973	227
1056	3300026142	Ga0207698_10291971	Ga0207698_102919712	227
1057	3300027471	Ga0209995_1017210	Ga0209995_10172102	227
1058	3300027512	Ga0209179_1029153	Ga0209179_10291532	227
1059	3300027526	Ga0209968_1030175	Ga0209968_10301751	227
1060	3300027552	Ga0209982_1002600	Ga0209982_10026002	227
1061	3300027614	Ga0209970_1012282	Ga0209970_10122822	227
1062	3300027617	Ga0210002_1001810	Ga0210002_10018103	227
1063	3300027665	Ga0209983_1035560	Ga0209983_10355602	227
1064	3300027682	Ga0209971_1037950	Ga0209971_10379502	227
1065	3300027695	Ga0209966_1001479	Ga0209966_10014793	227
1066	3300027695	Ga0209966_1001617	Ga0209966_10016173	227
1067	3300027717	Ga0209998_10001115	Ga0209998_100011157	227
1068	3300027717	Ga0209998_10001190	Ga0209998_100011902	227
1069	3300027876	Ga0209974_10000991	Ga0209974_100009912	227
1070	3300027876	Ga0209974_10123482	Ga0209974_101234821	227
1071	3300027907	Ga0207428_10000823	Ga0207428_1000082325	227
1072	3300027907	Ga0207428_10001512	Ga0207428_1000151211	227
1073	3300028023	Ga0265357_1001253	Ga0265357_10012532	227
1074	3300028379	Ga0268266_10026518	Ga0268266_100265184	227
1075	3300028379	Ga0268266_10135900	Ga0268266_101359002	227
1076	3300028379	Ga0268266_10153292	Ga0268266_101532923	227
1077	3300028379	Ga0268266_10167713	Ga0268266_101677132	227
1078	3300028380	Ga0268265_10001288	Ga0268265_1000128817	227
1079	3300028380	Ga0268265_10086490	Ga0268265_100864903	227
1080	3300028380	Ga0268265_10555025	Ga0268265_105550252	227
1081	3300028381	Ga0268264_10000456	Ga0268264_1000045650	227
1082	3300028381	Ga0268264_10005325	Ga0268264_100053255	227
1083	3300028381	Ga0268264_10074026	Ga0268264_100740264	227
1084	3300028381	Ga0268264_10128105	Ga0268264_101281052	227
1085	3300031247	Ga0265340_10004865	Ga0265340_100048654	227
1086	3300031249	Ga0265339_10004645	Ga0265339_1000464510	227
1087	3300031250	Ga0265331_10051231	Ga0265331_100512313	227
1088	3300031344	Ga0265316_10129850	Ga0265316_101298502	227
1089	3300031711	Ga0265314_10008306	Ga0265314_100083069	227
1090	3300031712	Ga0265342_10000092	Ga0265342_1000009297	227
1091	3300031852	Ga0307410_10730951	Ga0307410_107309511	227
1092	3300032133	Ga0316583_10000594	Ga0316583_1000059412	227
1093	3300034816	Ga0373930_0000196	Ga0373930_0000196_6436_7119	227
1094	3300034817	Ga0373948_0000861	Ga0373948_0000861_1095_1778	227
1095	3300034817	Ga0373948_0001041	Ga0373948_0001041_2397_3080	227
1096	3300034817	Ga0373948_0001761	Ga0373948_0001761_1576_2259	227
1097	3300034818	Ga0373950_0000297	Ga0373950_0000297_1444_2127	227
1098	3300034818	Ga0373950_0005679	Ga0373950_0005679_408_1091	227
1099	3300034819	Ga0373958_0002061	Ga0373958_0002061_897_1580	227
1100	3300034819	Ga0373958_0006709	Ga0373958_0006709_1082_1765	227
1101	3300034819	Ga0373958_0008200	Ga0373958_0008200_333_1016	227
1102	3300034820	Ga0373959_0001177	Ga0373959_0001177_1882_2565	227
1103	3300034820	Ga0373959_0002292	Ga0373959_0002292_1798_2481	227
1104	3300034957	Ga0373938_0000046	Ga0373938_0000046_6869_7552	227
1105	3300034957	Ga0373938_0002402	Ga0373938_0002402_297_980	227
1106	3300034957	Ga0373938_0020342	Ga0373938_0020342_381_1064	227
1107	3300035083	Ga0373926_0021975	Ga0373926_0021975_960_1643	227
1108	3300035083	Ga0373926_0046822	Ga0373926_0046822_614_1297	227
1109	3300035084	Ga0373928_0001726	Ga0373928_0001726_1593_2276	227
1110	3300035084	Ga0373928_0046076	Ga0373928_0046076_97_780	227
1111	3300035085	Ga0373929_0000284	Ga0373929_0000284_2704_3387	227
1112	3300035085	Ga0373929_0002711	Ga0373929_0002711_2524_3207	227
1113	3300035086	Ga0373934_0022290	Ga0373934_0022290_1281_1964	227
1114	3300035086	Ga0373934_0076615	Ga0373934_0076615_483_1166	227
1115	3300035088	Ga0373940_0001045	Ga0373940_0001045_1755_2438	227
1116	3300035088	Ga0373940_0001289	Ga0373940_0001289_1051_1734	227
1117	3300035089	Ga0373944_0003559	Ga0373944_0003559_2862_3545	227
1118	3300035089	Ga0373944_0005088	Ga0373944_0005088_511_1194	227
1119	3300035089	Ga0373944_0040433	Ga0373944_0040433_23_706	227
1120	3300035090	Ga0373949_0000546	Ga0373949_0000546_4728_5411	227
1121	3300035090	Ga0373949_0001599	Ga0373949_0001599_817_1500	227
1122	3300035090	Ga0373949_0024744	Ga0373949_0024744_346_1029	227
1123	3300035091	Ga0373951_0000608	Ga0373951_0000608_726_1409	227
1124	3300035091	Ga0373951_0001694	Ga0373951_0001694_4382_5065	227
1125	3300035091	Ga0373951_0020605	Ga0373951_0020605_385_1068	227
1126	3300035092	Ga0373952_0000574	Ga0373952_0000574_141_824	227
1127	3300035092	Ga0373952_0004003	Ga0373952_0004003_171_854	227
1128	3300035111	Ga0373923_0016264	Ga0373923_0016264_1091_1774	227
1129	3300035111	Ga0373923_0066038	Ga0373923_0066038_257_940	227
1130	3300035111	Ga0373923_0094372	Ga0373923_0094372_275_958	227
1131	3300035112	Ga0373932_0000577	Ga0373932_0000577_1179_1862	227
1132	3300035112	Ga0373932_0001670	Ga0373932_0001670_728_1411	227
1133	3300035112	Ga0373932_0011388	Ga0373932_0011388_671_1354	227
1134	3300035113	Ga0373936_0005473	Ga0373936_0005473_1136_1819	227
1135	3300035113	Ga0373936_0122148	Ga0373936_0122148_409_1092	227
1136	3300035114	Ga0373939_0000691	Ga0373939_0000691_1674_2357	227
1137	3300035114	Ga0373939_0001452	Ga0373939_0001452_726_1409	227
1138	3300035114	Ga0373939_0002354	Ga0373939_0002354_3416_4099	227
1139	3300035115	Ga0373941_0003673	Ga0373941_0003673_2697_3380	227
1140	3300035115	Ga0373941_0007450	Ga0373941_0007450_588_1271	227
1141	3300035116	Ga0373945_0021266	Ga0373945_0021266_13_696	227
1142	3300035116	Ga0373945_0021839	Ga0373945_0021839_821_1504	227
1143	3300035116	Ga0373945_0036414	Ga0373945_0036414_907_1590	227
1144	3300035116	Ga0373945_0095753	Ga0373945_0095753_444_1127	227
1145	3300035116	Ga0373945_0134297	Ga0373945_0134297_251_934	227
1146	3300035117	Ga0373953_0007986	Ga0373953_0007986_1754_2437	227
1147	3300035117	Ga0373953_0014564	Ga0373953_0014564_134_817	227
1148	3300035117	Ga0373953_0105645	Ga0373953_0105645_118_801	227
1149	3300035118	Ga0373954_0004076	Ga0373954_0004076_5303_5986	227
1150	3300035118	Ga0373954_0128019	Ga0373954_0128019_506_1189	227
1151	3300035119	Ga0373956_0001739	Ga0373956_0001739_1017_1700	227
1152	3300035119	Ga0373956_0001917	Ga0373956_0001917_4659_5342	227
1153	3300035119	Ga0373956_0024511	Ga0373956_0024511_306_989	227
1154	3300035120	Ga0373957_0006573	Ga0373957_0006573_2976_3659	227
1155	3300035120	Ga0373957_0006843	Ga0373957_0006843_2805_3488	227
1156	3300035121	Ga0373960_0000587	Ga0373960_0000587_726_1409	227
1157	3300035121	Ga0373960_0011868	Ga0373960_0011868_1000_1683	227
1158	3300035121	Ga0373960_0058946	Ga0373960_0058946_175_858	227
1159	3300035170	Ga0373943_0002330	Ga0373943_0002330_1897_2580	227
1160	3300035170	Ga0373943_0011524	Ga0373943_0011524_2234_2917	227
1161	3300035171	Ga0373946_0008539	Ga0373946_0008539_1800_2483	227
1162	3300035171	Ga0373946_0011321	Ga0373946_0011321_2000_2683	227
1163	3300035171	Ga0373946_0036676	Ga0373946_0036676_148_831	227
1164	3300035172	Ga0373955_0001883	Ga0373955_0001883_1028_1711	227
1165	3300035172	Ga0373955_0021582	Ga0373955_0021582_1695_2378	227
1166	3300035172	Ga0373955_0150546	Ga0373955_0150546_430_1113	227
1167	3300035172	Ga0373955_0416613	Ga0373955_0416613_16_699	227
1168	3300035207	Ga0373942_0001465	Ga0373942_0001465_2004_2687	227
1169	3300035207	Ga0373942_0004097	Ga0373942_0004097_824_1507	227
1170	3300035207	Ga0373942_0010473	Ga0373942_0010473_267_950	227
1171	3300035241	Ga0373961_0000385	Ga0373961_0000385_2109_2792	227
1172	3300035241	Ga0373961_0000869	Ga0373961_0000869_3081_3764	227
1173	3300035241	Ga0373961_0051776	Ga0373961_0051776_441_1124	227
1174	3300035241	Ga0373961_0054494	Ga0373961_0054494_493_1176	227
1175	3300035242	Ga0373962_0003613	Ga0373962_0003613_1985_2668	227
1176	3300035242	Ga0373962_0006217	Ga0373962_0006217_2103_2786	227
1177	3300035242	Ga0373962_0062480	Ga0373962_0062480_354_1037	227
1178	3300035242	Ga0373962_0073279	Ga0373962_0073279_48_731	227
1179	3300035410	Ga0373924_0223256	Ga0373924_0223256_57_740	227
1180	3300035691	Ga0373931_0001882	Ga0373931_0001882_4664_5347	227
1181	3300035691	Ga0373931_0003354	Ga0373931_0003354_5670_6353	227
1182	3300035691	Ga0373931_0012617	Ga0373931_0012617_2236_2919	227
1183	3300035692	Ga0373935_0002676	Ga0373935_0002676_4074_4757	227
1184	3300035692	Ga0373935_0257719	Ga0373935_0257719_301_984	227
1185	3300035695	Ga0373927_0010750	Ga0373927_0010750_2882_3565	227
1186	3300035695	Ga0373927_0122790	Ga0373927_0122790_84_767	227
1187	3300035695	Ga0373927_0179285	Ga0373927_0179285_23_706	227
1188	3300035724	Ga0373933_0000125	Ga0373933_0000125_13421_14104	227
1189	3300035724	Ga0373933_0002112	Ga0373933_0002112_3547_4230	227
1190	3300035724	Ga0373933_0010711	Ga0373933_0010711_2814_3497	227
1191	3300035724	Ga0373933_0017319	Ga0373933_0017319_186_869	227
1192	3300035725	Ga0373947_0001553	Ga0373947_0001553_9425_10108	227
1193	3300035725	Ga0373947_0080026	Ga0373947_0080026_1277_1960	227
1194	3300035725	Ga0373947_0170067	Ga0373947_0170067_23_706	227
1195	3300035725	Ga0373947_0436927	Ga0373947_0436927_81_764	227
1196	3300036401	Ga0373937_0002048	Ga0373937_0002048_12635_13318	227
1197	3300036401	Ga0373937_0188820	Ga0373937_0188820_115_798	227
1198	3300036401	Ga0373937_0223998	Ga0373937_0223998_805_1491	227
1199	3300037068	Ga0373925_0008896	Ga0373925_0008896_4651_5334	227
1200	3300037068	Ga0373925_0033160	Ga0373925_0033160_2544_3227	227
1201	3300037068	Ga0373925_0125619	Ga0373925_0125619_1252_1935	227
1202	3300038996	Ga0242420_015440	Ga0242420_015440_503_1186	227
1203	3300039437	Ga0436365_0657686	Ga0436365_0657686_10068_10751	227
1204	3300039453	Ga0436362_1090515	Ga0436362_1090515_298_981	227
1205	3300042876	Ga0451577_0297987	Ga0451577_0297987_115_798	227
1206	3300045051	Ga0451576_0021183	Ga0451576_0021183_3503_4186	227
1207	3300046452	Ga0495617_076952	Ga0495617_076952_383_1066	227
1208	3300046454	Ga0495592_0004699	Ga0495592_0004699_4122_4805	227
1209	3300046454	Ga0495592_0014796	Ga0495592_0014796_2021_2704	227
1210	3300046454	Ga0495592_0041714	Ga0495592_0041714_1649_2335	227
1211	3300046454	Ga0495592_0156492	Ga0495592_0156492_391_1074	227
1212	3300046455	Ga0495603_0025855	Ga0495603_0025855_2837_3520	227
1213	3300046455	Ga0495603_0082710	Ga0495603_0082710_739_1422	227
1214	3300046459	Ga0495629_0003044	Ga0495629_0003044_6939_7622	227
1215	3300046459	Ga0495629_0142612	Ga0495629_0142612_384_1067	227
1216	3300046459	Ga0495629_0157088	Ga0495629_0157088_581_1267	227
1217	3300046459	Ga0495629_0188613	Ga0495629_0188613_280_963	227
1218	3300046461	Ga0495641_0016811	Ga0495641_0016811_2434_3117	227
1219	3300046461	Ga0495641_0036035	Ga0495641_0036035_879_1562	227
1220	3300046461	Ga0495641_0084391	Ga0495641_0084391_21_707	227
1221	3300046462	Ga0495651_0002035	Ga0495651_0002035_14194_14877	227
1222	3300046462	Ga0495651_0010719	Ga0495651_0010719_2474_3157	227
1223	3300046462	Ga0495651_0036349	Ga0495651_0036349_2979_3662	227
1224	3300046462	Ga0495651_0164118	Ga0495651_0164118_452_1135	227
1225	3300046463	Ga0495653_0035187	Ga0495653_0035187_2496_3179	227
1226	3300046463	Ga0495653_0065475	Ga0495653_0065475_1996_2679	227
1227	3300046463	Ga0495653_0089810	Ga0495653_0089810_1083_1769	227
1228	3300046472	Ga0495580_0152763	Ga0495580_0152763_577_1260	227
1229	3300046472	Ga0495580_0199102	Ga0495580_0199102_257_940	227
1230	3300046473	Ga0495582_0003239	Ga0495582_0003239_953_1636	227
1231	3300046473	Ga0495582_0028856	Ga0495582_0028856_125_808	227
1232	3300046473	Ga0495582_0084807	Ga0495582_0084807_608_1291	227
1233	3300046473	Ga0495582_0104126	Ga0495582_0104126_89_772	227
1234	3300046474	Ga0495605_0035609	Ga0495605_0035609_337_1020	227
1235	3300046475	Ga0495639_0121074	Ga0495639_0121074_357_1040	227
1236	3300046476	Ga0495662_0048090	Ga0495662_0048090_322_1005	227
1237	3300046476	Ga0495662_0107218	Ga0495662_0107218_324_1007	227
1238	3300046477	Ga0495664_0030072	Ga0495664_0030072_32_715	227
1239	3300046477	Ga0495664_0110833	Ga0495664_0110833_818_1501	227
1240	3300046491	Ga0495584_0007023	Ga0495584_0007023_4191_4874	227
1241	3300046491	Ga0495584_0018261	Ga0495584_0018261_2847_3530	227
1242	3300046491	Ga0495584_0177029	Ga0495584_0177029_70_753	227
1243	3300046492	Ga0495585_0000856	Ga0495585_0000856_15353_16036	227
1244	3300046492	Ga0495585_0007417	Ga0495585_0007417_5665_6348	227
1245	3300046492	Ga0495585_0028456	Ga0495585_0028456_1672_2355	227
1246	3300046499	Ga0495594_0008038	Ga0495594_0008038_1147_1830	227
1247	3300046499	Ga0495594_0011796	Ga0495594_0011796_2943_3626	227
1248	3300046499	Ga0495594_0096793	Ga0495594_0096793_847_1530	227
1249	3300046499	Ga0495594_0110433	Ga0495594_0110433_622_1305	227
1250	3300046501	Ga0495607_0027202	Ga0495607_0027202_768_1451	227
1251	3300046501	Ga0495607_0195196	Ga0495607_0195196_24_707	227
1252	3300046511	Ga0495608_0000915	Ga0495608_0000915_17370_18053	227
1253	3300046511	Ga0495608_0058533	Ga0495608_0058533_890_1576	227
1254	3300046511	Ga0495608_0066508	Ga0495608_0066508_1209_1892	227
1255	3300046511	Ga0495608_0076902	Ga0495608_0076902_511_1194	227
1256	3300046516	Ga0495628_0008958	Ga0495628_0008958_300_983	227
1257	3300046516	Ga0495628_0032827	Ga0495628_0032827_1951_2634	227
1258	3300046516	Ga0495628_0184642	Ga0495628_0184642_386_1072	227
1259	3300046517	Ga0495630_0126393	Ga0495630_0126393_944_1627	227
1260	3300046517	Ga0495630_0130219	Ga0495630_0130219_558_1241	227
1261	3300046517	Ga0495630_0238275	Ga0495630_0238275_474_1160	227
1262	3300046517	Ga0495630_0541043	Ga0495630_0541043_84_767	227
1263	3300046518	Ga0495631_0094340	Ga0495631_0094340_187_870	227
1264	3300046520	Ga0495637_0044734	Ga0495637_0044734_1079_1762	227
1265	3300046523	Ga0495644_0033593	Ga0495644_0033593_1206_1889	227
1266	3300046525	Ga0495663_0021146	Ga0495663_0021146_979_1662	227
1267	3300046526	Ga0495666_0014396	Ga0495666_0014396_614_1297	227
1268	3300046526	Ga0495666_0018752	Ga0495666_0018752_2442_3125	227
1269	3300046528	Ga0495642_0167641	Ga0495642_0167641_33_716	227
1270	3300046529	Ga0495652_0005789	Ga0495652_0005789_2750_3433	227
1271	3300046529	Ga0495652_0063623	Ga0495652_0063623_2314_2997	227
1272	3300046529	Ga0495652_0261233	Ga0495652_0261233_526_1212	227
1273	3300046531	Ga0495665_0061258	Ga0495665_0061258_836_1519	227
1274	3300046531	Ga0495665_0082559	Ga0495665_0082559_450_1133	227
1275	3300046531	Ga0495665_0097718	Ga0495665_0097718_257_940	227
1276	3300046533	Ga0495640_0071044	Ga0495640_0071044_625_1308	227
1277	3300046533	Ga0495640_0209888	Ga0495640_0209888_282_965	227
1278	3300046533	Ga0495640_0348910	Ga0495640_0348910_14_700	227
1279	3300046535	Ga0495586_0075875	Ga0495586_0075875_135_818	227
1280	3300046536	Ga0495587_0001734	Ga0495587_0001734_427_1110	227
1281	3300046536	Ga0495587_0076892	Ga0495587_0076892_495_1178	227
1282	3300046536	Ga0495587_0116350	Ga0495587_0116350_54_737	227
1283	3300046537	Ga0495598_0000233	Ga0495598_0000233_202_885	227
1284	3300046537	Ga0495598_0020531	Ga0495598_0020531_288_971	227
1285	3300046538	Ga0495609_0039144	Ga0495609_0039144_222_905	227
1286	3300046539	Ga0495621_0050241	Ga0495621_0050241_794_1477	227
1287	3300046539	Ga0495621_0091691	Ga0495621_0091691_145_828	227
1288	3300046543	Ga0495645_0011672	Ga0495645_0011672_2878_3561	227
1289	3300046543	Ga0495645_0086453	Ga0495645_0086453_170_853	227
1290	3300046557	Ga0495622_0141676	Ga0495622_0141676_318_1001	227
1291	3300046558	Ga0495633_0017034	Ga0495633_0017034_997_1680	227
1292	3300046559	Ga0495667_0000259	Ga0495667_0000259_17207_17890	227
1293	3300046559	Ga0495667_0018366	Ga0495667_0018366_3111_3794	227
1294	3300046559	Ga0495667_0070601	Ga0495667_0070601_548_1234	227
1295	3300046615	Ga0495656_0000215	Ga0495656_0000215_17419_18102	227
1296	3300046616	Ga0495668_0039909	Ga0495668_0039909_287_970	227
1297	3300046642	Ga0495634_0008814	Ga0495634_0008814_6594_7277	227
1298	3300046648	Ga0495611_0003842	Ga0495611_0003842_5513_6196	227
1299	3300046648	Ga0495611_0277951	Ga0495611_0277951_56_739	227
1300	3300046663	Ga0495635_0010301	Ga0495635_0010301_5272_5958	227
1301	3300046663	Ga0495635_0015969	Ga0495635_0015969_302_985	227
1302	3300046663	Ga0495635_0026638	Ga0495635_0026638_819_1502	227
1303	3300046664	Ga0495659_0002574	Ga0495659_0002574_2148_2831	227
1304	3300046664	Ga0495659_0054558	Ga0495659_0054558_381_1064	227
1305	3300046665	Ga0495661_0063130	Ga0495661_0063130_1005_1688	227
1306	3300046665	Ga0495661_0222522	Ga0495661_0222522_86_769	227
1307	3300046674	Ga0495588_0020179	Ga0495588_0020179_2047_2730	227
1308	3300046675	Ga0495657_0091756	Ga0495657_0091756_275_958	227
1309	3300046678	Ga0495599_0002681	Ga0495599_0002681_6834_7517	227
1310	3300046678	Ga0495599_0017056	Ga0495599_0017056_3117_3800	227
1311	3300046678	Ga0495599_0042653	Ga0495599_0042653_216_899	227
1312	3300046679	Ga0495623_0020755	Ga0495623_0020755_495_1178	227
1313	3300046679	Ga0495623_0064743	Ga0495623_0064743_982_1665	227
1314	3300046680	Ga0495646_0010194	Ga0495646_0010194_3663_4346	227
1315	3300046680	Ga0495646_0026632	Ga0495646_0026632_590_1273	227
1316	3300046681	Ga0495647_0020437	Ga0495647_0020437_313_996	227
1317	3300046683	Ga0495658_0000360	Ga0495658_0000360_20216_20899	227
1318	3300046683	Ga0495658_0005781	Ga0495658_0005781_2347_3030	227
1319	3300046683	Ga0495658_0094433	Ga0495658_0094433_770_1453	227
1320	3300046689	Ga0495613_0006693	Ga0495613_0006693_296_979	227
1321	3300046689	Ga0495613_0027827	Ga0495613_0027827_3473_4156	227
1322	3300046689	Ga0495613_0033307	Ga0495613_0033307_1117_1800	227
1323	3300046689	Ga0495613_0065362	Ga0495613_0065362_178_861	227
1324	3300046690	Ga0495624_0155778	Ga0495624_0155778_427_1110	227
1325	3300046690	Ga0495624_0227022	Ga0495624_0227022_292_975	227
1326	3300046690	Ga0495624_0256231	Ga0495624_0256231_287_970	227
1327	3300046690	Ga0495624_0260707	Ga0495624_0260707_108_791	227
1328	3300046691	Ga0495670_0000213	Ga0495670_0000213_20906_21589	227
1329	3300046691	Ga0495670_0033566	Ga0495670_0033566_1196_1879	227
1330	3300046691	Ga0495670_0144478	Ga0495670_0144478_279_962	227
1331	3300046692	Ga0495671_0062082	Ga0495671_0062082_647_1330	227
1332	3300046692	Ga0495671_0301809	Ga0495671_0301809_24_707	227
1333	3300046809	Ga0495600_0006046	Ga0495600_0006046_4165_4848	227
1334	3300046809	Ga0495600_0052146	Ga0495600_0052146_408_1091	227
1335	3300047315	Ga0495581_0057033	Ga0495581_0057033_1316_1999	227
1336	3300047315	Ga0495581_0059837	Ga0495581_0059837_257_940	227
1337	3300047315	Ga0495581_0064661	Ga0495581_0064661_210_893	227
1338	3300047317	Ga0495604_0006070	Ga0495604_0006070_8545_9228	227
1339	3300047317	Ga0495604_0009049	Ga0495604_0009049_5096_5779	227
1340	3300047317	Ga0495604_0057607	Ga0495604_0057607_1430_2116	227
1341	3300047318	Ga0495636_0138265	Ga0495636_0138265_175_858	227
1342	3300047319	Ga0495674_0138581	Ga0495674_0138581_144_830	227
1343	3300047319	Ga0495674_0252836	Ga0495674_0252836_651_1334	227
1344	3300047319	Ga0495674_0338640	Ga0495674_0338640_400_1083	227
1345	3300047319	Ga0495674_0371609	Ga0495674_0371609_188_871	227
1346	3300047321	Ga0495676_0103110	Ga0495676_0103110_10_693	227
1347	3300047321	Ga0495676_0142975	Ga0495676_0142975_816_1499	227
1348	3300047322	Ga0495680_0002446	Ga0495680_0002446_18005_18688	227
1349	3300047322	Ga0495680_0004222	Ga0495680_0004222_1836_2519	227
1350	3300047322	Ga0495680_0012206	Ga0495680_0012206_4110_4796	227
1351	3300047322	Ga0495680_0018853	Ga0495680_0018853_911_1594	227
1352	3300047444	Ga0495675_0000147	Ga0495675_0000147_25189_25872	227
1353	3300047444	Ga0495675_0156734	Ga0495675_0156734_28_714	227
1354	3300047444	Ga0495675_0226208	Ga0495675_0226208_153_836	227
1355	3300047471	Ga0495684_0028528	Ga0495684_0028528_1278_1961	227
1356	3300047471	Ga0495684_0047645	Ga0495684_0047645_1166_1852	227
1357	3300047471	Ga0495684_0133969	Ga0495684_0133969_713_1396	227
1358	3300047673	Ga0495593_0014970	Ga0495593_0014970_2319_3002	227
1359	3300047673	Ga0495593_0039262	Ga0495593_0039262_1201_1890	227
1360	3300047673	Ga0495593_0059876	Ga0495593_0059876_599_1282	227
1361	3300047673	Ga0495593_0090251	Ga0495593_0090251_492_1175	227
1362	3300047673	Ga0495593_0091642	Ga0495593_0091642_369_1052	227
1363	3300048088	Ga0495602_0017376	Ga0495602_0017376_4173_4856	227
1364	3300048088	Ga0495602_0017828	Ga0495602_0017828_289_972	227
1365	3300048088	Ga0495602_0021291	Ga0495602_0021291_2555_3238	227
1366	3300048088	Ga0495602_0371326	Ga0495602_0371326_13_696	227
1367	3300048089	Ga0495614_0016270	Ga0495614_0016270_1280_1963	227
1368	3300048089	Ga0495614_0103831	Ga0495614_0103831_256_939	227
1369	3300048089	Ga0495614_0162082	Ga0495614_0162082_129_812	227
1370	3300048090	Ga0495615_0052303	Ga0495615_0052303_104_787	227
1371	3300048091	Ga0495626_0155680	Ga0495626_0155680_239_922	227
1372	3300048903	Ga0496100_0006594	Ga0496100_0006594_5532_6215	227
1373	3300048903	Ga0496100_0013961	Ga0496100_0013961_2374_3057	227
1374	3300048903	Ga0496100_0017287	Ga0496100_0017287_1560_2243	227
1375	3300048903	Ga0496100_0019150	Ga0496100_0019150_2726_3409	227
1376	3300048903	Ga0496100_0055392	Ga0496100_0055392_1318_2001	227
1377	3300048903	Ga0496100_0155297	Ga0496100_0155297_278_961	227
1378	3300048904	Ga0496101_0000079	Ga0496101_0000079_36753_37436	227
1379	3300048904	Ga0496101_0008107	Ga0496101_0008107_2618_3301	227
1380	3300048904	Ga0496101_0040176	Ga0496101_0040176_1836_2519	227
1381	3300048904	Ga0496101_0042859	Ga0496101_0042859_537_1220	227
1382	3300048904	Ga0496101_0207438	Ga0496101_0207438_791_1474	227
1383	3300048905	Ga0496102_0000942	Ga0496102_0000942_4660_5343	227
1384	3300048905	Ga0496102_0008860	Ga0496102_0008860_2686_3369	227
1385	3300048905	Ga0496102_0032833	Ga0496102_0032833_3499_4182	227
1386	3300048905	Ga0496102_0045286	Ga0496102_0045286_1423_2106	227
1387	3300048905	Ga0496102_0058807	Ga0496102_0058807_2064_2747	227
1388	3300048905	Ga0496102_0062689	Ga0496102_0062689_886_1569	227
1389	3300048905	Ga0496102_0065998	Ga0496102_0065998_1226_1909	227
1390	3300048905	Ga0496102_0240279	Ga0496102_0240279_175_858	227
1391	3300048905	Ga0496102_0570034	Ga0496102_0570034_28_711	227
1392	3300048905	Ga0496102_0634479	Ga0496102_0634479_142_825	227
1393	3300048906	Ga0496103_0002375	Ga0496103_0002375_6398_7081	227
1394	3300048906	Ga0496103_0003062	Ga0496103_0003062_5614_6297	227
1395	3300048906	Ga0496103_0003997	Ga0496103_0003997_5431_6114	227
1396	3300048906	Ga0496103_0019249	Ga0496103_0019249_2322_3005	227
1397	3300048906	Ga0496103_0127351	Ga0496103_0127351_606_1289	227
1398	3300048906	Ga0496103_0181710	Ga0496103_0181710_454_1137	227
1399	3300048907	Ga0496104_0000431	Ga0496104_0000431_17628_18311	227
1400	3300048907	Ga0496104_0001836	Ga0496104_0001836_11275_11958	227
1401	3300048907	Ga0496104_0004143	Ga0496104_0004143_5795_6478	227
1402	3300048907	Ga0496104_0004953	Ga0496104_0004953_9498_10181	227
1403	3300048907	Ga0496104_0048661	Ga0496104_0048661_1425_2108	227
1404	3300048907	Ga0496104_0057612	Ga0496104_0057612_956_1639	227
1405	3300048907	Ga0496104_0119489	Ga0496104_0119489_683_1366	227
1406	3300048908	Ga0496105_0003143	Ga0496105_0003143_6504_7187	227
1407	3300048908	Ga0496105_0010944	Ga0496105_0010944_2990_3673	227
1408	3300048908	Ga0496105_0023618	Ga0496105_0023618_3153_3836	227
1409	3300048908	Ga0496105_0030941	Ga0496105_0030941_932_1615	227
1410	3300048908	Ga0496105_0106414	Ga0496105_0106414_1582_2265	227
1411	3300048908	Ga0496105_0198022	Ga0496105_0198022_440_1123	227
1412	3300048908	Ga0496105_0269708	Ga0496105_0269708_425_1108	227
1413	3300048908	Ga0496105_0482244	Ga0496105_0482244_38_721	227
1414	3300048909	Ga0496106_0001143	Ga0496106_0001143_2245_2928	227
1415	3300048909	Ga0496106_0003554	Ga0496106_0003554_6268_6951	227
1416	3300048909	Ga0496106_0005844	Ga0496106_0005844_4435_5118	227
1417	3300048909	Ga0496106_0006633	Ga0496106_0006633_6185_6868	227
1418	3300048909	Ga0496106_0020095	Ga0496106_0020095_2681_3364	227
1419	3300048909	Ga0496106_0045494	Ga0496106_0045494_2135_2818	227
1420	3300048909	Ga0496106_0161002	Ga0496106_0161002_846_1529	227
1421	3300048909	Ga0496106_0210718	Ga0496106_0210718_64_771	227
1422	3300048909	Ga0496106_0243728	Ga0496106_0243728_460_1143	227
1423	3300048909	Ga0496106_0263203	Ga0496106_0263203_241_924	227
1424	3300048910	Ga0496107_0000359	Ga0496107_0000359_3283_3966	227
1425	3300048910	Ga0496107_0000436	Ga0496107_0000436_19983_20666	227
1426	3300048910	Ga0496107_0001363	Ga0496107_0001363_8317_9000	227
1427	3300048910	Ga0496107_0015236	Ga0496107_0015236_2869_3552	227
1428	3300048910	Ga0496107_0031502	Ga0496107_0031502_2507_3190	227
1429	3300048910	Ga0496107_0426888	Ga0496107_0426888_54_737	227
1430	3300048910	Ga0496107_0641522	Ga0496107_0641522_43_726	227
1431	3300048911	Ga0496108_0002867	Ga0496108_0002867_7354_8037	227
1432	3300048911	Ga0496108_0004006	Ga0496108_0004006_8568_9251	227
1433	3300048911	Ga0496108_0005147	Ga0496108_0005147_2615_3298	227
1434	3300048911	Ga0496108_0009582	Ga0496108_0009582_2239_2922	227
1435	3300048911	Ga0496108_0014038	Ga0496108_0014038_617_1300	227
1436	3300048911	Ga0496108_0026663	Ga0496108_0026663_3312_3995	227
1437	3300048911	Ga0496108_0049594	Ga0496108_0049594_2275_2958	227
1438	3300048911	Ga0496108_0070596	Ga0496108_0070596_2071_2754	227
1439	3300048911	Ga0496108_0539247	Ga0496108_0539247_262_945	227
1440	3300048912	Ga0496109_0000223	Ga0496109_0000223_9108_9791	227
1441	3300048912	Ga0496109_0000404	Ga0496109_0000404_14415_15098	227
1442	3300048912	Ga0496109_0003116	Ga0496109_0003116_1146_1829	227
1443	3300048912	Ga0496109_0003557	Ga0496109_0003557_10174_10857	227
1444	3300048912	Ga0496109_0011617	Ga0496109_0011617_3984_4667	227
1445	3300048912	Ga0496109_0032437	Ga0496109_0032437_1415_2098	227
1446	3300048912	Ga0496109_0043419	Ga0496109_0043419_1682_2365	227
1447	3300048912	Ga0496109_0062763	Ga0496109_0062763_1667_2350	227
1448	3300048912	Ga0496109_0129345	Ga0496109_0129345_1577_2260	227
1449	3300048912	Ga0496109_0160862	Ga0496109_0160862_289_972	227
1450	3300048912	Ga0496109_0433724	Ga0496109_0433724_35_718	227
1451	3300048913	Ga0496110_0001910	Ga0496110_0001910_6798_7481	227
1452	3300048913	Ga0496110_0002394	Ga0496110_0002394_812_1495	227
1453	3300048913	Ga0496110_0003653	Ga0496110_0003653_3639_4322	227
1454	3300048913	Ga0496110_0016589	Ga0496110_0016589_789_1472	227
1455	3300048913	Ga0496110_0021793	Ga0496110_0021793_3161_3844	227
1456	3300048913	Ga0496110_0156603	Ga0496110_0156603_52_735	227
1457	3300048913	Ga0496110_0352580	Ga0496110_0352580_47_730	227
1458	3300048913	Ga0496110_0393332	Ga0496110_0393332_558_1241	227
1459	3300048914	Ga0496111_0002312	Ga0496111_0002312_5664_6347	227
1460	3300048914	Ga0496111_0010932	Ga0496111_0010932_5357_6040	227
1461	3300048914	Ga0496111_0019333	Ga0496111_0019333_2974_3657	227
1462	3300048914	Ga0496111_0031701	Ga0496111_0031701_1418_2101	227
1463	3300048914	Ga0496111_0042841	Ga0496111_0042841_2524_3207	227
1464	3300048914	Ga0496111_0052032	Ga0496111_0052032_1959_2642	227
1465	3300048914	Ga0496111_0224552	Ga0496111_0224552_107_790	227
1466	3300048915	Ga0496112_0002963	Ga0496112_0002963_8048_8731	227
1467	3300048915	Ga0496112_0003601	Ga0496112_0003601_7397_8080	227
1468	3300048915	Ga0496112_0011928	Ga0496112_0011928_4641_5324	227
1469	3300048915	Ga0496112_0013071	Ga0496112_0013071_5772_6455	227
1470	3300048915	Ga0496112_0016019	Ga0496112_0016019_598_1281	227
1471	3300048915	Ga0496112_0033447	Ga0496112_0033447_49_732	227
1472	3300048915	Ga0496112_0041430	Ga0496112_0041430_2347_3030	227
1473	3300048915	Ga0496112_0067614	Ga0496112_0067614_609_1292	227
1474	3300048916	Ga0496113_0000624	Ga0496113_0000624_47_730	227
1475	3300048916	Ga0496113_0001396	Ga0496113_0001396_9764_10447	227
1476	3300048916	Ga0496113_0001735	Ga0496113_0001735_6689_7372	227
1477	3300048916	Ga0496113_0019330	Ga0496113_0019330_3317_4000	227
1478	3300048916	Ga0496113_0024186	Ga0496113_0024186_654_1337	227
1479	3300048916	Ga0496113_0055173	Ga0496113_0055173_1836_2519	227
1480	3300048916	Ga0496113_0084102	Ga0496113_0084102_462_1145	227
1481	3300048916	Ga0496113_0194380	Ga0496113_0194380_593_1276	227
1482	3300048916	Ga0496113_0466813	Ga0496113_0466813_293_976	227
1483	3300048916	Ga0496113_0553775	Ga0496113_0553775_135_818	227
1484	3300048917	Ga0496114_0003222	Ga0496114_0003222_10155_10838	227
1485	3300048917	Ga0496114_0003326	Ga0496114_0003326_9962_10645	227
1486	3300048917	Ga0496114_0026647	Ga0496114_0026647_3970_4653	227
1487	3300048917	Ga0496114_0030663	Ga0496114_0030663_440_1123	227
1488	3300048917	Ga0496114_0104819	Ga0496114_0104819_298_981	227
1489	3300048918	Ga0496115_0000547	Ga0496115_0000547_8327_9010	227
1490	3300048918	Ga0496115_0008495	Ga0496115_0008495_2786_3469	227
1491	3300048918	Ga0496115_0269700	Ga0496115_0269700_411_1094	227
1492	3300048918	Ga0496115_0616009	Ga0496115_0616009_67_750	227
1493	3300049570	Ga0501033_0076983	Ga0501033_0076983_34_717	227
1494	3300049571	Ga0501034_0112807	Ga0501034_0112807_923_1606	227
1495	3300049571	Ga0501034_0418822	Ga0501034_0418822_427_1113	227
1496	3300049571	Ga0501034_0485901	Ga0501034_0485901_368_1051	227
1497	3300049572	Ga0501036_0027820	Ga0501036_0027820_97_780	227
1498	3300049572	Ga0501036_0364034	Ga0501036_0364034_170_853	227
1499	3300049574	Ga0501038_0196245	Ga0501038_0196245_673_1356	227
1500	3300049574	Ga0501038_0285339	Ga0501038_0285339_568_1251	227
1501	3300049575	Ga0501039_0092711	Ga0501039_0092711_717_1400	227
1502	3300049575	Ga0501039_0435483	Ga0501039_0435483_291_974	227
1503	3300049575	Ga0501039_0517843	Ga0501039_0517843_234_917	227
1504	3300049576	Ga0501040_0100563	Ga0501040_0100563_519_1202	227
1505	3300049578	Ga0501042_0248800	Ga0501042_0248800_275_958	227
1506	3300049579	Ga0501043_0017209	Ga0501043_0017209_1033_1716	227
1507	3300049581	Ga0501047_0038971	Ga0501047_0038971_660_1343	227
1508	3300049581	Ga0501047_0252772	Ga0501047_0252772_129_815	227
1509	3300049581	Ga0501047_0534621	Ga0501047_0534621_203_886	227
1510	3300049582	Ga0501048_0165489	Ga0501048_0165489_525_1208	227
1511	3300049584	Ga0501068_0015903	Ga0501068_0015903_2473_3156	227
1512	3300049584	Ga0501068_0297176	Ga0501068_0297176_17_700	227
1513	3300049586	Ga0501070_0019024	Ga0501070_0019024_858_1541	227
1514	3300049586	Ga0501070_0084044	Ga0501070_0084044_93_776	227
1515	3300049587	Ga0501071_0049958	Ga0501071_0049958_183_866	227
1516	3300049587	Ga0501071_0285310	Ga0501071_0285310_542_1225	227
1517	3300049588	Ga0501072_0002712	Ga0501072_0002712_515_1198	227
1518	3300049588	Ga0501072_0334990	Ga0501072_0334990_283_966	227
1519	3300049589	Ga0501073_0033637	Ga0501073_0033637_1107_1790	227
1520	3300049589	Ga0501073_0135204	Ga0501073_0135204_998_1681	227
1521	3300049591	Ga0501075_0083915	Ga0501075_0083915_927_1610	227
1522	3300049592	Ga0501076_0062530	Ga0501076_0062530_1385_2068	227
1523	3300049593	Ga0501077_0018282	Ga0501077_0018282_776_1459	227
1524	3300049593	Ga0501077_0342582	Ga0501077_0342582_22_705	227
1525	3300049741	Ga0501079_0087588	Ga0501079_0087588_327_1010	227
1526	3300049741	Ga0501079_0152376	Ga0501079_0152376_362_1045	227
1527	3300049741	Ga0501079_0232621	Ga0501079_0232621_131_814	227
1528	3300049742	Ga0501080_0235329	Ga0501080_0235329_678_1361	227
1529	3300049742	Ga0501080_0239470	Ga0501080_0239470_203_886	227
1530	3300049742	Ga0501080_0266948	Ga0501080_0266948_57_740	227
1531	3300049743	Ga0501081_0245361	Ga0501081_0245361_537_1220	227
1532	3300049822	Ga0501035_0001940	Ga0501035_0001940_16794_17477	227
1533	3300049822	Ga0501035_0061568	Ga0501035_0061568_407_1090	227
1534	3300049823	Ga0501044_0063861	Ga0501044_0063861_1860_2543	227
1535	3300049823	Ga0501044_0065573	Ga0501044_0065573_2258_2941	227
1536	3300049823	Ga0501044_0145089	Ga0501044_0145089_1386_2069	227
1537	3300049823	Ga0501044_0387481	Ga0501044_0387481_438_1121	227
1538	3300049824	Ga0501045_0212135	Ga0501045_0212135_692_1375	227
1539	3300049824	Ga0501045_0341272	Ga0501045_0341272_350_1033	227
1540	3300050489	nmdc:mga03683_29136_c1	nmdc:mga03683_29136_c1_1298_1981	227
1541	3300050491	nmdc:mga00v17_135626_c1	nmdc:mga00v17_135626_c1_53_736	227
1542	3300050492	nmdc:mga0yw44_1437_c1	nmdc:mga0yw44_1437_c1_4767_5450	227
1543	3300050492	nmdc:mga0yw44_480014_c1	nmdc:mga0yw44_480014_c1_28_711	227
1544	3300050492	nmdc:mga0yw44_9426_c1	nmdc:mga0yw44_9426_c1_552_1238	227
1545	3300050494	nmdc:mga06z11_23264_c1	nmdc:mga06z11_23264_c1_256_939	227
1546	3300050494	nmdc:mga06z11_25302_c1	nmdc:mga06z11_25302_c1_1773_2456	227
1547	3300050507	nmdc:mga05p37_36596_c1	nmdc:mga05p37_36596_c1_3366_4049	227
1548	3300050507	nmdc:mga05p37_775316_c1	nmdc:mga05p37_775316_c1_117_800	227
1549	3300050507	nmdc:mga05p37_884548_c1	nmdc:mga05p37_884548_c1_258_941	227
1550	3300050508	nmdc:mga09592_84725_c1	nmdc:mga09592_84725_c1_1654_2337	227
1551	3300050509	nmdc:mga0qj67_18_c1	nmdc:mga0qj67_18_c1_30833_31516	227
1552	3300050509	nmdc:mga0qj67_563395_c1	nmdc:mga0qj67_563395_c1_160_843	227
1553	3300050510	nmdc:mga06r32_100936_c1	nmdc:mga06r32_100936_c1_1740_2423	227
1554	3300050510	nmdc:mga06r32_64510_c1	nmdc:mga06r32_64510_c1_1290_1973	227
1555	3300050511	nmdc:mga08y16_110772_c1	nmdc:mga08y16_110772_c1_2066_2749	227
1556	3300050511	nmdc:mga08y16_226164_c1	nmdc:mga08y16_226164_c1_1206_1889	227
1557	3300050511	nmdc:mga08y16_319526_c1	nmdc:mga08y16_319526_c1_772_1455	227
1558	3300050511	nmdc:mga08y16_468887_c1	nmdc:mga08y16_468887_c1_295_978	227
1559	3300050511	nmdc:mga08y16_939725_c1	nmdc:mga08y16_939725_c1_124_807	227
1560	3300050512	nmdc:mga0n895_1039522_c1	nmdc:mga0n895_1039522_c1_63_746	227
1561	3300050512	nmdc:mga0n895_330737_c1	nmdc:mga0n895_330737_c1_305_988	227
1562	3300050512	nmdc:mga0n895_35380_c1	nmdc:mga0n895_35380_c1_1615_2298	227
1563	3300050512	nmdc:mga0n895_52081_c1	nmdc:mga0n895_52081_c1_2513_3196	227
1564	3300050512	nmdc:mga0n895_622_c1	nmdc:mga0n895_622_c1_1989_2672	227
1565	3300050512	nmdc:mga0n895_64950_c2	nmdc:mga0n895_64950_c2_754_1437	227
1566	3300050512	nmdc:mga0n895_946020_c1	nmdc:mga0n895_946020_c1_23_706	227
1567	3300050513	nmdc:mga0rr50_221431_c1	nmdc:mga0rr50_221431_c1_231_914	227
1568	3300050513	nmdc:mga0rr50_259688_c1	nmdc:mga0rr50_259688_c1_55_738	227
1569	3300050513	nmdc:mga0rr50_50061_c1	nmdc:mga0rr50_50061_c1_1868_2551	227
1570	3300050514	nmdc:mga08x19_38629_c1	nmdc:mga08x19_38629_c1_163_846	227
1571	3300050515	nmdc:mga0a205_27052_c1	nmdc:mga0a205_27052_c1_2490_3173	227
1572	3300050515	nmdc:mga0a205_368579_c1	nmdc:mga0a205_368579_c1_473_1156	227
1573	3300050515	nmdc:mga0a205_7768_c1	nmdc:mga0a205_7768_c1_6072_6755	227
1574	3300053077	Ga0495601_0001750	Ga0495601_0001750_8312_8998	227
1575	3300053077	Ga0495601_0002382	Ga0495601_0002382_4388_5071	227
1576	3300053077	Ga0495601_0017376	Ga0495601_0017376_2162_2845	227
1577	3300053077	Ga0495601_0025698	Ga0495601_0025698_2370_3053	227
1578	3300053077	Ga0495601_0063960	Ga0495601_0063960_1342_2025	227
1579	3300053077	Ga0495601_0120741	Ga0495601_0120741_835_1518	227
1580	3300053077	Ga0495601_0153457	Ga0495601_0153457_601_1284	227
1581	3300053078	Ga0495612_0008869	Ga0495612_0008869_1782_2465	227
1582	3300053078	Ga0495612_0010274	Ga0495612_0010274_353_1036	227
1583	3300053078	Ga0495612_0043535	Ga0495612_0043535_829_1512	227
1584	3300053078	Ga0495612_0064139	Ga0495612_0064139_749_1432	227
1585	3300053083	Ga0495655_0008381	Ga0495655_0008381_964_1647	227
1586	3300053084	Ga0495595_0000576	Ga0495595_0000576_5214_5897	227
1587	3300053084	Ga0495595_0004751	Ga0495595_0004751_2750_3433	227
1588	3300053084	Ga0495595_0032435	Ga0495595_0032435_125_808	227
1589	3300053084	Ga0495595_0037073	Ga0495595_0037073_1494_2177	227
1590	3300053084	Ga0495595_0090029	Ga0495595_0090029_27_710	227
1591	3300053085	Ga0495619_0000132	Ga0495619_0000132_21406_22092	227
1592	3300053085	Ga0495619_0000178	Ga0495619_0000178_5675_6358	227
1593	3300053085	Ga0495619_0011281	Ga0495619_0011281_580_1263	227
1594	3300053085	Ga0495619_0031232	Ga0495619_0031232_1409_2092	227
1595	3300053085	Ga0495619_0037425	Ga0495619_0037425_29_712	227
1596	3300053085	Ga0495619_0037480	Ga0495619_0037480_580_1263	227
1597	3300053085	Ga0495619_0055466	Ga0495619_0055466_443_1126	227
1598	3300053085	Ga0495619_0249010	Ga0495619_0249010_357_1040	227
1599	3300060353	Ga0501082_0077631	Ga0501082_0077631_156_839	227
1600	3300060353	Ga0501082_0155815	Ga0501082_0155815_317_1000	227
1601	3300060353	Ga0501082_0156230	Ga0501082_0156230_1220_1903	227
1602	3300060353	Ga0501082_0259839	Ga0501082_0259839_719_1402	227
1603	3300061734	Ga0530510_0340487	Ga0530510_0340487_210_950	227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00814

TsaD

tRNA N6-adenosine threonylcarbamoyltransferase

52

203

0.9 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6nak-assembly1.cif.gz_C	bacterial protein complex tm bde complex	0.8642	1	198
2a6a-assembly1.cif.gz_A	crystal structure of glycoprotein endopeptidase (tm0874) from thermotoga maritima at 2.50 a resolution	0.858	1	198
3r6m-assembly2.cif.gz_C	crystal structure of vibrio parahaemolyticus yeaz	0.8432	1	198
4y0w-assembly1.cif.gz_D-2	yeaz from pseudomonas aeruginosa	0.8207	1	198
4y0w-assembly1.cif.gz_E-2	yeaz from pseudomonas aeruginosa	0.8176	1	210

ID	Description	Score	Start	End	Superfamily
af_P76256_2_102_3.30.420.40	Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain	0.9396	2	97	3.30.420.40
5br9C01	Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain	0.9391	2	96	3.30.420.40
af_Q2FWL0_1_92_3.30.420.40	Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain	0.9254	1	94	3.30.420.40
af_Q2FWL0_1_92_3.30.420.40	Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain	0.9159	1	94	3.30.420.40
3zeuB01	Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain	0.9139	1	100	3.30.420.40

ID	Description	Score	Start	End	GO Terms
AF-A0A382ESK2-F1-model_v4	Gcp-like domain-containing protein	0.9452	1	97	GO:0002949 GO:0005829
AF-A0A7Y3ELP6-F1-model_v4	tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	0.9389	1	100	GO:0002949 GO:0005829 GO:0016740
AF-A0A5E6NHC8-F1-model_v4	tRNA threonylcarbamoyladenosine biosynthesis protein TsaB (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaB)	0.9369	1	96	GO:0002949
AF-A0A1Q6UYR5-F1-model_v4	tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	0.9347	1	98	GO:0002949 GO:0005829 GO:0016740
AF-A0A4V5SEI4-F1-model_v4	deleted	0.9341	1	96

Feature Viewer

pLDDT	pTM	Quality
89.32	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F495003

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00814

TsaD

tRNA N6-adenosine threonylcarbamoyltransferase

52

203

0.9

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map