F495002

General Info

Members Datasets Scaffolds Average Seq Length
1602 660 1397 314

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|640427133|640488419
Length 362
Sequence DVRGYARWTPAGRHEFGWTVVRTAHRLNGLILLGQGLPMSRIYADNARSIGNTPLVMINRLGPKGVSIMAKIEGRNPAYSVKCRIGAGMIWDAEDSGRIKPGMTLVEPTSGNTGIGLAFVAAARGYKLMLTMPASMSLERRKVLKALGAELVLTEPAKGMKGAIEKAAEIAASNPEQYYMPQQFENPSNPAIHEKTTGPEIWNDTDGGIDVLVAGVGTGGTITGVSRYIKNTKGKQILSVAVEPASSPVISQTLAGEEVKPSPHKIQGIGAGFVPKNLDLSMVDRVELVDDNEAKQMALRLMREEGILCGISCGAAMAAAVRLAERPEMQGKNIVVILPDSGERYLSSMLFSDMFSEQELVQ

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
4 2506520008 Serratia plymuthica AS12 Isolate Unclassified
5 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
6 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
7 2511231004 Pseudomonas sp. GM102 Isolate Nodule
8 2511231007 Pseudomonas sp. GM18 Isolate Nodule
9 2511231011 Pseudomonas sp. GM30 Isolate Nodule
10 2511231016 Pseudomonas sp. GM50 Isolate Nodule
11 2511231018 Pseudomonas sp. GM60 Isolate Nodule
12 2511231019 Pseudomonas sp. GM67 Isolate Nodule
13 2511231022 Pseudomonas sp. GM79 Isolate Nodule
14 2511231024 Pseudomonas sp. GM84 Isolate Nodule
15 2527291627 Frankia casuarinae Thr Isolate Nodule
16 2527291629 Frankia sp. BMG5.23 Isolate Nodule
17 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
18 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
19 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
20 2547132512 Azospira oryzae 6a3 Isolate Unclassified
21 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
22 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
23 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
24 2576861822 Frankia sp. CeD Isolate Nodule
25 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
26 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
27 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
28 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
29 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
30 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
31 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
32 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
33 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
34 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
35 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
36 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
37 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
38 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
39 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
40 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
41 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
42 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
43 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
44 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
45 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
46 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
47 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
48 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
49 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
50 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
51 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
52 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
53 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
54 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
55 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
56 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
57 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
58 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
59 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
60 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
61 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
62 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
63 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
64 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
65 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
66 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
67 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
68 2626541554 Frankia sp. AvcI.1 Isolate Nodule
69 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
70 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
71 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
72 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
73 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
74 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
75 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
76 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
77 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
78 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
79 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
80 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
81 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
82 2684623036 Frankia sp. CgIM4 Isolate Nodule
83 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
84 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
85 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
86 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
87 2710264753 Frankia sp. KB5 Isolate Nodule
88 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
89 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
90 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
91 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
92 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
93 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
94 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
95 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
96 2765235841 Pseudomonas putida AA7 Isolate Unclassified
97 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
98 2773857670 Pseudomonas sp. 478 Isolate Unclassified
99 2773857673 Pseudomonas sp. 443 Isolate Unclassified
100 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
101 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
102 2773857924 Frankia sp. CgIS1 Isolate Nodule
103 2784132063 Pseudomonas sp. 424 Isolate Unclassified
104 2784132072 Pseudomonas sp. 460 Isolate Unclassified
105 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
106 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
107 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
108 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
109 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
110 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
111 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
112 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
113 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
114 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
115 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
116 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
117 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
118 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
119 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
120 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
121 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
122 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
123 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
124 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
125 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
126 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
127 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
128 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
129 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
130 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
131 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
132 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
133 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
134 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
135 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
136 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
137 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
138 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
139 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
140 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
141 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
142 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
143 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
144 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
145 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
146 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
147 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
148 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
149 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
150 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
151 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
152 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
153 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
154 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
155 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
156 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
157 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
158 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
159 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
160 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
161 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
162 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
163 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
164 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
165 2932406140 Serratia sp. 2723 Isolate Rhizosphere
166 2937967321 Serratia sp. YC16 Isolate Unclassified
167 2939577877 Serratia sp. 509 Isolate Rhizosphere
168 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
169 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
170 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
171 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
172 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
173 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
174 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
175 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
176 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
177 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
178 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
179 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
180 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
181 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
182 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
183 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
184 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
185 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
186 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
187 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
188 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
189 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
190 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
191 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
192 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
193 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
194 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
195 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
196 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
197 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
198 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
199 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
200 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
201 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
202 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
203 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
204 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
205 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
206 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
207 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
208 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
209 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
210 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
211 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
212 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
213 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
214 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
215 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
216 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
217 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
218 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
219 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
220 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
221 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
222 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
223 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
224 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
225 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
226 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
227 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
228 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
229 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
230 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
231 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
232 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
233 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
234 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
235 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
236 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
237 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
238 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
239 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
240 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
241 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
242 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
243 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
244 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
245 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
246 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
247 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
248 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
249 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
250 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
251 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
252 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
253 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
254 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
255 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
256 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
257 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
258 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
259 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
260 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
261 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
262 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
263 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
264 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
265 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
266 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
267 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
268 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
269 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
270 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
271 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
272 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
273 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
274 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
275 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
276 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
277 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
278 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
279 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
280 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
281 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
282 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
283 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
284 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
285 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
286 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
287 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
288 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
289 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
290 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
291 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
292 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
293 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
294 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
295 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
296 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
297 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
298 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
299 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
300 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
301 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
302 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
307 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
308 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
309 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
310 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
311 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
312 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
313 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
314 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
315 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
316 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
317 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
364 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
365 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
366 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
367 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
368 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
369 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
370 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
371 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
372 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
373 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
374 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
378 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
379 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
380 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
381 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
382 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
383 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
384 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
385 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
386 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
387 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
388 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
389 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
390 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
394 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
395 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
396 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
397 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
398 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
399 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
400 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
401 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
402 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
403 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
404 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
405 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
406 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
407 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
408 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
409 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
410 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
411 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
412 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
413 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
414 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
415 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
416 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
417 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
418 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
419 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
420 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
421 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
422 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
425 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
426 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
427 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
428 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
429 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
430 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
431 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
432 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
433 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
434 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
435 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
436 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
437 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
438 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
439 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
440 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
441 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
442 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
443 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
444 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
445 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
446 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
447 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
448 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
449 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
450 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
451 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
452 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
453 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
454 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
455 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
456 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
457 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
458 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
459 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
460 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
461 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
462 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
463 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
464 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
465 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
466 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
467 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
468 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
469 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
470 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
471 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
472 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
473 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
474 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
475 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
476 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
477 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
478 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
479 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
480 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
481 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
482 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
483 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
484 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
485 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
486 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
487 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
488 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
489 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
490 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
491 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
492 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
493 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
494 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
495 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
496 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
497 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
498 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
499 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
500 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
501 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
502 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
503 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
504 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
505 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
506 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
507 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
508 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
509 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
510 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
511 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
512 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
513 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
514 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
515 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
516 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
517 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
518 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
519 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
520 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
521 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
522 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
523 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
524 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
525 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
526 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
527 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
528 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
529 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
530 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
531 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
532 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
533 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
534 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
535 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
536 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
537 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
538 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
539 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
540 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
541 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
542 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
543 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
544 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
545 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
546 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
547 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
548 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
549 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
550 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
551 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
552 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
553 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
554 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
555 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
556 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
557 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
558 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
559 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
560 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
561 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
562 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
563 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
564 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
565 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
566 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
567 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
568 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
569 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
570 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
571 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
572 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
573 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
574 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
575 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
576 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
577 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
578 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
579 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
580 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
581 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
582 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
583 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
584 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
585 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
586 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
587 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
588 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
589 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
590 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
591 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
592 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
593 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
594 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
595 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
596 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
597 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
598 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
599 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
600 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
601 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
602 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
603 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
604 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
605 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
606 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
607 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
608 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
609 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
610 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
611 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
612 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
613 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
614 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
615 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
616 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
617 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
618 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
619 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
620 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
621 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
622 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
623 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
624 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
625 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
626 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
627 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
628 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
629 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
630 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
631 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
632 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
633 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
634 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
635 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
636 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
637 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
638 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
639 637000116 Frankia casuarinae CcI3 Isolate Nodule
640 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
641 640753048 Serratia proteamaculans 568 Isolate Endosphere
642 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
643 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
644 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
645 8004592986 Serratia sp. S119 Isolate Unclassified
646 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
647 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
648 8052494512 Pseudomonas putida LD6 Isolate Unclassified
649 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
650 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
651 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
652 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
653 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
654 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
655 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
656 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
657 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
658 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
659 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
660 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.08
Metatranscriptomes 1.31
Isolates 12.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.06
Bulb 0
Endosphere 2.25
Nodule 1.69
Rhizoplane 4.06
Rhizosphere 81.77
Stem 0
Stem Tuber 0.37
Unclassified 9.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_6404 2124908027 Bacteria 7500
2 MRS2a_Contig_914 2124908027 Bacteria 8140
3 SwRhRL2b_contig_2277002 2162886007 Bacteria 2239
4 JGI25162J39368_1000100 3300002737 Bacteria 94568
5 JGI25163J39215_1000894 3300002771 Bacteria 6912
6 JGI25164J39214_1000079 3300002772 Bacteria 94568
7 JGI25165J46597_1000183 3300003214 Bacteria 94568
8 Ga0055538_1000078 3300003751 Bacteria 86114
9 Ga0055539_1000119 3300003752 Bacteria 86114
10 Ga0055533_1000127 3300003756 Bacteria 86114
11 Ga0055532_1000068 3300003758 Bacteria 138828
12 Ga0055525_1000163 3300003759 Bacteria 86114
13 Ga0055536_1016854 3300003781 Bacteria 2420
14 Ga0055541_1000079 3300003841 Bacteria 86114
15 Ga0058692_1000067 3300003856 Bacteria 88996
16 Ga0058692_1000911 3300003856 Bacteria 11646
17 Ga0058692_1017134 3300003856 Bacteria 1595
18 Ga0065714_10001613 3300005288 Bacteria 5331
19 Ga0065714_10067998 3300005288 Bacteria 5045
20 Ga0065704_10003637 3300005289 Bacteria 4069
21 Ga0065704_10006591 3300005289 Bacteria 4786
22 Ga0065712_10002299 3300005290 Bacteria 6611
23 Ga0065715_10005136 3300005293 Bacteria 3683
24 Ga0070658_10077856 3300005327 Bacteria 2720
25 Ga0070683_100022822 3300005329 Bacteria 5597
26 Ga0070683_100025908 3300005329 Bacteria 5274
27 Ga0070683_100043891 3300005329 Bacteria 4121
28 Ga0070683_100063164 3300005329 Bacteria 3444
29 Ga0070683_100065855 3300005329 Bacteria 3374
30 Ga0070683_100100147 3300005329 Unclassified 2728
31 Ga0070683_100128431 3300005329 Bacteria 2397
32 Ga0070683_100318770 3300005329 Bacteria 1479
33 Ga0070690_100190414 3300005330 Bacteria 1422
34 Ga0070670_100000018 3300005331 Bacteria 221691
35 Ga0070670_100135408 3300005331 Bacteria 2129
36 Ga0068869_100135873 3300005334 Bacteria 1894
37 Ga0070682_100039334 3300005337 Bacteria 2906
38 Ga0068868_100031941 3300005338 Bacteria 4047
39 Ga0070660_100017653 3300005339 Bacteria 5203
40 Ga0070691_10001552 3300005341 Bacteria 9903
41 Ga0070691_10012197 3300005341 Bacteria 3936
42 Ga0070661_100192544 3300005344 Bacteria 1556
43 Ga0070668_100375171 3300005347 Bacteria 1209
44 Ga0070669_100000954 3300005353 Bacteria 21107
45 Ga0070675_100092910 3300005354 Bacteria 2530
46 Ga0070671_100000084 3300005355 Bacteria 59737
47 Ga0070671_100249178 3300005355 Bacteria 1509
48 Ga0070688_100000916 3300005365 Bacteria 14728
49 Ga0070659_100012188 3300005366 Bacteria 6372
50 Ga0070667_100000002 3300005367 Bacteria 504831
51 Ga0070714_100038188 3300005435 Bacteria 4038
52 Ga0070714_100042300 3300005435 Bacteria 3849
53 Ga0070714_100047786 3300005435 Bacteria 3637
54 Ga0070714_100096603 3300005435 Bacteria 2596
55 Ga0070714_100222041 3300005435 Bacteria 1737
56 Ga0070713_100013534 3300005436 Bacteria 6029
57 Ga0070713_100017674 3300005436 Bacteria 5402
58 Ga0070713_100049646 3300005436 Bacteria 3462
59 Ga0070713_100436349 3300005436 Bacteria 1228
60 Ga0070710_10103815 3300005437 Bacteria 1697
61 Ga0070711_100016406 3300005439 Bacteria 4704
62 Ga0070711_100079683 3300005439 Bacteria 2330
63 Ga0070708_100168989 3300005445 Bacteria 2041
64 Ga0070708_100182915 3300005445 Bacteria 1959
65 Ga0070663_100328580 3300005455 Bacteria 1232
66 Ga0070678_100259453 3300005456 Bacteria 1461
67 Ga0070662_100326916 3300005457 Bacteria 1252
68 Ga0070681_10013442 3300005458 Bacteria 8134
69 Ga0070681_10031212 3300005458 Bacteria 5347
70 Ga0070681_10107898 3300005458 Bacteria 2725
71 Ga0070681_10146899 3300005458 Bacteria 2286
72 Ga0070685_10000009 3300005466 Bacteria 166260
73 Ga0070706_100001466 3300005467 Bacteria 24814
74 Ga0070706_100325542 3300005467 Bacteria 1433
75 Ga0070707_100005111 3300005468 Bacteria 12300
76 Ga0070707_100061755 3300005468 Bacteria 3594
77 Ga0070699_100184904 3300005518 Bacteria 1850
78 Ga0070699_100191326 3300005518 Bacteria 1818
79 Ga0070679_100003415 3300005530 Bacteria 14542
80 Ga0070679_100070265 3300005530 Bacteria 3493
81 Ga0070679_100198544 3300005530 Bacteria 1973
82 Ga0070679_100255785 3300005530 Bacteria 1707
83 Ga0070684_100002254 3300005535 Bacteria 14182
84 Ga0070684_100060988 3300005535 Bacteria 3300
85 Ga0070684_100079773 3300005535 Bacteria 2894
86 Ga0070684_100128047 3300005535 Bacteria 2289
87 Ga0070684_100208463 3300005535 Bacteria 1781
88 Ga0070684_100240764 3300005535 Bacteria 1653
89 Ga0068853_100013136 3300005539 Bacteria 6758
90 Ga0068853_100042324 3300005539 Bacteria 3894
91 Ga0070696_100000147 3300005546 Bacteria 39206
92 Ga0070696_100004865 3300005546 Bacteria 8975
93 Ga0070665_100004663 3300005548 Bacteria 14320
94 Ga0070665_100060824 3300005548 Bacteria 3786
95 Ga0070665_100083206 3300005548 Bacteria 3205
96 Ga0068855_100004962 3300005563 Bacteria 16231
97 Ga0068855_100015449 3300005563 Bacteria 9191
98 Ga0068855_100390540 3300005563 Bacteria 1526
99 Ga0070664_100145049 3300005564 Bacteria 2093
100 Ga0070664_100267301 3300005564 Bacteria 1540
101 Ga0068857_100000451 3300005577 Bacteria 29292
102 Ga0068857_100006173 3300005577 Bacteria 10245
103 Ga0068857_100039946 3300005577 Bacteria 4159
104 Ga0068856_100000957 3300005614 Bacteria 30820
105 Ga0068856_100045631 3300005614 Bacteria 4316
106 Ga0068856_100144072 3300005614 Bacteria 2390
107 Ga0068852_100005614 3300005616 Bacteria 9000
108 Ga0068852_100012657 3300005616 Bacteria 6416
109 Ga0068864_100000002 3300005618 Bacteria 658857
110 Ga0068863_100132291 3300005841 Bacteria 2382
111 Ga0068858_100012945 3300005842 Bacteria 7867
112 Ga0068858_100033049 3300005842 Bacteria 4805
113 Ga0068858_100117640 3300005842 Bacteria 2484
114 Ga0068858_100136070 3300005842 Bacteria 2305
115 Ga0068858_100162062 3300005842 Bacteria 2106
116 Ga0068860_100000499 3300005843 Bacteria 48692
117 Ga0068862_100005568 3300005844 Bacteria 10522
118 Ga0081455_10032641 3300005937 Bacteria 4689
119 Ga0070717_10307513 3300006028 Bacteria 1410
120 Ga0075366_10038768 3300006195 Bacteria 2814
121 Ga0097621_100061966 3300006237 Bacteria 3069
122 Ga0068871_100013774 3300006358 Bacteria 6012
123 Ga0068871_100137250 3300006358 Bacteria 2078
124 Ga0068871_100205207 3300006358 Bacteria 1703
125 Ga0075428_100050306 3300006844 Bacteria 4571
126 Ga0075436_100004138 3300006914 Bacteria 9955
127 Ga0097620_100173920 3300006931 Bacteria 2235
128 Ga0099823_1000074 3300006944 Bacteria 48327
129 Ga0099823_1063482 3300006944 Bacteria 1843
130 Ga0079104_1001016 3300006946 Bacteria 21709
131 Ga0079104_1001936 3300006946 Bacteria 12328
132 Ga0079104_1012482 3300006946 Bacteria 2666
133 Ga0079104_1029289 3300006946 Bacteria 1388
134 Ga0105251_10000653 3300009011 Bacteria 31977
135 Ga0105251_10003325 3300009011 Bacteria 11738
136 Ga0105251_10005450 3300009011 Bacteria 8309
137 Ga0105251_10013205 3300009011 Bacteria 4630
138 Ga0105251_10023484 3300009011 Bacteria 3182
139 Ga0105251_10026906 3300009011 Bacteria 2923
140 Ga0105251_10029981 3300009011 Bacteria 2735
141 Ga0105251_10033879 3300009011 Bacteria 2531
142 Ga0105251_10035079 3300009011 Bacteria 2477
143 Ga0105251_10048767 3300009011 Bacteria 2029
144 Ga0105244_10000248 3300009036 Bacteria 55384
145 Ga0105244_10000274 3300009036 Bacteria 51929
146 Ga0105244_10002675 3300009036 Bacteria 13334
147 Ga0105244_10009787 3300009036 Bacteria 5855
148 Ga0105244_10010093 3300009036 Bacteria 5751
149 Ga0105244_10015761 3300009036 Bacteria 4327
150 Ga0105244_10033838 3300009036 Bacteria 2693
151 Ga0105244_10035696 3300009036 Bacteria 2610
152 Ga0105244_10035795 3300009036 Bacteria 2605
153 Ga0105244_10035887 3300009036 Bacteria 2602
154 Ga0105250_10013939 3300009092 Bacteria 3310
155 Ga0105250_10018481 3300009092 Bacteria 2823
156 Ga0105250_10021791 3300009092 Bacteria 2585
157 Ga0105250_10022369 3300009092 Bacteria 2550
158 Ga0105250_10034542 3300009092 Bacteria 2029
159 Ga0105250_10034581 3300009092 Bacteria 2028
160 Ga0105240_10002636 3300009093 Bacteria 28586
161 Ga0105240_10003683 3300009093 Bacteria 23696
162 Ga0105240_10005123 3300009093 Bacteria 19605
163 Ga0105240_10005449 3300009093 Bacteria 18962
164 Ga0105240_10007191 3300009093 Bacteria 16213
165 Ga0105240_10026186 3300009093 Bacteria 7652
166 Ga0105240_10047714 3300009093 Bacteria 5418
167 Ga0105240_10054350 3300009093 Bacteria 5018
168 Ga0105240_10074490 3300009093 Bacteria 4190
169 Ga0105240_10184676 3300009093 Bacteria 2457
170 Ga0105240_10251119 3300009093 Bacteria 2045
171 Ga0105240_10308746 3300009093 Bacteria 1807
172 Ga0105240_10759923 3300009093 Bacteria 1053
173 Ga0111539_10008365 3300009094 Bacteria 13165
174 Ga0111539_10016907 3300009094 Bacteria 9030
175 Ga0111539_10119867 3300009094 Bacteria 3083
176 Ga0111539_10187945 3300009094 Bacteria 2411
177 Ga0105245_10000694 3300009098 Bacteria 30357
178 Ga0105245_10373911 3300009098 Bacteria 1417
179 Ga0105245_10434957 3300009098 Bacteria 1318
180 Ga0105245_10477401 3300009098 Bacteria 1259
181 Ga0105247_10000176 3300009101 Bacteria 62687
182 Ga0105247_10004537 3300009101 Bacteria 8851
183 Ga0114129_10002078 3300009147 Bacteria 27546
184 Ga0105243_10000263 3300009148 Bacteria 59080
185 Ga0105243_10023492 3300009148 Bacteria 4695
186 Ga0105241_10000001 3300009174 Bacteria 879793
187 Ga0105241_10007966 3300009174 Bacteria 7793
188 Ga0105241_10043069 3300009174 Bacteria 3418
189 Ga0105241_10091320 3300009174 Bacteria 2402
190 Ga0105241_10164967 3300009174 Bacteria 1824
191 Ga0105241_10248325 3300009174 Bacteria 1507
192 Ga0105242_10015261 3300009176 Bacteria 5967
193 Ga0105242_10026595 3300009176 Bacteria 4586
194 Ga0105242_10089909 3300009176 Bacteria 2582
195 Ga0105242_10146764 3300009176 Bacteria 2053
196 Ga0105242_10263249 3300009176 Bacteria 1559
197 Ga0105248_10006442 3300009177 Bacteria 12880
198 Ga0105248_10006574 3300009177 Bacteria 12746
199 Ga0105248_10029592 3300009177 Bacteria 6110
200 Ga0105248_10460787 3300009177 Bacteria 1433
201 Ga0105248_10739221 3300009177 Bacteria 1110
202 Ga0105237_10008345 3300009545 Bacteria 11231
203 Ga0105237_10008700 3300009545 Bacteria 10965
204 Ga0105237_10016948 3300009545 Bacteria 7558
205 Ga0105237_10149607 3300009545 Bacteria 2331
206 Ga0105238_10000238 3300009551 Bacteria 61471
207 Ga0105238_10001852 3300009551 Bacteria 21198
208 Ga0105238_10006092 3300009551 Bacteria 11962
209 Ga0105238_10008661 3300009551 Bacteria 10181
210 Ga0105238_10091092 3300009551 Bacteria 3037
211 Ga0105238_10093299 3300009551 Bacteria 2998
212 Ga0105238_10117899 3300009551 Bacteria 2635
213 Ga0105238_10121358 3300009551 Bacteria 2593
214 Ga0105238_10181828 3300009551 Bacteria 2079
215 Ga0105249_10012651 3300009553 Bacteria 7441
216 Ga0099796_10027099 3300010159 Bacteria 1827
217 Ga0105246_10005750 3300011119 Bacteria 7566
218 Ga0105246_10025988 3300011119 Bacteria 3819
219 Ga0105246_10087869 3300011119 Bacteria 2232
220 Ga0157373_10000593 3300013100 Bacteria 28147
221 Ga0157373_10003913 3300013100 Bacteria 11243
222 Ga0157373_10016161 3300013100 Bacteria 5448
223 Ga0157373_10028452 3300013100 Bacteria 4032
224 Ga0157371_10000497 3300013102 Bacteria 47594
225 Ga0157371_10015917 3300013102 Bacteria 5627
226 Ga0157371_10078133 3300013102 Bacteria 2344
227 Ga0157371_10215321 3300013102 Bacteria 1379
228 Ga0157370_10001630 3300013104 Bacteria 27714
229 Ga0157370_10006826 3300013104 Bacteria 12512
230 Ga0157370_10007129 3300013104 Bacteria 12195
231 Ga0157370_10025437 3300013104 Bacteria 5859
232 Ga0157370_10028766 3300013104 Bacteria 5464
233 Ga0157370_10039334 3300013104 Bacteria 4571
234 Ga0157370_10093954 3300013104 Bacteria 2814
235 Ga0157370_10199378 3300013104 Bacteria 1857
236 Ga0157369_10009351 3300013105 Bacteria 11208
237 Ga0157369_10015015 3300013105 Bacteria 8740
238 Ga0157369_10032457 3300013105 Bacteria 5742
239 Ga0157369_10128690 3300013105 Bacteria 2684
240 Ga0157369_10131266 3300013105 Bacteria 2654
241 Ga0157369_10285226 3300013105 Bacteria 1719
242 Ga0157369_10487229 3300013105 Bacteria 1276
243 Ga0157374_10016482 3300013296 Bacteria 6497
244 Ga0157374_10084829 3300013296 Bacteria 3011
245 Ga0157374_10192967 3300013296 Bacteria 1992
246 Ga0157378_10376010 3300013297 Bacteria 1394
247 Ga0163162_10139987 3300013306 Bacteria 2532
248 Ga0163162_10303072 3300013306 Bacteria 1730
249 Ga0163162_10391986 3300013306 Bacteria 1521
250 Ga0157372_10000598 3300013307 Bacteria 39369
251 Ga0157372_10041986 3300013307 Bacteria 5057
252 Ga0157372_10047751 3300013307 Bacteria 4758
253 Ga0157372_10196571 3300013307 Bacteria 2336
254 Ga0157372_10266118 3300013307 Bacteria 1991
255 Ga0157372_10836391 3300013307 Bacteria 1069
256 Ga0157375_10040468 3300013308 Bacteria 4493
257 Ga0163163_10000627 3300014325 Bacteria 30451
258 Ga0163163_10031285 3300014325 Bacteria 5136
259 Ga0163163_10100549 3300014325 Bacteria 2914
260 Ga0182008_10014996 3300014497 Bacteria 4052
261 Ga0182008_10034069 3300014497 Bacteria 2554
262 Ga0157379_10158519 3300014968 Bacteria 2043
263 Ga0157376_10116201 3300014969 Bacteria 2363
264 Ga0182006_1000174 3300015261 Bacteria 67705
265 Ga0182006_1003543 3300015261 Bacteria 7963
266 Ga0182006_1009467 3300015261 Bacteria 4363
267 Ga0182006_1017180 3300015261 Bacteria 3078
268 Ga0182007_10000143 3300015262 Bacteria 47807
269 Ga0182005_1002054 3300015265 Bacteria 7536
270 Ga0163161_10000003 3300017792 Bacteria 339847
271 Ga0163161_10036567 3300017792 Bacteria 3516
272 Ga0163161_10045290 3300017792 Bacteria 3172
273 Ga0163161_10159843 3300017792 Bacteria 1718
274 Ga0163161_10261768 3300017792 Bacteria 1351
275 Ga0197907_10075445 3300020069 Bacteria 983
276 Ga0206355_1560789 3300020076 Bacteria 1166
277 Ga0206351_10065214 3300020077 Bacteria 1319
278 Ga0206352_10666988 3300020078 Bacteria 1059
279 Ga0206350_10221737 3300020080 Bacteria 1167
280 Ga0206350_10379269 3300020080 Bacteria 1675
281 Ga0206350_10938216 3300020080 Bacteria 1119
282 Ga0206354_10594356 3300020081 Bacteria 1305
283 Ga0206354_11413883 3300020081 Bacteria 1380
284 Ga0206353_11342932 3300020082 Bacteria 1827
285 Ga0213872_10000050 3300021361 Bacteria 109093
286 Ga0213872_10000905 3300021361 Bacteria 21307
287 Ga0213874_10004805 3300021377 Bacteria 3116
288 Ga0213876_10010217 3300021384 Bacteria 5041
289 Ga0213876_10029263 3300021384 Bacteria 2903
290 Ga0213875_10000019 3300021388 Bacteria 231333
291 Ga0213875_10016825 3300021388 Bacteria 3541
292 Ga0213875_10042529 3300021388 Bacteria 2134
293 Ga0213875_10065563 3300021388 Bacteria 1697
294 Ga0213871_10034082 3300021441 Bacteria 1341
295 Ga0224712_10039765 3300022467 Bacteria 1765
296 Ga0224712_10099106 3300022467 Bacteria 1233
297 Ga0224712_10135246 3300022467 Bacteria 1080
298 Ga0209435_100837 3300025206 Bacteria 4839
299 Ga0209760_100052 3300025207 Bacteria 103453
300 Ga0209784_100015 3300025224 Bacteria 482117
301 Ga0209566_100012 3300025225 Bacteria 482281
302 Ga0209674_100027 3300025226 Bacteria 482281
303 Ga0209147_100019 3300025229 Bacteria 482139
304 Ga0209563_100031 3300025230 Bacteria 482281
305 Ga0207427_100029 3300025231 Bacteria 376678
306 Ga0209437_100009 3300025233 Bacteria 915954
307 Ga0209258_100381 3300025242 Bacteria 56739
308 Ga0209646_1000344 3300025246 Bacteria 34445
309 Ga0209026_1000711 3300025250 Bacteria 19707
310 Ga0209677_100016 3300025253 Bacteria 482117
311 Ga0209759_1003201 3300025256 Bacteria 6639
312 Ga0209759_1010992 3300025256 Bacteria 2608
313 Ga0209233_1000032 3300025261 Bacteria 623596
314 Ga0209676_1000026 3300025292 Bacteria 574599
315 Ga0209676_1000532 3300025292 Bacteria 59471
316 Ga0209025_1053028 3300025294 Bacteria 1595
317 Ga0209050_1010390 3300025298 Bacteria 4595
318 Ga0207696_1000001 3300025711 Bacteria 2579611
319 Ga0207696_1000010 3300025711 Bacteria 534681
320 Ga0207696_1002599 3300025711 Bacteria 8757
321 Ga0207696_1003215 3300025711 Bacteria 7543
322 Ga0207696_1010018 3300025711 Bacteria 3498
323 Ga0207696_1021950 3300025711 Bacteria 2036
324 Ga0207696_1023146 3300025711 Bacteria 1963
325 Ga0207655_1000002 3300025728 Bacteria 1148694
326 Ga0207655_1000151 3300025728 Bacteria 127538
327 Ga0207655_1000197 3300025728 Bacteria 106282
328 Ga0207655_1000262 3300025728 Bacteria 83031
329 Ga0207655_1001327 3300025728 Bacteria 23344
330 Ga0207655_1009222 3300025728 Bacteria 6155
331 Ga0207655_1014210 3300025728 Bacteria 4515
332 Ga0207655_1014306 3300025728 Bacteria 4494
333 Ga0207655_1014419 3300025728 Bacteria 4468
334 Ga0207655_1014540 3300025728 Bacteria 4442
335 Ga0207655_1015788 3300025728 Bacteria 4174
336 Ga0207713_1000070 3300025735 Bacteria 186597
337 Ga0207713_1000072 3300025735 Bacteria 185652
338 Ga0207713_1005079 3300025735 Bacteria 8353
339 Ga0207713_1011564 3300025735 Bacteria 4785
340 Ga0207713_1023540 3300025735 Bacteria 2896
341 Ga0207713_1028889 3300025735 Bacteria 2493
342 Ga0207713_1038613 3300025735 Bacteria 2024
343 Ga0207713_1053053 3300025735 Bacteria 1600
344 Ga0207710_10000051 3300025900 Bacteria 182751
345 Ga0207710_10000455 3300025900 Bacteria 26350
346 Ga0207710_10004382 3300025900 Bacteria 6166
347 Ga0207680_10061334 3300025903 Bacteria 2293
348 Ga0207699_10026412 3300025906 Bacteria 3200
349 Ga0207684_10003450 3300025910 Bacteria 15417
350 Ga0207684_10372437 3300025910 Bacteria 1229
351 Ga0207684_10415456 3300025910 Bacteria 1156
352 Ga0207654_10000004 3300025911 Bacteria 902334
353 Ga0207654_10083975 3300025911 Bacteria 1924
354 Ga0207707_10032118 3300025912 Bacteria 4595
355 Ga0207707_10064455 3300025912 Bacteria 3190
356 Ga0207707_10112455 3300025912 Bacteria 2380
357 Ga0207707_10224707 3300025912 Bacteria 1634
358 Ga0207695_10000964 3300025913 Bacteria 51291
359 Ga0207695_10005339 3300025913 Bacteria 17095
360 Ga0207695_10009140 3300025913 Bacteria 12299
361 Ga0207695_10031123 3300025913 Bacteria 5858
362 Ga0207695_10049362 3300025913 Bacteria 4437
363 Ga0207695_10069201 3300025913 Bacteria 3612
364 Ga0207695_10086193 3300025913 Bacteria 3168
365 Ga0207695_10134361 3300025913 Bacteria 2428
366 Ga0207695_10342244 3300025913 Bacteria 1383
367 Ga0207671_10027273 3300025914 Bacteria 4270
368 Ga0207671_10050164 3300025914 Bacteria 3090
369 Ga0207693_10018001 3300025915 Bacteria 5630
370 Ga0207663_10016462 3300025916 Bacteria 4101
371 Ga0207663_10073947 3300025916 Bacteria 2207
372 Ga0207660_10006888 3300025917 Bacteria 7357
373 Ga0207660_10053276 3300025917 Bacteria 2883
374 Ga0207657_10010431 3300025919 Bacteria 9272
375 Ga0207657_10054869 3300025919 Bacteria 3444
376 Ga0207652_10002345 3300025921 Bacteria 16034
377 Ga0207652_10071427 3300025921 Bacteria 3016
378 Ga0207646_10009466 3300025922 Bacteria 9626
379 Ga0207681_10000509 3300025923 Bacteria 27059
380 Ga0207694_10005299 3300025924 Bacteria 9940
381 Ga0207694_10021698 3300025924 Bacteria 4866
382 Ga0207694_10023587 3300025924 Bacteria 4671
383 Ga0207694_10024889 3300025924 Bacteria 4547
384 Ga0207694_10071687 3300025924 Bacteria 2707
385 Ga0207650_10000002 3300025925 Bacteria 1439222
386 Ga0207687_10005523 3300025927 Bacteria 8363
387 Ga0207687_10007962 3300025927 Bacteria 6937
388 Ga0207687_10064122 3300025927 Bacteria 2604
389 Ga0207687_10276527 3300025927 Bacteria 1344
390 Ga0207700_10001065 3300025928 Bacteria 15796
391 Ga0207700_10078984 3300025928 Bacteria 2561
392 Ga0207700_10148524 3300025928 Bacteria 1935
393 Ga0207700_10150068 3300025928 Bacteria 1925
394 Ga0207700_10386293 3300025928 Bacteria 1225
395 Ga0207664_10035151 3300025929 Bacteria 3864
396 Ga0207664_10035512 3300025929 Bacteria 3847
397 Ga0207664_10179579 3300025929 Bacteria 1816
398 Ga0207664_10231859 3300025929 Bacteria 1605
399 Ga0207644_10001798 3300025931 Bacteria 13907
400 Ga0207644_10272376 3300025931 Bacteria 1357
401 Ga0207690_10016310 3300025932 Bacteria 4516
402 Ga0207690_10114010 3300025932 Bacteria 1951
403 Ga0207706_10284593 3300025933 Bacteria 1441
404 Ga0207686_10002054 3300025934 Bacteria 11093
405 Ga0207709_10000158 3300025935 Bacteria 91810
406 Ga0207709_10009838 3300025935 Bacteria 5267
407 Ga0207669_10357081 3300025937 Bacteria 1131
408 Ga0207691_10376693 3300025940 Bacteria 1212
409 Ga0207711_10000752 3300025941 Bacteria 31778
410 Ga0207711_10025879 3300025941 Bacteria 4921
411 Ga0207711_10041953 3300025941 Bacteria 3897
412 Ga0207711_10192714 3300025941 Bacteria 1858
413 Ga0207689_10157260 3300025942 Bacteria 1874
414 Ga0207661_10001589 3300025944 Bacteria 15456
415 Ga0207661_10011029 3300025944 Bacteria 6532
416 Ga0207661_10019484 3300025944 Bacteria 5059
417 Ga0207661_10077113 3300025944 Unclassified 2740
418 Ga0207661_10101271 3300025944 Bacteria 2419
419 Ga0207661_10381350 3300025944 Bacteria 1276
420 Ga0207661_10457424 3300025944 Bacteria 1163
421 Ga0207679_10124674 3300025945 Bacteria 2057
422 Ga0207679_10218628 3300025945 Bacteria 1602
423 Ga0207667_10000778 3300025949 Bacteria 41337
424 Ga0207667_10012222 3300025949 Bacteria 9917
425 Ga0207667_10018428 3300025949 Bacteria 7828
426 Ga0207712_10054911 3300025961 Bacteria 2799
427 Ga0207658_10000001 3300025986 Bacteria 1439333
428 Ga0207677_10067902 3300026023 Bacteria 2499
429 Ga0207703_10008479 3300026035 Bacteria 8122
430 Ga0207639_10026567 3300026041 Bacteria 4207
431 Ga0207702_10007438 3300026078 Bacteria 9346
432 Ga0207702_10033061 3300026078 Bacteria 4317
433 Ga0207702_10051541 3300026078 Bacteria 3479
434 Ga0207702_10051880 3300026078 Bacteria 3469
435 Ga0207641_10067303 3300026088 Bacteria 3068
436 Ga0207641_10259950 3300026088 Bacteria 1625
437 Ga0207641_10404785 3300026088 Bacteria 1311
438 Ga0207676_10000001 3300026095 Bacteria 1439222
439 Ga0207674_10000320 3300026116 Bacteria 61127
440 Ga0207674_10011685 3300026116 Bacteria 9857
441 Ga0207674_10049531 3300026116 Bacteria 4296
442 Ga0207683_10223164 3300026121 Bacteria 1717
443 Ga0207683_10276890 3300026121 Bacteria 1533
444 Ga0207683_10288828 3300026121 Bacteria 1499
445 Ga0207698_10445850 3300026142 Bacteria 1248
446 Ga0209281_1000038 3300027111 Bacteria 361154
447 Ga0209281_1000172 3300027111 Bacteria 151766
448 Ga0209281_1001784 3300027111 Bacteria 10840
449 Ga0209389_1000063 3300027296 Bacteria 102403
450 Ga0209371_1000196 3300027312 Bacteria 89093
451 Ga0209371_1000576 3300027312 Bacteria 33041
452 Ga0209371_1002233 3300027312 Bacteria 11185
453 Ga0209371_1003223 3300027312 Bacteria 8182
454 Ga0209371_1007522 3300027312 Bacteria 3777
455 Ga0209969_1003123 3300027360 Bacteria 2291
456 Ga0209984_1010318 3300027424 Bacteria 1197
457 Ga0209982_1005413 3300027552 Bacteria 1844
458 Ga0209971_1007555 3300027682 Bacteria 2580
459 Ga0209974_10006192 3300027876 Bacteria 4190
460 Ga0209974_10045407 3300027876 Bacteria 1467
461 Ga0207428_10175085 3300027907 Bacteria 1623
462 Ga0265354_1000479 3300028016 Bacteria 6947
463 Ga0265356_1000429 3300028017 Bacteria 7644
464 Ga0268266_10005113 3300028379 Bacteria 12359
465 Ga0268266_10007323 3300028379 Bacteria 9973
466 Ga0268266_10043227 3300028379 Bacteria 3850
467 Ga0268265_10000455 3300028380 Bacteria 43315
468 Ga0268265_10543460 3300028380 Bacteria 1102
469 Ga0268264_10000004 3300028381 Bacteria 1116842
470 Ga0265337_1010645 3300028556 Bacteria 3210
471 Ga0265337_1021446 3300028556 Bacteria 2013
472 Ga0265326_10006844 3300028558 Bacteria 3518
473 Ga0265326_10007728 3300028558 Bacteria 3280
474 Ga0265326_10013258 3300028558 Bacteria 2413
475 Ga0265319_1000117 3300028563 Bacteria 60512
476 Ga0265334_10010142 3300028573 Bacteria 3976
477 Ga0265318_10000127 3300028577 Bacteria 70203
478 Ga0265318_10045528 3300028577 Bacteria 1658
479 Ga0265318_10051719 3300028577 Bacteria 1542
480 Ga0265318_10074020 3300028577 Bacteria 1261
481 Ga0265323_10000442 3300028653 Bacteria 23783
482 Ga0265323_10000729 3300028653 Bacteria 17814
483 Ga0265323_10001018 3300028653 Bacteria 14603
484 Ga0265323_10001673 3300028653 Bacteria 10615
485 Ga0265323_10015696 3300028653 Bacteria 2974
486 Ga0265323_10023964 3300028653 Bacteria 2324
487 Ga0265322_10001727 3300028654 Bacteria 6930
488 Ga0265322_10019771 3300028654 Bacteria 1931
489 Ga0265322_10026141 3300028654 Bacteria 1669
490 Ga0265336_10003605 3300028666 Bacteria 6047
491 Ga0265336_10005093 3300028666 Bacteria 4889
492 Ga0307517_10113040 3300028786 Bacteria 2052
493 Ga0265338_10004158 3300028800 Bacteria 19773
494 Ga0265338_10006215 3300028800 Bacteria 15298
495 Ga0265338_10006479 3300028800 Bacteria 14906
496 Ga0265338_10040825 3300028800 Bacteria 4352
497 Ga0265338_10049222 3300028800 Bacteria 3823
498 Ga0265338_10083055 3300028800 Bacteria 2681
499 Ga0265338_10121263 3300028800 Bacteria 2084
500 Ga0265338_10181457 3300028800 Bacteria 1604
501 Ga0265338_10263578 3300028800 Bacteria 1266
502 Ga0265324_10000026 3300029957 Bacteria 161746
503 Ga0265324_10000069 3300029957 Bacteria 83572
504 Ga0265324_10000093 3300029957 Bacteria 69020
505 Ga0265324_10000411 3300029957 Bacteria 30799
506 Ga0265324_10008668 3300029957 Bacteria 4022
507 Ga0265324_10010285 3300029957 Bacteria 3615
508 Ga0265324_10067460 3300029957 Bacteria 1220
509 Ga0268256_1000158 3300030500 Bacteria 89061
510 Ga0268256_1000503 3300030500 Bacteria 33041
511 Ga0268256_1001972 3300030500 Bacteria 11185
512 Ga0268256_1007753 3300030500 Bacteria 3777
513 Ga0316183_1015099 3300030742 Bacteria 4141
514 Ga0265770_1000818 3300030878 Bacteria 4308
515 Ga0265765_1000811 3300030879 Bacteria 2673
516 Ga0265760_10000954 3300031090 Bacteria 8365
517 Ga0265760_10029106 3300031090 Bacteria 1623
518 Ga0265330_10000112 3300031235 Bacteria 66619
519 Ga0265330_10005890 3300031235 Bacteria 6072
520 Ga0265330_10005891 3300031235 Bacteria 6072
521 Ga0265330_10007670 3300031235 Bacteria 5242
522 Ga0265330_10010228 3300031235 Bacteria 4427
523 Ga0265330_10013565 3300031235 Bacteria 3795
524 Ga0265330_10021605 3300031235 Bacteria 2934
525 Ga0265330_10024877 3300031235 Bacteria 2715
526 Ga0265330_10029355 3300031235 Bacteria 2474
527 Ga0265330_10033380 3300031235 Bacteria 2301
528 Ga0265330_10035564 3300031235 Bacteria 2222
529 Ga0265330_10050703 3300031235 Bacteria 1820
530 Ga0265330_10117082 3300031235 Bacteria 1136
531 Ga0265332_10000013 3300031238 Bacteria 250095
532 Ga0265332_10000052 3300031238 Bacteria 109708
533 Ga0265332_10000062 3300031238 Bacteria 95133
534 Ga0265332_10000234 3300031238 Bacteria 44285
535 Ga0265332_10001836 3300031238 Bacteria 11330
536 Ga0265332_10003905 3300031238 Bacteria 7110
537 Ga0265332_10010180 3300031238 Bacteria 4186
538 Ga0265332_10034307 3300031238 Bacteria 2206
539 Ga0265332_10056281 3300031238 Bacteria 1685
540 Ga0265332_10070650 3300031238 Bacteria 1487
541 Ga0265328_10000076 3300031239 Bacteria 51815
542 Ga0265328_10000128 3300031239 Bacteria 36428
543 Ga0265328_10000297 3300031239 Bacteria 23171
544 Ga0265328_10001141 3300031239 Bacteria 12239
545 Ga0265328_10002442 3300031239 Bacteria 8339
546 Ga0265328_10005003 3300031239 Bacteria 5712
547 Ga0265328_10006581 3300031239 Bacteria 4897
548 Ga0265328_10014488 3300031239 Bacteria 3104
549 Ga0265328_10022723 3300031239 Bacteria 2384
550 Ga0265328_10035767 3300031239 Bacteria 1836
551 Ga0265320_10000969 3300031240 Bacteria 21356
552 Ga0265320_10002060 3300031240 Bacteria 14160
553 Ga0265320_10004794 3300031240 Bacteria 8790
554 Ga0265320_10005502 3300031240 Bacteria 8122
555 Ga0265320_10073931 3300031240 Bacteria 1601
556 Ga0265325_10003074 3300031241 Bacteria 11029
557 Ga0265325_10006487 3300031241 Bacteria 7094
558 Ga0265325_10008975 3300031241 Bacteria 5870
559 Ga0265325_10011735 3300031241 Bacteria 5026
560 Ga0265325_10038411 3300031241 Bacteria 2527
561 Ga0265325_10053699 3300031241 Bacteria 2065
562 Ga0265325_10123463 3300031241 Bacteria 1246
563 Ga0265325_10160877 3300031241 Bacteria 1056
564 Ga0265329_10000059 3300031242 Bacteria 48321
565 Ga0265329_10001427 3300031242 Bacteria 11542
566 Ga0265329_10001667 3300031242 Bacteria 10644
567 Ga0265329_10001674 3300031242 Bacteria 10614
568 Ga0265329_10011734 3300031242 Bacteria 3175
569 Ga0265329_10014035 3300031242 Bacteria 2838
570 Ga0265329_10014042 3300031242 Bacteria 2837
571 Ga0265329_10021672 3300031242 Bacteria 2156
572 Ga0265340_10000044 3300031247 Bacteria 56454
573 Ga0265340_10000882 3300031247 Bacteria 16980
574 Ga0265340_10002279 3300031247 Bacteria 10963
575 Ga0265340_10010569 3300031247 Bacteria 4933
576 Ga0265340_10012413 3300031247 Bacteria 4500
577 Ga0265340_10091168 3300031247 Bacteria 1425
578 Ga0265339_10000001 3300031249 Bacteria 613713
579 Ga0265339_10000004 3300031249 Bacteria 269533
580 Ga0265339_10000018 3300031249 Bacteria 181364
581 Ga0265339_10001637 3300031249 Bacteria 16530
582 Ga0265339_10003001 3300031249 Bacteria 11897
583 Ga0265339_10003717 3300031249 Bacteria 10642
584 Ga0265339_10004363 3300031249 Bacteria 9654
585 Ga0265339_10036307 3300031249 Bacteria 2759
586 Ga0265339_10070381 3300031249 Bacteria 1866
587 Ga0265339_10072546 3300031249 Bacteria 1832
588 Ga0265339_10085234 3300031249 Bacteria 1664
589 Ga0265331_10000036 3300031250 Bacteria 199058
590 Ga0265331_10000108 3300031250 Bacteria 110148
591 Ga0265331_10000145 3300031250 Bacteria 92545
592 Ga0265331_10000591 3300031250 Bacteria 32363
593 Ga0265331_10001957 3300031250 Bacteria 14384
594 Ga0265331_10002644 3300031250 Bacteria 12006
595 Ga0265331_10012348 3300031250 Bacteria 4630
596 Ga0265331_10047240 3300031250 Bacteria 2072
597 Ga0265331_10063883 3300031250 Bacteria 1733
598 Ga0265331_10068261 3300031250 Bacteria 1667
599 Ga0265331_10107964 3300031250 Bacteria 1278
600 Ga0265331_10113555 3300031250 Bacteria 1241
601 Ga0265327_10000008 3300031251 Bacteria 658870
602 Ga0265327_10000213 3300031251 Bacteria 121151
603 Ga0265327_10000229 3300031251 Bacteria 113907
604 Ga0265327_10000503 3300031251 Bacteria 67795
605 Ga0265327_10004005 3300031251 Bacteria 13426
606 Ga0265327_10004822 3300031251 Bacteria 11700
607 Ga0265327_10007133 3300031251 Bacteria 8718
608 Ga0265327_10007583 3300031251 Bacteria 8333
609 Ga0265327_10019468 3300031251 Bacteria 4169
610 Ga0265316_10000011 3300031344 Bacteria 227018
611 Ga0265316_10000731 3300031344 Bacteria 36246
612 Ga0265316_10000847 3300031344 Bacteria 33692
613 Ga0265316_10001116 3300031344 Bacteria 29109
614 Ga0265316_10001265 3300031344 Bacteria 27129
615 Ga0265316_10002090 3300031344 Bacteria 21001
616 Ga0265316_10002305 3300031344 Bacteria 19950
617 Ga0265316_10002945 3300031344 Bacteria 17419
618 Ga0265316_10003493 3300031344 Bacteria 15863
619 Ga0265316_10008374 3300031344 Bacteria 9602
620 Ga0265316_10012518 3300031344 Bacteria 7600
621 Ga0265316_10013282 3300031344 Bacteria 7325
622 Ga0265316_10029280 3300031344 Bacteria 4529
623 Ga0265316_10030608 3300031344 Bacteria 4409
624 Ga0265316_10044714 3300031344 Bacteria 3520
625 Ga0265316_10055363 3300031344 Bacteria 3102
626 Ga0265316_10085315 3300031344 Bacteria 2417
627 Ga0265316_10150442 3300031344 Bacteria 1744
628 Ga0265316_10151517 3300031344 Bacteria 1737
629 Ga0265316_10170975 3300031344 Bacteria 1621
630 Ga0265316_10208700 3300031344 Bacteria 1445
631 Ga0265316_10221885 3300031344 Bacteria 1394
632 Ga0265316_10227276 3300031344 Bacteria 1375
633 Ga0265316_10229035 3300031344 Bacteria 1369
634 Ga0265316_10277884 3300031344 Bacteria 1224
635 Ga0265316_10287086 3300031344 Bacteria 1201
636 Ga0265316_10338294 3300031344 Bacteria 1091
637 Ga0307509_10274381 3300031507 Bacteria 1452
638 Ga0307408_100000178 3300031548 Bacteria 71389
639 Ga0307408_100011056 3300031548 Bacteria 5958
640 Ga0307408_100020260 3300031548 Bacteria 4486
641 Ga0265313_10000056 3300031595 Bacteria 109106
642 Ga0265313_10001373 3300031595 Bacteria 22850
643 Ga0265313_10018959 3300031595 Bacteria 3847
644 Ga0265313_10040724 3300031595 Bacteria 2294
645 Ga0265313_10058884 3300031595 Bacteria 1809
646 Ga0316579_10061196 3300031691 Bacteria 1772
647 Ga0265314_10000007 3300031711 Bacteria 491737
648 Ga0265314_10000271 3300031711 Bacteria 76021
649 Ga0265314_10000933 3300031711 Bacteria 34474
650 Ga0265314_10001549 3300031711 Bacteria 25351
651 Ga0265314_10002364 3300031711 Bacteria 19452
652 Ga0265314_10003597 3300031711 Bacteria 14919
653 Ga0265314_10003642 3300031711 Bacteria 14820
654 Ga0265314_10005145 3300031711 Bacteria 11889
655 Ga0265314_10017132 3300031711 Bacteria 5695
656 Ga0265314_10033095 3300031711 Bacteria 3795
657 Ga0265314_10035236 3300031711 Bacteria 3650
658 Ga0265314_10137277 3300031711 Bacteria 1517
659 Ga0265314_10139318 3300031711 Bacteria 1502
660 Ga0265342_10000058 3300031712 Bacteria 118791
661 Ga0265342_10000472 3300031712 Bacteria 43635
662 Ga0265342_10000619 3300031712 Bacteria 37353
663 Ga0265342_10000762 3300031712 Bacteria 32881
664 Ga0265342_10000924 3300031712 Bacteria 29168
665 Ga0265342_10001136 3300031712 Bacteria 25428
666 Ga0265342_10001742 3300031712 Bacteria 19865
667 Ga0265342_10007313 3300031712 Bacteria 8102
668 Ga0265342_10007898 3300031712 Bacteria 7714
669 Ga0265342_10012661 3300031712 Bacteria 5706
670 Ga0265342_10014722 3300031712 Bacteria 5182
671 Ga0265342_10019789 3300031712 Bacteria 4331
672 Ga0265342_10021895 3300031712 Bacteria 4073
673 Ga0265342_10166351 3300031712 Bacteria 1216
674 Ga0316576_10017817 3300031727 Bacteria 4836
675 Ga0316576_10028196 3300031727 Bacteria 3955
676 Ga0316576_10043506 3300031727 Bacteria 3240
677 Ga0316576_10070843 3300031727 Bacteria 2571
678 Ga0316576_10265500 3300031727 Bacteria 1287
679 Ga0316578_10008951 3300031728 Bacteria 5121
680 Ga0316578_10079635 3300031728 Bacteria 1948
681 Ga0316578_10102627 3300031728 Bacteria 1715
682 Ga0307516_10000202 3300031730 Bacteria 77604
683 Ga0307405_10020411 3300031731 Bacteria 3701
684 Ga0316577_10076069 3300031733 Bacteria 1874
685 Ga0316577_10140008 3300031733 Bacteria 1363
686 Ga0307413_10010098 3300031824 Bacteria 4558
687 Ga0307406_10013085 3300031901 Bacteria 4744
688 Ga0307406_10051967 3300031901 Bacteria 2604
689 Ga0307406_10054623 3300031901 Bacteria 2549
690 Ga0307407_10026019 3300031903 Bacteria 3093
691 Ga0307412_10004978 3300031911 Bacteria 7425
692 Ga0307412_10010098 3300031911 Bacteria 5430
693 Ga0307412_10011635 3300031911 Bacteria 5101
694 Ga0307409_100041096 3300031995 Bacteria 3450
695 Ga0307414_10010683 3300032004 Bacteria 5344
696 Ga0307414_10056920 3300032004 Bacteria 2745
697 Ga0307411_10004175 3300032005 Bacteria 6866
698 Ga0316593_10037039 3300032168 Bacteria 1611
699 Ga0316593_10067502 3300032168 Bacteria 1232
700 Ga0316593_10071261 3300032168 Bacteria 1202
701 Ga0316596_1042114 3300033541 Bacteria 1201
702 Ga0373926_0007884 3300035083 Bacteria 3548
703 Ga0373926_0008882 3300035083 Bacteria 3349
704 Ga0373934_0003185 3300035086 Bacteria 5999
705 Ga0373934_0016862 3300035086 Bacteria 2781
706 Ga0373932_0009979 3300035112 Bacteria 2291
707 Ga0373936_0066099 3300035113 Bacteria 1484
708 Ga0373945_0106995 3300035116 Bacteria 1100
709 Ga0373953_0011245 3300035117 Bacteria 3138
710 Ga0373953_0021778 3300035117 Bacteria 2409
711 Ga0373954_0014791 3300035118 Bacteria 3482
712 Ga0373954_0044561 3300035118 Bacteria 2071
713 Ga0373956_0001217 3300035119 Bacteria 10658
714 Ga0373957_0042689 3300035120 Bacteria 1712
715 Ga0373955_0114834 3300035172 Bacteria 1560
716 Ga0373955_0174821 3300035172 Bacteria 1272
717 Ga0316574_0004307 3300035398 Bacteria 7433
718 Ga0316574_0020761 3300035398 Bacteria 3891
719 Ga0316574_0096617 3300035398 Bacteria 1888
720 Ga0316574_0241945 3300035398 Bacteria 1153
721 Ga0316574_0243127 3300035398 Bacteria 1150
722 Ga0373931_0167068 3300035691 Bacteria 1294
723 Ga0373935_0133566 3300035692 Bacteria 1670
724 Ga0373935_0145989 3300035692 Bacteria 1602
725 Ga0373927_0001539 3300035695 Bacteria 17343
726 Ga0373927_0002742 3300035695 Bacteria 12842
727 Ga0373927_0009722 3300035695 Bacteria 6446
728 Ga0373927_0063083 3300035695 Bacteria 2397
729 Ga0373927_0118306 3300035695 Bacteria 1729
730 Ga0373927_0301155 3300035695 Bacteria 1055
731 Ga0373933_0073672 3300035724 Bacteria 2081
732 Ga0373933_0095320 3300035724 Bacteria 1841
733 Ga0373947_0000740 3300035725 Bacteria 19574
734 Ga0373947_0099937 3300035725 Bacteria 1822
735 Ga0373937_0007741 3300036401 Bacteria 9312
736 Ga0373937_0019221 3300036401 Bacteria 6116
737 Ga0373937_0035160 3300036401 Bacteria 4559
738 Ga0373937_0227032 3300036401 Bacteria 1758
739 Ga0373937_0315761 3300036401 Bacteria 1478
740 Ga0373937_0339483 3300036401 Bacteria 1422
741 Ga0373937_0576904 3300036401 Bacteria 1068
742 Ga0316582_0036189 3300036647 Bacteria 3053
743 Ga0316582_0133884 3300036647 Bacteria 1667
744 Ga0316582_0205402 3300036647 Bacteria 1345
745 Ga0316584_0009600 3300036712 Bacteria 6726
746 Ga0316584_0024907 3300036712 Bacteria 4384
747 Ga0316584_0114947 3300036712 Bacteria 2013
748 Ga0373925_0000099 3300037068 Bacteria 93726
749 Ga0373925_0005608 3300037068 Bacteria 9345
750 Ga0373925_0015028 3300037068 Bacteria 5596
751 Ga0373925_0058578 3300037068 Bacteria 2888
752 Ga0373925_0076615 3300037068 Bacteria 2537
753 Ga0373925_0169322 3300037068 Bacteria 1724
754 Ga0395900_0025210 3300037418 Bacteria 6088
755 Ga0395900_0070182 3300037418 Bacteria 3602
756 Ga0395905_0003402 3300037471 Bacteria 17035
757 Ga0395905_0172075 3300037471 Bacteria 2034
758 Ga0436364_0176175 3300037853 Bacteria 4885
759 Ga0436364_0366372 3300037853 Bacteria 231753
760 Ga0436364_0514524 3300037853 Bacteria 1248
761 Ga0436364_0748631 3300037853 Bacteria 1323
762 Ga0436364_0807765 3300037853 Bacteria 7401
763 Ga0436364_0853204 3300037853 Bacteria 6229
764 Ga0436364_1151958 3300037853 Bacteria 3445
765 Ga0436364_1386202 3300037853 Bacteria 3656
766 Ga0436364_1410728 3300037853 Bacteria 4621
767 Ga0436364_1414125 3300037853 Bacteria 18149
768 Ga0436364_1489063 3300037853 Bacteria 6681
769 Ga0436364_1501586 3300037853 Bacteria 1905
770 Ga0400490_10431 3300038726 Bacteria 21033
771 Ga0400486_10993 3300038742 Bacteria 2242
772 Ga0400483_030371 3300039062 Bacteria 16130
773 Ga0400489_59676 3300039093 Bacteria 4698
774 Ga0436365_0139104 3300039437 Bacteria 12303
775 Ga0436365_0497797 3300039437 Bacteria 2851
776 Ga0436365_0721041 3300039437 Bacteria 3132
777 Ga0436365_1100189 3300039437 Bacteria 3446
778 Ga0436365_1490124 3300039437 Bacteria 4606
779 Ga0436360_0328545 3300039438 Bacteria 2166
780 Ga0436360_0378330 3300039438 Bacteria 8772
781 Ga0436360_1032306 3300039438 Bacteria 2846
782 Ga0436360_1333063 3300039438 Bacteria 2341
783 Ga0436361_0269507 3300039447 Bacteria 102308
784 Ga0436361_0285134 3300039447 Bacteria 3111
785 Ga0436361_0567168 3300039447 Bacteria 164343
786 Ga0436361_0682766 3300039447 Bacteria 3159
787 Ga0436363_1560073 3300039450 Bacteria 10797
788 Ga0436362_0084096 3300039453 Bacteria 5279
789 Ga0436362_0297328 3300039453 Bacteria 1754
790 Ga0439436_0007650 3300041404 Bacteria 3324
791 Ga0439438_000002 3300041405 Bacteria 618223
792 Ga0439438_000442 3300041405 Bacteria 18697
793 Ga0439438_003869 3300041405 Bacteria 5904
794 Ga0439438_004424 3300041405 Bacteria 5397
795 Ga0439438_012015 3300041405 Bacteria 2672
796 Ga0439438_013815 3300041405 Bacteria 2421
797 Ga0439447_001496 3300041407 Bacteria 8564
798 Ga0439447_002909 3300041407 Bacteria 6128
799 Ga0439447_003162 3300041407 Bacteria 5866
800 Ga0439447_008240 3300041407 Bacteria 3241
801 Ga0439466_0005969 3300041411 Bacteria 4638
802 Ga0439466_0006786 3300041411 Bacteria 4343
803 Ga0439466_0015267 3300041411 Bacteria 2790
804 Ga0439465_0006145 3300041413 Bacteria 3819
805 Ga0451855_1019283 3300041511 Bacteria 1912
806 Ga0439432_001052 3300042006 Bacteria 10485
807 Ga0439432_001239 3300042006 Bacteria 9653
808 Ga0439432_002018 3300042006 Bacteria 7686
809 Ga0439432_002789 3300042006 Bacteria 6512
810 Ga0439432_003342 3300042006 Bacteria 5957
811 Ga0439451_001638 3300042009 Bacteria 4446
812 Ga0439451_003813 3300042009 Bacteria 3061
813 Ga0439452_000003 3300042010 Bacteria 942815
814 Ga0439452_009904 3300042010 Bacteria 2792
815 Ga0439452_022042 3300042010 Bacteria 1653
816 Ga0439456_000271 3300042013 Bacteria 12605
817 Ga0439456_008922 3300042013 Bacteria 2070
818 Ga0450911_000002 3300042115 Bacteria 277703
819 Ga0450911_001193 3300042115 Bacteria 6338
820 Ga0450919_000614 3300042121 Bacteria 4509
821 Ga0450890_000186 3300042127 Bacteria 9401
822 Ga0450902_001984 3300042137 Bacteria 2862
823 Ga0450903_001828 3300042138 Bacteria 3879
824 Ga0450903_002098 3300042138 Bacteria 3585
825 Ga0450905_000029 3300042142 Bacteria 11982
826 Ga0450906_000658 3300042145 Bacteria 7392
827 Ga0450907_000132 3300042146 Bacteria 28311
828 Ga0450907_002076 3300042146 Bacteria 3972
829 Ga0439446_0008405 3300042156 Bacteria 2739
830 Ga0439446_0017328 3300042156 Bacteria 2012
831 Ga0450908_005178 3300042184 Bacteria 2500
832 Ga0450909_002104 3300042185 Bacteria 2810
833 Ga0439434_0000469 3300042435 Bacteria 11490
834 Ga0439464_0002709 3300042439 Bacteria 4394
835 Ga0439464_0009344 3300042439 Bacteria 2580
836 Ga0439460_0001104 3300042461 Bacteria 6297
837 Ga0439460_0005590 3300042461 Bacteria 3091
838 Ga0451577_0000035 3300042876 Bacteria 373467
839 Ga0451577_0000127 3300042876 Bacteria 168002
840 Ga0451577_0000644 3300042876 Bacteria 55517
841 Ga0451577_0001119 3300042876 Bacteria 38024
842 Ga0451577_0001484 3300042876 Bacteria 31087
843 Ga0451577_0003259 3300042876 Bacteria 18253
844 Ga0451577_0003915 3300042876 Bacteria 16080
845 Ga0451577_0008660 3300042876 Bacteria 9881
846 Ga0451577_0013211 3300042876 Bacteria 7736
847 Ga0451577_0015851 3300042876 Bacteria 6993
848 Ga0451577_0016891 3300042876 Bacteria 6749
849 Ga0451577_0026629 3300042876 Bacteria 5237
850 Ga0451577_0032932 3300042876 Bacteria 4671
851 Ga0451577_0034763 3300042876 Bacteria 4542
852 Ga0451577_0055642 3300042876 Bacteria 3529
853 Ga0451577_0065739 3300042876 Bacteria 3234
854 Ga0451577_0074573 3300042876 Bacteria 3026
855 Ga0451577_0081767 3300042876 Bacteria 2881
856 Ga0451577_0088449 3300042876 Bacteria 2764
857 Ga0451577_0095159 3300042876 Bacteria 2660
858 Ga0451577_0103585 3300042876 Bacteria 2543
859 Ga0451577_0161923 3300042876 Bacteria 2015
860 Ga0451577_0190718 3300042876 Bacteria 1849
861 Ga0451577_0392613 3300042876 Bacteria 1259
862 Ga0439440_0003112 3300042993 Bacteria 3173
863 Ga0439440_0009520 3300042993 Bacteria 2013
864 Ga0453683_0000001 3300044673 Bacteria 1384965
865 Ga0453683_0000009 3300044673 Bacteria 491115
866 Ga0453683_0000018 3300044673 Bacteria 309212
867 Ga0453683_0000233 3300044673 Bacteria 73679
868 Ga0453683_0004304 3300044673 Bacteria 10144
869 Ga0453683_0004940 3300044673 Bacteria 9370
870 Ga0453683_0006674 3300044673 Bacteria 7897
871 Ga0453683_0028839 3300044673 Bacteria 3512
872 Ga0453683_0065747 3300044673 Bacteria 2267
873 Ga0453683_0074008 3300044673 Bacteria 2132
874 Ga0453683_0171101 3300044673 Bacteria 1376
875 Ga0453683_0254441 3300044673 Bacteria 1120
876 Ga0453684_0000048 3300044712 Bacteria 559743
877 Ga0453684_0000097 3300044712 Bacteria 377772
878 Ga0453684_0000115 3300044712 Bacteria 355501
879 Ga0453684_0000221 3300044712 Bacteria 249908
880 Ga0453684_0000242 3300044712 Bacteria 234895
881 Ga0453684_0000499 3300044712 Bacteria 153532
882 Ga0453684_0000539 3300044712 Bacteria 143526
883 Ga0453684_0000555 3300044712 Bacteria 140770
884 Ga0453684_0000941 3300044712 Bacteria 96005
885 Ga0453684_0001135 3300044712 Bacteria 83367
886 Ga0453684_0001752 3300044712 Bacteria 58035
887 Ga0453684_0002408 3300044712 Bacteria 45598
888 Ga0453684_0002894 3300044712 Bacteria 40256
889 Ga0453684_0003084 3300044712 Bacteria 38484
890 Ga0453684_0004632 3300044712 Bacteria 28590
891 Ga0453684_0005926 3300044712 Bacteria 23699
892 Ga0453684_0007878 3300044712 Bacteria 19352
893 Ga0453684_0007938 3300044712 Bacteria 19252
894 Ga0453684_0013644 3300044712 Bacteria 13164
895 Ga0453684_0016279 3300044712 Bacteria 11645
896 Ga0453684_0019676 3300044712 Bacteria 10253
897 Ga0453684_0021899 3300044712 Bacteria 9513
898 Ga0453684_0030419 3300044712 Bacteria 7629
899 Ga0453684_0046636 3300044712 Bacteria 5761
900 Ga0453684_0048265 3300044712 Bacteria 5633
901 Ga0453684_0055436 3300044712 Bacteria 5153
902 Ga0453684_0057574 3300044712 Bacteria 5029
903 Ga0453684_0069986 3300044712 Bacteria 4447
904 Ga0453684_0070696 3300044712 Bacteria 4418
905 Ga0453684_0087668 3300044712 Bacteria 3856
906 Ga0453684_0097761 3300044712 Bacteria 3602
907 Ga0453684_0112724 3300044712 Bacteria 3301
908 Ga0453684_0134239 3300044712 Bacteria 2966
909 Ga0453684_0142404 3300044712 Bacteria 2861
910 Ga0453684_0152488 3300044712 Bacteria 2744
911 Ga0453684_0162295 3300044712 Bacteria 2642
912 Ga0453684_0167310 3300044712 Bacteria 2594
913 Ga0453684_0209441 3300044712 Bacteria 2267
914 Ga0453684_0352507 3300044712 Bacteria 1659
915 Ga0453684_0485017 3300044712 Bacteria 1371
916 Ga0453684_0504267 3300044712 Bacteria 1339
917 Ga0451576_0000488 3300045051 Bacteria 87699
918 Ga0451576_0000897 3300045051 Bacteria 56638
919 Ga0451576_0001625 3300045051 Bacteria 37674
920 Ga0451576_0002883 3300045051 Bacteria 24561
921 Ga0451576_0003235 3300045051 Bacteria 22666
922 Ga0451576_0007599 3300045051 Bacteria 12911
923 Ga0451576_0010023 3300045051 Bacteria 10916
924 Ga0451576_0017004 3300045051 Bacteria 8007
925 Ga0451576_0018382 3300045051 Bacteria 7664
926 Ga0451576_0029987 3300045051 Bacteria 5817
927 Ga0451576_0059407 3300045051 Bacteria 3991
928 Ga0451576_0083463 3300045051 Bacteria 3324
929 Ga0451576_0084574 3300045051 Bacteria 3300
930 Ga0451576_0091231 3300045051 Bacteria 3169
931 Ga0451576_0131379 3300045051 Bacteria 2610
932 Ga0451576_0145838 3300045051 Bacteria 2468
933 Ga0451576_0148525 3300045051 Bacteria 2444
934 Ga0451576_0217205 3300045051 Bacteria 1996
935 Ga0451576_0249655 3300045051 Bacteria 1854
936 Ga0451576_0396624 3300045051 Bacteria 1446
937 Ga0451576_0400895 3300045051 Bacteria 1438
938 Ga0451576_0431901 3300045051 Bacteria 1382
939 Ga0451576_0441847 3300045051 Bacteria 1365
940 Ga0451576_0741327 3300045051 Bacteria 1032
941 Ga0495617_000327 3300046452 Bacteria 26705
942 Ga0495627_000044 3300046453 Bacteria 182964
943 Ga0495627_000143 3300046453 Bacteria 85459
944 Ga0495627_001530 3300046453 Bacteria 13262
945 Ga0495627_005662 3300046453 Bacteria 4992
946 Ga0495627_005817 3300046453 Bacteria 4906
947 Ga0495592_0014490 3300046454 Bacteria 5983
948 Ga0495603_0019488 3300046455 Bacteria 4105
949 Ga0495590_0003015 3300046457 Bacteria 6901
950 Ga0495590_0026310 3300046457 Bacteria 2043
951 Ga0495590_0026839 3300046457 Bacteria 2021
952 Ga0495591_000023 3300046458 Bacteria 191598
953 Ga0495591_003647 3300046458 Bacteria 7836
954 Ga0495591_004045 3300046458 Bacteria 7325
955 Ga0495591_004793 3300046458 Bacteria 6466
956 Ga0495591_005488 3300046458 Bacteria 5861
957 Ga0495591_006035 3300046458 Bacteria 5459
958 Ga0495591_009042 3300046458 Bacteria 4003
959 Ga0495591_010786 3300046458 Bacteria 3511
960 Ga0495638_0032805 3300046460 Bacteria 3324
961 Ga0495651_0007664 3300046462 Bacteria 8253
962 Ga0495651_0053021 3300046462 Bacteria 3124
963 Ga0495653_0061150 3300046463 Bacteria 2850
964 Ga0495653_0111964 3300046463 Bacteria 1960
965 Ga0495650_0000065 3300046471 Bacteria 275124
966 Ga0495650_0000620 3300046471 Bacteria 48027
967 Ga0495650_0006361 3300046471 Bacteria 7378
968 Ga0495650_0009633 3300046471 Bacteria 5476
969 Ga0495580_0011408 3300046472 Bacteria 6875
970 Ga0495580_0017429 3300046472 Bacteria 5372
971 Ga0495580_0037314 3300046472 Bacteria 3489
972 Ga0495580_0108737 3300046472 Bacteria 1925
973 Ga0495605_0000048 3300046474 Bacteria 170182
974 Ga0495605_0000094 3300046474 Bacteria 112717
975 Ga0495605_0000330 3300046474 Bacteria 47649
976 Ga0495605_0000486 3300046474 Bacteria 34396
977 Ga0495605_0001320 3300046474 Bacteria 16426
978 Ga0495605_0005925 3300046474 Bacteria 7065
979 Ga0495605_0006308 3300046474 Bacteria 6834
980 Ga0495605_0042442 3300046474 Bacteria 2260
981 Ga0495605_0108899 3300046474 Bacteria 1266
982 Ga0495639_0000714 3300046475 Bacteria 15193
983 Ga0495664_0003394 3300046477 Bacteria 8652
984 Ga0495664_0224992 3300046477 Bacteria 1136
985 Ga0495584_0001356 3300046491 Bacteria 14814
986 Ga0495584_0004349 3300046491 Bacteria 7629
987 Ga0495584_0004438 3300046491 Bacteria 7549
988 Ga0495584_0020003 3300046491 Bacteria 3400
989 Ga0495585_0005478 3300046492 Bacteria 7990
990 Ga0495585_0022896 3300046492 Bacteria 3585
991 Ga0495594_0003631 3300046499 Bacteria 7933
992 Ga0495594_0188393 3300046499 Bacteria 1175
993 Ga0495596_0012119 3300046500 Bacteria 3699
994 Ga0495607_0000349 3300046501 Bacteria 47780
995 Ga0495607_0000396 3300046501 Bacteria 44362
996 Ga0495607_0001009 3300046501 Bacteria 25910
997 Ga0495607_0001535 3300046501 Bacteria 20312
998 Ga0495607_0003645 3300046501 Bacteria 11690
999 Ga0495607_0005366 3300046501 Bacteria 9203
1000 Ga0495607_0006278 3300046501 Bacteria 8378
1001 Ga0495607_0021862 3300046501 Bacteria 4022
1002 Ga0495607_0047000 3300046501 Bacteria 2530
1003 Ga0495607_0059081 3300046501 Bacteria 2188
1004 Ga0495607_0102701 3300046501 Bacteria 1528
1005 Ga0495583_0000096 3300046506 Bacteria 151090
1006 Ga0495583_0001432 3300046506 Bacteria 24231
1007 Ga0495583_0006317 3300046506 Bacteria 7780
1008 Ga0495583_0010134 3300046506 Bacteria 5533
1009 Ga0495583_0010743 3300046506 Bacteria 5309
1010 Ga0495583_0017557 3300046506 Bacteria 3794
1011 Ga0495583_0050576 3300046506 Bacteria 1898
1012 Ga0495606_0001112 3300046507 Bacteria 38418
1013 Ga0495606_0002582 3300046507 Bacteria 20733
1014 Ga0495606_0004094 3300046507 Bacteria 14816
1015 Ga0495606_0008803 3300046507 Bacteria 8665
1016 Ga0495606_0015513 3300046507 Bacteria 5864
1017 Ga0495606_0016101 3300046507 Bacteria 5723
1018 Ga0495608_0053847 3300046511 Bacteria 2661
1019 Ga0495610_0000021 3300046512 Bacteria 336300
1020 Ga0495610_0012081 3300046512 Bacteria 5222
1021 Ga0495610_0034270 3300046512 Bacteria 2616
1022 Ga0495616_0004161 3300046513 Bacteria 9170
1023 Ga0495616_0025122 3300046513 Bacteria 3186
1024 Ga0495616_0059646 3300046513 Bacteria 1876
1025 Ga0495620_0000001 3300046515 Bacteria 386508
1026 Ga0495620_0000002 3300046515 Bacteria 373737
1027 Ga0495620_0000757 3300046515 Bacteria 19829
1028 Ga0495620_0001337 3300046515 Bacteria 14977
1029 Ga0495620_0004859 3300046515 Bacteria 7538
1030 Ga0495628_0012932 3300046516 Bacteria 7028
1031 Ga0495628_0180534 3300046516 Bacteria 1597
1032 Ga0495630_0001621 3300046517 Bacteria 15640
1033 Ga0495630_0024426 3300046517 Bacteria 4469
1034 Ga0495631_0001469 3300046518 Bacteria 14301
1035 Ga0495631_0014162 3300046518 Bacteria 3854
1036 Ga0495631_0014537 3300046518 Bacteria 3796
1037 Ga0495631_0032838 3300046518 Bacteria 2337
1038 Ga0495632_0002507 3300046519 Bacteria 13918
1039 Ga0495632_0004158 3300046519 Bacteria 9921
1040 Ga0495632_0004287 3300046519 Bacteria 9736
1041 Ga0495632_0023780 3300046519 Bacteria 3266
1042 Ga0495632_0024047 3300046519 Bacteria 3243
1043 Ga0495637_0000630 3300046520 Bacteria 24850
1044 Ga0495637_0001225 3300046520 Bacteria 15558
1045 Ga0495637_0001699 3300046520 Bacteria 12710
1046 Ga0495637_0005266 3300046520 Bacteria 6619
1047 Ga0495637_0018833 3300046520 Bacteria 3198
1048 Ga0495643_0000303 3300046522 Bacteria 68802
1049 Ga0495643_0000560 3300046522 Bacteria 45977
1050 Ga0495643_0001685 3300046522 Bacteria 19270
1051 Ga0495643_0002672 3300046522 Bacteria 13791
1052 Ga0495643_0013070 3300046522 Bacteria 4986
1053 Ga0495643_0015736 3300046522 Bacteria 4461
1054 Ga0495643_0018964 3300046522 Bacteria 3984
1055 Ga0495644_0003708 3300046523 Bacteria 6012
1056 Ga0495644_0006504 3300046523 Bacteria 4525
1057 Ga0495648_0000521 3300046524 Bacteria 41448
1058 Ga0495648_0001868 3300046524 Bacteria 20138
1059 Ga0495648_0008904 3300046524 Bacteria 7843
1060 Ga0495648_0009937 3300046524 Bacteria 7303
1061 Ga0495648_0020975 3300046524 Bacteria 4540
1062 Ga0495648_0024807 3300046524 Bacteria 4072
1063 Ga0495648_0025968 3300046524 Bacteria 3954
1064 Ga0495648_0037701 3300046524 Bacteria 3102
1065 Ga0495648_0093676 3300046524 Bacteria 1674
1066 Ga0495666_0003007 3300046526 Bacteria 8461
1067 Ga0495642_0001462 3300046528 Bacteria 10574
1068 Ga0495642_0003590 3300046528 Bacteria 6101
1069 Ga0495642_0003766 3300046528 Bacteria 5936
1070 Ga0495652_0008745 3300046529 Bacteria 9218
1071 Ga0495652_0056581 3300046529 Bacteria 3330
1072 Ga0495652_0351409 3300046529 Bacteria 1056
1073 Ga0495654_0000096 3300046530 Bacteria 99777
1074 Ga0495654_0000102 3300046530 Bacteria 96991
1075 Ga0495654_0000588 3300046530 Bacteria 29030
1076 Ga0495654_0005166 3300046530 Bacteria 7614
1077 Ga0495654_0007690 3300046530 Bacteria 5997
1078 Ga0495654_0010751 3300046530 Bacteria 4971
1079 Ga0495654_0013991 3300046530 Bacteria 4279
1080 Ga0495654_0104304 3300046530 Bacteria 1301
1081 Ga0495665_0021153 3300046531 Bacteria 3495
1082 Ga0495640_0110106 3300046533 Bacteria 1800
1083 Ga0495587_0001493 3300046536 Bacteria 15596
1084 Ga0495587_0004848 3300046536 Bacteria 8828
1085 Ga0495609_0000012 3300046538 Bacteria 333994
1086 Ga0495609_0000079 3300046538 Bacteria 118997
1087 Ga0495609_0001254 3300046538 Bacteria 17456
1088 Ga0495609_0003270 3300046538 Bacteria 9357
1089 Ga0495609_0005619 3300046538 Bacteria 6538
1090 Ga0495609_0009678 3300046538 Bacteria 4652
1091 Ga0495609_0057899 3300046538 Bacteria 1714
1092 Ga0495597_0000016 3300046542 Bacteria 167456
1093 Ga0495597_0021120 3300046542 Bacteria 3028
1094 Ga0495645_0037723 3300046543 Bacteria 3524
1095 Ga0495645_0131099 3300046543 Bacteria 1756
1096 Ga0495645_0167920 3300046543 Bacteria 1512
1097 Ga0495622_0000809 3300046557 Bacteria 17316
1098 Ga0495622_0001364 3300046557 Bacteria 12491
1099 Ga0495622_0029990 3300046557 Bacteria 2541
1100 Ga0495633_0000034 3300046558 Bacteria 185552
1101 Ga0495633_0031235 3300046558 Bacteria 2584
1102 Ga0495667_0060055 3300046559 Bacteria 2494
1103 Ga0495667_0118620 3300046559 Bacteria 1709
1104 Ga0495667_0194558 3300046559 Bacteria 1299
1105 Ga0495656_0001632 3300046615 Bacteria 7338
1106 Ga0495668_0065953 3300046616 Bacteria 1992
1107 Ga0495634_0000967 3300046642 Bacteria 27121
1108 Ga0495611_0000656 3300046648 Bacteria 19743
1109 Ga0495611_0016202 3300046648 Bacteria 3186
1110 Ga0495611_0036628 3300046648 Bacteria 2178
1111 Ga0495625_0000076 3300046660 Bacteria 163580
1112 Ga0495625_0047649 3300046660 Bacteria 3089
1113 Ga0495635_0000752 3300046663 Bacteria 21018
1114 Ga0495635_0089474 3300046663 Bacteria 2106
1115 Ga0495659_0001347 3300046664 Bacteria 8436
1116 Ga0495659_0017477 3300046664 Bacteria 2377
1117 Ga0495661_0000004 3300046665 Bacteria 555340
1118 Ga0495661_0000099 3300046665 Bacteria 106462
1119 Ga0495661_0000146 3300046665 Bacteria 82292
1120 Ga0495661_0000773 3300046665 Bacteria 30663
1121 Ga0495661_0025579 3300046665 Bacteria 3811
1122 Ga0495661_0030918 3300046665 Bacteria 3404
1123 Ga0495661_0042222 3300046665 Bacteria 2812
1124 Ga0495661_0110881 3300046665 Bacteria 1529
1125 Ga0495588_0004580 3300046674 Bacteria 6111
1126 Ga0495599_0002296 3300046678 Bacteria 11119
1127 Ga0495599_0015207 3300046678 Bacteria 4773
1128 Ga0495623_0001889 3300046679 Bacteria 14069
1129 Ga0495623_0006999 3300046679 Bacteria 7328
1130 Ga0495646_0011937 3300046680 Bacteria 5525
1131 Ga0495646_0037210 3300046680 Bacteria 3012
1132 Ga0495669_0016103 3300046684 Bacteria 3201
1133 Ga0495670_0002495 3300046691 Bacteria 9090
1134 Ga0495670_0023981 3300046691 Bacteria 3012
1135 Ga0495670_0034984 3300046691 Bacteria 2502
1136 Ga0495671_0000024 3300046692 Bacteria 246812
1137 Ga0495671_0000908 3300046692 Bacteria 21076
1138 Ga0495671_0002113 3300046692 Bacteria 12706
1139 Ga0495671_0002880 3300046692 Bacteria 10758
1140 Ga0495671_0003585 3300046692 Bacteria 9480
1141 Ga0495671_0004322 3300046692 Bacteria 8540
1142 Ga0495671_0010611 3300046692 Bacteria 5094
1143 Ga0495671_0018765 3300046692 Bacteria 3666
1144 Ga0495649_0001633 3300046694 Bacteria 16680
1145 Ga0495649_0003386 3300046694 Bacteria 10781
1146 Ga0495649_0003919 3300046694 Bacteria 9844
1147 Ga0495649_0008042 3300046694 Bacteria 6370
1148 Ga0495649_0010145 3300046694 Bacteria 5567
1149 Ga0495649_0049172 3300046694 Bacteria 2290
1150 Ga0495589_0000003 3300046794 Bacteria 453448
1151 Ga0495589_0000194 3300046794 Bacteria 53082
1152 Ga0495589_0008684 3300046794 Bacteria 5291
1153 Ga0495589_0024274 3300046794 Bacteria 3082
1154 Ga0495589_0089809 3300046794 Bacteria 1492
1155 Ga0495600_0046810 3300046809 Bacteria 2821
1156 Ga0495660_0000017 3300046810 Bacteria 320655
1157 Ga0495660_0000824 3300046810 Bacteria 23044
1158 Ga0495660_0012602 3300046810 Bacteria 4906
1159 Ga0495660_0020560 3300046810 Bacteria 3783
1160 Ga0495660_0022401 3300046810 Bacteria 3607
1161 Ga0495660_0023907 3300046810 Bacteria 3482
1162 Ga0495604_0069019 3300047317 Bacteria 2680
1163 Ga0495604_0081857 3300047317 Bacteria 2415
1164 Ga0495604_0163470 3300047317 Bacteria 1571
1165 Ga0495636_0000764 3300047318 Bacteria 11844
1166 Ga0495674_0005437 3300047319 Bacteria 12235
1167 Ga0495674_0007240 3300047319 Bacteria 10618
1168 Ga0495674_0044383 3300047319 Bacteria 3953
1169 Ga0495672_0000001 3300047320 Bacteria 1458820
1170 Ga0495672_0004429 3300047320 Bacteria 11506
1171 Ga0495672_0005100 3300047320 Bacteria 10485
1172 Ga0495672_0008463 3300047320 Bacteria 7588
1173 Ga0495672_0077988 3300047320 Bacteria 1854
1174 Ga0495676_0000016 3300047321 Bacteria 196310
1175 Ga0495680_0018000 3300047322 Bacteria 6011
1176 Ga0495680_0038892 3300047322 Bacteria 3799
1177 Ga0495680_0130297 3300047322 Bacteria 1849
1178 Ga0495683_0000034 3300047323 Bacteria 148959
1179 Ga0495683_0015091 3300047323 Bacteria 4022
1180 Ga0495683_0036322 3300047323 Bacteria 2501
1181 Ga0495683_0125868 3300047323 Bacteria 1212
1182 Ga0495687_006222 3300047443 Bacteria 7365
1183 Ga0495675_0033821 3300047444 Bacteria 3263
1184 Ga0495675_0068006 3300047444 Bacteria 2251
1185 Ga0495675_0273848 3300047444 Bacteria 1008
1186 Ga0495677_0003900 3300047445 Bacteria 5768
1187 Ga0495679_000087 3300047446 Bacteria 85691
1188 Ga0495679_000377 3300047446 Bacteria 34132
1189 Ga0495679_012040 3300047446 Bacteria 3313
1190 Ga0495673_0000019 3300047469 Bacteria 554389
1191 Ga0495673_0001933 3300047469 Bacteria 15387
1192 Ga0495673_0002323 3300047469 Bacteria 13555
1193 Ga0495673_0009651 3300047469 Bacteria 5321
1194 Ga0495673_0015126 3300047469 Bacteria 3986
1195 Ga0495673_0015438 3300047469 Bacteria 3935
1196 Ga0495673_0027991 3300047469 Bacteria 2674
1197 Ga0495673_0043729 3300047469 Bacteria 2002
1198 Ga0495673_0097623 3300047469 Bacteria 1192
1199 Ga0495681_0016581 3300047470 Bacteria 4121
1200 Ga0495684_0000398 3300047471 Bacteria 35517
1201 Ga0495684_0040686 3300047471 Bacteria 3563
1202 Ga0495684_0195055 3300047471 Bacteria 1495
1203 Ga0495686_0016655 3300047472 Bacteria 4977
1204 Ga0495686_0075906 3300047472 Bacteria 2060
1205 Ga0495593_0045035 3300047673 Bacteria 2356
1206 Ga0495602_0015186 3300048088 Bacteria 7783
1207 Ga0495602_0186702 3300048088 Bacteria 1593
1208 Ga0495602_0194688 3300048088 Bacteria 1551
1209 Ga0495615_0002290 3300048090 Bacteria 3049
1210 Ga0495626_0000098 3300048091 Bacteria 113821
1211 Ga0495626_0004696 3300048091 Bacteria 8284
1212 Ga0495626_0006801 3300048091 Bacteria 6463
1213 Ga0495626_0033602 3300048091 Bacteria 2457
1214 Ga0495626_0038730 3300048091 Bacteria 2258
1215 Ga0496102_0000991 3300048905 Bacteria 26693
1216 Ga0496102_0034926 3300048905 Bacteria 4525
1217 Ga0496103_0000997 3300048906 Bacteria 19928
1218 Ga0496103_0048117 3300048906 Bacteria 2635
1219 Ga0496104_0000260 3300048907 Bacteria 46567
1220 Ga0496104_0148724 3300048907 Bacteria 2249
1221 Ga0496104_0404671 3300048907 Bacteria 1277
1222 Ga0496105_0000156 3300048908 Bacteria 45175
1223 Ga0496105_0163634 3300048908 Bacteria 1826
1224 Ga0496110_0009694 3300048913 Bacteria 7799
1225 Ga0496110_0048656 3300048913 Bacteria 3717
1226 Ga0496110_0056893 3300048913 Bacteria 3441
1227 Ga0496110_0136059 3300048913 Bacteria 2220
1228 Ga0496111_0126132 3300048914 Bacteria 1892
1229 Ga0496112_0006585 3300048915 Bacteria 10224
1230 Ga0496113_0173044 3300048916 Bacteria 1710
1231 Ga0496114_0003707 3300048917 Bacteria 11759
1232 Ga0496114_0061464 3300048917 Bacteria 3142
1233 Ga0496115_0007686 3300048918 Bacteria 7946
1234 Ga0496115_0024949 3300048918 Bacteria 4651
1235 Ga0496115_0287935 3300048918 Bacteria 1348
1236 Ga0496116_0000007 3300048919 Bacteria 795464
1237 Ga0496116_0010359 3300048919 Bacteria 7826
1238 Ga0496116_0045906 3300048919 Bacteria 2953
1239 Ga0496117_0001323 3300048920 Bacteria 36451
1240 Ga0496117_0001620 3300048920 Bacteria 31800
1241 Ga0496117_0002783 3300048920 Bacteria 21400
1242 Ga0496117_0003088 3300048920 Bacteria 19934
1243 Ga0496117_0006308 3300048920 Bacteria 12062
1244 Ga0496117_0012255 3300048920 Bacteria 7580
1245 Ga0496117_0018402 3300048920 Bacteria 5786
1246 Ga0496118_0002712 3300048921 Bacteria 23338
1247 Ga0496118_0002985 3300048921 Bacteria 21881
1248 Ga0496118_0006537 3300048921 Bacteria 12752
1249 Ga0496118_0036587 3300048921 Bacteria 3965
1250 Ga0496118_0052475 3300048921 Bacteria 3109
1251 Ga0496119_0000612 3300048922 Bacteria 48284
1252 Ga0496120_0001054 3300048923 Bacteria 36515
1253 Ga0496120_0008485 3300048923 Bacteria 7452
1254 Ga0496121_0007202 3300048924 Bacteria 13471
1255 Ga0496121_0030502 3300048924 Bacteria 4951
1256 Ga0496121_0034409 3300048924 Bacteria 4560
1257 Ga0496121_0094533 3300048924 Bacteria 2325
1258 Ga0496122_0001943 3300048925 Bacteria 31037
1259 Ga0496122_0002404 3300048925 Bacteria 26680
1260 Ga0496122_0007083 3300048925 Bacteria 12597
1261 Ga0496122_0019738 3300048925 Bacteria 6141
1262 Ga0496122_0022598 3300048925 Bacteria 5583
1263 Ga0496123_0000439 3300048926 Bacteria 74838
1264 Ga0496123_0001575 3300048926 Bacteria 31163
1265 Ga0496123_0014417 3300048926 Bacteria 6553
1266 Ga0496123_0026678 3300048926 Bacteria 4320
1267 Ga0496123_0054519 3300048926 Bacteria 2631
1268 Ga0496123_0058743 3300048926 Bacteria 2492
1269 Ga0496124_0000132 3300048927 Bacteria 155405
1270 Ga0496124_0001693 3300048927 Bacteria 31219
1271 Ga0496124_0002023 3300048927 Bacteria 27562
1272 Ga0496124_0006195 3300048927 Bacteria 13110
1273 Ga0496124_0006210 3300048927 Bacteria 13091
1274 Ga0496124_0015103 3300048927 Bacteria 7424
1275 Ga0496124_0038452 3300048927 Bacteria 4155
1276 Ga0496124_0045902 3300048927 Bacteria 3744
1277 Ga0496124_0059474 3300048927 Bacteria 3210
1278 Ga0496124_0060348 3300048927 Bacteria 3181
1279 Ga0496124_0173557 3300048927 Bacteria 1666
1280 Ga0496125_0000380 3300048928 Bacteria 82955
1281 Ga0496125_0001691 3300048928 Bacteria 30828
1282 Ga0496125_0004712 3300048928 Bacteria 15545
1283 Ga0496125_0024615 3300048928 Bacteria 5530
1284 Ga0496125_0038928 3300048928 Bacteria 4105
1285 Ga0496125_0099344 3300048928 Bacteria 2150
1286 Ga0496126_0000101 3300048929 Bacteria 201606
1287 Ga0496126_0097180 3300048929 Bacteria 2581
1288 Ga0496126_0154973 3300048929 Bacteria 1961
1289 Ga0496126_0339330 3300048929 Bacteria 1231
1290 Ga0496126_0388229 3300048929 Bacteria 1135
1291 Ga0495678_000049 3300049459 Bacteria 163929
1292 Ga0495678_000579 3300049459 Bacteria 34743
1293 Ga0495678_002688 3300049459 Bacteria 11735
1294 Ga0495678_006374 3300049459 Bacteria 6291
1295 Ga0495678_008976 3300049459 Bacteria 4993
1296 Ga0495678_039896 3300049459 Bacteria 1890
1297 Ga0495678_080824 3300049459 Bacteria 1167
1298 Ga0495682_0000011 3300049460 Bacteria 278474
1299 Ga0495682_0000128 3300049460 Bacteria 65703
1300 Ga0495682_0001668 3300049460 Bacteria 11355
1301 Ga0495682_0017012 3300049460 Bacteria 2749
1302 Ga0495682_0019899 3300049460 Bacteria 2521
1303 Ga0501031_0011752 3300049568 Bacteria 5711
1304 Ga0501031_0030930 3300049568 Bacteria 3493
1305 Ga0501032_0001038 3300049569 Bacteria 22303
1306 Ga0501032_0001256 3300049569 Bacteria 20363
1307 Ga0501032_0006131 3300049569 Bacteria 8855
1308 Ga0501032_0009678 3300049569 Bacteria 6982
1309 Ga0501033_0003841 3300049570 Bacteria 12212
1310 Ga0501033_0007400 3300049570 Bacteria 8549
1311 Ga0501033_0009063 3300049570 Bacteria 7677
1312 Ga0501033_0016351 3300049570 Bacteria 5619
1313 Ga0501034_0000041 3300049571 Bacteria 229264
1314 Ga0501034_0002365 3300049571 Bacteria 22914
1315 Ga0501034_0008207 3300049571 Bacteria 11064
1316 Ga0501034_0020051 3300049571 Bacteria 6828
1317 Ga0501034_0030857 3300049571 Bacteria 5447
1318 Ga0501034_0127735 3300049571 Bacteria 2527
1319 Ga0501034_0324523 3300049571 Bacteria 1472
1320 Ga0501036_0000583 3300049572 Bacteria 26372
1321 Ga0501036_0000764 3300049572 Bacteria 23858
1322 Ga0501037_0002333 3300049573 Bacteria 13707
1323 Ga0501037_0014890 3300049573 Bacteria 5721
1324 Ga0501037_0040016 3300049573 Bacteria 3450
1325 Ga0501037_0124890 3300049573 Bacteria 1848
1326 Ga0501037_0134521 3300049573 Bacteria 1771
1327 Ga0501038_0003064 3300049574 Bacteria 15576
1328 Ga0501038_0007027 3300049574 Bacteria 10398
1329 Ga0501038_0007681 3300049574 Bacteria 9943
1330 Ga0501038_0020808 3300049574 Bacteria 5896
1331 Ga0501038_0157567 3300049574 Bacteria 1848
1332 Ga0501039_0004609 3300049575 Bacteria 10423
1333 Ga0501039_0011648 3300049575 Bacteria 6697
1334 Ga0501039_0171108 3300049575 Bacteria 1708
1335 Ga0501040_0009107 3300049576 Bacteria 6463
1336 Ga0501040_0106982 3300049576 Bacteria 1954
1337 Ga0501042_0003284 3300049578 Bacteria 10121
1338 Ga0501042_0142376 3300049578 Bacteria 1729
1339 Ga0501043_0004581 3300049579 Bacteria 11214
1340 Ga0501043_0005319 3300049579 Bacteria 10404
1341 Ga0501043_0006282 3300049579 Bacteria 9537
1342 Ga0501043_0035508 3300049579 Bacteria 3921
1343 Ga0501043_0139463 3300049579 Bacteria 1899
1344 Ga0501046_0000889 3300049580 Bacteria 29096
1345 Ga0501046_0001127 3300049580 Bacteria 26110
1346 Ga0501046_0050465 3300049580 Bacteria 3287
1347 Ga0501047_0002434 3300049581 Bacteria 17788
1348 Ga0501048_0005502 3300049582 Bacteria 9636
1349 Ga0501048_0031545 3300049582 Bacteria 3833
1350 Ga0501067_0012770 3300049583 Bacteria 4653
1351 Ga0501068_0011869 3300049584 Bacteria 4925
1352 Ga0501068_0129193 3300049584 Bacteria 1579
1353 Ga0501069_0000937 3300049585 Bacteria 13931
1354 Ga0501070_0030461 3300049586 Bacteria 4521
1355 Ga0501072_0011524 3300049588 Bacteria 6757
1356 Ga0501073_0026765 3300049589 Bacteria 4129
1357 Ga0501076_0205757 3300049592 Bacteria 1608
1358 Ga0501077_0004163 3300049593 Bacteria 8737
1359 Ga0501079_0028748 3300049741 Bacteria 4267
1360 Ga0501080_0145730 3300049742 Bacteria 2189
1361 Ga0501081_0181438 3300049743 Bacteria 1523
1362 Ga0501083_0002458 3300049744 Bacteria 12688
1363 Ga0501083_0007866 3300049744 Bacteria 7552
1364 Ga0501035_0000158 3300049822 Bacteria 82890
1365 Ga0501035_0003883 3300049822 Bacteria 14259
1366 Ga0501035_0006972 3300049822 Bacteria 10552
1367 Ga0501035_0191013 3300049822 Bacteria 1761
1368 Ga0501044_0000190 3300049823 Bacteria 77415
1369 Ga0501044_0015234 3300049823 Bacteria 8282
1370 Ga0501044_0028814 3300049823 Bacteria 5857
1371 Ga0501044_0084786 3300049823 Bacteria 3201
1372 Ga0501044_0126007 3300049823 Bacteria 2559
1373 Ga0501044_0164704 3300049823 Bacteria 2192
1374 Ga0501044_0253119 3300049823 Bacteria 1701
1375 Ga0501045_0001759 3300049824 Bacteria 14603
1376 Ga0501226_000007 3300049853 Bacteria 227827
1377 nmdc:mga05p37_2980_c1 3300050507 Bacteria 19673
1378 nmdc:mga06r32_274823_c1 3300050510 Bacteria 1672
1379 nmdc:mga08y16_181967_c1 3300050511 Bacteria 2182
1380 nmdc:mga08y16_6325_c1 3300050511 Bacteria 12421
1381 nmdc:mga08y16_95630_c1 3300050511 Bacteria 3094
1382 nmdc:mga08x19_624_c1 3300050514 Bacteria 22809
1383 Ga0495601_0021931 3300053077 Bacteria 3917
1384 Ga0495601_0248421 3300053077 Bacteria 1162
1385 Ga0495612_0024226 3300053078 Bacteria 2437
1386 Ga0500595_007403 3300053119 Bacteria 4556
1387 Ga0500618_005360 3300053125 Bacteria 3913
1388 Ga0500621_000005 3300053126 Bacteria 320383
1389 Ga0500659_0035137 3300053135 Bacteria 2731
1390 Ga0500564_013234 3300053138 Bacteria 3688
1391 Ga0500568_0005172 3300053139 Bacteria 6802
1392 Ga0500604_0053869 3300053151 Bacteria 1248
1393 Ga0500616_0035421 3300053153 Bacteria 2714
1394 Ga0501084_0001126 3300054114 Bacteria 20857
1395 Ga0501084_0019920 3300054114 Bacteria 5592
1396 Ga0590071_005287 3300059421 Bacteria 3112
1397 Ga0501082_0005501 3300060353 Bacteria 10993

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035116 Ga0373945_0106995 Ga0373945_0106995_46_861 268
2 3300035118 Ga0373954_0044561 Ga0373954_0044561_930_1847 275
3 3300045051 Ga0451576_0145838 Ga0451576_0145838_12_839 275
4 3300035724 Ga0373933_0073672 Ga0373933_0073672_196_1164 280
5 3300035725 Ga0373947_0099937 Ga0373947_0099937_30_929 280
6 3300047472 Ga0495686_0016655 Ga0495686_0016655_3599_4531 280
7 3300049579 Ga0501043_0139463 Ga0501043_0139463_800_1762 280
8 3300049823 Ga0501044_0015234 Ga0501044_0015234_1407_2369 280
9 3300046463 Ga0495653_0111964 Ga0495653_0111964_225_1157 281
10 3300046512 Ga0495610_0000021 Ga0495610_0000021_323969_324901 281
11 3300005435 Ga0070714_100222041 Ga0070714_1002220412 282
12 3300025915 Ga0207693_10018001 Ga0207693_100180017 282
13 3300025929 Ga0207664_10231859 Ga0207664_102318592 282
14 3300035113 Ga0373936_0066099 Ga0373936_0066099_115_1116 282
15 3300046559 Ga0495667_0118620 Ga0495667_0118620_683_1684 282
16 3300005435 Ga0070714_100038188 Ga0070714_1000381882 283
17 3300049570 Ga0501033_0016351 Ga0501033_0016351_4414_5373 283
18 3300053078 Ga0495612_0024226 Ga0495612_0024226_166_1068 283
19 3300028800 Ga0265338_10006479 Ga0265338_1000647911 284
20 3300046692 Ga0495671_0000024 Ga0495671_0000024_198365_199297 284
21 3300025910 Ga0207684_10415456 Ga0207684_104154561 285
22 3300021441 Ga0213871_10034082 Ga0213871_100340822 287
23 3300039447 Ga0436361_0285134 Ga0436361_0285134_886_1860 287
24 3300025728 Ga0207655_1014419 Ga0207655_10144192 288
25 3300046474 Ga0495605_0005925 Ga0495605_0005925_2469_3443 288
26 3300046507 Ga0495606_0015513 Ga0495606_0015513_2613_3587 288
27 3300048921 Ga0496118_0036587 Ga0496118_0036587_2507_3535 288
28 3300048924 Ga0496121_0034409 Ga0496121_0034409_2310_3338 288
29 3300048925 Ga0496122_0001943 Ga0496122_0001943_27657_28685 288
30 3300048926 Ga0496123_0001575 Ga0496123_0001575_2335_3363 288
31 3300005539 Ga0068853_100013136 Ga0068853_1000131364 289
32 3300025927 Ga0207687_10064122 Ga0207687_100641222 289
33 3300025941 Ga0207711_10192714 Ga0207711_101927142 289
34 3300026041 Ga0207639_10026567 Ga0207639_100265671 289
35 3300031344 Ga0265316_10008374 Ga0265316_100083745 289
36 3300049571 Ga0501034_0324523 Ga0501034_0324523_375_1304 289
37 iso_pu_bacteria 2626541554 2626635872 289
38 3300005468 Ga0070707_100061755 Ga0070707_1000617553 290
39 3300005518 Ga0070699_100191326 Ga0070699_1001913261 290
40 3300013105 Ga0157369_10285226 Ga0157369_102852262 290
41 3300026078 Ga0207702_10051541 Ga0207702_100515413 290
42 3300035117 Ga0373953_0021778 Ga0373953_0021778_653_1585 290
43 3300053077 Ga0495601_0248421 Ga0495601_0248421_83_1015 290
44 3300013102 Ga0157371_10015917 Ga0157371_100159175 291
45 3300028800 Ga0265338_10263578 Ga0265338_102635781 291
46 3300031344 Ga0265316_10150442 Ga0265316_101504422 291
47 3300041405 Ga0439438_000002 Ga0439438_000002_449725_450696 291
48 3300041407 Ga0439447_001496 Ga0439447_001496_6431_7402 291
49 3300042006 Ga0439432_002789 Ga0439432_002789_5160_6131 291
50 3300005327 Ga0070658_10077856 Ga0070658_100778562 292
51 3300005329 Ga0070683_100043891 Ga0070683_1000438913 292
52 3300005329 Ga0070683_100065855 Ga0070683_1000658554 292
53 3300005341 Ga0070691_10012197 Ga0070691_100121971 292
54 3300005435 Ga0070714_100042300 Ga0070714_1000423003 292
55 3300005435 Ga0070714_100096603 Ga0070714_1000966031 292
56 3300005436 Ga0070713_100017674 Ga0070713_1000176747 292
57 3300005530 Ga0070679_100255785 Ga0070679_1002557851 292
58 3300005535 Ga0070684_100208463 Ga0070684_1002084632 292
59 3300005563 Ga0068855_100390540 Ga0068855_1003905402 292
60 3300005564 Ga0070664_100145049 Ga0070664_1001450493 292
61 3300005577 Ga0068857_100006173 Ga0068857_1000061733 292
62 3300005616 Ga0068852_100012657 Ga0068852_1000126574 292
63 3300006028 Ga0070717_10307513 Ga0070717_103075131 292
64 3300009093 Ga0105240_10251119 Ga0105240_102511192 292
65 3300009551 Ga0105238_10000238 Ga0105238_1000023838 292
66 3300009551 Ga0105238_10091092 Ga0105238_100910922 292
67 3300009551 Ga0105238_10121358 Ga0105238_101213581 292
68 3300009551 Ga0105238_10181828 Ga0105238_101818282 292
69 3300013105 Ga0157369_10015015 Ga0157369_100150159 292
70 3300013105 Ga0157369_10131266 Ga0157369_101312662 292
71 3300013307 Ga0157372_10836391 Ga0157372_108363911 292
72 3300020069 Ga0197907_10075445 Ga0197907_100754451 292
73 3300020076 Ga0206355_1560789 Ga0206355_15607891 292
74 3300020077 Ga0206351_10065214 Ga0206351_100652141 292
75 3300020078 Ga0206352_10666988 Ga0206352_106669881 292
76 3300020080 Ga0206350_10221737 Ga0206350_102217371 292
77 3300020080 Ga0206350_10379269 Ga0206350_103792691 292
78 3300020080 Ga0206350_10938216 Ga0206350_109382161 292
79 3300020081 Ga0206354_10594356 Ga0206354_105943561 292
80 3300020081 Ga0206354_11413883 Ga0206354_114138831 292
81 3300020082 Ga0206353_11342932 Ga0206353_113429322 292
82 3300022467 Ga0224712_10039765 Ga0224712_100397651 292
83 3300022467 Ga0224712_10099106 Ga0224712_100991062 292
84 3300022467 Ga0224712_10135246 Ga0224712_101352461 292
85 3300025912 Ga0207707_10064455 Ga0207707_100644553 292
86 3300025913 Ga0207695_10009140 Ga0207695_100091409 292
87 3300025919 Ga0207657_10010431 Ga0207657_100104319 292
88 3300025924 Ga0207694_10005299 Ga0207694_100052994 292
89 3300025928 Ga0207700_10001065 Ga0207700_100010656 292
90 3300025929 Ga0207664_10035151 Ga0207664_100351513 292
91 3300025944 Ga0207661_10001589 Ga0207661_100015897 292
92 3300025944 Ga0207661_10101271 Ga0207661_101012713 292
93 3300025945 Ga0207679_10124674 Ga0207679_101246741 292
94 3300025949 Ga0207667_10012222 Ga0207667_100122222 292
95 3300026116 Ga0207674_10049531 Ga0207674_100495313 292
96 3300031251 Ga0265327_10004822 Ga0265327_100048226 292
97 3300036401 Ga0373937_0315761 Ga0373937_0315761_290_1222 292
98 3300046559 Ga0495667_0194558 Ga0495667_0194558_131_1063 292
99 3300048907 Ga0496104_0404671 Ga0496104_0404671_293_1225 292
100 3300048913 Ga0496110_0048656 Ga0496110_0048656_753_1685 292
101 3300048915 Ga0496112_0006585 Ga0496112_0006585_4424_5356 292
102 3300059421 Ga0590071_005287 Ga0590071_005287_801_1736 292
103 3300005458 Ga0070681_10146899 Ga0070681_101468993 293
104 3300005530 Ga0070679_100198544 Ga0070679_1001985441 293
105 3300005331 Ga0070670_100135408 Ga0070670_1001354082 294
106 3300039453 Ga0436362_0084096 Ga0436362_0084096_1299_2252 294
107 3300046543 Ga0495645_0037723 Ga0495645_0037723_609_1496 294
108 3300005329 Ga0070683_100318770 Ga0070683_1003187702 295
109 3300005535 Ga0070684_100060988 Ga0070684_1000609882 295
110 3300009093 Ga0105240_10759923 Ga0105240_107599231 295
111 3300025944 Ga0207661_10381350 Ga0207661_103813502 295
112 3300036647 Ga0316582_0036189 Ga0316582_0036189_1061_1981 295
113 3300039093 Ga0400489_59676 Ga0400489_59676_1285_2205 295
114 3300046458 Ga0495591_010786 Ga0495591_010786_11_1039 295
115 3300050511 nmdc:mga08y16_181967_c1 nmdc:mga08y16_181967_c1_98_991 295
116 3300053153 Ga0500616_0035421 Ga0500616_0035421_1634_2602 295
117 3300006844 Ga0075428_100050306 Ga0075428_1000503066 296
118 3300009011 Ga0105251_10000653 Ga0105251_100006537 296
119 3300039437 Ga0436365_1490124 Ga0436365_1490124_967_1920 296
120 3300045051 Ga0451576_0007599 Ga0451576_0007599_8500_9459 296
121 3300046453 Ga0495627_000143 Ga0495627_000143_57381_58355 296
122 3300046515 Ga0495620_0001337 Ga0495620_0001337_1731_2816 296
123 3300046518 Ga0495631_0001469 Ga0495631_0001469_4571_5545 296
124 3300046519 Ga0495632_0024047 Ga0495632_0024047_962_1936 296
125 3300046530 Ga0495654_0000588 Ga0495654_0000588_11731_12705 296
126 3300046530 Ga0495654_0104304 Ga0495654_0104304_185_1159 296
127 3300046692 Ga0495671_0002880 Ga0495671_0002880_7861_8835 296
128 3300046694 Ga0495649_0003919 Ga0495649_0003919_8348_9322 296
129 3300047320 Ga0495672_0004429 Ga0495672_0004429_8692_9666 296
130 3300047469 Ga0495673_0002323 Ga0495673_0002323_1886_2971 296
131 3300053125 Ga0500618_005360 Ga0500618_005360_1130_2104 296
132 3300005338 Ga0068868_100031941 Ga0068868_1000319412 297
133 3300005548 Ga0070665_100083206 Ga0070665_1000832064 297
134 3300006358 Ga0068871_100137250 Ga0068871_1001372502 297
135 3300009011 Ga0105251_10023484 Ga0105251_100234842 297
136 3300009092 Ga0105250_10018481 Ga0105250_100184812 297
137 3300009093 Ga0105240_10003683 Ga0105240_1000368311 297
138 3300009098 Ga0105245_10373911 Ga0105245_103739112 297
139 3300009176 Ga0105242_10089909 Ga0105242_100899093 297
140 3300009177 Ga0105248_10460787 Ga0105248_104607872 297
141 3300009545 Ga0105237_10149607 Ga0105237_101496072 297
142 3300009551 Ga0105238_10093299 Ga0105238_100932992 297
143 3300013296 Ga0157374_10192967 Ga0157374_101929672 297
144 3300013306 Ga0163162_10139987 Ga0163162_101399872 297
145 3300025711 Ga0207696_1003215 Ga0207696_10032152 297
146 3300025735 Ga0207713_1023540 Ga0207713_10235402 297
147 3300025914 Ga0207671_10050164 Ga0207671_100501644 297
148 3300025944 Ga0207661_10457424 Ga0207661_104574241 297
149 3300026023 Ga0207677_10067902 Ga0207677_100679022 297
150 3300039437 Ga0436365_0497797 Ga0436365_0497797_275_1300 297
151 3300046499 Ga0495594_0188393 Ga0495594_0188393_96_1046 297
152 3300029957 Ga0265324_10010285 Ga0265324_100102853 298
153 3300031090 Ga0265760_10029106 Ga0265760_100291062 298
154 3300031235 Ga0265330_10029355 Ga0265330_100293552 298
155 3300031240 Ga0265320_10002060 Ga0265320_100020609 298
156 3300031241 Ga0265325_10038411 Ga0265325_100384112 298
157 3300031242 Ga0265329_10011734 Ga0265329_100117342 298
158 3300031242 Ga0265329_10021672 Ga0265329_100216722 298
159 3300031249 Ga0265339_10003717 Ga0265339_100037172 298
160 3300031250 Ga0265331_10012348 Ga0265331_100123483 298
161 3300031251 Ga0265327_10000503 Ga0265327_1000050313 298
162 3300031344 Ga0265316_10029280 Ga0265316_100292802 298
163 3300031344 Ga0265316_10208700 Ga0265316_102087002 298
164 3300031344 Ga0265316_10287086 Ga0265316_102870861 298
165 3300031711 Ga0265314_10003642 Ga0265314_100036429 298
166 3300031712 Ga0265342_10014722 Ga0265342_100147221 298
167 3300031728 Ga0316578_10079635 Ga0316578_100796352 298
168 3300036647 Ga0316582_0205402 Ga0316582_0205402_204_1163 298
169 3300044712 Ga0453684_0485017 Ga0453684_0485017_206_1138 298
170 3300048929 Ga0496126_0154973 Ga0496126_0154973_324_1277 298
171 3300028653 Ga0265323_10000729 Ga0265323_100007297 299
172 3300028653 Ga0265323_10001018 Ga0265323_1000101813 299
173 3300031235 Ga0265330_10035564 Ga0265330_100355642 299
174 3300031239 Ga0265328_10001141 Ga0265328_100011418 299
175 3300031240 Ga0265320_10004794 Ga0265320_100047948 299
176 3300031251 Ga0265327_10019468 Ga0265327_100194682 299
177 3300031344 Ga0265316_10012518 Ga0265316_100125182 299
178 3300031344 Ga0265316_10030608 Ga0265316_100306085 299
179 3300031712 Ga0265342_10007313 Ga0265342_100073135 299
180 3300031712 Ga0265342_10166351 Ga0265342_101663511 299
181 3300037853 Ga0436364_0514524 Ga0436364_0514524_23_925 299
182 3300039447 Ga0436361_0682766 Ga0436361_0682766_1964_2926 299
183 3300044673 Ga0453683_0074008 Ga0453683_0074008_1180_2094 299
184 3300044712 Ga0453684_0055436 Ga0453684_0055436_3661_4602 299
185 3300045051 Ga0451576_0083463 Ga0451576_0083463_38_952 299
186 3300005289 Ga0065704_10006591 Ga0065704_100065915 300
187 3300009011 Ga0105251_10003325 Ga0105251_100033254 300
188 3300009036 Ga0105244_10035696 Ga0105244_100356961 300
189 3300009036 Ga0105244_10035795 Ga0105244_100357953 300
190 3300009148 Ga0105243_10023492 Ga0105243_100234923 300
191 3300025711 Ga0207696_1000010 Ga0207696_1000010146 300
192 3300025728 Ga0207655_1015788 Ga0207655_10157884 300
193 3300025735 Ga0207713_1011564 Ga0207713_10115644 300
194 3300025935 Ga0207709_10009838 Ga0207709_100098383 300
195 3300031238 Ga0265332_10003905 Ga0265332_100039052 300
196 3300031241 Ga0265325_10123463 Ga0265325_101234631 300
197 3300031250 Ga0265331_10047240 Ga0265331_100472403 300
198 3300046515 Ga0495620_0000002 Ga0495620_0000002_247983_248957 300
199 3300046522 Ga0495643_0002672 Ga0495643_0002672_4385_5359 300
200 3300046524 Ga0495648_0000521 Ga0495648_0000521_39023_39997 300
201 3300048913 Ga0496110_0136059 Ga0496110_0136059_664_1656 300
202 3300048917 Ga0496114_0061464 Ga0496114_0061464_952_1926 300
203 3300048920 Ga0496117_0001323 Ga0496117_0001323_15843_16817 300
204 3300048920 Ga0496117_0012255 Ga0496117_0012255_3263_4237 300
205 3300048921 Ga0496118_0002985 Ga0496118_0002985_19058_20032 300
206 3300048927 Ga0496124_0006195 Ga0496124_0006195_1372_2364 300
207 3300048927 Ga0496124_0038452 Ga0496124_0038452_1568_2542 300
208 3300048928 Ga0496125_0000380 Ga0496125_0000380_45744_46718 300
209 3300049576 Ga0501040_0009107 Ga0501040_0009107_3534_4454 300
210 3300049578 Ga0501042_0142376 Ga0501042_0142376_386_1306 300
211 3300049592 Ga0501076_0205757 Ga0501076_0205757_561_1481 300
212 3300049743 Ga0501081_0181438 Ga0501081_0181438_497_1417 300
213 3300053139 Ga0500568_0005172 Ga0500568_0005172_2223_3176 300
214 3300027312 Ga0209371_1007522 Ga0209371_10075222 301
215 3300028653 Ga0265323_10023964 Ga0265323_100239642 301
216 3300028800 Ga0265338_10049222 Ga0265338_100492223 301
217 3300030500 Ga0268256_1007753 Ga0268256_10077533 301
218 3300031241 Ga0265325_10006487 Ga0265325_100064875 301
219 3300031247 Ga0265340_10000882 Ga0265340_100008823 301
220 3300031249 Ga0265339_10072546 Ga0265339_100725461 301
221 3300031250 Ga0265331_10002644 Ga0265331_100026448 301
222 3300031711 Ga0265314_10000007 Ga0265314_1000000794 301
223 3300031712 Ga0265342_10000619 Ga0265342_1000061930 301
224 3300037853 Ga0436364_1501586 Ga0436364_1501586_689_1597 301
225 3300039453 Ga0436362_0297328 Ga0436362_0297328_367_1275 301
226 3300046458 Ga0495591_006035 Ga0495591_006035_1561_2532 301
227 3300046471 Ga0495650_0000065 Ga0495650_0000065_223973_224944 301
228 3300046474 Ga0495605_0042442 Ga0495605_0042442_766_1737 301
229 3300046501 Ga0495607_0003645 Ga0495607_0003645_3623_4594 301
230 3300046507 Ga0495606_0016101 Ga0495606_0016101_3067_4038 301
231 3300046513 Ga0495616_0059646 Ga0495616_0059646_638_1609 301
232 3300046523 Ga0495644_0003708 Ga0495644_0003708_4909_5880 301
233 3300046524 Ga0495648_0009937 Ga0495648_0009937_2068_3039 301
234 3300046530 Ga0495654_0000102 Ga0495654_0000102_41054_42025 301
235 3300046692 Ga0495671_0002113 Ga0495671_0002113_8591_9562 301
236 3300046694 Ga0495649_0008042 Ga0495649_0008042_716_1687 301
237 3300046794 Ga0495589_0089809 Ga0495589_0089809_486_1457 301
238 3300046810 Ga0495660_0000017 Ga0495660_0000017_125595_126566 301
239 3300047320 Ga0495672_0000001 Ga0495672_0000001_1250174_1251145 301
240 3300047323 Ga0495683_0125868 Ga0495683_0125868_113_1084 301
241 3300047469 Ga0495673_0000019 Ga0495673_0000019_359401_360372 301
242 3300049459 Ga0495678_000579 Ga0495678_000579_7211_8182 301
243 3300049460 Ga0495682_0000011 Ga0495682_0000011_221064_222035 301
244 3300049744 Ga0501083_0002458 Ga0501083_0002458_5831_6799 301
245 3300053126 Ga0500621_000005 Ga0500621_000005_116113_117084 301
246 3300054114 Ga0501084_0019920 Ga0501084_0019920_1704_2672 301
247 iso_pu_bacteria 2887630918 2887631791 301
248 3300013297 Ga0157378_10376010 Ga0157378_103760102 302
249 3300028666 Ga0265336_10003605 Ga0265336_100036053 302
250 3300031240 Ga0265320_10005502 Ga0265320_100055025 302
251 3300031250 Ga0265331_10068261 Ga0265331_100682611 302
252 3300031711 Ga0265314_10017132 Ga0265314_100171325 302
253 3300031712 Ga0265342_10000058 Ga0265342_1000005888 302
254 3300039438 Ga0436360_0378330 Ga0436360_0378330_1191_2102 302
255 3300046538 Ga0495609_0057899 Ga0495609_0057899_332_1306 302
256 3300048927 Ga0496124_0000132 Ga0496124_0000132_129068_130042 302
257 iso_pu_bacteria 8002317523 8002317854 302
258 3300005329 Ga0070683_100063164 Ga0070683_1000631643 303
259 3300005334 Ga0068869_100135873 Ga0068869_1001358732 303
260 3300005458 Ga0070681_10107898 Ga0070681_101078983 303
261 3300005535 Ga0070684_100079773 Ga0070684_1000797733 303
262 3300005577 Ga0068857_100039946 Ga0068857_1000399462 303
263 3300009174 Ga0105241_10164967 Ga0105241_101649672 303
264 3300009176 Ga0105242_10026595 Ga0105242_100265955 303
265 3300009177 Ga0105248_10739221 Ga0105248_107392211 303
266 3300009551 Ga0105238_10117899 Ga0105238_101178995 303
267 3300013307 Ga0157372_10047751 Ga0157372_100477516 303
268 3300021377 Ga0213874_10004805 Ga0213874_100048054 303
269 3300021384 Ga0213876_10010217 Ga0213876_100102174 303
270 3300025250 Ga0209026_1000711 Ga0209026_10007113 303
271 3300025912 Ga0207707_10224707 Ga0207707_102247073 303
272 3300025924 Ga0207694_10071687 Ga0207694_100716871 303
273 3300025934 Ga0207686_10002054 Ga0207686_1000205411 303
274 3300025942 Ga0207689_10157260 Ga0207689_101572602 303
275 3300026088 Ga0207641_10404785 Ga0207641_104047852 303
276 3300026116 Ga0207674_10011685 Ga0207674_1001168512 303
277 3300028380 Ga0268265_10543460 Ga0268265_105434601 303
278 3300028558 Ga0265326_10007728 Ga0265326_100077282 303
279 3300029957 Ga0265324_10000026 Ga0265324_1000002641 303
280 3300031235 Ga0265330_10005891 Ga0265330_100058915 303
281 3300035172 Ga0373955_0114834 Ga0373955_0114834_512_1468 303
282 3300035695 Ga0373927_0063083 Ga0373927_0063083_788_1744 303
283 3300037853 Ga0436364_1151958 Ga0436364_1151958_2001_2954 303
284 3300039437 Ga0436365_0139104 Ga0436365_0139104_2573_3526 303
285 3300039450 Ga0436363_1560073 Ga0436363_1560073_8205_9158 303
286 3300044712 Ga0453684_0016279 Ga0453684_0016279_6699_7655 303
287 3300046472 Ga0495580_0011408 Ga0495580_0011408_5266_6222 303
288 3300005330 Ga0070690_100190414 Ga0070690_1001904142 304
289 3300005344 Ga0070661_100192544 Ga0070661_1001925442 304
290 3300005355 Ga0070671_100249178 Ga0070671_1002491782 304
291 3300005366 Ga0070659_100012188 Ga0070659_1000121887 304
292 3300005535 Ga0070684_100128047 Ga0070684_1001280472 304
293 3300005564 Ga0070664_100267301 Ga0070664_1002673012 304
294 3300005614 Ga0068856_100144072 Ga0068856_1001440722 304
295 3300005842 Ga0068858_100162062 Ga0068858_1001620622 304
296 3300009094 Ga0111539_10187945 Ga0111539_101879452 304
297 3300009174 Ga0105241_10043069 Ga0105241_100430692 304
298 3300009176 Ga0105242_10263249 Ga0105242_102632492 304
299 3300009177 Ga0105248_10006442 Ga0105248_100064426 304
300 3300013296 Ga0157374_10016482 Ga0157374_100164823 304
301 3300014325 Ga0163163_10031285 Ga0163163_100312854 304
302 3300025924 Ga0207694_10021698 Ga0207694_100216982 304
303 3300025927 Ga0207687_10276527 Ga0207687_102765271 304
304 3300025931 Ga0207644_10272376 Ga0207644_102723761 304
305 3300025932 Ga0207690_10016310 Ga0207690_100163103 304
306 3300025937 Ga0207669_10357081 Ga0207669_103570811 304
307 3300025941 Ga0207711_10025879 Ga0207711_100258793 304
308 3300025945 Ga0207679_10218628 Ga0207679_102186282 304
309 3300025949 Ga0207667_10018428 Ga0207667_100184282 304
310 3300026078 Ga0207702_10051880 Ga0207702_100518802 304
311 3300026121 Ga0207683_10276890 Ga0207683_102768902 304
312 3300028653 Ga0265323_10001673 Ga0265323_100016733 304
313 3300031239 Ga0265328_10000076 Ga0265328_1000007621 304
314 3300031250 Ga0265331_10113555 Ga0265331_101135551 304
315 3300035083 Ga0373926_0008882 Ga0373926_0008882_2233_3174 304
316 3300035398 Ga0316574_0241945 Ga0316574_0241945_161_1141 304
317 3300035691 Ga0373931_0167068 Ga0373931_0167068_90_1043 304
318 3300035692 Ga0373935_0133566 Ga0373935_0133566_680_1621 304
319 3300035695 Ga0373927_0001539 Ga0373927_0001539_12640_13581 304
320 3300036712 Ga0316584_0114947 Ga0316584_0114947_636_1616 304
321 3300044673 Ga0453683_0171101 Ga0453683_0171101_317_1270 304
322 3300046472 Ga0495580_0037314 Ga0495580_0037314_2430_3371 304
323 3300050511 nmdc:mga08y16_95630_c1 nmdc:mga08y16_95630_c1_1041_1985 304
324 iso_pu_bacteria 2527291627 2528203243 304
325 iso_pu_bacteria 2527291629 2528214404 304
326 iso_pu_bacteria 2546825537 2546947887 304
327 iso_pu_bacteria 2576861822 2579749772 304
328 iso_pu_bacteria 2684623036 2686541628 304
329 iso_pu_bacteria 2710264753 2710604992 304
330 iso_pu_bacteria 2773857924 2774864360 304
331 iso_pu_bacteria 2846037992 2846041089 304
332 iso_pu_bacteria 637000116 637879757 304
333 3300005842 Ga0068858_100012945 Ga0068858_1000129453 305
334 3300006195 Ga0075366_10038768 Ga0075366_100387682 305
335 3300009177 Ga0105248_10006574 Ga0105248_1000657414 305
336 3300009551 Ga0105238_10006092 Ga0105238_1000609213 305
337 3300011119 Ga0105246_10005750 Ga0105246_100057502 305
338 3300013308 Ga0157375_10040468 Ga0157375_100404683 305
339 3300025927 Ga0207687_10005523 Ga0207687_100055232 305
340 3300025941 Ga0207711_10000752 Ga0207711_1000075221 305
341 3300026035 Ga0207703_10008479 Ga0207703_100084793 305
342 3300031239 Ga0265328_10022723 Ga0265328_100227232 305
343 3300031240 Ga0265320_10073931 Ga0265320_100739311 305
344 3300031250 Ga0265331_10107964 Ga0265331_101079641 305
345 3300031344 Ga0265316_10000847 Ga0265316_100008472 305
346 3300031595 Ga0265313_10058884 Ga0265313_100588841 305
347 3300031711 Ga0265314_10137277 Ga0265314_101372772 305
348 3300032168 Ga0316593_10071261 Ga0316593_100712612 305
349 3300039437 Ga0436365_1100189 Ga0436365_1100189_1447_2403 305
350 3300039438 Ga0436360_0328545 Ga0436360_0328545_75_1028 305
351 3300042876 Ga0451577_0013211 Ga0451577_0013211_1451_2407 305
352 3300044712 Ga0453684_0002894 Ga0453684_0002894_5344_6300 305
353 3300044712 Ga0453684_0069986 Ga0453684_0069986_1376_2332 305
354 3300045051 Ga0451576_0029987 Ga0451576_0029987_3900_4856 305
355 iso_pu_bacteria 2547132103 2547373094 305
356 iso_pu_bacteria 2547132512 2548846078 305
357 iso_pu_bacteria 2579778521 2579858337 305
358 iso_pu_bacteria 2684623219 2687239187 305
359 iso_pu_bacteria 2843690924 2843691833 305
360 iso_pu_bacteria 8054913762 8054914687 305
361 3300005445 Ga0070708_100168989 Ga0070708_1001689892 306
362 3300005467 Ga0070706_100001466 Ga0070706_10000146621 306
363 3300005468 Ga0070707_100005111 Ga0070707_10000511112 306
364 3300005518 Ga0070699_100184904 Ga0070699_1001849041 306
365 3300006358 Ga0068871_100205207 Ga0068871_1002052072 306
366 3300025910 Ga0207684_10003450 Ga0207684_100034505 306
367 3300025922 Ga0207646_10009466 Ga0207646_100094669 306
368 3300028800 Ga0265338_10006215 Ga0265338_100062154 306
369 3300028800 Ga0265338_10121263 Ga0265338_101212632 306
370 3300029957 Ga0265324_10008668 Ga0265324_100086685 306
371 3300031235 Ga0265330_10010228 Ga0265330_100102283 306
372 3300031238 Ga0265332_10000062 Ga0265332_1000006247 306
373 3300031239 Ga0265328_10000297 Ga0265328_1000029717 306
374 3300031239 Ga0265328_10002442 Ga0265328_100024424 306
375 3300031239 Ga0265328_10014488 Ga0265328_100144882 306
376 3300031239 Ga0265328_10035767 Ga0265328_100357672 306
377 3300031242 Ga0265329_10001674 Ga0265329_100016746 306
378 3300031242 Ga0265329_10014035 Ga0265329_100140353 306
379 3300031249 Ga0265339_10036307 Ga0265339_100363072 306
380 3300031250 Ga0265331_10000036 Ga0265331_1000003671 306
381 3300031250 Ga0265331_10000145 Ga0265331_1000014526 306
382 3300031250 Ga0265331_10063883 Ga0265331_100638833 306
383 3300031251 Ga0265327_10007133 Ga0265327_1000713312 306
384 3300031344 Ga0265316_10000011 Ga0265316_10000011109 306
385 3300031344 Ga0265316_10001265 Ga0265316_1000126518 306
386 3300031711 Ga0265314_10000933 Ga0265314_1000093326 306
387 3300031712 Ga0265342_10000762 Ga0265342_1000076219 306
388 3300032168 Ga0316593_10067502 Ga0316593_100675022 306
389 3300038726 Ga0400490_10431 Ga0400490_10431_18454_19404 306
390 3300042876 Ga0451577_0034763 Ga0451577_0034763_2608_3567 306
391 3300044673 Ga0453683_0028839 Ga0453683_0028839_383_1306 306
392 3300044712 Ga0453684_0007878 Ga0453684_0007878_15427_16413 306
393 3300044712 Ga0453684_0097761 Ga0453684_0097761_572_1531 306
394 3300045051 Ga0451576_0148525 Ga0451576_0148525_1388_2401 306
395 3300045051 Ga0451576_0400895 Ga0451576_0400895_412_1380 306
396 3300005329 Ga0070683_100022822 Ga0070683_1000228222 307
397 3300005563 Ga0068855_100015449 Ga0068855_1000154492 307
398 3300009011 Ga0105251_10005450 Ga0105251_100054502 307
399 3300009093 Ga0105240_10005449 Ga0105240_1000544910 307
400 3300009098 Ga0105245_10000694 Ga0105245_1000069414 307
401 3300013104 Ga0157370_10001630 Ga0157370_1000163025 307
402 3300013104 Ga0157370_10006826 Ga0157370_100068264 307
403 3300013104 Ga0157370_10028766 Ga0157370_100287665 307
404 3300013307 Ga0157372_10196571 Ga0157372_101965712 307
405 3300025735 Ga0207713_1053053 Ga0207713_10530531 307
406 3300025927 Ga0207687_10007962 Ga0207687_100079622 307
407 3300025944 Ga0207661_10019484 Ga0207661_100194843 307
408 3300027360 Ga0209969_1003123 Ga0209969_10031232 307
409 3300027424 Ga0209984_1010318 Ga0209984_10103181 307
410 3300027552 Ga0209982_1005413 Ga0209982_10054131 307
411 3300027682 Ga0209971_1007555 Ga0209971_10075552 307
412 3300027876 Ga0209974_10006192 Ga0209974_100061925 307
413 3300028556 Ga0265337_1010645 Ga0265337_10106453 307
414 3300031235 Ga0265330_10033380 Ga0265330_100333802 307
415 3300031238 Ga0265332_10000234 Ga0265332_100002346 307
416 3300031241 Ga0265325_10003074 Ga0265325_100030749 307
417 3300031247 Ga0265340_10000044 Ga0265340_100000445 307
418 3300031250 Ga0265331_10001957 Ga0265331_100019579 307
419 3300031711 Ga0265314_10000271 Ga0265314_100002719 307
420 3300031711 Ga0265314_10001549 Ga0265314_100015499 307
421 3300031712 Ga0265342_10012661 Ga0265342_100126612 307
422 3300041411 Ga0439466_0005969 Ga0439466_0005969_3414_4430 307
423 3300041511 Ga0451855_1019283 Ga0451855_1019283_385_1317 307
424 3300042876 Ga0451577_0055642 Ga0451577_0055642_1533_2519 307
425 3300042876 Ga0451577_0103585 Ga0451577_0103585_1455_2414 307
426 3300044712 Ga0453684_0002408 Ga0453684_0002408_13951_14928 307
427 3300045051 Ga0451576_0003235 Ga0451576_0003235_20969_21979 307
428 3300045051 Ga0451576_0441847 Ga0451576_0441847_19_1005 307
429 3300046507 Ga0495606_0001112 Ga0495606_0001112_3163_4137 307
430 3300046522 Ga0495643_0001685 Ga0495643_0001685_1575_2549 307
431 3300046694 Ga0495649_0003386 Ga0495649_0003386_8190_9164 307
432 3300049568 Ga0501031_0011752 Ga0501031_0011752_2061_3038 307
433 3300049569 Ga0501032_0006131 Ga0501032_0006131_2256_3233 307
434 3300049570 Ga0501033_0009063 Ga0501033_0009063_2137_3114 307
435 3300049575 Ga0501039_0004609 Ga0501039_0004609_8206_9183 307
436 3300049575 Ga0501039_0171108 Ga0501039_0171108_587_1567 307
437 3300049580 Ga0501046_0050465 Ga0501046_0050465_1928_2905 307
438 3300049822 Ga0501035_0000158 Ga0501035_0000158_34192_35169 307
439 3300049823 Ga0501044_0253119 Ga0501044_0253119_16_993 307
440 3300009093 Ga0105240_10047714 Ga0105240_100477145 308
441 3300009147 Ga0114129_10002078 Ga0114129_1000207815 308
442 3300017792 Ga0163161_10045290 Ga0163161_100452903 308
443 3300021361 Ga0213872_10000905 Ga0213872_1000090517 308
444 3300025294 Ga0209025_1053028 Ga0209025_10530282 308
445 3300028016 Ga0265354_1000479 Ga0265354_10004794 308
446 3300028654 Ga0265322_10019771 Ga0265322_100197712 308
447 3300029957 Ga0265324_10067460 Ga0265324_100674601 308
448 3300030878 Ga0265770_1000818 Ga0265770_10008182 308
449 3300030879 Ga0265765_1000811 Ga0265765_10008112 308
450 3300031090 Ga0265760_10000954 Ga0265760_100009542 308
451 3300031235 Ga0265330_10005890 Ga0265330_100058903 308
452 3300031238 Ga0265332_10056281 Ga0265332_100562813 308
453 3300031242 Ga0265329_10001667 Ga0265329_100016672 308
454 3300031249 Ga0265339_10004363 Ga0265339_100043639 308
455 3300031249 Ga0265339_10085234 Ga0265339_100852343 308
456 3300031344 Ga0265316_10002305 Ga0265316_1000230513 308
457 3300031344 Ga0265316_10003493 Ga0265316_100034934 308
458 3300031711 Ga0265314_10003597 Ga0265314_100035978 308
459 3300031711 Ga0265314_10033095 Ga0265314_100330953 308
460 3300031712 Ga0265342_10001742 Ga0265342_1000174213 308
461 3300031712 Ga0265342_10021895 Ga0265342_100218953 308
462 3300031727 Ga0316576_10017817 Ga0316576_100178174 308
463 3300039447 Ga0436361_0567168 Ga0436361_0567168_37609_38586 308
464 3300042876 Ga0451577_0081767 Ga0451577_0081767_987_1961 308
465 3300044712 Ga0453684_0000048 Ga0453684_0000048_492350_493321 308
466 3300044712 Ga0453684_0001752 Ga0453684_0001752_8484_9458 308
467 3300046477 Ga0495664_0224992 Ga0495664_0224992_57_989 308
468 3300046522 Ga0495643_0000560 Ga0495643_0000560_14613_15587 308
469 3300046543 Ga0495645_0167920 Ga0495645_0167920_193_1152 308
470 3300046692 Ga0495671_0003585 Ga0495671_0003585_5604_6578 308
471 3300047317 Ga0495604_0163470 Ga0495604_0163470_509_1468 308
472 3300047319 Ga0495674_0044383 Ga0495674_0044383_1128_2060 308
473 3300047444 Ga0495675_0068006 Ga0495675_0068006_713_1672 308
474 3300047471 Ga0495684_0040686 Ga0495684_0040686_1301_2260 308
475 3300047472 Ga0495686_0075906 Ga0495686_0075906_653_1627 308
476 3300048907 Ga0496104_0000260 Ga0496104_0000260_25426_26424 308
477 3300048908 Ga0496105_0000156 Ga0496105_0000156_18752_19750 308
478 3300048929 Ga0496126_0000101 Ga0496126_0000101_158615_159550 308
479 3300048929 Ga0496126_0339330 Ga0496126_0339330_144_1118 308
480 3300050507 nmdc:mga05p37_2980_c1 nmdc:mga05p37_2980_c1_17799_18728 308
481 3300050510 nmdc:mga06r32_274823_c1 nmdc:mga06r32_274823_c1_591_1520 308
482 iso_pu_bacteria 2687453341 2688393533 308
483 iso_pu_bacteria 2687453341 2688394040 308
484 3300003751 Ga0055538_1000078 Ga0055538_100007846 309
485 3300003752 Ga0055539_1000119 Ga0055539_100011946 309
486 3300003756 Ga0055533_1000127 Ga0055533_100012746 309
487 3300003758 Ga0055532_1000068 Ga0055532_100006838 309
488 3300003759 Ga0055525_1000163 Ga0055525_100016346 309
489 3300003841 Ga0055541_1000079 Ga0055541_100007946 309
490 3300003856 Ga0058692_1017134 Ga0058692_10171342 309
491 3300005329 Ga0070683_100128431 Ga0070683_1001284312 309
492 3300005436 Ga0070713_100049646 Ga0070713_1000496464 309
493 3300005458 Ga0070681_10031212 Ga0070681_100312124 309
494 3300005530 Ga0070679_100070265 Ga0070679_1000702651 309
495 3300006944 Ga0099823_1000074 Ga0099823_100007439 309
496 3300006944 Ga0099823_1063482 Ga0099823_10634822 309
497 3300009011 Ga0105251_10048767 Ga0105251_100487672 309
498 3300009036 Ga0105244_10000248 Ga0105244_1000024822 309
499 3300009036 Ga0105244_10000274 Ga0105244_100002747 309
500 3300009036 Ga0105244_10002675 Ga0105244_100026756 309
501 3300009036 Ga0105244_10015761 Ga0105244_100157614 309
502 3300009092 Ga0105250_10034542 Ga0105250_100345422 309
503 3300009092 Ga0105250_10034581 Ga0105250_100345812 309
504 3300011119 Ga0105246_10087869 Ga0105246_100878692 309
505 3300013100 Ga0157373_10028452 Ga0157373_100284523 309
506 3300013102 Ga0157371_10000497 Ga0157371_1000049744 309
507 3300013102 Ga0157371_10078133 Ga0157371_100781332 309
508 3300013104 Ga0157370_10093954 Ga0157370_100939541 309
509 3300013105 Ga0157369_10032457 Ga0157369_100324574 309
510 3300013307 Ga0157372_10000598 Ga0157372_1000059836 309
511 3300013307 Ga0157372_10266118 Ga0157372_102661182 309
512 3300014497 Ga0182008_10034069 Ga0182008_100340692 309
513 3300014968 Ga0157379_10158519 Ga0157379_101585193 309
514 3300015261 Ga0182006_1017180 Ga0182006_10171803 309
515 3300021361 Ga0213872_10000050 Ga0213872_1000005058 309
516 3300025206 Ga0209435_100837 Ga0209435_1008373 309
517 3300025224 Ga0209784_100015 Ga0209784_100015397 309
518 3300025225 Ga0209566_100012 Ga0209566_100012397 309
519 3300025226 Ga0209674_100027 Ga0209674_100027397 309
520 3300025229 Ga0209147_100019 Ga0209147_100019397 309
521 3300025230 Ga0209563_100031 Ga0209563_100031397 309
522 3300025242 Ga0209258_100381 Ga0209258_10038117 309
523 3300025246 Ga0209646_1000344 Ga0209646_100034423 309
524 3300025253 Ga0209677_100016 Ga0209677_100016397 309
525 3300025256 Ga0209759_1010992 Ga0209759_10109923 309
526 3300025292 Ga0209676_1000532 Ga0209676_100053238 309
527 3300025711 Ga0207696_1010018 Ga0207696_10100183 309
528 3300025711 Ga0207696_1021950 Ga0207696_10219502 309
529 3300025728 Ga0207655_1000151 Ga0207655_100015147 309
530 3300025728 Ga0207655_1000197 Ga0207655_100019743 309
531 3300025735 Ga0207713_1038613 Ga0207713_10386132 309
532 3300025906 Ga0207699_10026412 Ga0207699_100264121 309
533 3300025912 Ga0207707_10032118 Ga0207707_100321185 309
534 3300025917 Ga0207660_10053276 Ga0207660_100532763 309
535 3300025921 Ga0207652_10071427 Ga0207652_100714273 309
536 3300025928 Ga0207700_10148524 Ga0207700_101485242 309
537 3300025929 Ga0207664_10035512 Ga0207664_100355122 309
538 3300027296 Ga0209389_1000063 Ga0209389_10000639 309
539 3300027312 Ga0209371_1000576 Ga0209371_10005763 309
540 3300028573 Ga0265334_10010142 Ga0265334_100101422 309
541 3300028577 Ga0265318_10045528 Ga0265318_100455282 309
542 3300028666 Ga0265336_10005093 Ga0265336_100050932 309
543 3300028786 Ga0307517_10113040 Ga0307517_101130401 309
544 3300028800 Ga0265338_10040825 Ga0265338_100408254 309
545 3300030500 Ga0268256_1000503 Ga0268256_100050328 309
546 3300031235 Ga0265330_10050703 Ga0265330_100507032 309
547 3300031238 Ga0265332_10000013 Ga0265332_10000013163 309
548 3300031238 Ga0265332_10070650 Ga0265332_100706501 309
549 3300031344 Ga0265316_10013282 Ga0265316_100132827 309
550 3300031344 Ga0265316_10338294 Ga0265316_103382942 309
551 3300031507 Ga0307509_10274381 Ga0307509_102743812 309
552 3300031711 Ga0265314_10002364 Ga0265314_100023643 309
553 3300031712 Ga0265342_10019789 Ga0265342_100197894 309
554 3300031727 Ga0316576_10028196 Ga0316576_100281962 309
555 3300031727 Ga0316576_10043506 Ga0316576_100435062 309
556 3300031728 Ga0316578_10008951 Ga0316578_100089515 309
557 3300032168 Ga0316593_10037039 Ga0316593_100370392 309
558 3300035398 Ga0316574_0004307 Ga0316574_0004307_2060_2992 309
559 3300036712 Ga0316584_0009600 Ga0316584_0009600_700_1632 309
560 3300037068 Ga0373925_0058578 Ga0373925_0058578_777_1763 309
561 3300039438 Ga0436360_1032306 Ga0436360_1032306_1096_2049 309
562 3300039447 Ga0436361_0269507 Ga0436361_0269507_50663_51676 309
563 3300042006 Ga0439432_001052 Ga0439432_001052_250_1224 309
564 3300042142 Ga0450905_000029 Ga0450905_000029_1726_2700 309
565 3300042876 Ga0451577_0074573 Ga0451577_0074573_580_1521 309
566 3300045051 Ga0451576_0084574 Ga0451576_0084574_1102_2043 309
567 3300046453 Ga0495627_005817 Ga0495627_005817_1535_2557 309
568 3300046457 Ga0495590_0026310 Ga0495590_0026310_886_1860 309
569 3300046458 Ga0495591_004793 Ga0495591_004793_68_1090 309
570 3300046458 Ga0495591_005488 Ga0495591_005488_3495_4469 309
571 3300046458 Ga0495591_009042 Ga0495591_009042_123_1097 309
572 3300046471 Ga0495650_0000620 Ga0495650_0000620_9825_10799 309
573 3300046471 Ga0495650_0006361 Ga0495650_0006361_150_1124 309
574 3300046474 Ga0495605_0000048 Ga0495605_0000048_50401_51423 309
575 3300046474 Ga0495605_0000094 Ga0495605_0000094_23230_24204 309
576 3300046474 Ga0495605_0000330 Ga0495605_0000330_14954_15928 309
577 3300046491 Ga0495584_0020003 Ga0495584_0020003_196_1170 309
578 3300046492 Ga0495585_0005478 Ga0495585_0005478_6506_7480 309
579 3300046500 Ga0495596_0012119 Ga0495596_0012119_2391_3365 309
580 3300046501 Ga0495607_0000396 Ga0495607_0000396_40240_41343 309
581 3300046501 Ga0495607_0021862 Ga0495607_0021862_1810_2853 309
582 3300046501 Ga0495607_0047000 Ga0495607_0047000_1006_1980 309
583 3300046506 Ga0495583_0000096 Ga0495583_0000096_36595_37617 309
584 3300046506 Ga0495583_0001432 Ga0495583_0001432_14415_15389 309
585 3300046506 Ga0495583_0010134 Ga0495583_0010134_969_1943 309
586 3300046506 Ga0495583_0010743 Ga0495583_0010743_510_1484 309
587 3300046506 Ga0495583_0017557 Ga0495583_0017557_2678_3652 309
588 3300046507 Ga0495606_0004094 Ga0495606_0004094_7626_8558 309
589 3300046512 Ga0495610_0012081 Ga0495610_0012081_2036_3010 309
590 3300046513 Ga0495616_0025122 Ga0495616_0025122_932_1906 309
591 3300046515 Ga0495620_0000001 Ga0495620_0000001_1662_2684 309
592 3300046518 Ga0495631_0014162 Ga0495631_0014162_34_1008 309
593 3300046518 Ga0495631_0014537 Ga0495631_0014537_1281_2255 309
594 3300046519 Ga0495632_0004287 Ga0495632_0004287_2668_3642 309
595 3300046520 Ga0495637_0000630 Ga0495637_0000630_10074_11048 309
596 3300046520 Ga0495637_0001225 Ga0495637_0001225_12387_13361 309
597 3300046522 Ga0495643_0000303 Ga0495643_0000303_1515_2489 309
598 3300046522 Ga0495643_0013070 Ga0495643_0013070_776_1750 309
599 3300046524 Ga0495648_0008904 Ga0495648_0008904_1674_2606 309
600 3300046524 Ga0495648_0020975 Ga0495648_0020975_553_1527 309
601 3300046524 Ga0495648_0024807 Ga0495648_0024807_701_1723 309
602 3300046524 Ga0495648_0037701 Ga0495648_0037701_1140_2114 309
603 3300046528 Ga0495642_0003590 Ga0495642_0003590_4006_4938 309
604 3300046530 Ga0495654_0005166 Ga0495654_0005166_3778_4752 309
605 3300046530 Ga0495654_0007690 Ga0495654_0007690_3475_4497 309
606 3300046538 Ga0495609_0000012 Ga0495609_0000012_39285_40307 309
607 3300046538 Ga0495609_0000079 Ga0495609_0000079_80606_81580 309
608 3300046538 Ga0495609_0001254 Ga0495609_0001254_14349_15323 309
609 3300046538 Ga0495609_0009678 Ga0495609_0009678_2642_3616 309
610 3300046557 Ga0495622_0029990 Ga0495622_0029990_322_1296 309
611 3300046558 Ga0495633_0000034 Ga0495633_0000034_148005_149027 309
612 3300046558 Ga0495633_0031235 Ga0495633_0031235_501_1433 309
613 3300046616 Ga0495668_0065953 Ga0495668_0065953_430_1404 309
614 3300046648 Ga0495611_0000656 Ga0495611_0000656_12844_13818 309
615 3300046648 Ga0495611_0036628 Ga0495611_0036628_1015_1989 309
616 3300046660 Ga0495625_0000076 Ga0495625_0000076_68696_69670 309
617 3300046665 Ga0495661_0000004 Ga0495661_0000004_517686_518708 309
618 3300046665 Ga0495661_0000099 Ga0495661_0000099_84686_85660 309
619 3300046665 Ga0495661_0000146 Ga0495661_0000146_19238_20212 309
620 3300046665 Ga0495661_0025579 Ga0495661_0025579_431_1405 309
621 3300046665 Ga0495661_0030918 Ga0495661_0030918_2388_3362 309
622 3300046691 Ga0495670_0023981 Ga0495670_0023981_1661_2683 309
623 3300046692 Ga0495671_0010611 Ga0495671_0010611_2870_3844 309
624 3300046692 Ga0495671_0018765 Ga0495671_0018765_1536_2558 309
625 3300046694 Ga0495649_0049172 Ga0495649_0049172_165_1139 309
626 3300046810 Ga0495660_0012602 Ga0495660_0012602_551_1525 309
627 3300046810 Ga0495660_0023907 Ga0495660_0023907_1847_2869 309
628 3300047320 Ga0495672_0077988 Ga0495672_0077988_678_1652 309
629 3300047321 Ga0495676_0000016 Ga0495676_0000016_67962_68936 309
630 3300047323 Ga0495683_0000034 Ga0495683_0000034_111534_112556 309
631 3300047446 Ga0495679_000087 Ga0495679_000087_5851_6825 309
632 3300047446 Ga0495679_000377 Ga0495679_000377_31494_32516 309
633 3300047469 Ga0495673_0015126 Ga0495673_0015126_1542_2516 309
634 3300047469 Ga0495673_0015438 Ga0495673_0015438_2819_3793 309
635 3300047469 Ga0495673_0027991 Ga0495673_0027991_1642_2664 309
636 3300047469 Ga0495673_0043729 Ga0495673_0043729_65_1039 309
637 3300047470 Ga0495681_0016581 Ga0495681_0016581_2148_3122 309
638 3300048090 Ga0495615_0002290 Ga0495615_0002290_1850_2782 309
639 3300048091 Ga0495626_0000098 Ga0495626_0000098_18384_19358 309
640 3300048918 Ga0496115_0024949 Ga0496115_0024949_2582_3559 309
641 3300048920 Ga0496117_0003088 Ga0496117_0003088_1511_2485 309
642 3300048921 Ga0496118_0002712 Ga0496118_0002712_17450_18424 309
643 3300048922 Ga0496119_0000612 Ga0496119_0000612_32661_33635 309
644 3300048923 Ga0496120_0001054 Ga0496120_0001054_32464_33438 309
645 3300048925 Ga0496122_0002404 Ga0496122_0002404_10045_11019 309
646 3300048925 Ga0496122_0019738 Ga0496122_0019738_1522_2496 309
647 3300048925 Ga0496122_0022598 Ga0496122_0022598_1640_2662 309
648 3300048926 Ga0496123_0000439 Ga0496123_0000439_55838_56812 309
649 3300048926 Ga0496123_0014417 Ga0496123_0014417_1496_2470 309
650 3300048926 Ga0496123_0026678 Ga0496123_0026678_2794_3816 309
651 3300048927 Ga0496124_0015103 Ga0496124_0015103_2068_3042 309
652 3300048927 Ga0496124_0060348 Ga0496124_0060348_612_1586 309
653 3300048927 Ga0496124_0173557 Ga0496124_0173557_306_1280 309
654 3300048928 Ga0496125_0004712 Ga0496125_0004712_12864_13838 309
655 3300048928 Ga0496125_0024615 Ga0496125_0024615_1043_2017 309
656 3300048929 Ga0496126_0388229 Ga0496126_0388229_71_1048 309
657 3300049459 Ga0495678_000049 Ga0495678_000049_126475_127497 309
658 3300049459 Ga0495678_002688 Ga0495678_002688_9701_10675 309
659 3300049459 Ga0495678_039896 Ga0495678_039896_41_1015 309
660 3300049459 Ga0495678_080824 Ga0495678_080824_73_1047 309
661 3300049568 Ga0501031_0030930 Ga0501031_0030930_52_1032 309
662 3300049569 Ga0501032_0001038 Ga0501032_0001038_16732_17712 309
663 3300049571 Ga0501034_0000041 Ga0501034_0000041_27588_28562 309
664 3300049571 Ga0501034_0030857 Ga0501034_0030857_3842_4783 309
665 3300049571 Ga0501034_0127735 Ga0501034_0127735_1269_2237 309
666 3300049574 Ga0501038_0007681 Ga0501038_0007681_7066_8085 309
667 3300049823 Ga0501044_0164704 Ga0501044_0164704_1054_2034 309
668 3300049853 Ga0501226_000007 Ga0501226_000007_135318_136292 309
669 3300053135 Ga0500659_0035137 Ga0500659_0035137_1354_2328 309
670 3300053138 Ga0500564_013234 Ga0500564_013234_280_1245 309
671 3300003781 Ga0055536_1016854 Ga0055536_10168544 310
672 3300005435 Ga0070714_100047786 Ga0070714_1000477862 310
673 3300005445 Ga0070708_100182915 Ga0070708_1001829153 310
674 3300009551 Ga0105238_10008661 Ga0105238_100086613 310
675 3300013104 Ga0157370_10007129 Ga0157370_1000712912 310
676 3300025292 Ga0209676_1000026 Ga0209676_1000026341 310
677 3300025298 Ga0209050_1010390 Ga0209050_10103902 310
678 3300025924 Ga0207694_10024889 Ga0207694_100248894 310
679 3300025940 Ga0207691_10376693 Ga0207691_103766932 310
680 3300035086 Ga0373934_0016862 Ga0373934_0016862_1400_2335 310
681 3300035119 Ga0373956_0001217 Ga0373956_0001217_4797_5750 310
682 3300035120 Ga0373957_0042689 Ga0373957_0042689_617_1552 310
683 3300036401 Ga0373937_0007741 Ga0373937_0007741_3195_4130 310
684 3300042439 Ga0439464_0002709 Ga0439464_0002709_1953_2927 310
685 3300044673 Ga0453683_0065747 Ga0453683_0065747_703_1644 310
686 3300046501 Ga0495607_0001535 Ga0495607_0001535_4648_5655 310
687 3300046507 Ga0495606_0002582 Ga0495606_0002582_15769_16743 310
688 3300046515 Ga0495620_0000757 Ga0495620_0000757_14971_15978 310
689 3300047469 Ga0495673_0009651 Ga0495673_0009651_3686_4660 310
690 3300048905 Ga0496102_0034926 Ga0496102_0034926_648_1622 310
691 3300048913 Ga0496110_0009694 Ga0496110_0009694_31_1008 310
692 3300048916 Ga0496113_0173044 Ga0496113_0173044_355_1332 310
693 3300048924 Ga0496121_0007202 Ga0496121_0007202_4470_5444 310
694 3300048926 Ga0496123_0058743 Ga0496123_0058743_1177_2151 310
695 3300048927 Ga0496124_0006210 Ga0496124_0006210_2564_3538 310
696 3300048927 Ga0496124_0059474 Ga0496124_0059474_2144_3151 310
697 3300049460 Ga0495682_0001668 Ga0495682_0001668_5752_6759 310
698 3300049571 Ga0501034_0002365 Ga0501034_0002365_9919_10998 310
699 3300002737 JGI25162J39368_1000100 JGI25162J39368_100010063 311
700 3300002771 JGI25163J39215_1000894 JGI25163J39215_10008948 311
701 3300002772 JGI25164J39214_1000079 JGI25164J39214_100007963 311
702 3300003214 JGI25165J46597_1000183 JGI25165J46597_100018363 311
703 3300005439 Ga0070711_100079683 Ga0070711_1000796832 311
704 3300005546 Ga0070696_100000147 Ga0070696_10000014723 311
705 3300006946 Ga0079104_1001936 Ga0079104_10019367 311
706 3300009011 Ga0105251_10013205 Ga0105251_100132053 311
707 3300009098 Ga0105245_10477401 Ga0105245_104774011 311
708 3300009174 Ga0105241_10248325 Ga0105241_102483252 311
709 3300013306 Ga0163162_10391986 Ga0163162_103919862 311
710 3300015261 Ga0182006_1009467 Ga0182006_10094672 311
711 3300021388 Ga0213875_10000019 Ga0213875_1000001939 311
712 3300025207 Ga0209760_100052 Ga0209760_10005262 311
713 3300025231 Ga0207427_100029 Ga0207427_10002932 311
714 3300025233 Ga0209437_100009 Ga0209437_100009287 311
715 3300025261 Ga0209233_1000032 Ga0209233_1000032287 311
716 3300025911 Ga0207654_10083975 Ga0207654_100839752 311
717 3300025916 Ga0207663_10073947 Ga0207663_100739472 311
718 3300027111 Ga0209281_1000172 Ga0209281_1000172113 311
719 3300028800 Ga0265338_10083055 Ga0265338_100830553 311
720 3300031247 Ga0265340_10091168 Ga0265340_100911682 311
721 3300031344 Ga0265316_10227276 Ga0265316_102272762 311
722 3300031548 Ga0307408_100000178 Ga0307408_10000017859 311
723 3300033541 Ga0316596_1042114 Ga0316596_10421141 311
724 3300037068 Ga0373925_0005608 Ga0373925_0005608_6976_7929 311
725 3300037068 Ga0373925_0076615 Ga0373925_0076615_353_1306 311
726 3300037853 Ga0436364_0366372 Ga0436364_0366372_188298_189251 311
727 3300041405 Ga0439438_000442 Ga0439438_000442_15833_16807 311
728 3300044712 Ga0453684_0005926 Ga0453684_0005926_17216_18169 311
729 3300044712 Ga0453684_0209441 Ga0453684_0209441_721_1707 311
730 3300046453 Ga0495627_001530 Ga0495627_001530_10511_11485 311
731 3300046458 Ga0495591_000023 Ga0495591_000023_139267_140259 311
732 3300046458 Ga0495591_004045 Ga0495591_004045_1794_2768 311
733 3300046472 Ga0495580_0108737 Ga0495580_0108737_848_1801 311
734 3300046474 Ga0495605_0000486 Ga0495605_0000486_27195_28187 311
735 3300046474 Ga0495605_0108899 Ga0495605_0108899_99_1097 311
736 3300046501 Ga0495607_0001009 Ga0495607_0001009_23284_24282 311
737 3300046501 Ga0495607_0005366 Ga0495607_0005366_2650_3720 311
738 3300046501 Ga0495607_0059081 Ga0495607_0059081_931_1905 311
739 3300046507 Ga0495606_0008803 Ga0495606_0008803_6229_7203 311
740 3300046512 Ga0495610_0034270 Ga0495610_0034270_1387_2361 311
741 3300046515 Ga0495620_0004859 Ga0495620_0004859_4811_5785 311
742 3300046519 Ga0495632_0023780 Ga0495632_0023780_1780_2754 311
743 3300046520 Ga0495637_0018833 Ga0495637_0018833_1709_2701 311
744 3300046542 Ga0495597_0000016 Ga0495597_0000016_133564_134604 311
745 3300046665 Ga0495661_0000773 Ga0495661_0000773_1982_2956 311
746 3300046810 Ga0495660_0000824 Ga0495660_0000824_19242_20240 311
747 3300046810 Ga0495660_0022401 Ga0495660_0022401_1742_2782 311
748 3300048920 Ga0496117_0001620 Ga0496117_0001620_29220_30194 311
749 3300048923 Ga0496120_0008485 Ga0496120_0008485_1860_2834 311
750 3300048927 Ga0496124_0001693 Ga0496124_0001693_1880_2854 311
751 3300048928 Ga0496125_0001691 Ga0496125_0001691_1643_2617 311
752 iso_pu_bacteria 2684623219 2687238447 311
753 3300035083 Ga0373926_0007884 Ga0373926_0007884_56_997 312
754 3300035695 Ga0373927_0009722 Ga0373927_0009722_1303_2244 312
755 3300035724 Ga0373933_0095320 Ga0373933_0095320_162_1103 312
756 3300035725 Ga0373947_0000740 Ga0373947_0000740_16585_17526 312
757 3300037068 Ga0373925_0015028 Ga0373925_0015028_2239_3180 312
758 3300041405 Ga0439438_004424 Ga0439438_004424_2871_3845 312
759 3300041407 Ga0439447_003162 Ga0439447_003162_1071_2045 312
760 3300041413 Ga0439465_0006145 Ga0439465_0006145_941_1915 312
761 3300042006 Ga0439432_001239 Ga0439432_001239_6918_7892 312
762 3300042009 Ga0439451_003813 Ga0439451_003813_68_1042 312
763 3300042115 Ga0450911_001193 Ga0450911_001193_3947_4921 312
764 3300042121 Ga0450919_000614 Ga0450919_000614_2135_3109 312
765 3300042127 Ga0450890_000186 Ga0450890_000186_1990_2964 312
766 3300042137 Ga0450902_001984 Ga0450902_001984_614_1588 312
767 3300042138 Ga0450903_001828 Ga0450903_001828_790_1764 312
768 3300042145 Ga0450906_000658 Ga0450906_000658_5588_6562 312
769 3300042146 Ga0450907_002076 Ga0450907_002076_1601_2575 312
770 3300042156 Ga0439446_0008405 Ga0439446_0008405_1545_2519 312
771 3300042184 Ga0450908_005178 Ga0450908_005178_110_1084 312
772 3300042439 Ga0439464_0009344 Ga0439464_0009344_769_1743 312
773 3300042461 Ga0439460_0005590 Ga0439460_0005590_1431_2405 312
774 3300042876 Ga0451577_0032932 Ga0451577_0032932_454_1413 312
775 3300042993 Ga0439440_0003112 Ga0439440_0003112_1426_2400 312
776 3300044712 Ga0453684_0057574 Ga0453684_0057574_680_1639 312
777 3300046501 Ga0495607_0006278 Ga0495607_0006278_6010_6984 312
778 3300046501 Ga0495607_0102701 Ga0495607_0102701_330_1304 312
779 3300046664 Ga0495659_0017477 Ga0495659_0017477_138_1112 312
780 3300046665 Ga0495661_0042222 Ga0495661_0042222_562_1536 312
781 3300046691 Ga0495670_0002495 Ga0495670_0002495_6474_7448 312
782 3300005937 Ga0081455_10032641 Ga0081455_100326412 313
783 3300031238 Ga0265332_10010180 Ga0265332_100101805 313
784 3300031251 Ga0265327_10004005 Ga0265327_100040053 313
785 3300037471 Ga0395905_0003402 Ga0395905_0003402_9955_10941 313
786 3300041404 Ga0439436_0007650 Ga0439436_0007650_348_1424 313
787 3300041405 Ga0439438_003869 Ga0439438_003869_383_1459 313
788 3300041407 Ga0439447_008240 Ga0439447_008240_1958_3034 313
789 3300041411 Ga0439466_0006786 Ga0439466_0006786_587_1663 313
790 3300042006 Ga0439432_002018 Ga0439432_002018_5895_6971 313
791 3300042010 Ga0439452_022042 Ga0439452_022042_122_1198 313
792 3300042115 Ga0450911_000002 Ga0450911_000002_153837_154811 313
793 3300044712 Ga0453684_0046636 Ga0453684_0046636_693_1643 313
794 3300045051 Ga0451576_0431901 Ga0451576_0431901_178_1137 313
795 iso_pu_bacteria 2846540461 2846542270 313
796 3300009093 Ga0105240_10184676 Ga0105240_101846762 314
797 3300009545 Ga0105237_10008700 Ga0105237_100087004 314
798 3300025924 Ga0207694_10023587 Ga0207694_100235874 314
799 3300028577 Ga0265318_10074020 Ga0265318_100740202 314
800 3300028653 Ga0265323_10015696 Ga0265323_100156963 314
801 3300028654 Ga0265322_10001727 Ga0265322_100017275 314
802 3300031235 Ga0265330_10013565 Ga0265330_100135653 314
803 3300031242 Ga0265329_10000059 Ga0265329_100000592 314
804 3300031249 Ga0265339_10001637 Ga0265339_1000163711 314
805 3300031249 Ga0265339_10070381 Ga0265339_100703811 314
806 3300031251 Ga0265327_10000213 Ga0265327_1000021341 314
807 3300031251 Ga0265327_10000213 Ga0265327_1000021353 314
808 3300031344 Ga0265316_10001116 Ga0265316_1000111619 314
809 3300031344 Ga0265316_10085315 Ga0265316_100853152 314
810 3300031712 Ga0265342_10000924 Ga0265342_100009242 314
811 3300031712 Ga0265342_10001136 Ga0265342_100011369 314
812 3300049569 Ga0501032_0009678 Ga0501032_0009678_156_1103 314
813 3300049570 Ga0501033_0007400 Ga0501033_0007400_7591_8538 314
814 3300049571 Ga0501034_0020051 Ga0501034_0020051_294_1241 314
815 3300049572 Ga0501036_0000583 Ga0501036_0000583_2753_3700 314
816 3300049573 Ga0501037_0014890 Ga0501037_0014890_2888_3835 314
817 3300049574 Ga0501038_0020808 Ga0501038_0020808_451_1398 314
818 3300049575 Ga0501039_0011648 Ga0501039_0011648_2950_3897 314
819 3300049579 Ga0501043_0004581 Ga0501043_0004581_2460_3407 314
820 3300049580 Ga0501046_0001127 Ga0501046_0001127_1500_2447 314
821 3300049582 Ga0501048_0031545 Ga0501048_0031545_294_1241 314
822 3300049583 Ga0501067_0012770 Ga0501067_0012770_157_1104 314
823 3300049584 Ga0501068_0129193 Ga0501068_0129193_93_1040 314
824 3300049585 Ga0501069_0000937 Ga0501069_0000937_8267_9214 314
825 3300049586 Ga0501070_0030461 Ga0501070_0030461_3185_4132 314
826 3300049588 Ga0501072_0011524 Ga0501072_0011524_4717_5664 314
827 3300049589 Ga0501073_0026765 Ga0501073_0026765_2731_3678 314
828 3300049593 Ga0501077_0004163 Ga0501077_0004163_4568_5515 314
829 3300049741 Ga0501079_0028748 Ga0501079_0028748_451_1398 314
830 3300049744 Ga0501083_0007866 Ga0501083_0007866_1888_2835 314
831 3300054114 Ga0501084_0001126 Ga0501084_0001126_17452_18399 314
832 3300060353 Ga0501082_0005501 Ga0501082_0005501_9597_10544 314
833 3300005437 Ga0070710_10103815 Ga0070710_101038152 315
834 3300009093 Ga0105240_10002636 Ga0105240_1000263611 315
835 3300010159 Ga0099796_10027099 Ga0099796_100270992 315
836 3300013100 Ga0157373_10000593 Ga0157373_1000059324 315
837 3300028653 Ga0265323_10000442 Ga0265323_100004424 315
838 3300029957 Ga0265324_10000069 Ga0265324_1000006966 315
839 3300030742 Ga0316183_1015099 Ga0316183_10150993 315
840 3300031235 Ga0265330_10007670 Ga0265330_100076705 315
841 3300031235 Ga0265330_10117082 Ga0265330_101170822 315
842 3300031238 Ga0265332_10000052 Ga0265332_1000005261 315
843 3300031239 Ga0265328_10005003 Ga0265328_100050037 315
844 3300031242 Ga0265329_10014042 Ga0265329_100140424 315
845 3300031249 Ga0265339_10000004 Ga0265339_1000000410 315
846 3300031250 Ga0265331_10000108 Ga0265331_1000010861 315
847 3300031344 Ga0265316_10002090 Ga0265316_100020904 315
848 3300031344 Ga0265316_10002945 Ga0265316_100029453 315
849 3300031344 Ga0265316_10044714 Ga0265316_100447142 315
850 3300031548 Ga0307408_100020260 Ga0307408_1000202603 315
851 3300031731 Ga0307405_10020411 Ga0307405_100204113 315
852 3300031824 Ga0307413_10010098 Ga0307413_100100982 315
853 3300031901 Ga0307406_10054623 Ga0307406_100546232 315
854 3300031903 Ga0307407_10026019 Ga0307407_100260192 315
855 3300031911 Ga0307412_10004978 Ga0307412_100049783 315
856 3300031995 Ga0307409_100041096 Ga0307409_1000410963 315
857 3300032004 Ga0307414_10010683 Ga0307414_100106833 315
858 3300032005 Ga0307411_10004175 Ga0307411_100041755 315
859 3300042876 Ga0451577_0088449 Ga0451577_0088449_773_1723 315
860 3300044712 Ga0453684_0000499 Ga0453684_0000499_105685_106635 315
861 3300044712 Ga0453684_0002894 Ga0453684_0002894_19323_20273 315
862 3300044712 Ga0453684_0030419 Ga0453684_0030419_3644_4594 315
863 3300044712 Ga0453684_0048265 Ga0453684_0048265_982_1932 315
864 3300044712 Ga0453684_0087668 Ga0453684_0087668_1988_2938 315
865 3300005337 Ga0070682_100039334 Ga0070682_1000393343 316
866 3300005339 Ga0070660_100017653 Ga0070660_1000176532 316
867 3300005341 Ga0070691_10001552 Ga0070691_100015526 316
868 3300005436 Ga0070713_100013534 Ga0070713_1000135342 316
869 3300005458 Ga0070681_10013442 Ga0070681_100134422 316
870 3300005530 Ga0070679_100003415 Ga0070679_1000034155 316
871 3300005535 Ga0070684_100002254 Ga0070684_1000022542 316
872 3300005539 Ga0068853_100042324 Ga0068853_1000423243 316
873 3300005563 Ga0068855_100004962 Ga0068855_1000049623 316
874 3300005577 Ga0068857_100000451 Ga0068857_1000004518 316
875 3300005614 Ga0068856_100000957 Ga0068856_10000095721 316
876 3300005616 Ga0068852_100005614 Ga0068852_1000056141 316
877 3300005842 Ga0068858_100033049 Ga0068858_1000330495 316
878 3300006237 Ga0097621_100061966 Ga0097621_1000619663 316
879 3300006358 Ga0068871_100013774 Ga0068871_1000137743 316
880 3300006931 Ga0097620_100173920 Ga0097620_1001739203 316
881 3300009093 Ga0105240_10005123 Ga0105240_1000512311 316
882 3300009093 Ga0105240_10007191 Ga0105240_100071912 316
883 3300009093 Ga0105240_10074490 Ga0105240_100744901 316
884 3300009098 Ga0105245_10434957 Ga0105245_104349572 316
885 3300009174 Ga0105241_10007966 Ga0105241_100079663 316
886 3300009174 Ga0105241_10091320 Ga0105241_100913202 316
887 3300009176 Ga0105242_10015261 Ga0105242_100152612 316
888 3300009177 Ga0105248_10029592 Ga0105248_100295923 316
889 3300009545 Ga0105237_10008345 Ga0105237_100083454 316
890 3300009545 Ga0105237_10016948 Ga0105237_100169484 316
891 3300009551 Ga0105238_10001852 Ga0105238_1000185211 316
892 3300011119 Ga0105246_10025988 Ga0105246_100259883 316
893 3300013102 Ga0157371_10215321 Ga0157371_102153212 316
894 3300013104 Ga0157370_10025437 Ga0157370_100254373 316
895 3300013105 Ga0157369_10009351 Ga0157369_1000935111 316
896 3300013105 Ga0157369_10128690 Ga0157369_101286902 316
897 3300013105 Ga0157369_10487229 Ga0157369_104872292 316
898 3300013307 Ga0157372_10041986 Ga0157372_100419862 316
899 3300021388 Ga0213875_10042529 Ga0213875_100425292 316
900 3300021388 Ga0213875_10065563 Ga0213875_100655632 316
901 3300025913 Ga0207695_10000964 Ga0207695_1000096411 316
902 3300025913 Ga0207695_10049362 Ga0207695_100493622 316
903 3300025913 Ga0207695_10086193 Ga0207695_100861932 316
904 3300025914 Ga0207671_10027273 Ga0207671_100272733 316
905 3300025917 Ga0207660_10006888 Ga0207660_100068889 316
906 3300025919 Ga0207657_10054869 Ga0207657_100548692 316
907 3300025921 Ga0207652_10002345 Ga0207652_100023454 316
908 3300025928 Ga0207700_10150068 Ga0207700_101500682 316
909 3300025929 Ga0207664_10179579 Ga0207664_101795792 316
910 3300025932 Ga0207690_10114010 Ga0207690_101140102 316
911 3300025949 Ga0207667_10000778 Ga0207667_1000077818 316
912 3300026078 Ga0207702_10007438 Ga0207702_100074389 316
913 3300026116 Ga0207674_10000320 Ga0207674_1000032016 316
914 3300026142 Ga0207698_10445850 Ga0207698_104458502 316
915 3300028654 Ga0265322_10026141 Ga0265322_100261412 316
916 3300029957 Ga0265324_10000411 Ga0265324_100004116 316
917 3300031249 Ga0265339_10000018 Ga0265339_100000187 316
918 3300035086 Ga0373934_0003185 Ga0373934_0003185_746_1699 316
919 3300035112 Ga0373932_0009979 Ga0373932_0009979_1027_1980 316
920 3300035117 Ga0373953_0011245 Ga0373953_0011245_1455_2408 316
921 3300035118 Ga0373954_0014791 Ga0373954_0014791_2408_3361 316
922 3300035172 Ga0373955_0174821 Ga0373955_0174821_247_1200 316
923 3300036401 Ga0373937_0019221 Ga0373937_0019221_4908_5861 316
924 3300036401 Ga0373937_0035160 Ga0373937_0035160_3473_4426 316
925 3300036401 Ga0373937_0339483 Ga0373937_0339483_152_1105 316
926 3300037853 Ga0436364_0176175 Ga0436364_0176175_684_1637 316
927 3300037853 Ga0436364_0807765 Ga0436364_0807765_6055_7008 316
928 3300037853 Ga0436364_0853204 Ga0436364_0853204_4805_5758 316
929 3300037853 Ga0436364_1386202 Ga0436364_1386202_1790_2743 316
930 3300037853 Ga0436364_1414125 Ga0436364_1414125_14439_15392 316
931 3300042876 Ga0451577_0000035 Ga0451577_0000035_301152_302105 316
932 3300042876 Ga0451577_0000127 Ga0451577_0000127_115830_116783 316
933 3300042876 Ga0451577_0000644 Ga0451577_0000644_22867_23853 316
934 3300042876 Ga0451577_0001119 Ga0451577_0001119_27245_28228 316
935 3300042876 Ga0451577_0001484 Ga0451577_0001484_4387_5340 316
936 3300042876 Ga0451577_0003259 Ga0451577_0003259_4038_4991 316
937 3300042876 Ga0451577_0008660 Ga0451577_0008660_1517_2470 316
938 3300042876 Ga0451577_0095159 Ga0451577_0095159_1183_2136 316
939 3300042876 Ga0451577_0190718 Ga0451577_0190718_168_1121 316
940 3300042876 Ga0451577_0392613 Ga0451577_0392613_222_1175 316
941 3300044673 Ga0453683_0000001 Ga0453683_0000001_560482_561435 316
942 3300044673 Ga0453683_0000009 Ga0453683_0000009_479145_480098 316
943 3300044673 Ga0453683_0000018 Ga0453683_0000018_171930_172883 316
944 3300044673 Ga0453683_0000233 Ga0453683_0000233_42167_43120 316
945 3300044673 Ga0453683_0004304 Ga0453683_0004304_896_1849 316
946 3300044673 Ga0453683_0004940 Ga0453683_0004940_815_1768 316
947 3300044673 Ga0453683_0006674 Ga0453683_0006674_4518_5471 316
948 3300044673 Ga0453683_0254441 Ga0453683_0254441_60_1013 316
949 3300044712 Ga0453684_0000097 Ga0453684_0000097_301159_302112 316
950 3300044712 Ga0453684_0000242 Ga0453684_0000242_85534_86487 316
951 3300044712 Ga0453684_0000539 Ga0453684_0000539_45415_46368 316
952 3300044712 Ga0453684_0000555 Ga0453684_0000555_93826_94779 316
953 3300044712 Ga0453684_0000941 Ga0453684_0000941_77572_78555 316
954 3300044712 Ga0453684_0001135 Ga0453684_0001135_38918_39904 316
955 3300044712 Ga0453684_0003084 Ga0453684_0003084_17713_18666 316
956 3300044712 Ga0453684_0004632 Ga0453684_0004632_16282_17235 316
957 3300044712 Ga0453684_0007938 Ga0453684_0007938_10127_11080 316
958 3300044712 Ga0453684_0013644 Ga0453684_0013644_3538_4491 316
959 3300044712 Ga0453684_0021899 Ga0453684_0021899_1064_2017 316
960 3300044712 Ga0453684_0142404 Ga0453684_0142404_1529_2482 316
961 3300044712 Ga0453684_0152488 Ga0453684_0152488_432_1385 316
962 3300044712 Ga0453684_0352507 Ga0453684_0352507_671_1624 316
963 3300044712 Ga0453684_0504267 Ga0453684_0504267_153_1106 316
964 3300045051 Ga0451576_0000488 Ga0451576_0000488_35360_36313 316
965 3300045051 Ga0451576_0000897 Ga0451576_0000897_16866_17852 316
966 3300045051 Ga0451576_0001625 Ga0451576_0001625_6232_7215 316
967 3300045051 Ga0451576_0002883 Ga0451576_0002883_12008_12961 316
968 3300045051 Ga0451576_0010023 Ga0451576_0010023_141_1094 316
969 3300045051 Ga0451576_0017004 Ga0451576_0017004_3091_4044 316
970 3300045051 Ga0451576_0018382 Ga0451576_0018382_1717_2670 316
971 3300045051 Ga0451576_0091231 Ga0451576_0091231_1932_2885 316
972 3300045051 Ga0451576_0131379 Ga0451576_0131379_385_1338 316
973 3300045051 Ga0451576_0249655 Ga0451576_0249655_130_1083 316
974 3300046678 Ga0495599_0015207 Ga0495599_0015207_992_1945 316
975 3300047322 Ga0495680_0130297 Ga0495680_0130297_702_1655 316
976 3300047444 Ga0495675_0273848 Ga0495675_0273848_12_965 316
977 3300047471 Ga0495684_0195055 Ga0495684_0195055_518_1471 316
978 3300048907 Ga0496104_0148724 Ga0496104_0148724_754_1707 316
979 3300048918 Ga0496115_0287935 Ga0496115_0287935_200_1153 316
980 3300049573 Ga0501037_0134521 Ga0501037_0134521_397_1350 316
981 3300049574 Ga0501038_0157567 Ga0501038_0157567_660_1613 316
982 3300053077 Ga0495601_0021931 Ga0495601_0021931_114_1067 316
983 2162886007 SwRhRL2b_contig_2277002 SwRhRL2b_0172.00005240 317
984 3300003856 Ga0058692_1000911 Ga0058692_10009116 317
985 3300005329 Ga0070683_100025908 Ga0070683_1000259083 317
986 3300005329 Ga0070683_100100147 Ga0070683_1001001473 317
987 3300005456 Ga0070678_100259453 Ga0070678_1002594532 317
988 3300005535 Ga0070684_100240764 Ga0070684_1002407642 317
989 3300005546 Ga0070696_100004865 Ga0070696_10000486510 317
990 3300005614 Ga0068856_100045631 Ga0068856_1000456312 317
991 3300005841 Ga0068863_100132291 Ga0068863_1001322913 317
992 3300006914 Ga0075436_100004138 Ga0075436_1000041389 317
993 3300006946 Ga0079104_1029289 Ga0079104_10292891 317
994 3300009011 Ga0105251_10033879 Ga0105251_100338792 317
995 3300009092 Ga0105250_10021791 Ga0105250_100217912 317
996 3300009093 Ga0105240_10308746 Ga0105240_103087462 317
997 3300009094 Ga0111539_10119867 Ga0111539_101198672 317
998 3300009176 Ga0105242_10146764 Ga0105242_101467643 317
999 3300013296 Ga0157374_10084829 Ga0157374_100848293 317
1000 3300013306 Ga0163162_10303072 Ga0163162_103030722 317
1001 3300014325 Ga0163163_10100549 Ga0163163_101005493 317
1002 3300014969 Ga0157376_10116201 Ga0157376_101162012 317
1003 3300015261 Ga0182006_1000174 Ga0182006_10001742 317
1004 3300021384 Ga0213876_10029263 Ga0213876_100292633 317
1005 3300021388 Ga0213875_10016825 Ga0213875_100168252 317
1006 3300025728 Ga0207655_1000002 Ga0207655_1000002141 317
1007 3300025912 Ga0207707_10112455 Ga0207707_101124553 317
1008 3300025913 Ga0207695_10005339 Ga0207695_100053394 317
1009 3300025913 Ga0207695_10031123 Ga0207695_100311235 317
1010 3300025913 Ga0207695_10134361 Ga0207695_101343611 317
1011 3300025928 Ga0207700_10078984 Ga0207700_100789842 317
1012 3300025944 Ga0207661_10011029 Ga0207661_100110293 317
1013 3300025944 Ga0207661_10077113 Ga0207661_100771132 317
1014 3300026078 Ga0207702_10033061 Ga0207702_100330616 317
1015 3300026088 Ga0207641_10067303 Ga0207641_100673032 317
1016 3300026121 Ga0207683_10223164 Ga0207683_102231642 317
1017 3300026121 Ga0207683_10288828 Ga0207683_102888282 317
1018 3300027111 Ga0209281_1001784 Ga0209281_10017843 317
1019 3300027312 Ga0209371_1002233 Ga0209371_10022336 317
1020 3300027312 Ga0209371_1003223 Ga0209371_10032232 317
1021 3300028577 Ga0265318_10051719 Ga0265318_100517191 317
1022 3300028800 Ga0265338_10004158 Ga0265338_1000415810 317
1023 3300028800 Ga0265338_10181457 Ga0265338_101814571 317
1024 3300030500 Ga0268256_1001972 Ga0268256_10019726 317
1025 3300031238 Ga0265332_10034307 Ga0265332_100343073 317
1026 3300031241 Ga0265325_10011735 Ga0265325_100117352 317
1027 3300031241 Ga0265325_10053699 Ga0265325_100536992 317
1028 3300031241 Ga0265325_10160877 Ga0265325_101608771 317
1029 3300031344 Ga0265316_10055363 Ga0265316_100553633 317
1030 3300031344 Ga0265316_10151517 Ga0265316_101515172 317
1031 3300031344 Ga0265316_10221885 Ga0265316_102218852 317
1032 3300031344 Ga0265316_10277884 Ga0265316_102778842 317
1033 3300031711 Ga0265314_10035236 Ga0265314_100352363 317
1034 3300031712 Ga0265342_10007898 Ga0265342_100078984 317
1035 3300035398 Ga0316574_0096617 Ga0316574_0096617_833_1789 317
1036 3300035695 Ga0373927_0002742 Ga0373927_0002742_597_1562 317
1037 3300035695 Ga0373927_0118306 Ga0373927_0118306_102_1061 317
1038 3300035695 Ga0373927_0301155 Ga0373927_0301155_85_1044 317
1039 3300036401 Ga0373937_0227032 Ga0373937_0227032_205_1164 317
1040 3300036401 Ga0373937_0576904 Ga0373937_0576904_68_1027 317
1041 3300036647 Ga0316582_0133884 Ga0316582_0133884_269_1228 317
1042 3300037068 Ga0373925_0000099 Ga0373925_0000099_70897_71862 317
1043 3300037853 Ga0436364_0748631 Ga0436364_0748631_340_1299 317
1044 3300037853 Ga0436364_1410728 Ga0436364_1410728_134_1096 317
1045 3300037853 Ga0436364_1489063 Ga0436364_1489063_1627_2586 317
1046 3300039437 Ga0436365_0721041 Ga0436365_0721041_69_1028 317
1047 3300041405 Ga0439438_013815 Ga0439438_013815_314_1285 317
1048 3300042010 Ga0439452_000003 Ga0439452_000003_657812_658783 317
1049 3300044712 Ga0453684_0000221 Ga0453684_0000221_232783_233739 317
1050 3300045051 Ga0451576_0059407 Ga0451576_0059407_305_1261 317
1051 3300046454 Ga0495592_0014490 Ga0495592_0014490_1643_2602 317
1052 3300046462 Ga0495651_0007664 Ga0495651_0007664_2894_3853 317
1053 3300046462 Ga0495651_0053021 Ga0495651_0053021_1993_2952 317
1054 3300046472 Ga0495580_0017429 Ga0495580_0017429_3523_4482 317
1055 3300046477 Ga0495664_0003394 Ga0495664_0003394_6940_7899 317
1056 3300046511 Ga0495608_0053847 Ga0495608_0053847_467_1426 317
1057 3300046516 Ga0495628_0012932 Ga0495628_0012932_4426_5385 317
1058 3300046516 Ga0495628_0180534 Ga0495628_0180534_165_1124 317
1059 3300046517 Ga0495630_0024426 Ga0495630_0024426_1303_2262 317
1060 3300046529 Ga0495652_0008745 Ga0495652_0008745_4061_5020 317
1061 3300046529 Ga0495652_0056581 Ga0495652_0056581_738_1697 317
1062 3300046531 Ga0495665_0021153 Ga0495665_0021153_1159_2118 317
1063 3300046533 Ga0495640_0110106 Ga0495640_0110106_622_1581 317
1064 3300046543 Ga0495645_0131099 Ga0495645_0131099_727_1686 317
1065 3300046559 Ga0495667_0060055 Ga0495667_0060055_1113_2072 317
1066 3300046663 Ga0495635_0089474 Ga0495635_0089474_332_1291 317
1067 3300046678 Ga0495599_0002296 Ga0495599_0002296_4855_5814 317
1068 3300046679 Ga0495623_0006999 Ga0495623_0006999_308_1267 317
1069 3300046680 Ga0495646_0037210 Ga0495646_0037210_964_1923 317
1070 3300046809 Ga0495600_0046810 Ga0495600_0046810_1727_2686 317
1071 3300047317 Ga0495604_0069019 Ga0495604_0069019_1330_2289 317
1072 3300047319 Ga0495674_0007240 Ga0495674_0007240_1304_2263 317
1073 3300047322 Ga0495680_0038892 Ga0495680_0038892_620_1579 317
1074 3300047444 Ga0495675_0033821 Ga0495675_0033821_1278_2237 317
1075 3300047471 Ga0495684_0000398 Ga0495684_0000398_32080_33039 317
1076 3300048088 Ga0495602_0015186 Ga0495602_0015186_4642_5601 317
1077 3300048088 Ga0495602_0186702 Ga0495602_0186702_238_1197 317
1078 3300048920 Ga0496117_0006308 Ga0496117_0006308_10401_11372 317
1079 3300048924 Ga0496121_0094533 Ga0496121_0094533_557_1528 317
1080 3300050514 nmdc:mga08x19_624_c1 nmdc:mga08x19_624_c1_5651_6607 317
1081 3300053151 Ga0500604_0053869 Ga0500604_0053869_265_1221 317
1082 iso_pu_bacteria 2599185299 2599926649 317
1083 iso_pu_bacteria 2684622997 2686356135 317
1084 iso_pu_bacteria 2808606414 2809125354 317
1085 iso_pu_bacteria 8002745576 8002746318 317
1086 3300005436 Ga0070713_100436349 Ga0070713_1004363491 318
1087 3300025928 Ga0207700_10386293 Ga0207700_103862932 318
1088 3300031251 Ga0265327_10007583 Ga0265327_100075833 318
1089 3300031730 Ga0307516_10000202 Ga0307516_1000020231 318
1090 3300042876 Ga0451577_0016891 Ga0451577_0016891_364_1323 318
1091 3300044712 Ga0453684_0019676 Ga0453684_0019676_3317_4306 318
1092 3300044712 Ga0453684_0162295 Ga0453684_0162295_492_1451 318
1093 3300045051 Ga0451576_0217205 Ga0451576_0217205_898_1857 318
1094 3300045051 Ga0451576_0741327 Ga0451576_0741327_58_1017 318
1095 3300049573 Ga0501037_0124890 Ga0501037_0124890_90_1049 318
1096 3300049579 Ga0501043_0035508 Ga0501043_0035508_1934_2893 318
1097 3300049823 Ga0501044_0028814 Ga0501044_0028814_343_1302 318
1098 iso_pu_bacteria 2506520007 2506579725 318
1099 iso_pu_bacteria 2506520008 2506584864 318
1100 iso_pu_bacteria 2508501071 2508853525 318
1101 iso_pu_bacteria 2537561728 2538426471 318
1102 iso_pu_bacteria 2565956521 2566034961 318
1103 iso_pu_bacteria 2648501241 2649121677 318
1104 iso_pu_bacteria 2651869818 2652975972 318
1105 iso_pu_bacteria 2654587920 2656276837 318
1106 iso_pu_bacteria 2687453601 2689446254 318
1107 iso_pu_bacteria 2706794495 2707100223 318
1108 iso_pu_bacteria 2772190666 2772440165 318
1109 iso_pu_bacteria 2811995292 2813727714 318
1110 iso_pu_bacteria 2854601825 2854605894 318
1111 iso_pu_bacteria 2855195626 2855196988 318
1112 iso_pu_bacteria 2858466076 2858467416 318
1113 iso_pu_bacteria 2869551831 2869555603 318
1114 iso_pu_bacteria 2871272651 2871273881 318
1115 iso_pu_bacteria 2871282230 2871283649 318
1116 iso_pu_bacteria 2888366609 2888370254 318
1117 iso_pu_bacteria 2888373701 2888377233 318
1118 iso_pu_bacteria 2900051742 2900054533 318
1119 iso_pu_bacteria 2916178963 2916182991 318
1120 iso_pu_bacteria 2919493220 2919496615 318
1121 iso_pu_bacteria 2919497567 2919500817 318
1122 iso_pu_bacteria 2919543075 2919547101 318
1123 iso_pu_bacteria 2923525760 2923529294 318
1124 iso_pu_bacteria 2932406140 2932410748 318
1125 iso_pu_bacteria 2937967321 2937968796 318
1126 iso_pu_bacteria 2939577877 2939582212 318
1127 iso_pu_bacteria 640753048 640939000 318
1128 iso_pu_bacteria 8004592986 8004596328 318
1129 iso_pu_bacteria 8015394850 8015397568 318
1130 iso_pu_bacteria 8055693939 8055695288 318
1131 3300003856 Ga0058692_1000067 Ga0058692_100006788 319
1132 3300005331 Ga0070670_100000018 Ga0070670_100000018184 319
1133 3300005353 Ga0070669_100000954 Ga0070669_10000095411 319
1134 3300005355 Ga0070671_100000084 Ga0070671_10000008422 319
1135 3300005365 Ga0070688_100000916 Ga0070688_1000009162 319
1136 3300005367 Ga0070667_100000002 Ga0070667_100000002123 319
1137 3300005455 Ga0070663_100328580 Ga0070663_1003285801 319
1138 3300005457 Ga0070662_100326916 Ga0070662_1003269161 319
1139 3300005466 Ga0070685_10000009 Ga0070685_10000009153 319
1140 3300005467 Ga0070706_100325542 Ga0070706_1003255421 319
1141 3300005548 Ga0070665_100004663 Ga0070665_1000046633 319
1142 3300005618 Ga0068864_100000002 Ga0068864_100000002357 319
1143 3300005842 Ga0068858_100117640 Ga0068858_1001176402 319
1144 3300005843 Ga0068860_100000499 Ga0068860_10000049942 319
1145 3300005844 Ga0068862_100005568 Ga0068862_1000055685 319
1146 3300009011 Ga0105251_10035079 Ga0105251_100350792 319
1147 3300009036 Ga0105244_10035887 Ga0105244_100358872 319
1148 3300009093 Ga0105240_10026186 Ga0105240_100261863 319
1149 3300009094 Ga0111539_10008365 Ga0111539_1000836513 319
1150 3300009094 Ga0111539_10016907 Ga0111539_100169071 319
1151 3300009101 Ga0105247_10004537 Ga0105247_100045372 319
1152 3300009148 Ga0105243_10000263 Ga0105243_100002633 319
1153 3300009553 Ga0105249_10012651 Ga0105249_100126515 319
1154 3300013104 Ga0157370_10199378 Ga0157370_101993782 319
1155 3300014325 Ga0163163_10000627 Ga0163163_1000062715 319
1156 3300017792 Ga0163161_10159843 Ga0163161_101598431 319
1157 3300025711 Ga0207696_1023146 Ga0207696_10231462 319
1158 3300025728 Ga0207655_1014210 Ga0207655_10142106 319
1159 3300025728 Ga0207655_1014306 Ga0207655_10143066 319
1160 3300025900 Ga0207710_10000455 Ga0207710_100004553 319
1161 3300025900 Ga0207710_10004382 Ga0207710_100043822 319
1162 3300025903 Ga0207680_10061334 Ga0207680_100613342 319
1163 3300025910 Ga0207684_10372437 Ga0207684_103724371 319
1164 3300025913 Ga0207695_10069201 Ga0207695_100692014 319
1165 3300025923 Ga0207681_10000509 Ga0207681_1000050917 319
1166 3300025925 Ga0207650_10000002 Ga0207650_10000002352 319
1167 3300025931 Ga0207644_10001798 Ga0207644_1000179810 319
1168 3300025933 Ga0207706_10284593 Ga0207706_102845932 319
1169 3300025935 Ga0207709_10000158 Ga0207709_1000015892 319
1170 3300025941 Ga0207711_10041953 Ga0207711_100419532 319
1171 3300025961 Ga0207712_10054911 Ga0207712_100549112 319
1172 3300025986 Ga0207658_10000001 Ga0207658_100000011000 319
1173 3300026095 Ga0207676_10000001 Ga0207676_10000001352 319
1174 3300027312 Ga0209371_1000196 Ga0209371_100019689 319
1175 3300027907 Ga0207428_10175085 Ga0207428_101750851 319
1176 3300028379 Ga0268266_10005113 Ga0268266_100051138 319
1177 3300028379 Ga0268266_10007323 Ga0268266_100073232 319
1178 3300028380 Ga0268265_10000455 Ga0268265_1000045534 319
1179 3300028381 Ga0268264_10000004 Ga0268264_10000004370 319
1180 3300030500 Ga0268256_1000158 Ga0268256_10001583 319
1181 3300042876 Ga0451577_0003915 Ga0451577_0003915_4205_5185 319
1182 3300046453 Ga0495627_005662 Ga0495627_005662_941_1939 319
1183 3300048917 Ga0496114_0003707 Ga0496114_0003707_143_1105 319
1184 3300048927 Ga0496124_0002023 Ga0496124_0002023_10773_11732 319
1185 3300048927 Ga0496124_0045902 Ga0496124_0045902_1428_2387 319
1186 3300048928 Ga0496125_0099344 Ga0496125_0099344_398_1357 319
1187 3300050511 nmdc:mga08y16_6325_c1 nmdc:mga08y16_6325_c1_79_1041 319
1188 iso_pu_bacteria 2551306352 2552746416 319
1189 iso_pu_bacteria 2675903507 2678229663 319
1190 iso_pu_bacteria 2744054655 2745162055 319
1191 iso_pu_bacteria 2773857761 2774391356 319
1192 iso_pu_bacteria 2773857770 2774436090 319
1193 iso_pu_bacteria 2852103415 2852107147 319
1194 iso_pu_bacteria 2916699645 2916702311 319
1195 iso_pu_bacteria 2919182534 2919185239 319
1196 iso_pu_bacteria 2984568884 2984569470 319
1197 3300005347 Ga0070668_100375171 Ga0070668_1003751711 320
1198 3300046529 Ga0495652_0351409 Ga0495652_0351409_45_1010 320
1199 3300046536 Ga0495587_0004848 Ga0495587_0004848_4282_5247 320
1200 3300048088 Ga0495602_0194688 Ga0495602_0194688_390_1355 320
1201 iso_pu_bacteria 2510065053 2510285074 320
1202 iso_pu_bacteria 2511231004 2511254484 320
1203 iso_pu_bacteria 2511231007 2511269701 320
1204 iso_pu_bacteria 2511231011 2511298767 320
1205 iso_pu_bacteria 2511231016 2511329179 320
1206 iso_pu_bacteria 2511231018 2511341334 320
1207 iso_pu_bacteria 2511231019 2511347513 320
1208 iso_pu_bacteria 2511231022 2511360643 320
1209 iso_pu_bacteria 2511231024 2511374796 320
1210 iso_pu_bacteria 2554235231 2555246088 320
1211 iso_pu_bacteria 2597489888 2597862830 320
1212 iso_pu_bacteria 2597489889 2597868631 320
1213 iso_pu_bacteria 2599185155 2599328570 320
1214 iso_pu_bacteria 2599185167 2599396608 320
1215 iso_pu_bacteria 2599185179 2599453332 320
1216 iso_pu_bacteria 2599185188 2599503933 320
1217 iso_pu_bacteria 2599185189 2599507589 320
1218 iso_pu_bacteria 2599185190 2599514664 320
1219 iso_pu_bacteria 2599185191 2599517405 320
1220 iso_pu_bacteria 2599185248 2599772729 320
1221 iso_pu_bacteria 2599185289 2599889226 320
1222 iso_pu_bacteria 2599185290 2599894071 320
1223 iso_pu_bacteria 2599185291 2599896547 320
1224 iso_pu_bacteria 2599185300 2599931901 320
1225 iso_pu_bacteria 2599185302 2599945551 320
1226 iso_pu_bacteria 2599185304 2599956669 320
1227 iso_pu_bacteria 2599185305 2599962622 320
1228 iso_pu_bacteria 2599185306 2599965242 320
1229 iso_pu_bacteria 2599185307 2599973907 320
1230 iso_pu_bacteria 2599185308 2599978788 320
1231 iso_pu_bacteria 2599185309 2599985409 320
1232 iso_pu_bacteria 2599185310 2599991840 320
1233 iso_pu_bacteria 2599185311 2599996561 320
1234 iso_pu_bacteria 2599185312 2600002363 320
1235 iso_pu_bacteria 2599185313 2600006884 320
1236 iso_pu_bacteria 2599185314 2600010474 320
1237 iso_pu_bacteria 2599185315 2600021397 320
1238 iso_pu_bacteria 2599185316 2600026382 320
1239 iso_pu_bacteria 2599185317 2600032463 320
1240 iso_pu_bacteria 2599185318 2600036318 320
1241 iso_pu_bacteria 2599185319 2600043615 320
1242 iso_pu_bacteria 2599185320 2600049896 320
1243 iso_pu_bacteria 2599185321 2600053523 320
1244 iso_pu_bacteria 2599185322 2600061461 320
1245 iso_pu_bacteria 2599185323 2600067385 320
1246 iso_pu_bacteria 2599185324 2600070392 320
1247 iso_pu_bacteria 2599185325 2600080220 320
1248 iso_pu_bacteria 2600254930 2600362025 320
1249 iso_pu_bacteria 2600255283 2601626537 320
1250 iso_pu_bacteria 2600255296 2601691366 320
1251 iso_pu_bacteria 2623620446 2624493752 320
1252 iso_pu_bacteria 2643221633 2644187584 320
1253 iso_pu_bacteria 2643221650 2644283634 320
1254 iso_pu_bacteria 2643221713 2644625113 320
1255 iso_pu_bacteria 2651869719 2652547489 320
1256 iso_pu_bacteria 2667528170 2671090423 320
1257 iso_pu_bacteria 2667528176 2671130395 320
1258 iso_pu_bacteria 2675903420 2677896682 320
1259 iso_pu_bacteria 2675903515 2678262380 320
1260 iso_pu_bacteria 2721755607 2723247659 320
1261 iso_pu_bacteria 2728369097 2729147406 320
1262 iso_pu_bacteria 2738541271 2738691410 320
1263 iso_pu_bacteria 2738543016 2739267185 320
1264 iso_pu_bacteria 2738543020 2739290022 320
1265 iso_pu_bacteria 2738543021 2739295334 320
1266 iso_pu_bacteria 2744054620 2745008726 320
1267 iso_pu_bacteria 2765235841 2765582576 320
1268 iso_pu_bacteria 2773857670 2774121349 320
1269 iso_pu_bacteria 2773857673 2774135982 320
1270 iso_pu_bacteria 2784132063 2784259992 320
1271 iso_pu_bacteria 2784132072 2784317308 320
1272 iso_pu_bacteria 2791355520 2794596176 320
1273 iso_pu_bacteria 2806310737 2807409656 320
1274 iso_pu_bacteria 2806310745 2807457957 320
1275 iso_pu_bacteria 2808606361 2808858227 320
1276 iso_pu_bacteria 2808606373 2808904563 320
1277 iso_pu_bacteria 2808606376 2808924150 320
1278 iso_pu_bacteria 2808606378 2808938384 320
1279 iso_pu_bacteria 2808606379 2808941811 320
1280 iso_pu_bacteria 2808606380 2808946091 320
1281 iso_pu_bacteria 2808606382 2808957514 320
1282 iso_pu_bacteria 2808606383 2808966712 320
1283 iso_pu_bacteria 2808606389 2809001542 320
1284 iso_pu_bacteria 2811994881 2812367911 320
1285 iso_pu_bacteria 2818991456 2819654504 320
1286 iso_pu_bacteria 2825651385 2825653259 320
1287 iso_pu_bacteria 2826581358 2826584468 320
1288 iso_pu_bacteria 2842805378 2842810088 320
1289 iso_pu_bacteria 2842815866 2842818035 320
1290 iso_pu_bacteria 2842837860 2842840061 320
1291 iso_pu_bacteria 2842849001 2842849342 320
1292 iso_pu_bacteria 2842854478 2842858989 320
1293 iso_pu_bacteria 2852657418 2852658718 320
1294 iso_pu_bacteria 2860339153 2860340223 320
1295 iso_pu_bacteria 2880230671 2880232108 320
1296 iso_pu_bacteria 2904518522 2904522362 320
1297 iso_pu_bacteria 2912963787 2912965141 320
1298 iso_pu_bacteria 2913036834 2913038352 320
1299 iso_pu_bacteria 2919155634 2919160059 320
1300 iso_pu_bacteria 2919481497 2919481620 320
1301 iso_pu_bacteria 2919506607 2919509235 320
1302 iso_pu_bacteria 2919697872 2919700339 320
1303 iso_pu_bacteria 2923519811 2923521962 320
1304 iso_pu_bacteria 2923586266 2923587523 320
1305 iso_pu_bacteria 2929144301 2929145797 320
1306 iso_pu_bacteria 2931369376 2931370863 320
1307 iso_pu_bacteria 2931390751 2931392496 320
1308 iso_pu_bacteria 2931396565 2931399874 320
1309 iso_pu_bacteria 2939651529 2939653501 320
1310 iso_pu_bacteria 2945928738 2945929108 320
1311 iso_pu_bacteria 2945961074 2945961817 320
1312 iso_pu_bacteria 2946006987 2946011338 320
1313 iso_pu_bacteria 2988728565 2988733332 320
1314 iso_pu_bacteria 3007252601 3007256756 320
1315 iso_pu_bacteria 3007315729 3007319005 320
1316 iso_pu_bacteria 3007419365 3007421130 320
1317 iso_pu_bacteria 3007511990 3007512825 320
1318 iso_pu_bacteria 3007803356 3007806354 320
1319 iso_pu_bacteria 3007866637 3007867986 320
1320 iso_pu_bacteria 3007872151 3007876025 320
1321 iso_pu_bacteria 651053060 651176454 320
1322 iso_pu_bacteria 8019775933 8019776994 320
1323 iso_pu_bacteria 8052494512 8052498645 320
1324 iso_pu_bacteria 8054347763 8054351917 320
1325 iso_pu_bacteria 8054929484 8054933913 320
1326 iso_pu_bacteria 8055817908 8055819527 320
1327 iso_pu_bacteria 8055878733 8055880244 320
1328 iso_pu_bacteria 8056115690 8056119958 320
1329 iso_pu_bacteria 8056120720 8056122118 320
1330 iso_pu_bacteria 8056137416 8056141600 320
1331 iso_pu_bacteria 8056143049 8056147478 320
1332 iso_pu_bacteria 8056155041 8056159314 320
1333 iso_pu_bacteria 8056161164 8056164810 320
1334 3300005288 Ga0065714_10067998 Ga0065714_100679983 322
1335 3300005548 Ga0070665_100060824 Ga0070665_1000608242 322
1336 3300006946 Ga0079104_1001016 Ga0079104_100101610 322
1337 3300006946 Ga0079104_1012482 Ga0079104_10124822 322
1338 3300009011 Ga0105251_10026906 Ga0105251_100269063 322
1339 3300009011 Ga0105251_10029981 Ga0105251_100299812 322
1340 3300009036 Ga0105244_10010093 Ga0105244_100100934 322
1341 3300009036 Ga0105244_10033838 Ga0105244_100338382 322
1342 3300009092 Ga0105250_10013939 Ga0105250_100139393 322
1343 3300009101 Ga0105247_10000176 Ga0105247_1000017630 322
1344 3300009174 Ga0105241_10000001 Ga0105241_10000001845 322
1345 3300013100 Ga0157373_10003913 Ga0157373_100039139 322
1346 3300017792 Ga0163161_10000003 Ga0163161_1000000335 322
1347 3300025711 Ga0207696_1000001 Ga0207696_10000012483 322
1348 3300025728 Ga0207655_1000262 Ga0207655_100026255 322
1349 3300025735 Ga0207713_1000070 Ga0207713_100007034 322
1350 3300025735 Ga0207713_1000072 Ga0207713_100007238 322
1351 3300025735 Ga0207713_1028889 Ga0207713_10288891 322
1352 3300025900 Ga0207710_10000051 Ga0207710_10000051152 322
1353 3300025911 Ga0207654_10000004 Ga0207654_10000004872 322
1354 3300027111 Ga0209281_1000038 Ga0209281_100003841 322
1355 3300028379 Ga0268266_10043227 Ga0268266_100432272 322
1356 3300031251 Ga0265327_10000229 Ga0265327_1000022941 322
1357 3300031727 Ga0316576_10070843 Ga0316576_100708431 322
1358 3300031727 Ga0316576_10265500 Ga0316576_102655001 322
1359 3300031728 Ga0316578_10102627 Ga0316578_101026271 322
1360 3300031733 Ga0316577_10076069 Ga0316577_100760693 322
1361 3300031733 Ga0316577_10140008 Ga0316577_101400082 322
1362 3300035398 Ga0316574_0020761 Ga0316574_0020761_2458_3438 322
1363 3300035398 Ga0316574_0243127 Ga0316574_0243127_84_1064 322
1364 3300036712 Ga0316584_0024907 Ga0316584_0024907_993_1973 322
1365 3300039062 Ga0400483_030371 Ga0400483_030371_14436_15422 322
1366 3300045051 Ga0451576_0003235 Ga0451576_0003235_14730_15710 322
1367 3300045051 Ga0451576_0396624 Ga0451576_0396624_52_1032 322
1368 3300046453 Ga0495627_000044 Ga0495627_000044_149374_150342 322
1369 3300046530 Ga0495654_0013991 Ga0495654_0013991_1624_2592 322
1370 3300046794 Ga0495589_0000003 Ga0495589_0000003_417844_418812 322
1371 3300048906 Ga0496103_0048117 Ga0496103_0048117_800_1768 322
1372 3300048919 Ga0496116_0000007 Ga0496116_0000007_449676_450644 322
1373 3300048920 Ga0496117_0002783 Ga0496117_0002783_10194_11162 322
1374 3300049572 Ga0501036_0000764 Ga0501036_0000764_19052_20023 322
1375 3300049573 Ga0501037_0040016 Ga0501037_0040016_1269_2240 322
1376 3300049574 Ga0501038_0007027 Ga0501038_0007027_7508_8479 322
1377 3300049579 Ga0501043_0005319 Ga0501043_0005319_6105_7076 322
1378 3300049822 Ga0501035_0003883 Ga0501035_0003883_5444_6415 322
1379 3300049823 Ga0501044_0000190 Ga0501044_0000190_49258_50229 322
1380 3300053119 Ga0500595_007403 Ga0500595_007403_219_1187 322
1381 3300005439 Ga0070711_100016406 Ga0070711_1000164062 323
1382 3300009093 Ga0105240_10054350 Ga0105240_100543502 323
1383 3300025913 Ga0207695_10342244 Ga0207695_103422441 323
1384 3300025916 Ga0207663_10016462 Ga0207663_100164624 323
1385 3300028017 Ga0265356_1000429 Ga0265356_10004294 323
1386 3300028556 Ga0265337_1021446 Ga0265337_10214462 323
1387 3300028558 Ga0265326_10006844 Ga0265326_100068442 323
1388 3300028558 Ga0265326_10013258 Ga0265326_100132583 323
1389 3300029957 Ga0265324_10000093 Ga0265324_1000009328 323
1390 3300031235 Ga0265330_10021605 Ga0265330_100216051 323
1391 3300031235 Ga0265330_10024877 Ga0265330_100248772 323
1392 3300031241 Ga0265325_10008975 Ga0265325_100089756 323
1393 3300031247 Ga0265340_10002279 Ga0265340_1000227911 323
1394 3300031247 Ga0265340_10012413 Ga0265340_100124132 323
1395 3300031249 Ga0265339_10000001 Ga0265339_10000001175 323
1396 3300031344 Ga0265316_10229035 Ga0265316_102290351 323
1397 3300031595 Ga0265313_10001373 Ga0265313_1000137325 323
1398 3300031595 Ga0265313_10018959 Ga0265313_100189592 323
1399 3300031595 Ga0265313_10040724 Ga0265313_100407242 323
1400 3300031691 Ga0316579_10061196 Ga0316579_100611962 323
1401 3300031711 Ga0265314_10139318 Ga0265314_101393181 323
1402 3300031901 Ga0307406_10013085 Ga0307406_100130853 323
1403 3300035692 Ga0373935_0145989 Ga0373935_0145989_280_1263 323
1404 3300037068 Ga0373925_0169322 Ga0373925_0169322_621_1604 323
1405 3300042876 Ga0451577_0026629 Ga0451577_0026629_3366_4352 323
1406 3300042876 Ga0451577_0065739 Ga0451577_0065739_1384_2370 323
1407 3300042876 Ga0451577_0161923 Ga0451577_0161923_856_1869 323
1408 3300044712 Ga0453684_0000115 Ga0453684_0000115_119146_120132 323
1409 3300044712 Ga0453684_0134239 Ga0453684_0134239_1079_2092 323
1410 3300044712 Ga0453684_0167310 Ga0453684_0167310_106_1092 323
1411 3300048918 Ga0496115_0007686 Ga0496115_0007686_6050_7033 323
1412 2124908027 MRS2a_Contig_6404 MRS2a_00294590 324
1413 2124908027 MRS2a_Contig_914 MRS2a_00760420 324
1414 3300005288 Ga0065714_10001613 Ga0065714_100016134 324
1415 3300005289 Ga0065704_10003637 Ga0065704_100036374 324
1416 3300005290 Ga0065712_10002299 Ga0065712_100022994 324
1417 3300005293 Ga0065715_10005136 Ga0065715_100051361 324
1418 3300005354 Ga0070675_100092910 Ga0070675_1000929102 324
1419 3300005842 Ga0068858_100136070 Ga0068858_1001360701 324
1420 3300009036 Ga0105244_10009787 Ga0105244_100097872 324
1421 3300009092 Ga0105250_10022369 Ga0105250_100223692 324
1422 3300013100 Ga0157373_10016161 Ga0157373_100161615 324
1423 3300013104 Ga0157370_10039334 Ga0157370_100393344 324
1424 3300014497 Ga0182008_10014996 Ga0182008_100149962 324
1425 3300015261 Ga0182006_1003543 Ga0182006_10035434 324
1426 3300015262 Ga0182007_10000143 Ga0182007_1000014322 324
1427 3300015265 Ga0182005_1002054 Ga0182005_10020545 324
1428 3300017792 Ga0163161_10036567 Ga0163161_100365674 324
1429 3300017792 Ga0163161_10261768 Ga0163161_102617682 324
1430 3300025256 Ga0209759_1003201 Ga0209759_10032014 324
1431 3300025711 Ga0207696_1002599 Ga0207696_10025996 324
1432 3300025728 Ga0207655_1001327 Ga0207655_10013275 324
1433 3300025728 Ga0207655_1009222 Ga0207655_10092225 324
1434 3300025728 Ga0207655_1014540 Ga0207655_10145402 324
1435 3300025735 Ga0207713_1005079 Ga0207713_10050796 324
1436 3300026088 Ga0207641_10259950 Ga0207641_102599502 324
1437 3300027876 Ga0209974_10045407 Ga0209974_100454072 324
1438 3300028563 Ga0265319_1000117 Ga0265319_100011729 324
1439 3300028577 Ga0265318_10000127 Ga0265318_1000012744 324
1440 3300031235 Ga0265330_10000112 Ga0265330_1000011250 324
1441 3300031238 Ga0265332_10001836 Ga0265332_100018364 324
1442 3300031239 Ga0265328_10000128 Ga0265328_100001287 324
1443 3300031239 Ga0265328_10006581 Ga0265328_100065812 324
1444 3300031240 Ga0265320_10000969 Ga0265320_1000096916 324
1445 3300031242 Ga0265329_10001427 Ga0265329_100014276 324
1446 3300031247 Ga0265340_10010569 Ga0265340_100105692 324
1447 3300031249 Ga0265339_10003001 Ga0265339_100030016 324
1448 3300031250 Ga0265331_10000591 Ga0265331_1000059122 324
1449 3300031251 Ga0265327_10000008 Ga0265327_10000008159 324
1450 3300031344 Ga0265316_10000731 Ga0265316_100007317 324
1451 3300031344 Ga0265316_10170975 Ga0265316_101709752 324
1452 3300031548 Ga0307408_100011056 Ga0307408_1000110565 324
1453 3300031595 Ga0265313_10000056 Ga0265313_1000005630 324
1454 3300031711 Ga0265314_10005145 Ga0265314_100051454 324
1455 3300031712 Ga0265342_10000472 Ga0265342_100004727 324
1456 3300031901 Ga0307406_10051967 Ga0307406_100519672 324
1457 3300031911 Ga0307412_10010098 Ga0307412_100100984 324
1458 3300031911 Ga0307412_10011635 Ga0307412_100116354 324
1459 3300032004 Ga0307414_10056920 Ga0307414_100569202 324
1460 3300037418 Ga0395900_0025210 Ga0395900_0025210_3379_4368 324
1461 3300037418 Ga0395900_0070182 Ga0395900_0070182_1401_2378 324
1462 3300037471 Ga0395905_0172075 Ga0395905_0172075_965_1954 324
1463 3300038742 Ga0400486_10993 Ga0400486_10993_883_1860 324
1464 3300039438 Ga0436360_1333063 Ga0436360_1333063_936_1913 324
1465 3300041405 Ga0439438_012015 Ga0439438_012015_219_1193 324
1466 3300041407 Ga0439447_002909 Ga0439447_002909_3357_4331 324
1467 3300041411 Ga0439466_0015267 Ga0439466_0015267_752_1726 324
1468 3300042006 Ga0439432_003342 Ga0439432_003342_1484_2458 324
1469 3300042009 Ga0439451_001638 Ga0439451_001638_3061_4035 324
1470 3300042010 Ga0439452_009904 Ga0439452_009904_834_1808 324
1471 3300042013 Ga0439456_000271 Ga0439456_000271_2602_3576 324
1472 3300042013 Ga0439456_008922 Ga0439456_008922_1065_2039 324
1473 3300042138 Ga0450903_002098 Ga0450903_002098_581_1555 324
1474 3300042146 Ga0450907_000132 Ga0450907_000132_23846_24820 324
1475 3300042156 Ga0439446_0017328 Ga0439446_0017328_268_1242 324
1476 3300042185 Ga0450909_002104 Ga0450909_002104_577_1551 324
1477 3300042435 Ga0439434_0000469 Ga0439434_0000469_8135_9109 324
1478 3300042461 Ga0439460_0001104 Ga0439460_0001104_2607_3581 324
1479 3300042876 Ga0451577_0015851 Ga0451577_0015851_5857_6837 324
1480 3300042993 Ga0439440_0009520 Ga0439440_0009520_500_1474 324
1481 3300044712 Ga0453684_0070696 Ga0453684_0070696_2323_3309 324
1482 3300044712 Ga0453684_0112724 Ga0453684_0112724_117_1097 324
1483 3300046452 Ga0495617_000327 Ga0495617_000327_14435_15409 324
1484 3300046455 Ga0495603_0019488 Ga0495603_0019488_1049_2023 324
1485 3300046457 Ga0495590_0003015 Ga0495590_0003015_165_1139 324
1486 3300046457 Ga0495590_0026839 Ga0495590_0026839_470_1444 324
1487 3300046458 Ga0495591_003647 Ga0495591_003647_4708_5682 324
1488 3300046460 Ga0495638_0032805 Ga0495638_0032805_213_1187 324
1489 3300046463 Ga0495653_0061150 Ga0495653_0061150_447_1421 324
1490 3300046471 Ga0495650_0009633 Ga0495650_0009633_1764_2738 324
1491 3300046474 Ga0495605_0001320 Ga0495605_0001320_17_991 324
1492 3300046474 Ga0495605_0006308 Ga0495605_0006308_3267_4241 324
1493 3300046475 Ga0495639_0000714 Ga0495639_0000714_3216_4190 324
1494 3300046491 Ga0495584_0001356 Ga0495584_0001356_12512_13486 324
1495 3300046491 Ga0495584_0004349 Ga0495584_0004349_4838_5812 324
1496 3300046491 Ga0495584_0004438 Ga0495584_0004438_4660_5634 324
1497 3300046492 Ga0495585_0022896 Ga0495585_0022896_2054_3028 324
1498 3300046499 Ga0495594_0003631 Ga0495594_0003631_5257_6231 324
1499 3300046501 Ga0495607_0000349 Ga0495607_0000349_37121_38095 324
1500 3300046506 Ga0495583_0006317 Ga0495583_0006317_5356_6330 324
1501 3300046506 Ga0495583_0050576 Ga0495583_0050576_519_1493 324
1502 3300046513 Ga0495616_0004161 Ga0495616_0004161_5676_6650 324
1503 3300046517 Ga0495630_0001621 Ga0495630_0001621_13426_14400 324
1504 3300046518 Ga0495631_0032838 Ga0495631_0032838_1086_2060 324
1505 3300046519 Ga0495632_0002507 Ga0495632_0002507_11199_12173 324
1506 3300046519 Ga0495632_0004158 Ga0495632_0004158_6599_7573 324
1507 3300046520 Ga0495637_0001699 Ga0495637_0001699_9340_10314 324
1508 3300046520 Ga0495637_0005266 Ga0495637_0005266_3393_4367 324
1509 3300046522 Ga0495643_0015736 Ga0495643_0015736_1836_2810 324
1510 3300046522 Ga0495643_0018964 Ga0495643_0018964_486_1460 324
1511 3300046523 Ga0495644_0006504 Ga0495644_0006504_2200_3174 324
1512 3300046524 Ga0495648_0001868 Ga0495648_0001868_1751_2725 324
1513 3300046524 Ga0495648_0025968 Ga0495648_0025968_2102_3076 324
1514 3300046524 Ga0495648_0093676 Ga0495648_0093676_636_1610 324
1515 3300046526 Ga0495666_0003007 Ga0495666_0003007_7150_8124 324
1516 3300046528 Ga0495642_0001462 Ga0495642_0001462_2462_3436 324
1517 3300046528 Ga0495642_0003766 Ga0495642_0003766_3318_4292 324
1518 3300046530 Ga0495654_0000096 Ga0495654_0000096_90893_91867 324
1519 3300046530 Ga0495654_0010751 Ga0495654_0010751_1632_2606 324
1520 3300046536 Ga0495587_0001493 Ga0495587_0001493_3420_4394 324
1521 3300046538 Ga0495609_0003270 Ga0495609_0003270_6795_7769 324
1522 3300046538 Ga0495609_0005619 Ga0495609_0005619_3696_4670 324
1523 3300046542 Ga0495597_0021120 Ga0495597_0021120_188_1162 324
1524 3300046557 Ga0495622_0000809 Ga0495622_0000809_6727_7701 324
1525 3300046557 Ga0495622_0001364 Ga0495622_0001364_2497_3471 324
1526 3300046615 Ga0495656_0001632 Ga0495656_0001632_6248_7222 324
1527 3300046642 Ga0495634_0000967 Ga0495634_0000967_3046_4020 324
1528 3300046648 Ga0495611_0016202 Ga0495611_0016202_1706_2680 324
1529 3300046660 Ga0495625_0047649 Ga0495625_0047649_1646_2620 324
1530 3300046663 Ga0495635_0000752 Ga0495635_0000752_2755_3729 324
1531 3300046664 Ga0495659_0001347 Ga0495659_0001347_4832_5806 324
1532 3300046665 Ga0495661_0110881 Ga0495661_0110881_342_1316 324
1533 3300046674 Ga0495588_0004580 Ga0495588_0004580_1704_2678 324
1534 3300046679 Ga0495623_0001889 Ga0495623_0001889_11246_12220 324
1535 3300046680 Ga0495646_0011937 Ga0495646_0011937_2561_3535 324
1536 3300046684 Ga0495669_0016103 Ga0495669_0016103_2139_3113 324
1537 3300046691 Ga0495670_0034984 Ga0495670_0034984_244_1218 324
1538 3300046692 Ga0495671_0000908 Ga0495671_0000908_17653_18627 324
1539 3300046692 Ga0495671_0004322 Ga0495671_0004322_6171_7145 324
1540 3300046694 Ga0495649_0001633 Ga0495649_0001633_15542_16516 324
1541 3300046694 Ga0495649_0010145 Ga0495649_0010145_1552_2526 324
1542 3300046794 Ga0495589_0000194 Ga0495589_0000194_15359_16333 324
1543 3300046794 Ga0495589_0008684 Ga0495589_0008684_117_1091 324
1544 3300046794 Ga0495589_0024274 Ga0495589_0024274_430_1404 324
1545 3300046810 Ga0495660_0020560 Ga0495660_0020560_769_1743 324
1546 3300047317 Ga0495604_0081857 Ga0495604_0081857_1104_2078 324
1547 3300047318 Ga0495636_0000764 Ga0495636_0000764_1271_2245 324
1548 3300047319 Ga0495674_0005437 Ga0495674_0005437_1835_2809 324
1549 3300047320 Ga0495672_0005100 Ga0495672_0005100_7892_8866 324
1550 3300047320 Ga0495672_0008463 Ga0495672_0008463_2309_3283 324
1551 3300047322 Ga0495680_0018000 Ga0495680_0018000_1863_2837 324
1552 3300047323 Ga0495683_0015091 Ga0495683_0015091_2756_3730 324
1553 3300047323 Ga0495683_0036322 Ga0495683_0036322_402_1376 324
1554 3300047443 Ga0495687_006222 Ga0495687_006222_4829_5803 324
1555 3300047445 Ga0495677_0003900 Ga0495677_0003900_2458_3432 324
1556 3300047446 Ga0495679_012040 Ga0495679_012040_335_1309 324
1557 3300047469 Ga0495673_0001933 Ga0495673_0001933_10061_11035 324
1558 3300047469 Ga0495673_0097623 Ga0495673_0097623_86_1060 324
1559 3300047673 Ga0495593_0045035 Ga0495593_0045035_1241_2215 324
1560 3300048091 Ga0495626_0004696 Ga0495626_0004696_5560_6534 324
1561 3300048091 Ga0495626_0006801 Ga0495626_0006801_2836_3810 324
1562 3300048091 Ga0495626_0033602 Ga0495626_0033602_577_1551 324
1563 3300048091 Ga0495626_0038730 Ga0495626_0038730_1110_2084 324
1564 3300048905 Ga0496102_0000991 Ga0496102_0000991_2751_3725 324
1565 3300048906 Ga0496103_0000997 Ga0496103_0000997_1876_2850 324
1566 3300048908 Ga0496105_0163634 Ga0496105_0163634_443_1417 324
1567 3300048913 Ga0496110_0056893 Ga0496110_0056893_1861_2835 324
1568 3300048914 Ga0496111_0126132 Ga0496111_0126132_240_1214 324
1569 3300048919 Ga0496116_0010359 Ga0496116_0010359_3807_4781 324
1570 3300048919 Ga0496116_0045906 Ga0496116_0045906_1808_2782 324
1571 3300048920 Ga0496117_0018402 Ga0496117_0018402_1886_2860 324
1572 3300048921 Ga0496118_0006537 Ga0496118_0006537_11203_12177 324
1573 3300048921 Ga0496118_0052475 Ga0496118_0052475_598_1572 324
1574 3300048924 Ga0496121_0030502 Ga0496121_0030502_1142_2116 324
1575 3300048925 Ga0496122_0007083 Ga0496122_0007083_2827_3801 324
1576 3300048926 Ga0496123_0054519 Ga0496123_0054519_247_1221 324
1577 3300048928 Ga0496125_0038928 Ga0496125_0038928_2519_3493 324
1578 3300048929 Ga0496126_0097180 Ga0496126_0097180_221_1195 324
1579 3300049459 Ga0495678_006374 Ga0495678_006374_3599_4573 324
1580 3300049459 Ga0495678_008976 Ga0495678_008976_2150_3124 324
1581 3300049460 Ga0495682_0000128 Ga0495682_0000128_54175_55149 324
1582 3300049460 Ga0495682_0017012 Ga0495682_0017012_1281_2255 324
1583 3300049460 Ga0495682_0019899 Ga0495682_0019899_1383_2357 324
1584 3300049569 Ga0501032_0001256 Ga0501032_0001256_5835_6812 324
1585 3300049570 Ga0501033_0003841 Ga0501033_0003841_7146_8123 324
1586 3300049571 Ga0501034_0008207 Ga0501034_0008207_3098_4075 324
1587 3300049573 Ga0501037_0002333 Ga0501037_0002333_2307_3284 324
1588 3300049574 Ga0501038_0003064 Ga0501038_0003064_11501_12478 324
1589 3300049576 Ga0501040_0106982 Ga0501040_0106982_935_1912 324
1590 3300049578 Ga0501042_0003284 Ga0501042_0003284_2810_3787 324
1591 3300049579 Ga0501043_0006282 Ga0501043_0006282_1278_2255 324
1592 3300049580 Ga0501046_0000889 Ga0501046_0000889_13028_14005 324
1593 3300049581 Ga0501047_0002434 Ga0501047_0002434_6372_7349 324
1594 3300049582 Ga0501048_0005502 Ga0501048_0005502_4720_5697 324
1595 3300049584 Ga0501068_0011869 Ga0501068_0011869_872_1849 324
1596 3300049742 Ga0501080_0145730 Ga0501080_0145730_1058_2035 324
1597 3300049822 Ga0501035_0006972 Ga0501035_0006972_5802_6779 324
1598 3300049822 Ga0501035_0191013 Ga0501035_0191013_326_1306 324
1599 3300049823 Ga0501044_0084786 Ga0501044_0084786_571_1548 324
1600 3300049823 Ga0501044_0126007 Ga0501044_0126007_734_1714 324
1601 3300049824 Ga0501045_0001759 Ga0501045_0001759_6817_7794 324
1602 iso_pu_bacteria 640427133 640488419 324

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

47

340

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c35-assembly1.cif.gz_A-2 crystal structure of m96a mutant of o-acetyl-l-serine sulfhydrylase from haemophilus influenzae 0.984 4 312
7cm8-assembly1.cif.gz_A-2 high resolution crystal structure of m92a mutant of o-acetyl-l-serine sulfhydrylase from haemophilus influenzae 0.9828 4 312
4ore-assembly1.cif.gz_X-2 error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9812 4 312
5j43-assembly1.cif.gz_A cdia-ct from uropathogenic escherichia coli in complex with cysk 0.98 2 314
7yof-assembly1.cif.gz_A-2 crystal structure of triple mutant (d67e, a68p, i88l) of o-acetyl-l-serine sulfhydrylase from haemophilus influenzae at 2.3 a 0.98 4 312
ID Description Score Start End Superfamily
1d6sB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9807 2 314 3.40.50.1100
af_I1L6I6_202_359_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9723 150 314 3.40.50.1100
1d6sB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9706 2 314 3.40.50.1100
5xa2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9698 4 316 3.40.50.1100
3vbeA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9687 159 314 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A7C6E4F2-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9993 139 316 GO:0006534
GO:0009069
GO:0044272
AF-V6AE82-F1-model_v4 deleted 0.9977 1 323
AF-A0A7S1NQW6-F1-model_v4 Tryptophan synthase beta chain-like PALP domain-containing protein 0.9977 91 265 GO:0019344
AF-A4VMC6-F1-model_v4 Cysteine synthase (EC 2.5.1.47) 0.9968 1 323 GO:0004124
GO:0006535
AF-A0A836NXP8-F1-model_v4 deleted 0.9966 1 286

Feature Viewer

pLDDT pTM Quality
94.12 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map