F494950
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1593 | 342 | 3186 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300005615|Ga0070702_100521761|Ga0070702_1005217611 |
| Length | 107 |
| Sequence | MVVFVTASIRTSLKESDGPMPDEQRVANNSQTYVADADTFQFETVQQENGQATVIRFRLEDPRYHAGDVLVVLSGSEIHFHGMIGQLADGWAVASDHRGSLLAATVQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 4 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 5 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 13 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 103 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 137 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 228 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 231 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 232 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 233 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 234 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 235 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 236 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 237 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 238 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 239 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 240 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 241 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 242 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 243 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 259 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 262 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 265 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 266 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 267 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 268 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 269 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 270 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 271 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 272 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 273 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 274 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 279 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 280 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 281 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 282 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 283 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 284 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 285 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 286 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 287 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 288 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 289 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 290 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 291 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 292 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 293 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 294 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 295 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 296 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 297 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 298 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 299 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 300 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 301 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 302 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 303 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 304 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 305 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 306 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 307 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 308 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 309 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 310 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 311 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 312 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 313 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 316 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 317 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 318 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 319 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 320 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 321 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 322 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 323 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 324 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 325 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 326 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 327 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 328 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 329 | 3300049849 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought | Metagenome | Rhizosphere |
| 330 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 331 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 332 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 333 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0.13 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.13 |
| Rhizosphere | 98.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 31.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070702_100521761 | 3300005615 | Bacteria | 876 |
| 2 | MRS2a_Contig_11610 | 2124908027 | Bacteria | 673 |
| 3 | SwRhRL3b_contig_1296301 | 2162886006 | Bacteria | 1376 |
| 4 | SwRhRL3b_contig_2608105 | 2162886006 | Unclassified | 1569 |
| 5 | SwRhRL3b_contig_3931003 | 2162886006 | Unclassified | 857 |
| 6 | MBSR1b_contig_5607604 | 2162886012 | Unclassified | 941 |
| 7 | CNAas_1000004 | 3300000532 | Bacteria | 14982 |
| 8 | JGI24034J26672_10000002 | 3300002239 | Bacteria | 925353 |
| 9 | JGI24742J22300_10007517 | 3300002244 | Bacteria | 1798 |
| 10 | JGI24751J29686_10000017 | 3300002459 | Bacteria | 109415 |
| 11 | JGI24751J29686_10000149 | 3300002459 | Bacteria | 33687 |
| 12 | JGI25406J46586_10014972 | 3300003203 | Unclassified | 3282 |
| 13 | JGI25406J46586_10015093 | 3300003203 | Unclassified | 3266 |
| 14 | JGI25406J46586_10056700 | 3300003203 | Bacteria | 1284 |
| 15 | rootH2_10239322 | 3300003320 | Unclassified | 1227 |
| 16 | rootL2_10089685 | 3300003322 | Bacteria | 6450 |
| 17 | Ga0058859_11445007 | 3300004798 | Unclassified | 814 |
| 18 | Ga0058860_12182722 | 3300004801 | Bacteria | 619 |
| 19 | Ga0065714_10064460 | 3300005288 | Bacteria | 66400 |
| 20 | Ga0065704_10011042 | 3300005289 | Unclassified | 2166 |
| 21 | Ga0065704_10083950 | 3300005289 | Bacteria | 3397 |
| 22 | Ga0065704_10118959 | 3300005289 | Bacteria | 1808 |
| 23 | Ga0065704_10300358 | 3300005289 | Bacteria | 886 |
| 24 | Ga0065704_10375249 | 3300005289 | Unclassified | 780 |
| 25 | Ga0065704_10509140 | 3300005289 | Unclassified | 661 |
| 26 | Ga0065712_10068069 | 3300005290 | Bacteria | 15521 |
| 27 | Ga0065712_10072987 | 3300005290 | Bacteria | 4544 |
| 28 | Ga0065712_10186778 | 3300005290 | Bacteria | 1136 |
| 29 | Ga0065712_10189659 | 3300005290 | Bacteria | 1153 |
| 30 | Ga0065712_10541569 | 3300005290 | Unclassified | 623 |
| 31 | Ga0065712_10633265 | 3300005290 | Unclassified | 575 |
| 32 | Ga0065712_10758371 | 3300005290 | Unclassified | 526 |
| 33 | Ga0065712_10762445 | 3300005290 | Bacteria | 522 |
| 34 | Ga0065712_10807805 | 3300005290 | Bacteria | 510 |
| 35 | Ga0065715_10089839 | 3300005293 | Bacteria | 8355 |
| 36 | Ga0065715_10095392 | 3300005293 | Bacteria | 4095 |
| 37 | Ga0065715_10107731 | 3300005293 | Bacteria | 2747 |
| 38 | Ga0065715_10117551 | 3300005293 | Bacteria | 2344 |
| 39 | Ga0065715_10131647 | 3300005293 | Bacteria | 1975 |
| 40 | Ga0065715_10148470 | 3300005293 | Bacteria | 1732 |
| 41 | Ga0065715_10237332 | 3300005293 | Bacteria | 1212 |
| 42 | Ga0065715_10306895 | 3300005293 | Bacteria | 1029 |
| 43 | Ga0065715_10344726 | 3300005293 | Bacteria | 961 |
| 44 | Ga0065715_10651527 | 3300005293 | Unclassified | 678 |
| 45 | Ga0065715_10765313 | 3300005293 | Unclassified | 555 |
| 46 | Ga0065715_10823858 | 3300005293 | Unclassified | 601 |
| 47 | Ga0065715_11082937 | 3300005293 | Bacteria | 524 |
| 48 | Ga0065707_10010856 | 3300005295 | Bacteria | 2354 |
| 49 | Ga0065707_10201680 | 3300005295 | Unclassified | 1307 |
| 50 | Ga0065707_10235308 | 3300005295 | Bacteria | 1174 |
| 51 | Ga0065707_10294041 | 3300005295 | Bacteria | 1019 |
| 52 | Ga0065707_10335170 | 3300005295 | Unclassified | 943 |
| 53 | Ga0065707_10519932 | 3300005295 | Unclassified | 743 |
| 54 | Ga0065707_10529747 | 3300005295 | Bacteria | 731 |
| 55 | Ga0065707_10658809 | 3300005295 | Unclassified | 659 |
| 56 | Ga0070676_10032637 | 3300005328 | Bacteria | 2984 |
| 57 | Ga0070676_10243604 | 3300005328 | Bacteria | 1197 |
| 58 | Ga0070676_10358790 | 3300005328 | Bacteria | 1004 |
| 59 | Ga0070676_11021682 | 3300005328 | Unclassified | 621 |
| 60 | Ga0070676_11144689 | 3300005328 | Unclassified | 589 |
| 61 | Ga0070683_100151571 | 3300005329 | Bacteria | 2198 |
| 62 | Ga0070690_100001046 | 3300005330 | Bacteria | 14164 |
| 63 | Ga0070690_100037425 | 3300005330 | Bacteria | 3057 |
| 64 | Ga0070690_100173822 | 3300005330 | Bacteria | 1484 |
| 65 | Ga0070690_100188166 | 3300005330 | Bacteria | 1430 |
| 66 | Ga0070690_100189860 | 3300005330 | Unclassified | 1424 |
| 67 | Ga0070690_100958731 | 3300005330 | Unclassified | 672 |
| 68 | Ga0070690_101543130 | 3300005330 | Unclassified | 537 |
| 69 | Ga0070670_100005375 | 3300005331 | Bacteria | 10812 |
| 70 | Ga0070670_100039124 | 3300005331 | Bacteria | 4078 |
| 71 | Ga0070670_100085719 | 3300005331 | Bacteria | 2706 |
| 72 | Ga0070670_100270379 | 3300005331 | Bacteria | 1483 |
| 73 | Ga0070670_100339090 | 3300005331 | Unclassified | 1319 |
| 74 | Ga0070670_100351613 | 3300005331 | Bacteria | 1295 |
| 75 | Ga0070670_100351694 | 3300005331 | Bacteria | 1294 |
| 76 | Ga0070670_100360744 | 3300005331 | Bacteria | 1278 |
| 77 | Ga0070670_100737455 | 3300005331 | Unclassified | 887 |
| 78 | Ga0070670_100830129 | 3300005331 | Bacteria | 836 |
| 79 | Ga0070670_101506894 | 3300005331 | Unclassified | 617 |
| 80 | Ga0070677_10314608 | 3300005333 | Bacteria | 800 |
| 81 | Ga0070677_10665447 | 3300005333 | Unclassified | 583 |
| 82 | Ga0070677_10852453 | 3300005333 | Bacteria | 524 |
| 83 | Ga0068869_100007551 | 3300005334 | Bacteria | 6960 |
| 84 | Ga0068869_100024467 | 3300005334 | Bacteria | 4183 |
| 85 | Ga0068869_100049836 | 3300005334 | Bacteria | 3033 |
| 86 | Ga0068869_100194191 | 3300005334 | Bacteria | 1598 |
| 87 | Ga0068869_100223963 | 3300005334 | Bacteria | 1492 |
| 88 | Ga0068869_100278987 | 3300005334 | Unclassified | 1343 |
| 89 | Ga0068869_100280994 | 3300005334 | Bacteria | 1339 |
| 90 | Ga0068869_100443435 | 3300005334 | Unclassified | 1075 |
| 91 | Ga0068869_100705214 | 3300005334 | Unclassified | 861 |
| 92 | Ga0068869_100871428 | 3300005334 | Bacteria | 778 |
| 93 | Ga0068869_101208385 | 3300005334 | Bacteria | 665 |
| 94 | Ga0068869_101566084 | 3300005334 | Bacteria | 586 |
| 95 | Ga0068869_101705336 | 3300005334 | Unclassified | 562 |
| 96 | Ga0070666_10179611 | 3300005335 | Bacteria | 1484 |
| 97 | Ga0070666_10743424 | 3300005335 | Bacteria | 721 |
| 98 | Ga0070680_100013569 | 3300005336 | Bacteria | 6350 |
| 99 | Ga0070680_100057291 | 3300005336 | Bacteria | 3186 |
| 100 | Ga0070680_100166982 | 3300005336 | Bacteria | 1851 |
| 101 | Ga0070680_100169415 | 3300005336 | Bacteria | 1837 |
| 102 | Ga0070680_100493796 | 3300005336 | Unclassified | 1047 |
| 103 | Ga0070680_101726647 | 3300005336 | Unclassified | 542 |
| 104 | Ga0070682_100093931 | 3300005337 | Bacteria | 1967 |
| 105 | Ga0070682_100290157 | 3300005337 | Bacteria | 1196 |
| 106 | Ga0068868_100007808 | 3300005338 | Bacteria | 7637 |
| 107 | Ga0068868_100415580 | 3300005338 | Bacteria | 1164 |
| 108 | Ga0068868_100640344 | 3300005338 | Bacteria | 946 |
| 109 | Ga0068868_100942934 | 3300005338 | Bacteria | 787 |
| 110 | Ga0068868_100982438 | 3300005338 | Unclassified | 771 |
| 111 | Ga0070660_101673088 | 3300005339 | Unclassified | 542 |
| 112 | Ga0070689_100002993 | 3300005340 | Bacteria | 11113 |
| 113 | Ga0070689_100096060 | 3300005340 | Unclassified | 2342 |
| 114 | Ga0070689_100165309 | 3300005340 | Bacteria | 1791 |
| 115 | Ga0070689_100169227 | 3300005340 | Bacteria | 1770 |
| 116 | Ga0070689_100180065 | 3300005340 | Unclassified | 1716 |
| 117 | Ga0070689_100189932 | 3300005340 | Bacteria | 1672 |
| 118 | Ga0070689_100303314 | 3300005340 | Unclassified | 1330 |
| 119 | Ga0070689_100930094 | 3300005340 | Bacteria | 770 |
| 120 | Ga0070689_102164220 | 3300005340 | Unclassified | 510 |
| 121 | Ga0070691_10070020 | 3300005341 | Bacteria | 1701 |
| 122 | Ga0070691_10178249 | 3300005341 | Bacteria | 1105 |
| 123 | Ga0070691_10415664 | 3300005341 | Bacteria | 761 |
| 124 | Ga0070687_100014088 | 3300005343 | Bacteria | 3583 |
| 125 | Ga0070687_100023965 | 3300005343 | Bacteria | 2907 |
| 126 | Ga0070687_100083621 | 3300005343 | Unclassified | 1748 |
| 127 | Ga0070687_100190456 | 3300005343 | Bacteria | 1236 |
| 128 | Ga0070687_100198919 | 3300005343 | Unclassified | 1213 |
| 129 | Ga0070687_100302197 | 3300005343 | Bacteria | 1016 |
| 130 | Ga0070687_100502200 | 3300005343 | Unclassified | 817 |
| 131 | Ga0070687_101401304 | 3300005343 | Unclassified | 522 |
| 132 | Ga0070661_100239167 | 3300005344 | Bacteria | 1398 |
| 133 | Ga0070661_100867558 | 3300005344 | Bacteria | 744 |
| 134 | Ga0070692_10010290 | 3300005345 | Bacteria | 4251 |
| 135 | Ga0070692_10102794 | 3300005345 | Bacteria | 1569 |
| 136 | Ga0070692_10171622 | 3300005345 | Bacteria | 1250 |
| 137 | Ga0070692_10339714 | 3300005345 | Unclassified | 929 |
| 138 | Ga0070692_10397043 | 3300005345 | Bacteria | 869 |
| 139 | Ga0070692_10399291 | 3300005345 | Unclassified | 867 |
| 140 | Ga0070692_10623561 | 3300005345 | Bacteria | 716 |
| 141 | Ga0070692_10678020 | 3300005345 | Bacteria | 691 |
| 142 | Ga0070692_10756924 | 3300005345 | Unclassified | 659 |
| 143 | Ga0070692_11128043 | 3300005345 | Unclassified | 555 |
| 144 | Ga0070692_11427125 | 3300005345 | Unclassified | 501 |
| 145 | Ga0070669_100002230 | 3300005353 | Bacteria | 14029 |
| 146 | Ga0070669_100010477 | 3300005353 | Bacteria | 6584 |
| 147 | Ga0070669_100113959 | 3300005353 | Bacteria | 2055 |
| 148 | Ga0070669_100459268 | 3300005353 | Bacteria | 1051 |
| 149 | Ga0070669_100680061 | 3300005353 | Bacteria | 868 |
| 150 | Ga0070669_101300527 | 3300005353 | Bacteria | 630 |
| 151 | Ga0070675_100228755 | 3300005354 | Bacteria | 1622 |
| 152 | Ga0070675_100312349 | 3300005354 | Bacteria | 1387 |
| 153 | Ga0070675_100475415 | 3300005354 | Bacteria | 1123 |
| 154 | Ga0070675_100748491 | 3300005354 | Unclassified | 892 |
| 155 | Ga0070675_100862853 | 3300005354 | Unclassified | 829 |
| 156 | Ga0070675_101828494 | 3300005354 | Bacteria | 560 |
| 157 | Ga0070671_100002480 | 3300005355 | Bacteria | 14270 |
| 158 | Ga0070671_100045419 | 3300005355 | Bacteria | 3652 |
| 159 | Ga0070671_100114238 | 3300005355 | Bacteria | 2269 |
| 160 | Ga0070671_100851201 | 3300005355 | Unclassified | 795 |
| 161 | Ga0070671_101064418 | 3300005355 | Unclassified | 710 |
| 162 | Ga0070674_100516308 | 3300005356 | Unclassified | 997 |
| 163 | Ga0070674_100577257 | 3300005356 | Bacteria | 947 |
| 164 | Ga0070673_100012429 | 3300005364 | Bacteria | 5844 |
| 165 | Ga0070673_100029869 | 3300005364 | Bacteria | 4070 |
| 166 | Ga0070673_100049169 | 3300005364 | Bacteria | 3292 |
| 167 | Ga0070673_100105087 | 3300005364 | Bacteria | 2332 |
| 168 | Ga0070673_100411888 | 3300005364 | Unclassified | 1210 |
| 169 | Ga0070673_100788027 | 3300005364 | Unclassified | 877 |
| 170 | Ga0070673_100959241 | 3300005364 | Bacteria | 795 |
| 171 | Ga0070673_101015646 | 3300005364 | Unclassified | 773 |
| 172 | Ga0070673_101064959 | 3300005364 | Unclassified | 754 |
| 173 | Ga0070673_101612314 | 3300005364 | Bacteria | 613 |
| 174 | Ga0070673_101864297 | 3300005364 | Unclassified | 570 |
| 175 | Ga0070673_102076273 | 3300005364 | Unclassified | 540 |
| 176 | Ga0070688_100015368 | 3300005365 | Bacteria | 4354 |
| 177 | Ga0070688_100487162 | 3300005365 | Bacteria | 928 |
| 178 | Ga0070688_100711450 | 3300005365 | Unclassified | 779 |
| 179 | Ga0070688_100895556 | 3300005365 | Unclassified | 699 |
| 180 | Ga0070688_101170034 | 3300005365 | Unclassified | 617 |
| 181 | Ga0070688_101754273 | 3300005365 | Unclassified | 509 |
| 182 | Ga0070659_100039290 | 3300005366 | Unclassified | 3694 |
| 183 | Ga0070659_100128321 | 3300005366 | Bacteria | 2058 |
| 184 | Ga0070659_100690065 | 3300005366 | Bacteria | 882 |
| 185 | Ga0070667_100021151 | 3300005367 | Bacteria | 5405 |
| 186 | Ga0070667_100163170 | 3300005367 | Bacteria | 1964 |
| 187 | Ga0070667_100965162 | 3300005367 | Bacteria | 795 |
| 188 | Ga0070667_101109108 | 3300005367 | Bacteria | 740 |
| 189 | Ga0070667_101760522 | 3300005367 | Unclassified | 583 |
| 190 | Ga0070703_10000081 | 3300005406 | Bacteria | 47961 |
| 191 | Ga0070703_10015244 | 3300005406 | Unclassified | 2199 |
| 192 | Ga0070703_10299019 | 3300005406 | Bacteria | 670 |
| 193 | Ga0070703_10415488 | 3300005406 | Unclassified | 589 |
| 194 | Ga0070703_10586856 | 3300005406 | Bacteria | 512 |
| 195 | Ga0070709_10332763 | 3300005434 | Bacteria | 1118 |
| 196 | Ga0070701_10008309 | 3300005438 | Bacteria | 4484 |
| 197 | Ga0070701_10014106 | 3300005438 | Bacteria | 3655 |
| 198 | Ga0070701_10024681 | 3300005438 | Bacteria | 2910 |
| 199 | Ga0070701_10053852 | 3300005438 | Unclassified | 2096 |
| 200 | Ga0070701_10065518 | 3300005438 | Unclassified | 1928 |
| 201 | Ga0070701_10065613 | 3300005438 | Unclassified | 1927 |
| 202 | Ga0070701_10612105 | 3300005438 | Unclassified | 723 |
| 203 | Ga0070701_10963315 | 3300005438 | Bacteria | 593 |
| 204 | Ga0070711_101694197 | 3300005439 | Bacteria | 554 |
| 205 | Ga0070705_100080171 | 3300005440 | Unclassified | 2002 |
| 206 | Ga0070705_100117897 | 3300005440 | Bacteria | 1709 |
| 207 | Ga0070705_100234958 | 3300005440 | Bacteria | 1277 |
| 208 | Ga0070705_100332245 | 3300005440 | Bacteria | 1101 |
| 209 | Ga0070705_100385252 | 3300005440 | Bacteria | 1033 |
| 210 | Ga0070705_100805526 | 3300005440 | Unclassified | 748 |
| 211 | Ga0070705_101072543 | 3300005440 | Bacteria | 658 |
| 212 | Ga0070705_101781812 | 3300005440 | Unclassified | 522 |
| 213 | Ga0070700_100000964 | 3300005441 | Bacteria | 14218 |
| 214 | Ga0070700_100034359 | 3300005441 | Bacteria | 3062 |
| 215 | Ga0070700_100056426 | 3300005441 | Unclassified | 2462 |
| 216 | Ga0070700_100157664 | 3300005441 | Bacteria | 1559 |
| 217 | Ga0070700_100161480 | 3300005441 | Bacteria | 1543 |
| 218 | Ga0070700_100757436 | 3300005441 | Bacteria | 778 |
| 219 | Ga0070694_100000264 | 3300005444 | Bacteria | 27824 |
| 220 | Ga0070694_100025104 | 3300005444 | Bacteria | 3854 |
| 221 | Ga0070694_100035884 | 3300005444 | Unclassified | 3281 |
| 222 | Ga0070694_100058270 | 3300005444 | Bacteria | 2627 |
| 223 | Ga0070694_100123883 | 3300005444 | Bacteria | 1858 |
| 224 | Ga0070694_100147570 | 3300005444 | Unclassified | 1714 |
| 225 | Ga0070694_100184431 | 3300005444 | Bacteria | 1545 |
| 226 | Ga0070694_100185495 | 3300005444 | Bacteria | 1541 |
| 227 | Ga0070694_100247167 | 3300005444 | Unclassified | 1348 |
| 228 | Ga0070694_100258289 | 3300005444 | Bacteria | 1320 |
| 229 | Ga0070694_100294498 | 3300005444 | Bacteria | 1241 |
| 230 | Ga0070694_100310204 | 3300005444 | Bacteria | 1211 |
| 231 | Ga0070694_100361215 | 3300005444 | Unclassified | 1128 |
| 232 | Ga0070694_100609897 | 3300005444 | Unclassified | 880 |
| 233 | Ga0070694_100737723 | 3300005444 | Unclassified | 803 |
| 234 | Ga0070694_100796830 | 3300005444 | Unclassified | 774 |
| 235 | Ga0070694_100817290 | 3300005444 | Unclassified | 765 |
| 236 | Ga0070694_100827429 | 3300005444 | Bacteria | 761 |
| 237 | Ga0070694_100859917 | 3300005444 | Bacteria | 747 |
| 238 | Ga0070694_100993926 | 3300005444 | Bacteria | 696 |
| 239 | Ga0070694_101140415 | 3300005444 | Unclassified | 651 |
| 240 | Ga0070694_101296620 | 3300005444 | Unclassified | 612 |
| 241 | Ga0070694_101313669 | 3300005444 | Bacteria | 609 |
| 242 | Ga0070694_101803010 | 3300005444 | Unclassified | 521 |
| 243 | Ga0070694_101959337 | 3300005444 | Bacteria | 501 |
| 244 | Ga0070708_100000508 | 3300005445 | Bacteria | 29318 |
| 245 | Ga0070708_100033345 | 3300005445 | Bacteria | 4474 |
| 246 | Ga0070708_100153039 | 3300005445 | Bacteria | 2146 |
| 247 | Ga0070708_100253976 | 3300005445 | Bacteria | 1652 |
| 248 | Ga0070708_100280968 | 3300005445 | Unclassified | 1567 |
| 249 | Ga0070708_100457801 | 3300005445 | Bacteria | 1204 |
| 250 | Ga0070708_100508299 | 3300005445 | Bacteria | 1137 |
| 251 | Ga0070708_100678611 | 3300005445 | Unclassified | 970 |
| 252 | Ga0070708_101019249 | 3300005445 | Unclassified | 776 |
| 253 | Ga0070708_101091246 | 3300005445 | Bacteria | 748 |
| 254 | Ga0070678_100102215 | 3300005456 | Bacteria | 2224 |
| 255 | Ga0070678_101256349 | 3300005456 | Bacteria | 688 |
| 256 | Ga0070662_100085451 | 3300005457 | Bacteria | 2358 |
| 257 | Ga0070662_100275963 | 3300005457 | Unclassified | 1359 |
| 258 | Ga0070662_100290873 | 3300005457 | Bacteria | 1325 |
| 259 | Ga0070662_100352717 | 3300005457 | Bacteria | 1206 |
| 260 | Ga0070662_100889246 | 3300005457 | Unclassified | 760 |
| 261 | Ga0070681_10000489 | 3300005458 | Bacteria | 32333 |
| 262 | Ga0070681_10046425 | 3300005458 | Bacteria | 4343 |
| 263 | Ga0070681_10047995 | 3300005458 | Bacteria | 4267 |
| 264 | Ga0070681_10072586 | 3300005458 | Unclassified | 3404 |
| 265 | Ga0070681_10231787 | 3300005458 | Unclassified | 1761 |
| 266 | Ga0070681_10758840 | 3300005458 | Bacteria | 887 |
| 267 | Ga0068867_100014896 | 3300005459 | Bacteria | 5510 |
| 268 | Ga0068867_100110352 | 3300005459 | Bacteria | 2113 |
| 269 | Ga0068867_100282674 | 3300005459 | Unclassified | 1361 |
| 270 | Ga0068867_100300247 | 3300005459 | Unclassified | 1324 |
| 271 | Ga0068867_100331315 | 3300005459 | Bacteria | 1264 |
| 272 | Ga0068867_100461314 | 3300005459 | Bacteria | 1085 |
| 273 | Ga0068867_100518630 | 3300005459 | Unclassified | 1027 |
| 274 | Ga0068867_100588590 | 3300005459 | Unclassified | 969 |
| 275 | Ga0068867_100780902 | 3300005459 | Unclassified | 850 |
| 276 | Ga0068867_101250038 | 3300005459 | Unclassified | 684 |
| 277 | Ga0068867_101374698 | 3300005459 | Bacteria | 654 |
| 278 | Ga0068867_101725079 | 3300005459 | Bacteria | 588 |
| 279 | Ga0068867_101849831 | 3300005459 | Unclassified | 568 |
| 280 | Ga0068867_102021214 | 3300005459 | Unclassified | 545 |
| 281 | Ga0070685_10007677 | 3300005466 | Bacteria | 5520 |
| 282 | Ga0070685_11459654 | 3300005466 | Unclassified | 526 |
| 283 | Ga0070685_11487242 | 3300005466 | Bacteria | 522 |
| 284 | Ga0070706_100000088 | 3300005467 | Bacteria | 107818 |
| 285 | Ga0070706_100009738 | 3300005467 | Bacteria | 8930 |
| 286 | Ga0070706_100053420 | 3300005467 | Bacteria | 3730 |
| 287 | Ga0070706_100070901 | 3300005467 | Bacteria | 3223 |
| 288 | Ga0070706_100201747 | 3300005467 | Bacteria | 1858 |
| 289 | Ga0070706_100993211 | 3300005467 | Unclassified | 774 |
| 290 | Ga0070707_100004499 | 3300005468 | Bacteria | 13062 |
| 291 | Ga0070707_100116288 | 3300005468 | Bacteria | 2596 |
| 292 | Ga0070707_100199261 | 3300005468 | Bacteria | 1951 |
| 293 | Ga0070707_100199754 | 3300005468 | Bacteria | 1949 |
| 294 | Ga0070707_100531602 | 3300005468 | Bacteria | 1138 |
| 295 | Ga0070707_100650494 | 3300005468 | Unclassified | 1017 |
| 296 | Ga0070707_101600686 | 3300005468 | Unclassified | 618 |
| 297 | Ga0070698_100002826 | 3300005471 | Bacteria | 19105 |
| 298 | Ga0070698_100027844 | 3300005471 | Bacteria | 5872 |
| 299 | Ga0070698_100031002 | 3300005471 | Bacteria | 5544 |
| 300 | Ga0070698_100212505 | 3300005471 | Bacteria | 1868 |
| 301 | Ga0070698_100339850 | 3300005471 | Bacteria | 1433 |
| 302 | Ga0070698_100462162 | 3300005471 | Unclassified | 1205 |
| 303 | Ga0070698_100585001 | 3300005471 | Unclassified | 1056 |
| 304 | Ga0070699_100001427 | 3300005518 | Bacteria | 21970 |
| 305 | Ga0070699_100017437 | 3300005518 | Bacteria | 6164 |
| 306 | Ga0070699_100018214 | 3300005518 | Bacteria | 6034 |
| 307 | Ga0070699_100020141 | 3300005518 | Bacteria | 5750 |
| 308 | Ga0070699_100048311 | 3300005518 | Bacteria | 3682 |
| 309 | Ga0070699_100167940 | 3300005518 | Bacteria | 1944 |
| 310 | Ga0070699_100204447 | 3300005518 | Bacteria | 1757 |
| 311 | Ga0070699_100206751 | 3300005518 | Bacteria | 1747 |
| 312 | Ga0070699_100251603 | 3300005518 | Bacteria | 1579 |
| 313 | Ga0070699_100657007 | 3300005518 | Unclassified | 957 |
| 314 | Ga0070699_101057025 | 3300005518 | Unclassified | 745 |
| 315 | Ga0070699_101317388 | 3300005518 | Unclassified | 662 |
| 316 | Ga0070699_101338864 | 3300005518 | Bacteria | 657 |
| 317 | Ga0070699_101427985 | 3300005518 | Bacteria | 635 |
| 318 | Ga0070699_101752523 | 3300005518 | Bacteria | 569 |
| 319 | Ga0070699_101811469 | 3300005518 | Bacteria | 559 |
| 320 | Ga0070679_100000604 | 3300005530 | Bacteria | 30555 |
| 321 | Ga0070679_100054518 | 3300005530 | Bacteria | 3980 |
| 322 | Ga0070679_100143251 | 3300005530 | Bacteria | 2368 |
| 323 | Ga0070679_100919273 | 3300005530 | Bacteria | 818 |
| 324 | Ga0070684_101378791 | 3300005535 | Bacteria | 664 |
| 325 | Ga0070697_100000112 | 3300005536 | Bacteria | 63499 |
| 326 | Ga0070697_100009364 | 3300005536 | Bacteria | 7653 |
| 327 | Ga0070697_100116504 | 3300005536 | Bacteria | 2231 |
| 328 | Ga0070697_100162734 | 3300005536 | Bacteria | 1885 |
| 329 | Ga0070697_100192559 | 3300005536 | Unclassified | 1731 |
| 330 | Ga0070697_100277985 | 3300005536 | Bacteria | 1436 |
| 331 | Ga0070697_100465713 | 3300005536 | Bacteria | 1102 |
| 332 | Ga0070697_100758312 | 3300005536 | Bacteria | 858 |
| 333 | Ga0070697_100976156 | 3300005536 | Unclassified | 753 |
| 334 | Ga0070697_101452268 | 3300005536 | Bacteria | 613 |
| 335 | Ga0068853_100075885 | 3300005539 | Bacteria | 2934 |
| 336 | Ga0068853_100104662 | 3300005539 | Bacteria | 2506 |
| 337 | Ga0068853_100269207 | 3300005539 | Bacteria | 1568 |
| 338 | Ga0068853_100738906 | 3300005539 | Unclassified | 940 |
| 339 | Ga0068853_100952320 | 3300005539 | Unclassified | 825 |
| 340 | Ga0068853_101171820 | 3300005539 | Bacteria | 742 |
| 341 | Ga0070672_100047637 | 3300005543 | Bacteria | 3327 |
| 342 | Ga0070672_100627693 | 3300005543 | Unclassified | 937 |
| 343 | Ga0070672_100914567 | 3300005543 | Unclassified | 775 |
| 344 | Ga0070686_100001026 | 3300005544 | Bacteria | 16055 |
| 345 | Ga0070686_100013004 | 3300005544 | Bacteria | 4751 |
| 346 | Ga0070686_100043948 | 3300005544 | Unclassified | 2805 |
| 347 | Ga0070686_100056067 | 3300005544 | Bacteria | 2526 |
| 348 | Ga0070686_100115294 | 3300005544 | Unclassified | 1837 |
| 349 | Ga0070686_100596776 | 3300005544 | Unclassified | 870 |
| 350 | Ga0070686_101208605 | 3300005544 | Bacteria | 628 |
| 351 | Ga0070695_100020677 | 3300005545 | Bacteria | 4020 |
| 352 | Ga0070695_100134413 | 3300005545 | Bacteria | 1708 |
| 353 | Ga0070695_100154646 | 3300005545 | Bacteria | 1604 |
| 354 | Ga0070695_100166176 | 3300005545 | Bacteria | 1553 |
| 355 | Ga0070695_100188451 | 3300005545 | Bacteria | 1466 |
| 356 | Ga0070695_100192513 | 3300005545 | Bacteria | 1452 |
| 357 | Ga0070695_100225368 | 3300005545 | Unclassified | 1353 |
| 358 | Ga0070695_100249585 | 3300005545 | Bacteria | 1291 |
| 359 | Ga0070695_100531833 | 3300005545 | Unclassified | 914 |
| 360 | Ga0070695_100867899 | 3300005545 | Unclassified | 727 |
| 361 | Ga0070695_100871784 | 3300005545 | Bacteria | 725 |
| 362 | Ga0070695_101017137 | 3300005545 | Unclassified | 675 |
| 363 | Ga0070695_101815543 | 3300005545 | Bacteria | 512 |
| 364 | Ga0070696_100074135 | 3300005546 | Bacteria | 2399 |
| 365 | Ga0070696_100098863 | 3300005546 | Bacteria | 2087 |
| 366 | Ga0070696_100184570 | 3300005546 | Bacteria | 1549 |
| 367 | Ga0070696_100218636 | 3300005546 | Bacteria | 1429 |
| 368 | Ga0070696_100231303 | 3300005546 | Bacteria | 1391 |
| 369 | Ga0070696_100270652 | 3300005546 | Bacteria | 1291 |
| 370 | Ga0070696_100283287 | 3300005546 | Unclassified | 1264 |
| 371 | Ga0070696_100305985 | 3300005546 | Bacteria | 1219 |
| 372 | Ga0070696_100581649 | 3300005546 | Unclassified | 901 |
| 373 | Ga0070696_100677513 | 3300005546 | Bacteria | 839 |
| 374 | Ga0070696_101050765 | 3300005546 | Bacteria | 682 |
| 375 | Ga0070696_101185964 | 3300005546 | Unclassified | 645 |
| 376 | Ga0070696_101249926 | 3300005546 | Unclassified | 629 |
| 377 | Ga0070696_101290387 | 3300005546 | Bacteria | 619 |
| 378 | Ga0070696_101383130 | 3300005546 | Bacteria | 600 |
| 379 | Ga0070696_101383131 | 3300005546 | Bacteria | 600 |
| 380 | Ga0070693_100004578 | 3300005547 | Bacteria | 6560 |
| 381 | Ga0070693_100083470 | 3300005547 | Bacteria | 1910 |
| 382 | Ga0070693_100171149 | 3300005547 | Bacteria | 1391 |
| 383 | Ga0070693_100421192 | 3300005547 | Unclassified | 930 |
| 384 | Ga0070693_100515140 | 3300005547 | Bacteria | 851 |
| 385 | Ga0070693_100694380 | 3300005547 | Unclassified | 744 |
| 386 | Ga0070693_100703635 | 3300005547 | Unclassified | 740 |
| 387 | Ga0070693_100738564 | 3300005547 | Unclassified | 724 |
| 388 | Ga0070693_100913465 | 3300005547 | Unclassified | 659 |
| 389 | Ga0070693_100935787 | 3300005547 | Bacteria | 652 |
| 390 | Ga0070693_101350213 | 3300005547 | Bacteria | 552 |
| 391 | Ga0070665_100326918 | 3300005548 | Bacteria | 1538 |
| 392 | Ga0070665_100771023 | 3300005548 | Bacteria | 975 |
| 393 | Ga0070665_101020989 | 3300005548 | Bacteria | 839 |
| 394 | Ga0070704_100037629 | 3300005549 | Bacteria | 3308 |
| 395 | Ga0070704_100048892 | 3300005549 | Bacteria | 2963 |
| 396 | Ga0070704_100072040 | 3300005549 | Bacteria | 2513 |
| 397 | Ga0070704_100110677 | 3300005549 | Unclassified | 2089 |
| 398 | Ga0070704_100478727 | 3300005549 | Unclassified | 1077 |
| 399 | Ga0070704_100544559 | 3300005549 | Bacteria | 1013 |
| 400 | Ga0070704_100634299 | 3300005549 | Bacteria | 942 |
| 401 | Ga0070704_100636089 | 3300005549 | Bacteria | 941 |
| 402 | Ga0070704_100647101 | 3300005549 | Bacteria | 933 |
| 403 | Ga0070704_100717129 | 3300005549 | Unclassified | 888 |
| 404 | Ga0070704_100980118 | 3300005549 | Unclassified | 764 |
| 405 | Ga0070704_101331179 | 3300005549 | Unclassified | 658 |
| 406 | Ga0070704_101673133 | 3300005549 | Bacteria | 588 |
| 407 | Ga0068855_102087414 | 3300005563 | Unclassified | 571 |
| 408 | Ga0068855_102571540 | 3300005563 | Unclassified | 505 |
| 409 | Ga0070664_100003375 | 3300005564 | Bacteria | 12898 |
| 410 | Ga0070664_100176818 | 3300005564 | Bacteria | 1895 |
| 411 | Ga0070664_100296261 | 3300005564 | Unclassified | 1461 |
| 412 | Ga0070664_100501036 | 3300005564 | Bacteria | 1119 |
| 413 | Ga0070664_101290088 | 3300005564 | Bacteria | 690 |
| 414 | Ga0068857_100012945 | 3300005577 | Bacteria | 7269 |
| 415 | Ga0068857_100113116 | 3300005577 | Bacteria | 2440 |
| 416 | Ga0068857_100131800 | 3300005577 | Bacteria | 2255 |
| 417 | Ga0068857_100273159 | 3300005577 | Bacteria | 1554 |
| 418 | Ga0068857_100511241 | 3300005577 | Unclassified | 1128 |
| 419 | Ga0068857_100775027 | 3300005577 | Unclassified | 915 |
| 420 | Ga0068857_100960290 | 3300005577 | Bacteria | 821 |
| 421 | Ga0068857_100975833 | 3300005577 | Unclassified | 815 |
| 422 | Ga0068857_100982123 | 3300005577 | Unclassified | 812 |
| 423 | Ga0068857_101423396 | 3300005577 | Bacteria | 674 |
| 424 | Ga0068857_101865428 | 3300005577 | Unclassified | 589 |
| 425 | Ga0068854_100222624 | 3300005578 | Bacteria | 1493 |
| 426 | Ga0068854_100236070 | 3300005578 | Bacteria | 1454 |
| 427 | Ga0068854_100295186 | 3300005578 | Bacteria | 1309 |
| 428 | Ga0068854_100306412 | 3300005578 | Bacteria | 1287 |
| 429 | Ga0068854_100398256 | 3300005578 | Bacteria | 1139 |
| 430 | Ga0068854_100440219 | 3300005578 | Bacteria | 1086 |
| 431 | Ga0068854_100628560 | 3300005578 | Bacteria | 920 |
| 432 | Ga0068854_100917510 | 3300005578 | Unclassified | 771 |
| 433 | Ga0068854_101578648 | 3300005578 | Unclassified | 597 |
| 434 | Ga0068854_101619442 | 3300005578 | Unclassified | 590 |
| 435 | Ga0068854_102268413 | 3300005578 | Bacteria | 503 |
| 436 | Ga0068856_100369411 | 3300005614 | Bacteria | 1453 |
| 437 | Ga0068856_100546242 | 3300005614 | Bacteria | 1180 |
| 438 | Ga0068856_100936536 | 3300005614 | Unclassified | 885 |
| 439 | Ga0068856_101288561 | 3300005614 | Bacteria | 746 |
| 440 | Ga0068856_102209051 | 3300005614 | Bacteria | 559 |
| 441 | Ga0070702_100054597 | 3300005615 | Bacteria | 2300 |
| 442 | Ga0070702_100060215 | 3300005615 | Bacteria | 2207 |
| 443 | Ga0070702_100139589 | 3300005615 | Bacteria | 1542 |
| 444 | Ga0070702_100208162 | 3300005615 | Bacteria | 1299 |
| 445 | Ga0070702_100291641 | 3300005615 | Bacteria | 1125 |
| 446 | Ga0070702_100348747 | 3300005615 | Unclassified | 1042 |
| 447 | Ga0070702_100568749 | 3300005615 | Bacteria | 844 |
| 448 | Ga0070702_100584046 | 3300005615 | Bacteria | 835 |
| 449 | Ga0070702_100796104 | 3300005615 | Bacteria | 730 |
| 450 | Ga0070702_100897417 | 3300005615 | Unclassified | 694 |
| 451 | Ga0070702_100921342 | 3300005615 | Unclassified | 686 |
| 452 | Ga0070702_100952270 | 3300005615 | Bacteria | 676 |
| 453 | Ga0070702_101817593 | 3300005615 | Unclassified | 509 |
| 454 | Ga0068852_100235114 | 3300005616 | Bacteria | 1749 |
| 455 | Ga0068852_100427088 | 3300005616 | Bacteria | 1308 |
| 456 | Ga0068852_101010790 | 3300005616 | Bacteria | 850 |
| 457 | Ga0068852_101715179 | 3300005616 | Unclassified | 651 |
| 458 | Ga0068852_102859879 | 3300005616 | Bacteria | 501 |
| 459 | Ga0068859_100002739 | 3300005617 | Bacteria | 17881 |
| 460 | Ga0068859_100004457 | 3300005617 | Bacteria | 14286 |
| 461 | Ga0068859_100012082 | 3300005617 | Bacteria | 8676 |
| 462 | Ga0068859_100015155 | 3300005617 | Bacteria | 7738 |
| 463 | Ga0068859_100046093 | 3300005617 | Bacteria | 4379 |
| 464 | Ga0068859_100093048 | 3300005617 | Bacteria | 3066 |
| 465 | Ga0068859_100110623 | 3300005617 | Bacteria | 2809 |
| 466 | Ga0068859_100121851 | 3300005617 | Bacteria | 2674 |
| 467 | Ga0068859_100138053 | 3300005617 | Unclassified | 2511 |
| 468 | Ga0068859_100262271 | 3300005617 | Bacteria | 1819 |
| 469 | Ga0068859_100283215 | 3300005617 | Unclassified | 1750 |
| 470 | Ga0068859_100379771 | 3300005617 | Unclassified | 1508 |
| 471 | Ga0068859_100552870 | 3300005617 | Unclassified | 1245 |
| 472 | Ga0068859_100557490 | 3300005617 | Bacteria | 1240 |
| 473 | Ga0068859_100637466 | 3300005617 | Unclassified | 1158 |
| 474 | Ga0068859_100665811 | 3300005617 | Bacteria | 1132 |
| 475 | Ga0068859_100682432 | 3300005617 | Bacteria | 1118 |
| 476 | Ga0068859_100830421 | 3300005617 | Unclassified | 1011 |
| 477 | Ga0068859_100863086 | 3300005617 | Unclassified | 991 |
| 478 | Ga0068859_100991537 | 3300005617 | Bacteria | 922 |
| 479 | Ga0068859_101972354 | 3300005617 | Bacteria | 645 |
| 480 | Ga0068859_102219544 | 3300005617 | Unclassified | 606 |
| 481 | Ga0068859_102284608 | 3300005617 | Bacteria | 596 |
| 482 | Ga0068859_102365219 | 3300005617 | Unclassified | 586 |
| 483 | Ga0068864_100001530 | 3300005618 | Bacteria | 19039 |
| 484 | Ga0068864_100020573 | 3300005618 | Bacteria | 5521 |
| 485 | Ga0068864_100042336 | 3300005618 | Unclassified | 3897 |
| 486 | Ga0068864_100065888 | 3300005618 | Bacteria | 3142 |
| 487 | Ga0068864_100124254 | 3300005618 | Bacteria | 2311 |
| 488 | Ga0068864_100169193 | 3300005618 | Bacteria | 1991 |
| 489 | Ga0068864_100187029 | 3300005618 | Bacteria | 1896 |
| 490 | Ga0068864_100196096 | 3300005618 | Bacteria | 1853 |
| 491 | Ga0068864_100257797 | 3300005618 | Bacteria | 1621 |
| 492 | Ga0068864_100380687 | 3300005618 | Bacteria | 1337 |
| 493 | Ga0068864_100519754 | 3300005618 | Bacteria | 1147 |
| 494 | Ga0068864_100740898 | 3300005618 | Bacteria | 962 |
| 495 | Ga0068864_101352784 | 3300005618 | Unclassified | 713 |
| 496 | Ga0068864_101557328 | 3300005618 | Bacteria | 664 |
| 497 | Ga0068864_101927195 | 3300005618 | Bacteria | 597 |
| 498 | Ga0068864_102625498 | 3300005618 | Bacteria | 509 |
| 499 | Ga0068866_10020829 | 3300005718 | Bacteria | 3011 |
| 500 | Ga0068866_10109457 | 3300005718 | Unclassified | 1539 |
| 501 | Ga0068866_10486520 | 3300005718 | Unclassified | 814 |
| 502 | Ga0068861_100017567 | 3300005719 | Bacteria | 5082 |
| 503 | Ga0068861_100033929 | 3300005719 | Bacteria | 3769 |
| 504 | Ga0068861_100050519 | 3300005719 | Unclassified | 3153 |
| 505 | Ga0068861_100091114 | 3300005719 | Bacteria | 2406 |
| 506 | Ga0068861_100127543 | 3300005719 | Unclassified | 2061 |
| 507 | Ga0068861_100143940 | 3300005719 | Bacteria | 1949 |
| 508 | Ga0068861_100324439 | 3300005719 | Bacteria | 1342 |
| 509 | Ga0068861_100505420 | 3300005719 | Unclassified | 1093 |
| 510 | Ga0068861_100531612 | 3300005719 | Bacteria | 1068 |
| 511 | Ga0068861_100585506 | 3300005719 | Unclassified | 1022 |
| 512 | Ga0068861_100659592 | 3300005719 | Bacteria | 967 |
| 513 | Ga0068861_101184665 | 3300005719 | Unclassified | 738 |
| 514 | Ga0068861_101537536 | 3300005719 | Unclassified | 654 |
| 515 | Ga0068861_101747340 | 3300005719 | Bacteria | 616 |
| 516 | Ga0068861_102178462 | 3300005719 | Unclassified | 555 |
| 517 | Ga0068861_102492523 | 3300005719 | Bacteria | 521 |
| 518 | Ga0068851_11039033 | 3300005834 | Unclassified | 518 |
| 519 | Ga0068870_10008350 | 3300005840 | Bacteria | 4656 |
| 520 | Ga0068870_10027938 | 3300005840 | Unclassified | 2827 |
| 521 | Ga0068870_10057964 | 3300005840 | Bacteria | 2072 |
| 522 | Ga0068870_10179502 | 3300005840 | Bacteria | 1270 |
| 523 | Ga0068870_10354242 | 3300005840 | Bacteria | 943 |
| 524 | Ga0068870_10560422 | 3300005840 | Unclassified | 771 |
| 525 | Ga0068870_10623170 | 3300005840 | Bacteria | 736 |
| 526 | Ga0068870_10738148 | 3300005840 | Unclassified | 683 |
| 527 | Ga0068870_10840626 | 3300005840 | Bacteria | 644 |
| 528 | Ga0068863_100018044 | 3300005841 | Bacteria | 6756 |
| 529 | Ga0068863_100128325 | 3300005841 | Bacteria | 2420 |
| 530 | Ga0068863_100242354 | 3300005841 | Bacteria | 1740 |
| 531 | Ga0068863_100483801 | 3300005841 | Bacteria | 1218 |
| 532 | Ga0068863_100536414 | 3300005841 | Unclassified | 1154 |
| 533 | Ga0068863_100800482 | 3300005841 | Bacteria | 940 |
| 534 | Ga0068863_100915019 | 3300005841 | Unclassified | 878 |
| 535 | Ga0068863_101166831 | 3300005841 | Bacteria | 776 |
| 536 | Ga0068863_101270606 | 3300005841 | Bacteria | 743 |
| 537 | Ga0068863_101445779 | 3300005841 | Unclassified | 695 |
| 538 | Ga0068863_101716145 | 3300005841 | Bacteria | 638 |
| 539 | Ga0068858_100000227 | 3300005842 | Bacteria | 60951 |
| 540 | Ga0068858_100123442 | 3300005842 | Bacteria | 2423 |
| 541 | Ga0068858_100127098 | 3300005842 | Bacteria | 2388 |
| 542 | Ga0068858_100185364 | 3300005842 | Bacteria | 1966 |
| 543 | Ga0068858_100315530 | 3300005842 | Unclassified | 1493 |
| 544 | Ga0068858_100330592 | 3300005842 | Bacteria | 1458 |
| 545 | Ga0068858_100370918 | 3300005842 | Bacteria | 1373 |
| 546 | Ga0068858_100418693 | 3300005842 | Bacteria | 1288 |
| 547 | Ga0068858_100444019 | 3300005842 | Unclassified | 1250 |
| 548 | Ga0068858_100456053 | 3300005842 | Bacteria | 1232 |
| 549 | Ga0068858_100492143 | 3300005842 | Bacteria | 1184 |
| 550 | Ga0068858_101210707 | 3300005842 | Unclassified | 742 |
| 551 | Ga0068860_100004210 | 3300005843 | Bacteria | 14745 |
| 552 | Ga0068860_100034116 | 3300005843 | Bacteria | 4881 |
| 553 | Ga0068860_100053875 | 3300005843 | Unclassified | 3824 |
| 554 | Ga0068860_100072351 | 3300005843 | Bacteria | 3276 |
| 555 | Ga0068860_100079833 | 3300005843 | Bacteria | 3111 |
| 556 | Ga0068860_100114891 | 3300005843 | Bacteria | 2574 |
| 557 | Ga0068860_100177474 | 3300005843 | Bacteria | 2059 |
| 558 | Ga0068860_100193004 | 3300005843 | Bacteria | 1971 |
| 559 | Ga0068860_100273083 | 3300005843 | Unclassified | 1650 |
| 560 | Ga0068860_100388220 | 3300005843 | Unclassified | 1379 |
| 561 | Ga0068860_100405958 | 3300005843 | Bacteria | 1348 |
| 562 | Ga0068860_101038929 | 3300005843 | Bacteria | 838 |
| 563 | Ga0068860_101059866 | 3300005843 | Bacteria | 829 |
| 564 | Ga0068860_101195298 | 3300005843 | Unclassified | 780 |
| 565 | Ga0068860_101308113 | 3300005843 | Unclassified | 746 |
| 566 | Ga0068860_101438552 | 3300005843 | Bacteria | 711 |
| 567 | Ga0068860_101791275 | 3300005843 | Unclassified | 636 |
| 568 | Ga0068862_100007975 | 3300005844 | Bacteria | 8759 |
| 569 | Ga0068862_100019794 | 3300005844 | Bacteria | 5622 |
| 570 | Ga0068862_100036723 | 3300005844 | Bacteria | 4153 |
| 571 | Ga0068862_100075730 | 3300005844 | Bacteria | 2911 |
| 572 | Ga0068862_100076530 | 3300005844 | Bacteria | 2896 |
| 573 | Ga0068862_100093042 | 3300005844 | Bacteria | 2628 |
| 574 | Ga0068862_100111498 | 3300005844 | Unclassified | 2402 |
| 575 | Ga0068862_100129213 | 3300005844 | Bacteria | 2233 |
| 576 | Ga0068862_100260238 | 3300005844 | Bacteria | 1584 |
| 577 | Ga0068862_100398128 | 3300005844 | Unclassified | 1288 |
| 578 | Ga0068862_100461823 | 3300005844 | Bacteria | 1199 |
| 579 | Ga0068862_101429284 | 3300005844 | Unclassified | 695 |
| 580 | Ga0081539_10000043 | 3300005985 | Bacteria | 288108 |
| 581 | Ga0081539_10000851 | 3300005985 | Bacteria | 58399 |
| 582 | Ga0081539_10001474 | 3300005985 | Bacteria | 39921 |
| 583 | Ga0081539_10005869 | 3300005985 | Bacteria | 12167 |
| 584 | Ga0081539_10085004 | 3300005985 | Bacteria | 1652 |
| 585 | Ga0081539_10114976 | 3300005985 | Bacteria | 1347 |
| 586 | Ga0070715_10000007 | 3300006163 | Bacteria | 192075 |
| 587 | Ga0070716_100000007 | 3300006173 | Bacteria | 256300 |
| 588 | Ga0070716_100112996 | 3300006173 | Bacteria | 1686 |
| 589 | Ga0070716_100292811 | 3300006173 | Bacteria | 1129 |
| 590 | Ga0070716_100454963 | 3300006173 | Unclassified | 934 |
| 591 | Ga0070716_101472838 | 3300006173 | Bacteria | 556 |
| 592 | Ga0070716_101490476 | 3300006173 | Bacteria | 553 |
| 593 | Ga0097621_100081069 | 3300006237 | Bacteria | 2700 |
| 594 | Ga0097621_100088346 | 3300006237 | Bacteria | 2589 |
| 595 | Ga0097621_100152573 | 3300006237 | Unclassified | 1982 |
| 596 | Ga0097621_100162804 | 3300006237 | Unclassified | 1919 |
| 597 | Ga0097621_100522547 | 3300006237 | Bacteria | 1077 |
| 598 | Ga0097621_100801102 | 3300006237 | Bacteria | 873 |
| 599 | Ga0097621_102401019 | 3300006237 | Bacteria | 505 |
| 600 | Ga0068871_100006022 | 3300006358 | Bacteria | 8535 |
| 601 | Ga0068871_100015503 | 3300006358 | Bacteria | 5706 |
| 602 | Ga0068871_100028784 | 3300006358 | Bacteria | 4359 |
| 603 | Ga0068871_100104621 | 3300006358 | Bacteria | 2374 |
| 604 | Ga0068871_101119555 | 3300006358 | Bacteria | 737 |
| 605 | Ga0075428_100136086 | 3300006844 | Bacteria | 2671 |
| 606 | Ga0075428_100857025 | 3300006844 | Bacteria | 964 |
| 607 | Ga0075428_101253559 | 3300006844 | Unclassified | 781 |
| 608 | Ga0075430_100037954 | 3300006846 | Bacteria | 4083 |
| 609 | Ga0075430_100360466 | 3300006846 | Bacteria | 1200 |
| 610 | Ga0075430_101239324 | 3300006846 | Bacteria | 614 |
| 611 | Ga0075431_100064005 | 3300006847 | Bacteria | 3796 |
| 612 | Ga0075431_100131761 | 3300006847 | Bacteria | 2578 |
| 613 | Ga0075431_100451990 | 3300006847 | Bacteria | 1280 |
| 614 | Ga0075431_100498545 | 3300006847 | Bacteria | 1209 |
| 615 | Ga0075431_101736912 | 3300006847 | Bacteria | 581 |
| 616 | Ga0075433_10020255 | 3300006852 | Bacteria | 5558 |
| 617 | Ga0075433_10020844 | 3300006852 | Bacteria | 5487 |
| 618 | Ga0075433_10022972 | 3300006852 | Bacteria | 5243 |
| 619 | Ga0075433_10416613 | 3300006852 | Bacteria | 1185 |
| 620 | Ga0075433_10965815 | 3300006852 | Bacteria | 743 |
| 621 | Ga0075433_11062446 | 3300006852 | Unclassified | 704 |
| 622 | Ga0075433_11124778 | 3300006852 | Unclassified | 683 |
| 623 | Ga0075433_11142763 | 3300006852 | Bacteria | 677 |
| 624 | Ga0075433_11928193 | 3300006852 | Bacteria | 507 |
| 625 | Ga0075434_100032647 | 3300006871 | Bacteria | 5135 |
| 626 | Ga0075434_100081851 | 3300006871 | Bacteria | 3225 |
| 627 | Ga0075434_100134853 | 3300006871 | Bacteria | 2488 |
| 628 | Ga0075434_100150631 | 3300006871 | Bacteria | 2346 |
| 629 | Ga0075434_100417145 | 3300006871 | Unclassified | 1363 |
| 630 | Ga0075434_101484527 | 3300006871 | Unclassified | 687 |
| 631 | Ga0075434_101727709 | 3300006871 | Bacteria | 633 |
| 632 | Ga0075429_100004845 | 3300006880 | Bacteria | 11595 |
| 633 | Ga0075429_100072291 | 3300006880 | Bacteria | 3004 |
| 634 | Ga0075429_100109852 | 3300006880 | Bacteria | 2411 |
| 635 | Ga0075429_100224296 | 3300006880 | Bacteria | 1646 |
| 636 | Ga0075429_100647729 | 3300006880 | Bacteria | 926 |
| 637 | Ga0075429_100946019 | 3300006880 | Bacteria | 754 |
| 638 | Ga0068865_100130776 | 3300006881 | Bacteria | 1880 |
| 639 | Ga0068865_100323889 | 3300006881 | Unclassified | 1241 |
| 640 | Ga0068865_100809230 | 3300006881 | Bacteria | 809 |
| 641 | Ga0068865_101592075 | 3300006881 | Unclassified | 587 |
| 642 | Ga0075436_100000018 | 3300006914 | Bacteria | 139195 |
| 643 | Ga0075436_100041994 | 3300006914 | Bacteria | 3154 |
| 644 | Ga0075436_100535602 | 3300006914 | Bacteria | 859 |
| 645 | Ga0097620_100002739 | 3300006931 | Bacteria | 17881 |
| 646 | Ga0097620_100004457 | 3300006931 | Bacteria | 14286 |
| 647 | Ga0097620_100012083 | 3300006931 | Bacteria | 8676 |
| 648 | Ga0097620_100015156 | 3300006931 | Bacteria | 7738 |
| 649 | Ga0097620_100046093 | 3300006931 | Bacteria | 4379 |
| 650 | Ga0097620_100093051 | 3300006931 | Bacteria | 3066 |
| 651 | Ga0097620_100110619 | 3300006931 | Bacteria | 2809 |
| 652 | Ga0097620_100121856 | 3300006931 | Bacteria | 2674 |
| 653 | Ga0097620_100138047 | 3300006931 | Unclassified | 2511 |
| 654 | Ga0097620_100262260 | 3300006931 | Bacteria | 1819 |
| 655 | Ga0097620_100283230 | 3300006931 | Unclassified | 1750 |
| 656 | Ga0097620_100379749 | 3300006931 | Unclassified | 1508 |
| 657 | Ga0097620_100552878 | 3300006931 | Unclassified | 1245 |
| 658 | Ga0097620_100557553 | 3300006931 | Bacteria | 1240 |
| 659 | Ga0097620_100637463 | 3300006931 | Unclassified | 1158 |
| 660 | Ga0097620_100665819 | 3300006931 | Bacteria | 1132 |
| 661 | Ga0097620_100682453 | 3300006931 | Bacteria | 1118 |
| 662 | Ga0097620_100830456 | 3300006931 | Unclassified | 1011 |
| 663 | Ga0097620_100863126 | 3300006931 | Unclassified | 991 |
| 664 | Ga0097620_100991515 | 3300006931 | Bacteria | 922 |
| 665 | Ga0097620_101972312 | 3300006931 | Bacteria | 645 |
| 666 | Ga0097620_102219349 | 3300006931 | Unclassified | 606 |
| 667 | Ga0097620_102284651 | 3300006931 | Bacteria | 596 |
| 668 | Ga0097620_102365137 | 3300006931 | Unclassified | 586 |
| 669 | Ga0075435_100000359 | 3300007076 | Bacteria | 27892 |
| 670 | Ga0075435_100003678 | 3300007076 | Bacteria | 10443 |
| 671 | Ga0075435_100117894 | 3300007076 | Bacteria | 2212 |
| 672 | Ga0075435_100667224 | 3300007076 | Unclassified | 903 |
| 673 | Ga0075435_100908894 | 3300007076 | Bacteria | 768 |
| 674 | Ga0075435_101134427 | 3300007076 | Bacteria | 684 |
| 675 | Ga0099794_10004255 | 3300007265 | Bacteria | 5592 |
| 676 | Ga0099794_10209875 | 3300007265 | Unclassified | 999 |
| 677 | Ga0099794_10378354 | 3300007265 | Bacteria | 738 |
| 678 | Ga0099794_10704353 | 3300007265 | Unclassified | 538 |
| 679 | Ga0105251_10140108 | 3300009011 | Unclassified | 1094 |
| 680 | Ga0105251_10145842 | 3300009011 | Bacteria | 1070 |
| 681 | Ga0105251_10368478 | 3300009011 | Unclassified | 657 |
| 682 | Ga0105250_10548024 | 3300009092 | Bacteria | 530 |
| 683 | Ga0105240_10195833 | 3300009093 | Bacteria | 2373 |
| 684 | Ga0105240_10988408 | 3300009093 | Unclassified | 901 |
| 685 | Ga0105240_11684628 | 3300009093 | Unclassified | 662 |
| 686 | Ga0111539_10004262 | 3300009094 | Bacteria | 18727 |
| 687 | Ga0111539_10012727 | 3300009094 | Bacteria | 10536 |
| 688 | Ga0111539_10024482 | 3300009094 | Bacteria | 7405 |
| 689 | Ga0111539_10091295 | 3300009094 | Bacteria | 3578 |
| 690 | Ga0111539_10300357 | 3300009094 | Bacteria | 1869 |
| 691 | Ga0111539_10531773 | 3300009094 | Bacteria | 1370 |
| 692 | Ga0111539_10794095 | 3300009094 | Bacteria | 1102 |
| 693 | Ga0111539_10903829 | 3300009094 | Bacteria | 1027 |
| 694 | Ga0111539_11342174 | 3300009094 | Bacteria | 830 |
| 695 | Ga0105245_10024756 | 3300009098 | Bacteria | 5273 |
| 696 | Ga0105245_10457960 | 3300009098 | Unclassified | 1285 |
| 697 | Ga0105245_12479219 | 3300009098 | Unclassified | 572 |
| 698 | Ga0105247_10000001 | 3300009101 | Bacteria | 739726 |
| 699 | Ga0105247_10089947 | 3300009101 | Bacteria | 1947 |
| 700 | Ga0105247_10191004 | 3300009101 | Unclassified | 1371 |
| 701 | Ga0105247_10208493 | 3300009101 | Bacteria | 1317 |
| 702 | Ga0105247_10383210 | 3300009101 | Unclassified | 997 |
| 703 | Ga0105247_10484965 | 3300009101 | Unclassified | 898 |
| 704 | Ga0105247_10641300 | 3300009101 | Unclassified | 792 |
| 705 | Ga0105247_10743641 | 3300009101 | Bacteria | 743 |
| 706 | Ga0114129_10030857 | 3300009147 | Bacteria | 7580 |
| 707 | Ga0114129_10055247 | 3300009147 | Bacteria | 5566 |
| 708 | Ga0114129_10063314 | 3300009147 | Bacteria | 5165 |
| 709 | Ga0114129_10103825 | 3300009147 | Bacteria | 3929 |
| 710 | Ga0114129_10208718 | 3300009147 | Bacteria | 2642 |
| 711 | Ga0114129_10354022 | 3300009147 | Bacteria | 1944 |
| 712 | Ga0114129_10715081 | 3300009147 | Bacteria | 1286 |
| 713 | Ga0114129_10747559 | 3300009147 | Unclassified | 1252 |
| 714 | Ga0114129_10848454 | 3300009147 | Bacteria | 1161 |
| 715 | Ga0114129_10978988 | 3300009147 | Unclassified | 1067 |
| 716 | Ga0114129_11286196 | 3300009147 | Bacteria | 907 |
| 717 | Ga0114129_11317362 | 3300009147 | Unclassified | 894 |
| 718 | Ga0114129_12257170 | 3300009147 | Bacteria | 654 |
| 719 | Ga0114129_12390948 | 3300009147 | Bacteria | 633 |
| 720 | Ga0105243_10000024 | 3300009148 | Bacteria | 197391 |
| 721 | Ga0105243_10048260 | 3300009148 | Bacteria | 3356 |
| 722 | Ga0105243_10068303 | 3300009148 | Bacteria | 2864 |
| 723 | Ga0105243_10086783 | 3300009148 | Bacteria | 2567 |
| 724 | Ga0105243_10133790 | 3300009148 | Unclassified | 2107 |
| 725 | Ga0105243_10284964 | 3300009148 | Unclassified | 1490 |
| 726 | Ga0105243_10295494 | 3300009148 | Bacteria | 1466 |
| 727 | Ga0105243_10360634 | 3300009148 | Bacteria | 1338 |
| 728 | Ga0105243_10383972 | 3300009148 | Unclassified | 1300 |
| 729 | Ga0105243_10418900 | 3300009148 | Unclassified | 1249 |
| 730 | Ga0105243_10540840 | 3300009148 | Unclassified | 1111 |
| 731 | Ga0105243_10764478 | 3300009148 | Unclassified | 949 |
| 732 | Ga0105243_10766658 | 3300009148 | Unclassified | 947 |
| 733 | Ga0105243_10772027 | 3300009148 | Bacteria | 944 |
| 734 | Ga0105243_11594481 | 3300009148 | Unclassified | 679 |
| 735 | Ga0105241_10019047 | 3300009174 | Bacteria | 5061 |
| 736 | Ga0105241_10040109 | 3300009174 | Bacteria | 3534 |
| 737 | Ga0105241_10055499 | 3300009174 | Bacteria | 3035 |
| 738 | Ga0105241_10109573 | 3300009174 | Bacteria | 2208 |
| 739 | Ga0105241_10137350 | 3300009174 | Unclassified | 1987 |
| 740 | Ga0105241_10237460 | 3300009174 | Bacteria | 1539 |
| 741 | Ga0105241_10358719 | 3300009174 | Bacteria | 1268 |
| 742 | Ga0105241_10714956 | 3300009174 | Unclassified | 916 |
| 743 | Ga0105241_10727548 | 3300009174 | Bacteria | 908 |
| 744 | Ga0105241_10976599 | 3300009174 | Bacteria | 791 |
| 745 | Ga0105241_11178223 | 3300009174 | Bacteria | 725 |
| 746 | Ga0105241_12413291 | 3300009174 | Unclassified | 525 |
| 747 | Ga0105241_12520886 | 3300009174 | Unclassified | 515 |
| 748 | Ga0105242_10000249 | 3300009176 | Bacteria | 42499 |
| 749 | Ga0105242_10007429 | 3300009176 | Bacteria | 8437 |
| 750 | Ga0105242_10016672 | 3300009176 | Bacteria | 5715 |
| 751 | Ga0105242_10484601 | 3300009176 | Bacteria | 1173 |
| 752 | Ga0105242_10504552 | 3300009176 | Bacteria | 1151 |
| 753 | Ga0105242_10686284 | 3300009176 | Unclassified | 1000 |
| 754 | Ga0105242_11603761 | 3300009176 | Bacteria | 684 |
| 755 | Ga0105242_11612376 | 3300009176 | Unclassified | 683 |
| 756 | Ga0105242_11899135 | 3300009176 | Unclassified | 636 |
| 757 | Ga0105242_12100278 | 3300009176 | Bacteria | 609 |
| 758 | Ga0105248_10006056 | 3300009177 | Bacteria | 13274 |
| 759 | Ga0105248_10017237 | 3300009177 | Bacteria | 7959 |
| 760 | Ga0105248_10027995 | 3300009177 | Bacteria | 6276 |
| 761 | Ga0105248_10094785 | 3300009177 | Bacteria | 3361 |
| 762 | Ga0105248_10137959 | 3300009177 | Unclassified | 2751 |
| 763 | Ga0105248_10146328 | 3300009177 | Unclassified | 2666 |
| 764 | Ga0105248_10196840 | 3300009177 | Unclassified | 2271 |
| 765 | Ga0105248_10322011 | 3300009177 | Bacteria | 1741 |
| 766 | Ga0105248_10458735 | 3300009177 | Bacteria | 1436 |
| 767 | Ga0105248_10491147 | 3300009177 | Bacteria | 1384 |
| 768 | Ga0105248_10494443 | 3300009177 | Bacteria | 1379 |
| 769 | Ga0105248_10519078 | 3300009177 | Bacteria | 1343 |
| 770 | Ga0105248_10656251 | 3300009177 | Unclassified | 1184 |
| 771 | Ga0105248_10671371 | 3300009177 | Bacteria | 1169 |
| 772 | Ga0105248_10820932 | 3300009177 | Unclassified | 1049 |
| 773 | Ga0105248_10839248 | 3300009177 | Bacteria | 1037 |
| 774 | Ga0105248_11013285 | 3300009177 | Unclassified | 938 |
| 775 | Ga0105248_11431034 | 3300009177 | Unclassified | 782 |
| 776 | Ga0105248_11757502 | 3300009177 | Unclassified | 703 |
| 777 | Ga0105248_11797911 | 3300009177 | Bacteria | 695 |
| 778 | Ga0105248_12702830 | 3300009177 | Unclassified | 566 |
| 779 | Ga0105248_12912716 | 3300009177 | Bacteria | 545 |
| 780 | Ga0105248_13185443 | 3300009177 | Unclassified | 522 |
| 781 | Ga0105237_10752398 | 3300009545 | Bacteria | 981 |
| 782 | Ga0105237_11595497 | 3300009545 | Bacteria | 659 |
| 783 | Ga0105238_10007632 | 3300009551 | Bacteria | 10835 |
| 784 | Ga0105238_10027606 | 3300009551 | Bacteria | 5785 |
| 785 | Ga0105238_11208504 | 3300009551 | Unclassified | 780 |
| 786 | Ga0105238_11603688 | 3300009551 | Bacteria | 681 |
| 787 | Ga0105238_12913216 | 3300009551 | Unclassified | 514 |
| 788 | Ga0105249_10007021 | 3300009553 | Bacteria | 9829 |
| 789 | Ga0105249_10056201 | 3300009553 | Bacteria | 3603 |
| 790 | Ga0105249_10085714 | 3300009553 | Bacteria | 2936 |
| 791 | Ga0105249_10219725 | 3300009553 | Bacteria | 1869 |
| 792 | Ga0105249_10271328 | 3300009553 | Unclassified | 1690 |
| 793 | Ga0105249_10440540 | 3300009553 | Unclassified | 1340 |
| 794 | Ga0105249_10459448 | 3300009553 | Unclassified | 1313 |
| 795 | Ga0105249_10627277 | 3300009553 | Unclassified | 1131 |
| 796 | Ga0105249_11157472 | 3300009553 | Bacteria | 844 |
| 797 | Ga0105249_11292662 | 3300009553 | Unclassified | 801 |
| 798 | Ga0099796_10090181 | 3300010159 | Bacteria | 1138 |
| 799 | Ga0099796_10141922 | 3300010159 | Unclassified | 939 |
| 800 | Ga0105239_10098779 | 3300010375 | Bacteria | 3227 |
| 801 | Ga0105239_10136278 | 3300010375 | Bacteria | 2733 |
| 802 | Ga0105239_10817672 | 3300010375 | Bacteria | 1068 |
| 803 | Ga0105239_11012294 | 3300010375 | Unclassified | 955 |
| 804 | Ga0105239_11777823 | 3300010375 | Unclassified | 714 |
| 805 | Ga0105239_12073186 | 3300010375 | Bacteria | 661 |
| 806 | Ga0105239_12120510 | 3300010375 | Bacteria | 653 |
| 807 | Ga0105239_12263939 | 3300010375 | Unclassified | 632 |
| 808 | Ga0105246_10092959 | 3300011119 | Bacteria | 2178 |
| 809 | Ga0105246_10094253 | 3300011119 | Bacteria | 2165 |
| 810 | Ga0105246_10297765 | 3300011119 | Unclassified | 1301 |
| 811 | Ga0105246_10307590 | 3300011119 | Bacteria | 1282 |
| 812 | Ga0105246_10945204 | 3300011119 | Bacteria | 776 |
| 813 | Ga0105246_11261251 | 3300011119 | Bacteria | 683 |
| 814 | Ga0105246_11921716 | 3300011119 | Bacteria | 569 |
| 815 | Ga0105246_11949722 | 3300011119 | Unclassified | 565 |
| 816 | Ga0105246_12087577 | 3300011119 | Bacteria | 549 |
| 817 | Ga0105246_12543543 | 3300011119 | Unclassified | 505 |
| 818 | Ga0157373_10002883 | 3300013100 | Bacteria | 13006 |
| 819 | Ga0157373_10008292 | 3300013100 | Bacteria | 7720 |
| 820 | Ga0157373_10299751 | 3300013100 | Unclassified | 1141 |
| 821 | Ga0157373_10333694 | 3300013100 | Unclassified | 1080 |
| 822 | Ga0157373_10529883 | 3300013100 | Bacteria | 853 |
| 823 | Ga0157373_10590125 | 3300013100 | Unclassified | 808 |
| 824 | Ga0157373_10590298 | 3300013100 | Bacteria | 808 |
| 825 | Ga0157373_10825105 | 3300013100 | Bacteria | 685 |
| 826 | Ga0157373_11081738 | 3300013100 | Bacteria | 601 |
| 827 | Ga0157373_11143819 | 3300013100 | Bacteria | 585 |
| 828 | Ga0157373_11272214 | 3300013100 | Unclassified | 556 |
| 829 | Ga0157371_10191333 | 3300013102 | Bacteria | 1465 |
| 830 | Ga0157371_10223987 | 3300013102 | Bacteria | 1351 |
| 831 | Ga0157371_10908968 | 3300013102 | Bacteria | 668 |
| 832 | Ga0157369_10592547 | 3300013105 | Bacteria | 1145 |
| 833 | Ga0157374_10026890 | 3300013296 | Bacteria | 5182 |
| 834 | Ga0157374_10296798 | 3300013296 | Bacteria | 1598 |
| 835 | Ga0157374_11534395 | 3300013296 | Unclassified | 690 |
| 836 | Ga0157374_11911154 | 3300013296 | Bacteria | 619 |
| 837 | Ga0157374_12226860 | 3300013296 | Bacteria | 575 |
| 838 | Ga0157374_12304669 | 3300013296 | Bacteria | 566 |
| 839 | Ga0157374_12747311 | 3300013296 | Unclassified | 520 |
| 840 | Ga0157378_10001968 | 3300013297 | Bacteria | 18403 |
| 841 | Ga0157378_10012080 | 3300013297 | Bacteria | 7562 |
| 842 | Ga0157378_10063010 | 3300013297 | Bacteria | 3312 |
| 843 | Ga0157378_10078501 | 3300013297 | Bacteria | 2978 |
| 844 | Ga0157378_10134439 | 3300013297 | Bacteria | 2292 |
| 845 | Ga0157378_10149954 | 3300013297 | Bacteria | 2172 |
| 846 | Ga0157378_10174969 | 3300013297 | Bacteria | 2015 |
| 847 | Ga0157378_10274815 | 3300013297 | Bacteria | 1622 |
| 848 | Ga0157378_10629917 | 3300013297 | Bacteria | 1086 |
| 849 | Ga0157378_10765577 | 3300013297 | Bacteria | 989 |
| 850 | Ga0157378_11015645 | 3300013297 | Unclassified | 864 |
| 851 | Ga0157378_11195153 | 3300013297 | Unclassified | 800 |
| 852 | Ga0157378_11246657 | 3300013297 | Unclassified | 784 |
| 853 | Ga0157378_11297631 | 3300013297 | Bacteria | 769 |
| 854 | Ga0157378_11337511 | 3300013297 | Bacteria | 758 |
| 855 | Ga0157378_11431953 | 3300013297 | Bacteria | 734 |
| 856 | Ga0157378_11921246 | 3300013297 | Bacteria | 641 |
| 857 | Ga0157378_12296038 | 3300013297 | Unclassified | 591 |
| 858 | Ga0157378_12443924 | 3300013297 | Unclassified | 574 |
| 859 | Ga0163162_10002437 | 3300013306 | Bacteria | 17536 |
| 860 | Ga0163162_10011708 | 3300013306 | Bacteria | 8555 |
| 861 | Ga0163162_10012021 | 3300013306 | Bacteria | 8441 |
| 862 | Ga0163162_10162770 | 3300013306 | Bacteria | 2353 |
| 863 | Ga0163162_10175826 | 3300013306 | Bacteria | 2266 |
| 864 | Ga0163162_10237280 | 3300013306 | Bacteria | 1954 |
| 865 | Ga0163162_10334283 | 3300013306 | Bacteria | 1647 |
| 866 | Ga0163162_10529386 | 3300013306 | Unclassified | 1308 |
| 867 | Ga0163162_10683774 | 3300013306 | Bacteria | 1148 |
| 868 | Ga0163162_10756571 | 3300013306 | Bacteria | 1091 |
| 869 | Ga0163162_10899763 | 3300013306 | Bacteria | 998 |
| 870 | Ga0163162_11781558 | 3300013306 | Unclassified | 704 |
| 871 | Ga0163162_12170397 | 3300013306 | Bacteria | 637 |
| 872 | Ga0157372_10001564 | 3300013307 | Bacteria | 24928 |
| 873 | Ga0157372_10113138 | 3300013307 | Bacteria | 3111 |
| 874 | Ga0157372_10338510 | 3300013307 | Bacteria | 1752 |
| 875 | Ga0157372_12010740 | 3300013307 | Unclassified | 664 |
| 876 | Ga0157375_10063548 | 3300013308 | Bacteria | 3673 |
| 877 | Ga0157375_10133001 | 3300013308 | Bacteria | 2608 |
| 878 | Ga0157375_10142189 | 3300013308 | Bacteria | 2527 |
| 879 | Ga0157375_10147109 | 3300013308 | Unclassified | 2487 |
| 880 | Ga0157375_10381537 | 3300013308 | Bacteria | 1576 |
| 881 | Ga0157375_10501249 | 3300013308 | Bacteria | 1378 |
| 882 | Ga0157375_10737006 | 3300013308 | Unclassified | 1137 |
| 883 | Ga0157375_10949964 | 3300013308 | Unclassified | 1001 |
| 884 | Ga0157375_11013889 | 3300013308 | Unclassified | 969 |
| 885 | Ga0157375_11458999 | 3300013308 | Bacteria | 807 |
| 886 | Ga0157375_11852458 | 3300013308 | Unclassified | 716 |
| 887 | Ga0157375_11963834 | 3300013308 | Bacteria | 695 |
| 888 | Ga0157375_12023587 | 3300013308 | Bacteria | 685 |
| 889 | Ga0157375_13683476 | 3300013308 | Unclassified | 510 |
| 890 | Ga0163163_10000862 | 3300014325 | Bacteria | 25852 |
| 891 | Ga0163163_10004317 | 3300014325 | Bacteria | 12113 |
| 892 | Ga0163163_10058608 | 3300014325 | Bacteria | 3808 |
| 893 | Ga0163163_10062838 | 3300014325 | Bacteria | 3680 |
| 894 | Ga0163163_10065206 | 3300014325 | Unclassified | 3614 |
| 895 | Ga0163163_10067723 | 3300014325 | Unclassified | 3550 |
| 896 | Ga0163163_10106824 | 3300014325 | Bacteria | 2825 |
| 897 | Ga0163163_10235973 | 3300014325 | Unclassified | 1878 |
| 898 | Ga0163163_10241251 | 3300014325 | Bacteria | 1857 |
| 899 | Ga0163163_10318992 | 3300014325 | Bacteria | 1608 |
| 900 | Ga0163163_10634198 | 3300014325 | Bacteria | 1132 |
| 901 | Ga0163163_10963387 | 3300014325 | Bacteria | 916 |
| 902 | Ga0163163_11387267 | 3300014325 | Unclassified | 764 |
| 903 | Ga0163163_11777180 | 3300014325 | Bacteria | 677 |
| 904 | Ga0163163_13324639 | 3300014325 | Unclassified | 501 |
| 905 | Ga0157380_10004388 | 3300014326 | Bacteria | 9778 |
| 906 | Ga0157380_10014633 | 3300014326 | Bacteria | 5745 |
| 907 | Ga0157380_10053614 | 3300014326 | Bacteria | 3198 |
| 908 | Ga0157380_10072771 | 3300014326 | Bacteria | 2785 |
| 909 | Ga0157380_10079299 | 3300014326 | Bacteria | 2681 |
| 910 | Ga0157380_10315847 | 3300014326 | Bacteria | 1446 |
| 911 | Ga0157380_10396852 | 3300014326 | Bacteria | 1307 |
| 912 | Ga0157380_10614569 | 3300014326 | Bacteria | 1078 |
| 913 | Ga0157380_10810655 | 3300014326 | Bacteria | 954 |
| 914 | Ga0157380_11090362 | 3300014326 | Bacteria | 837 |
| 915 | Ga0157380_11249541 | 3300014326 | Bacteria | 788 |
| 916 | Ga0157380_12645064 | 3300014326 | Unclassified | 568 |
| 917 | Ga0157380_13039303 | 3300014326 | Bacteria | 535 |
| 918 | Ga0182008_10914109 | 3300014497 | Unclassified | 517 |
| 919 | Ga0157377_10075982 | 3300014745 | Bacteria | 1952 |
| 920 | Ga0157377_10127036 | 3300014745 | Bacteria | 1552 |
| 921 | Ga0157377_10265524 | 3300014745 | Bacteria | 1119 |
| 922 | Ga0157377_10455023 | 3300014745 | Bacteria | 885 |
| 923 | Ga0157377_10714259 | 3300014745 | Unclassified | 729 |
| 924 | Ga0157379_10090780 | 3300014968 | Bacteria | 2740 |
| 925 | Ga0157379_10353050 | 3300014968 | Bacteria | 1346 |
| 926 | Ga0157379_10353334 | 3300014968 | Bacteria | 1346 |
| 927 | Ga0157379_10475067 | 3300014968 | Bacteria | 1156 |
| 928 | Ga0157379_11870751 | 3300014968 | Bacteria | 591 |
| 929 | Ga0157379_12079156 | 3300014968 | Bacteria | 562 |
| 930 | Ga0157376_10017462 | 3300014969 | Bacteria | 5474 |
| 931 | Ga0157376_10638660 | 3300014969 | Bacteria | 1064 |
| 932 | Ga0182007_10065245 | 3300015262 | Unclassified | 1193 |
| 933 | Ga0163161_10015460 | 3300017792 | Bacteria | 5320 |
| 934 | Ga0163161_10140454 | 3300017792 | Unclassified | 1829 |
| 935 | Ga0163161_10320364 | 3300017792 | Bacteria | 1225 |
| 936 | Ga0163161_10776946 | 3300017792 | Bacteria | 803 |
| 937 | Ga0163161_11065836 | 3300017792 | Bacteria | 693 |
| 938 | Ga0213876_10005036 | 3300021384 | Bacteria | 7288 |
| 939 | Ga0207672_1000122 | 3300025223 | Bacteria | 10489 |
| 940 | Ga0207666_1010072 | 3300025271 | Bacteria | 1288 |
| 941 | Ga0207697_10031153 | 3300025315 | Bacteria | 2182 |
| 942 | Ga0207713_1194727 | 3300025735 | Unclassified | 625 |
| 943 | Ga0207653_10000130 | 3300025885 | Bacteria | 53391 |
| 944 | Ga0207653_10187401 | 3300025885 | Unclassified | 776 |
| 945 | Ga0207682_10413216 | 3300025893 | Bacteria | 638 |
| 946 | Ga0207642_10005892 | 3300025899 | Bacteria | 4035 |
| 947 | Ga0207642_10521238 | 3300025899 | Unclassified | 730 |
| 948 | Ga0207710_10000003 | 3300025900 | Bacteria | 1071597 |
| 949 | Ga0207710_10001166 | 3300025900 | Bacteria | 13372 |
| 950 | Ga0207710_10152193 | 3300025900 | Unclassified | 1123 |
| 951 | Ga0207710_10182455 | 3300025900 | Unclassified | 1030 |
| 952 | Ga0207710_10553664 | 3300025900 | Unclassified | 599 |
| 953 | Ga0207688_10244747 | 3300025901 | Bacteria | 1085 |
| 954 | Ga0207688_10245451 | 3300025901 | Unclassified | 1083 |
| 955 | Ga0207680_10116217 | 3300025903 | Bacteria | 1743 |
| 956 | Ga0207680_10203388 | 3300025903 | Unclassified | 1351 |
| 957 | Ga0207680_10374376 | 3300025903 | Bacteria | 1003 |
| 958 | Ga0207680_10409524 | 3300025903 | Unclassified | 959 |
| 959 | Ga0207647_10000385 | 3300025904 | Bacteria | 35983 |
| 960 | Ga0207647_10048111 | 3300025904 | Bacteria | 2649 |
| 961 | Ga0207647_10503356 | 3300025904 | Bacteria | 675 |
| 962 | Ga0207685_10000007 | 3300025905 | Bacteria | 278341 |
| 963 | Ga0207699_11015603 | 3300025906 | Bacteria | 613 |
| 964 | Ga0207645_10108720 | 3300025907 | Bacteria | 1794 |
| 965 | Ga0207645_10466515 | 3300025907 | Unclassified | 853 |
| 966 | Ga0207645_10768014 | 3300025907 | Bacteria | 655 |
| 967 | Ga0207645_10893899 | 3300025907 | Bacteria | 603 |
| 968 | Ga0207643_10021068 | 3300025908 | Bacteria | 3579 |
| 969 | Ga0207643_10042107 | 3300025908 | Unclassified | 2574 |
| 970 | Ga0207643_10135729 | 3300025908 | Unclassified | 1467 |
| 971 | Ga0207643_10190988 | 3300025908 | Bacteria | 1243 |
| 972 | Ga0207643_10366713 | 3300025908 | Unclassified | 906 |
| 973 | Ga0207643_10653980 | 3300025908 | Bacteria | 678 |
| 974 | Ga0207684_10000131 | 3300025910 | Bacteria | 137508 |
| 975 | Ga0207684_10032227 | 3300025910 | Bacteria | 4457 |
| 976 | Ga0207684_10358230 | 3300025910 | Unclassified | 1255 |
| 977 | Ga0207684_10377063 | 3300025910 | Bacteria | 1220 |
| 978 | Ga0207654_10022993 | 3300025911 | Bacteria | 3334 |
| 979 | Ga0207654_10073402 | 3300025911 | Unclassified | 2039 |
| 980 | Ga0207654_10306150 | 3300025911 | Unclassified | 1082 |
| 981 | Ga0207654_10422733 | 3300025911 | Unclassified | 930 |
| 982 | Ga0207654_10525608 | 3300025911 | Bacteria | 838 |
| 983 | Ga0207654_10835984 | 3300025911 | Unclassified | 666 |
| 984 | Ga0207654_10851681 | 3300025911 | Unclassified | 660 |
| 985 | Ga0207707_10000017 | 3300025912 | Bacteria | 237068 |
| 986 | Ga0207707_10004243 | 3300025912 | Bacteria | 12691 |
| 987 | Ga0207707_10109843 | 3300025912 | Bacteria | 2410 |
| 988 | Ga0207707_10602079 | 3300025912 | Unclassified | 930 |
| 989 | Ga0207707_10608347 | 3300025912 | Unclassified | 924 |
| 990 | Ga0207695_10123112 | 3300025913 | Bacteria | 2559 |
| 991 | Ga0207671_10148293 | 3300025914 | Bacteria | 1811 |
| 992 | Ga0207671_10161583 | 3300025914 | Bacteria | 1735 |
| 993 | Ga0207671_10674393 | 3300025914 | Bacteria | 823 |
| 994 | Ga0207660_10026986 | 3300025917 | Bacteria | 3915 |
| 995 | Ga0207660_10135185 | 3300025917 | Bacteria | 1880 |
| 996 | Ga0207660_10210627 | 3300025917 | Bacteria | 1522 |
| 997 | Ga0207660_10735298 | 3300025917 | Bacteria | 805 |
| 998 | Ga0207660_11643311 | 3300025917 | Unclassified | 517 |
| 999 | Ga0207662_10005692 | 3300025918 | Bacteria | 6667 |
| 1000 | Ga0207662_10023437 | 3300025918 | Bacteria | 3546 |
| 1001 | Ga0207662_10069082 | 3300025918 | Bacteria | 2134 |
| 1002 | Ga0207662_10260706 | 3300025918 | Bacteria | 1141 |
| 1003 | Ga0207662_10282924 | 3300025918 | Unclassified | 1098 |
| 1004 | Ga0207662_10361470 | 3300025918 | Bacteria | 977 |
| 1005 | Ga0207662_11323185 | 3300025918 | Unclassified | 512 |
| 1006 | Ga0207657_10703100 | 3300025919 | Unclassified | 785 |
| 1007 | Ga0207649_10448989 | 3300025920 | Bacteria | 973 |
| 1008 | Ga0207649_11030574 | 3300025920 | Bacteria | 648 |
| 1009 | Ga0207652_10000335 | 3300025921 | Bacteria | 48903 |
| 1010 | Ga0207652_10114949 | 3300025921 | Bacteria | 2390 |
| 1011 | Ga0207652_11100128 | 3300025921 | Unclassified | 695 |
| 1012 | Ga0207646_10009704 | 3300025922 | Bacteria | 9490 |
| 1013 | Ga0207646_10100260 | 3300025922 | Bacteria | 2596 |
| 1014 | Ga0207646_10136843 | 3300025922 | Bacteria | 2206 |
| 1015 | Ga0207646_10467588 | 3300025922 | Unclassified | 1137 |
| 1016 | Ga0207646_10998948 | 3300025922 | Unclassified | 739 |
| 1017 | Ga0207681_10011297 | 3300025923 | Bacteria | 5486 |
| 1018 | Ga0207681_10044905 | 3300025923 | Bacteria | 2963 |
| 1019 | Ga0207681_10106684 | 3300025923 | Bacteria | 2030 |
| 1020 | Ga0207681_10322741 | 3300025923 | Bacteria | 1228 |
| 1021 | Ga0207694_10049440 | 3300025924 | Bacteria | 3255 |
| 1022 | Ga0207694_10076122 | 3300025924 | Bacteria | 2628 |
| 1023 | Ga0207650_10000005 | 3300025925 | Bacteria | 663190 |
| 1024 | Ga0207650_10063251 | 3300025925 | Bacteria | 2766 |
| 1025 | Ga0207650_10163632 | 3300025925 | Bacteria | 1764 |
| 1026 | Ga0207650_10189159 | 3300025925 | Bacteria | 1644 |
| 1027 | Ga0207650_10302083 | 3300025925 | Unclassified | 1307 |
| 1028 | Ga0207650_10612480 | 3300025925 | Bacteria | 916 |
| 1029 | Ga0207650_10633851 | 3300025925 | Unclassified | 900 |
| 1030 | Ga0207650_10744741 | 3300025925 | Bacteria | 829 |
| 1031 | Ga0207650_10765378 | 3300025925 | Unclassified | 817 |
| 1032 | Ga0207659_10254107 | 3300025926 | Unclassified | 1427 |
| 1033 | Ga0207659_10378233 | 3300025926 | Bacteria | 1180 |
| 1034 | Ga0207659_10451059 | 3300025926 | Bacteria | 1083 |
| 1035 | Ga0207687_10080623 | 3300025927 | Bacteria | 2350 |
| 1036 | Ga0207687_10797720 | 3300025927 | Unclassified | 805 |
| 1037 | Ga0207644_10000074 | 3300025931 | Bacteria | 73369 |
| 1038 | Ga0207644_10030944 | 3300025931 | Bacteria | 3726 |
| 1039 | Ga0207644_10100032 | 3300025931 | Bacteria | 2177 |
| 1040 | Ga0207644_11011304 | 3300025931 | Bacteria | 698 |
| 1041 | Ga0207644_11402991 | 3300025931 | Unclassified | 587 |
| 1042 | Ga0207690_10013967 | 3300025932 | Bacteria | 4839 |
| 1043 | Ga0207690_10056799 | 3300025932 | Bacteria | 2642 |
| 1044 | Ga0207690_10683952 | 3300025932 | Bacteria | 843 |
| 1045 | Ga0207690_11395134 | 3300025932 | Bacteria | 586 |
| 1046 | Ga0207706_10044092 | 3300025933 | Bacteria | 3953 |
| 1047 | Ga0207706_10125993 | 3300025933 | Bacteria | 2253 |
| 1048 | Ga0207706_10134256 | 3300025933 | Bacteria | 2177 |
| 1049 | Ga0207706_10360556 | 3300025933 | Bacteria | 1263 |
| 1050 | Ga0207706_10551675 | 3300025933 | Unclassified | 992 |
| 1051 | Ga0207686_10000011 | 3300025934 | Bacteria | 216046 |
| 1052 | Ga0207686_10010343 | 3300025934 | Bacteria | 5078 |
| 1053 | Ga0207686_10017843 | 3300025934 | Unclassified | 4006 |
| 1054 | Ga0207686_10439152 | 3300025934 | Bacteria | 1002 |
| 1055 | Ga0207686_10797179 | 3300025934 | Bacteria | 757 |
| 1056 | Ga0207709_10000042 | 3300025935 | Bacteria | 254145 |
| 1057 | Ga0207709_10074732 | 3300025935 | Bacteria | 2164 |
| 1058 | Ga0207709_10123016 | 3300025935 | Unclassified | 1755 |
| 1059 | Ga0207709_10272911 | 3300025935 | Bacteria | 1246 |
| 1060 | Ga0207709_10347634 | 3300025935 | Unclassified | 1118 |
| 1061 | Ga0207709_10423684 | 3300025935 | Unclassified | 1023 |
| 1062 | Ga0207709_10997707 | 3300025935 | Unclassified | 684 |
| 1063 | Ga0207709_11154694 | 3300025935 | Bacteria | 637 |
| 1064 | Ga0207709_11159774 | 3300025935 | Unclassified | 636 |
| 1065 | Ga0207709_11452116 | 3300025935 | Bacteria | 568 |
| 1066 | Ga0207709_11724738 | 3300025935 | Unclassified | 521 |
| 1067 | Ga0207670_10017942 | 3300025936 | Bacteria | 4288 |
| 1068 | Ga0207670_10059135 | 3300025936 | Bacteria | 2606 |
| 1069 | Ga0207670_10390021 | 3300025936 | Unclassified | 1111 |
| 1070 | Ga0207670_10650281 | 3300025936 | Unclassified | 869 |
| 1071 | Ga0207670_10779026 | 3300025936 | Bacteria | 796 |
| 1072 | Ga0207670_11248002 | 3300025936 | Bacteria | 630 |
| 1073 | Ga0207670_11260140 | 3300025936 | Bacteria | 627 |
| 1074 | Ga0207669_10356127 | 3300025937 | Bacteria | 1132 |
| 1075 | Ga0207704_10083943 | 3300025938 | Bacteria | 2069 |
| 1076 | Ga0207704_10467027 | 3300025938 | Bacteria | 1010 |
| 1077 | Ga0207704_10835307 | 3300025938 | Bacteria | 771 |
| 1078 | Ga0207704_11146927 | 3300025938 | Unclassified | 661 |
| 1079 | Ga0207665_10000027 | 3300025939 | Bacteria | 96926 |
| 1080 | Ga0207665_10140145 | 3300025939 | Bacteria | 1723 |
| 1081 | Ga0207665_10349671 | 3300025939 | Bacteria | 1116 |
| 1082 | Ga0207665_10471511 | 3300025939 | Bacteria | 966 |
| 1083 | Ga0207665_10556603 | 3300025939 | Bacteria | 892 |
| 1084 | Ga0207665_11250822 | 3300025939 | Bacteria | 592 |
| 1085 | Ga0207691_10001531 | 3300025940 | Bacteria | 22999 |
| 1086 | Ga0207691_10891538 | 3300025940 | Bacteria | 745 |
| 1087 | Ga0207691_10899636 | 3300025940 | Unclassified | 741 |
| 1088 | Ga0207711_10003667 | 3300025941 | Bacteria | 13273 |
| 1089 | Ga0207711_10025575 | 3300025941 | Bacteria | 4951 |
| 1090 | Ga0207711_10026824 | 3300025941 | Bacteria | 4835 |
| 1091 | Ga0207711_10064400 | 3300025941 | Unclassified | 3166 |
| 1092 | Ga0207711_10115243 | 3300025941 | Bacteria | 2394 |
| 1093 | Ga0207711_10177075 | 3300025941 | Unclassified | 1938 |
| 1094 | Ga0207711_10480815 | 3300025941 | Bacteria | 1157 |
| 1095 | Ga0207711_10512928 | 3300025941 | Bacteria | 1118 |
| 1096 | Ga0207711_10826120 | 3300025941 | Unclassified | 863 |
| 1097 | Ga0207711_10853585 | 3300025941 | Bacteria | 847 |
| 1098 | Ga0207711_10973120 | 3300025941 | Unclassified | 788 |
| 1099 | Ga0207711_11761835 | 3300025941 | Unclassified | 563 |
| 1100 | Ga0207711_11850396 | 3300025941 | Unclassified | 547 |
| 1101 | Ga0207689_10008713 | 3300025942 | Bacteria | 8828 |
| 1102 | Ga0207689_10016842 | 3300025942 | Bacteria | 6185 |
| 1103 | Ga0207689_10046764 | 3300025942 | Bacteria | 3575 |
| 1104 | Ga0207689_10146107 | 3300025942 | Bacteria | 1948 |
| 1105 | Ga0207689_10169483 | 3300025942 | Bacteria | 1799 |
| 1106 | Ga0207689_10219895 | 3300025942 | Bacteria | 1569 |
| 1107 | Ga0207689_10244123 | 3300025942 | Unclassified | 1485 |
| 1108 | Ga0207689_10331929 | 3300025942 | Bacteria | 1263 |
| 1109 | Ga0207689_10459006 | 3300025942 | Bacteria | 1065 |
| 1110 | Ga0207689_10475000 | 3300025942 | Bacteria | 1046 |
| 1111 | Ga0207689_10951399 | 3300025942 | Bacteria | 725 |
| 1112 | Ga0207689_11169271 | 3300025942 | Bacteria | 648 |
| 1113 | Ga0207689_11364343 | 3300025942 | Bacteria | 595 |
| 1114 | Ga0207661_10252955 | 3300025944 | Bacteria | 1567 |
| 1115 | Ga0207661_11800446 | 3300025944 | Unclassified | 558 |
| 1116 | Ga0207679_10299917 | 3300025945 | Bacteria | 1385 |
| 1117 | Ga0207679_10325900 | 3300025945 | Bacteria | 1331 |
| 1118 | Ga0207679_10604760 | 3300025945 | Bacteria | 988 |
| 1119 | Ga0207679_10789734 | 3300025945 | Bacteria | 865 |
| 1120 | Ga0207679_11291505 | 3300025945 | Unclassified | 670 |
| 1121 | Ga0207667_12049369 | 3300025949 | Unclassified | 532 |
| 1122 | Ga0207651_10039329 | 3300025960 | Bacteria | 3118 |
| 1123 | Ga0207651_10094856 | 3300025960 | Bacteria | 2195 |
| 1124 | Ga0207651_10373390 | 3300025960 | Unclassified | 1207 |
| 1125 | Ga0207651_10493191 | 3300025960 | Unclassified | 1058 |
| 1126 | Ga0207651_10533004 | 3300025960 | Bacteria | 1019 |
| 1127 | Ga0207651_10608130 | 3300025960 | Unclassified | 956 |
| 1128 | Ga0207651_10885752 | 3300025960 | Unclassified | 794 |
| 1129 | Ga0207712_10019580 | 3300025961 | Bacteria | 4423 |
| 1130 | Ga0207712_10028818 | 3300025961 | Bacteria | 3718 |
| 1131 | Ga0207712_10044712 | 3300025961 | Bacteria | 3062 |
| 1132 | Ga0207712_10380598 | 3300025961 | Bacteria | 1181 |
| 1133 | Ga0207712_11181802 | 3300025961 | Bacteria | 682 |
| 1134 | Ga0207712_11716441 | 3300025961 | Bacteria | 563 |
| 1135 | Ga0207640_10081777 | 3300025981 | Bacteria | 2210 |
| 1136 | Ga0207640_10112579 | 3300025981 | Bacteria | 1933 |
| 1137 | Ga0207640_10162778 | 3300025981 | Bacteria | 1653 |
| 1138 | Ga0207640_10209832 | 3300025981 | Bacteria | 1483 |
| 1139 | Ga0207640_10219765 | 3300025981 | Bacteria | 1454 |
| 1140 | Ga0207640_10471093 | 3300025981 | Bacteria | 1039 |
| 1141 | Ga0207640_10669167 | 3300025981 | Unclassified | 887 |
| 1142 | Ga0207640_10736941 | 3300025981 | Bacteria | 848 |
| 1143 | Ga0207640_10774639 | 3300025981 | Bacteria | 829 |
| 1144 | Ga0207640_11256543 | 3300025981 | Bacteria | 660 |
| 1145 | Ga0207640_11901586 | 3300025981 | Bacteria | 538 |
| 1146 | Ga0207640_12122058 | 3300025981 | Unclassified | 510 |
| 1147 | Ga0207658_10068564 | 3300025986 | Bacteria | 2677 |
| 1148 | Ga0207658_10570205 | 3300025986 | Bacteria | 1014 |
| 1149 | Ga0207658_11480944 | 3300025986 | Unclassified | 621 |
| 1150 | Ga0207677_10251485 | 3300026023 | Bacteria | 1435 |
| 1151 | Ga0207677_11069330 | 3300026023 | Bacteria | 734 |
| 1152 | Ga0207677_11114819 | 3300026023 | Bacteria | 720 |
| 1153 | Ga0207677_11886654 | 3300026023 | Unclassified | 555 |
| 1154 | Ga0207703_10000101 | 3300026035 | Bacteria | 101290 |
| 1155 | Ga0207703_10073238 | 3300026035 | Bacteria | 2833 |
| 1156 | Ga0207703_10159449 | 3300026035 | Unclassified | 1975 |
| 1157 | Ga0207703_10184078 | 3300026035 | Bacteria | 1845 |
| 1158 | Ga0207703_10230270 | 3300026035 | Bacteria | 1661 |
| 1159 | Ga0207703_10258220 | 3300026035 | Bacteria | 1574 |
| 1160 | Ga0207703_10283261 | 3300026035 | Unclassified | 1506 |
| 1161 | Ga0207703_10386619 | 3300026035 | Bacteria | 1295 |
| 1162 | Ga0207703_10894211 | 3300026035 | Bacteria | 850 |
| 1163 | Ga0207639_10061466 | 3300026041 | Bacteria | 2901 |
| 1164 | Ga0207639_10252918 | 3300026041 | Bacteria | 1537 |
| 1165 | Ga0207639_11284413 | 3300026041 | Unclassified | 687 |
| 1166 | Ga0207708_10000043 | 3300026075 | Bacteria | 121725 |
| 1167 | Ga0207708_10002522 | 3300026075 | Bacteria | 13464 |
| 1168 | Ga0207708_10007831 | 3300026075 | Bacteria | 7914 |
| 1169 | Ga0207708_10053037 | 3300026075 | Bacteria | 3089 |
| 1170 | Ga0207708_10087926 | 3300026075 | Unclassified | 2393 |
| 1171 | Ga0207708_10192647 | 3300026075 | Bacteria | 1623 |
| 1172 | Ga0207708_10293813 | 3300026075 | Unclassified | 1320 |
| 1173 | Ga0207708_10461891 | 3300026075 | Bacteria | 1059 |
| 1174 | Ga0207708_11591261 | 3300026075 | Bacteria | 574 |
| 1175 | Ga0207702_10150385 | 3300026078 | Bacteria | 2117 |
| 1176 | Ga0207702_11959942 | 3300026078 | Bacteria | 576 |
| 1177 | Ga0207641_10109885 | 3300026088 | Bacteria | 2442 |
| 1178 | Ga0207641_10180752 | 3300026088 | Bacteria | 1932 |
| 1179 | Ga0207641_10246746 | 3300026088 | Bacteria | 1666 |
| 1180 | Ga0207641_10348820 | 3300026088 | Unclassified | 1410 |
| 1181 | Ga0207641_10476106 | 3300026088 | Unclassified | 1210 |
| 1182 | Ga0207641_10529446 | 3300026088 | Unclassified | 1147 |
| 1183 | Ga0207641_10652594 | 3300026088 | Bacteria | 1033 |
| 1184 | Ga0207641_10998635 | 3300026088 | Bacteria | 833 |
| 1185 | Ga0207641_11012145 | 3300026088 | Unclassified | 828 |
| 1186 | Ga0207641_11022677 | 3300026088 | Bacteria | 823 |
| 1187 | Ga0207641_11136937 | 3300026088 | Unclassified | 780 |
| 1188 | Ga0207641_11156421 | 3300026088 | Unclassified | 773 |
| 1189 | Ga0207641_11176415 | 3300026088 | Bacteria | 766 |
| 1190 | Ga0207641_11461741 | 3300026088 | Unclassified | 685 |
| 1191 | Ga0207641_11477258 | 3300026088 | Bacteria | 681 |
| 1192 | Ga0207641_11926792 | 3300026088 | Bacteria | 592 |
| 1193 | Ga0207641_12024034 | 3300026088 | Unclassified | 577 |
| 1194 | Ga0207641_12040738 | 3300026088 | Bacteria | 575 |
| 1195 | Ga0207648_10015138 | 3300026089 | Bacteria | 7099 |
| 1196 | Ga0207648_10048951 | 3300026089 | Bacteria | 3700 |
| 1197 | Ga0207648_10121810 | 3300026089 | Viruses | 2293 |
| 1198 | Ga0207648_10313067 | 3300026089 | Bacteria | 1409 |
| 1199 | Ga0207648_10439552 | 3300026089 | Unclassified | 1186 |
| 1200 | Ga0207648_10457671 | 3300026089 | Bacteria | 1163 |
| 1201 | Ga0207648_10695167 | 3300026089 | Bacteria | 942 |
| 1202 | Ga0207648_10879578 | 3300026089 | Unclassified | 836 |
| 1203 | Ga0207648_11068407 | 3300026089 | Unclassified | 757 |
| 1204 | Ga0207648_11490987 | 3300026089 | Unclassified | 636 |
| 1205 | Ga0207648_11636644 | 3300026089 | Bacteria | 605 |
| 1206 | Ga0207648_11636662 | 3300026089 | Unclassified | 605 |
| 1207 | Ga0207676_10004891 | 3300026095 | Bacteria | 9491 |
| 1208 | Ga0207676_10029953 | 3300026095 | Bacteria | 4079 |
| 1209 | Ga0207676_10158301 | 3300026095 | Bacteria | 1959 |
| 1210 | Ga0207676_10309008 | 3300026095 | Bacteria | 1446 |
| 1211 | Ga0207676_10361000 | 3300026095 | Bacteria | 1346 |
| 1212 | Ga0207676_10369391 | 3300026095 | Bacteria | 1332 |
| 1213 | Ga0207676_10902931 | 3300026095 | Unclassified | 866 |
| 1214 | Ga0207676_10996562 | 3300026095 | Bacteria | 825 |
| 1215 | Ga0207676_11028316 | 3300026095 | Unclassified | 813 |
| 1216 | Ga0207676_11598995 | 3300026095 | Bacteria | 649 |
| 1217 | Ga0207676_12175917 | 3300026095 | Unclassified | 553 |
| 1218 | Ga0207674_10002367 | 3300026116 | Bacteria | 23830 |
| 1219 | Ga0207674_10236066 | 3300026116 | Bacteria | 1776 |
| 1220 | Ga0207674_10300871 | 3300026116 | Bacteria | 1553 |
| 1221 | Ga0207674_10349529 | 3300026116 | Bacteria | 1429 |
| 1222 | Ga0207674_10359862 | 3300026116 | Unclassified | 1407 |
| 1223 | Ga0207674_10417305 | 3300026116 | Bacteria | 1297 |
| 1224 | Ga0207674_10907232 | 3300026116 | Unclassified | 849 |
| 1225 | Ga0207674_11204972 | 3300026116 | Bacteria | 727 |
| 1226 | Ga0207674_11266136 | 3300026116 | Bacteria | 707 |
| 1227 | Ga0207674_11383254 | 3300026116 | Bacteria | 673 |
| 1228 | Ga0207674_11430754 | 3300026116 | Bacteria | 660 |
| 1229 | Ga0207674_12119246 | 3300026116 | Unclassified | 526 |
| 1230 | Ga0207675_100008740 | 3300026118 | Bacteria | 9514 |
| 1231 | Ga0207675_100021904 | 3300026118 | Bacteria | 5950 |
| 1232 | Ga0207675_100039921 | 3300026118 | Bacteria | 4379 |
| 1233 | Ga0207675_100059927 | 3300026118 | Bacteria | 3553 |
| 1234 | Ga0207675_100098854 | 3300026118 | Bacteria | 2749 |
| 1235 | Ga0207675_100140754 | 3300026118 | Bacteria | 2292 |
| 1236 | Ga0207675_100320494 | 3300026118 | Bacteria | 1513 |
| 1237 | Ga0207675_100391398 | 3300026118 | Bacteria | 1368 |
| 1238 | Ga0207675_100409058 | 3300026118 | Bacteria | 1338 |
| 1239 | Ga0207675_100477989 | 3300026118 | Bacteria | 1238 |
| 1240 | Ga0207675_100592840 | 3300026118 | Bacteria | 1111 |
| 1241 | Ga0207675_100768874 | 3300026118 | Bacteria | 975 |
| 1242 | Ga0207675_101186281 | 3300026118 | Unclassified | 784 |
| 1243 | Ga0207675_102135441 | 3300026118 | Unclassified | 576 |
| 1244 | Ga0207683_10044488 | 3300026121 | Bacteria | 3881 |
| 1245 | Ga0207683_10623123 | 3300026121 | Bacteria | 999 |
| 1246 | Ga0207683_10903689 | 3300026121 | Unclassified | 820 |
| 1247 | Ga0207698_10381916 | 3300026142 | Bacteria | 1340 |
| 1248 | Ga0207698_10959572 | 3300026142 | Bacteria | 864 |
| 1249 | Ga0207698_12671160 | 3300026142 | Unclassified | 508 |
| 1250 | Ga0209588_1012523 | 3300027671 | Bacteria | 2576 |
| 1251 | Ga0207428_10013786 | 3300027907 | Bacteria | 7044 |
| 1252 | Ga0207428_10015457 | 3300027907 | Bacteria | 6603 |
| 1253 | Ga0207428_10047588 | 3300027907 | Bacteria | 3443 |
| 1254 | Ga0207428_10309009 | 3300027907 | Bacteria | 1169 |
| 1255 | Ga0268266_11792847 | 3300028379 | Bacteria | 588 |
| 1256 | Ga0268266_11811724 | 3300028379 | Bacteria | 585 |
| 1257 | Ga0268265_10006379 | 3300028380 | Bacteria | 7995 |
| 1258 | Ga0268265_10024099 | 3300028380 | Bacteria | 4300 |
| 1259 | Ga0268265_10058203 | 3300028380 | Unclassified | 2949 |
| 1260 | Ga0268265_10301028 | 3300028380 | Unclassified | 1444 |
| 1261 | Ga0268265_10332204 | 3300028380 | Bacteria | 1381 |
| 1262 | Ga0268265_10370946 | 3300028380 | Bacteria | 1313 |
| 1263 | Ga0268265_10393052 | 3300028380 | Bacteria | 1279 |
| 1264 | Ga0268265_10412492 | 3300028380 | Bacteria | 1252 |
| 1265 | Ga0268265_10588777 | 3300028380 | Bacteria | 1061 |
| 1266 | Ga0268265_10612213 | 3300028380 | Bacteria | 1042 |
| 1267 | Ga0268265_12330200 | 3300028380 | Bacteria | 542 |
| 1268 | Ga0268264_10040717 | 3300028381 | Unclassified | 3839 |
| 1269 | Ga0268264_10065566 | 3300028381 | Bacteria | 3060 |
| 1270 | Ga0268264_10073497 | 3300028381 | Bacteria | 2902 |
| 1271 | Ga0268264_10081426 | 3300028381 | Bacteria | 2767 |
| 1272 | Ga0268264_10094055 | 3300028381 | Bacteria | 2591 |
| 1273 | Ga0268264_10113918 | 3300028381 | Bacteria | 2373 |
| 1274 | Ga0268264_10216347 | 3300028381 | Bacteria | 1761 |
| 1275 | Ga0268264_10229768 | 3300028381 | Bacteria | 1713 |
| 1276 | Ga0268264_10278375 | 3300028381 | Unclassified | 1566 |
| 1277 | Ga0268264_10302825 | 3300028381 | Bacteria | 1505 |
| 1278 | Ga0268264_10364595 | 3300028381 | Unclassified | 1379 |
| 1279 | Ga0268264_10886578 | 3300028381 | Bacteria | 895 |
| 1280 | Ga0268264_10960291 | 3300028381 | Bacteria | 860 |
| 1281 | Ga0268264_10980158 | 3300028381 | Unclassified | 851 |
| 1282 | Ga0268264_11737297 | 3300028381 | Unclassified | 634 |
| 1283 | Ga0307408_100011791 | 3300031548 | Bacteria | 5781 |
| 1284 | Ga0307408_100122608 | 3300031548 | Bacteria | 2016 |
| 1285 | Ga0307408_100161167 | 3300031548 | Bacteria | 1782 |
| 1286 | Ga0307408_102172747 | 3300031548 | Bacteria | 536 |
| 1287 | Ga0307405_10079066 | 3300031731 | Bacteria | 2142 |
| 1288 | Ga0307405_10096007 | 3300031731 | Bacteria | 1975 |
| 1289 | Ga0307405_10293436 | 3300031731 | Unclassified | 1230 |
| 1290 | Ga0307405_10796673 | 3300031731 | Bacteria | 791 |
| 1291 | Ga0307405_12161694 | 3300031731 | Bacteria | 500 |
| 1292 | Ga0307410_10142349 | 3300031852 | Bacteria | 1776 |
| 1293 | Ga0307410_11133279 | 3300031852 | Bacteria | 679 |
| 1294 | Ga0307406_10008963 | 3300031901 | Bacteria | 5594 |
| 1295 | Ga0307406_10563767 | 3300031901 | Bacteria | 934 |
| 1296 | Ga0307407_10364056 | 3300031903 | Bacteria | 1028 |
| 1297 | Ga0307407_10537790 | 3300031903 | Bacteria | 862 |
| 1298 | Ga0307407_10760830 | 3300031903 | Unclassified | 734 |
| 1299 | Ga0307412_10008317 | 3300031911 | Bacteria | 5914 |
| 1300 | Ga0307412_10012400 | 3300031911 | Bacteria | 4969 |
| 1301 | Ga0307412_10202912 | 3300031911 | Unclassified | 1507 |
| 1302 | Ga0307412_10376790 | 3300031911 | Bacteria | 1148 |
| 1303 | Ga0307409_100157714 | 3300031995 | Bacteria | 1980 |
| 1304 | Ga0307409_100512853 | 3300031995 | Bacteria | 1170 |
| 1305 | Ga0307416_100002153 | 3300032002 | Bacteria | 11158 |
| 1306 | Ga0307416_100134836 | 3300032002 | Bacteria | 2231 |
| 1307 | Ga0307416_100748409 | 3300032002 | Unclassified | 1070 |
| 1308 | Ga0307416_101259722 | 3300032002 | Unclassified | 845 |
| 1309 | Ga0307416_101655824 | 3300032002 | Unclassified | 745 |
| 1310 | Ga0307416_103269924 | 3300032002 | Bacteria | 542 |
| 1311 | Ga0307414_10001957 | 3300032004 | Bacteria | 10653 |
| 1312 | Ga0307414_10153795 | 3300032004 | Unclassified | 1818 |
| 1313 | Ga0307414_11803176 | 3300032004 | Bacteria | 571 |
| 1314 | Ga0307411_10005777 | 3300032005 | Bacteria | 6123 |
| 1315 | Ga0307411_10012992 | 3300032005 | Bacteria | 4574 |
| 1316 | Ga0307411_10479196 | 3300032005 | Unclassified | 1047 |
| 1317 | Ga0307411_10738589 | 3300032005 | Unclassified | 861 |
| 1318 | Ga0307411_11879461 | 3300032005 | Bacteria | 557 |
| 1319 | Ga0307415_100009574 | 3300032126 | Bacteria | 5441 |
| 1320 | Ga0307415_100180309 | 3300032126 | Bacteria | 1656 |
| 1321 | Ga0307415_100444967 | 3300032126 | Unclassified | 1119 |
| 1322 | Ga0307415_100961815 | 3300032126 | Unclassified | 791 |
| 1323 | Ga0307415_101742985 | 3300032126 | Unclassified | 601 |
| 1324 | Ga0373928_0096405 | 3300035084 | Bacteria | 766 |
| 1325 | Ga0373940_0106449 | 3300035088 | Bacteria | 856 |
| 1326 | Ga0373949_0131460 | 3300035090 | Unclassified | 711 |
| 1327 | Ga0373951_0001101 | 3300035091 | Bacteria | 7209 |
| 1328 | Ga0373932_0382033 | 3300035112 | Bacteria | 541 |
| 1329 | Ga0373941_0342101 | 3300035115 | Bacteria | 606 |
| 1330 | Ga0373942_0007648 | 3300035207 | Bacteria | 2511 |
| 1331 | Ga0373931_0158434 | 3300035691 | Bacteria | 1325 |
| 1332 | Ga0395899_0745589 | 3300037312 | Bacteria | 610 |
| 1333 | Ga0395900_0168787 | 3300037418 | Unclassified | 2229 |
| 1334 | Ga0395900_0395234 | 3300037418 | Bacteria | 1348 |
| 1335 | Ga0395900_0654449 | 3300037418 | Bacteria | 987 |
| 1336 | Ga0395900_0893323 | 3300037418 | Bacteria | 812 |
| 1337 | Ga0395900_1010833 | 3300037418 | Unclassified | 751 |
| 1338 | Ga0395898_0482532 | 3300037466 | Bacteria | 1179 |
| 1339 | Ga0395898_1259002 | 3300037466 | Unclassified | 670 |
| 1340 | Ga0395905_0359368 | 3300037471 | Bacteria | 1349 |
| 1341 | Ga0395905_0610509 | 3300037471 | Bacteria | 993 |
| 1342 | Ga0395905_1509350 | 3300037471 | Unclassified | 576 |
| 1343 | Ga0395901_0256020 | 3300038443 | Unclassified | 1823 |
| 1344 | Ga0395901_1650284 | 3300038443 | Bacteria | 593 |
| 1345 | Ga0395901_1952323 | 3300038443 | Bacteria | 534 |
| 1346 | Ga0242420_000913 | 3300038996 | Bacteria | 3685 |
| 1347 | Ga0436365_0564234 | 3300039437 | Bacteria | 5801 |
| 1348 | Ga0436365_0671345 | 3300039437 | Bacteria | 6054 |
| 1349 | Ga0436362_0146661 | 3300039453 | Bacteria | 696 |
| 1350 | Ga0439439_0006583 | 3300041406 | Bacteria | 2690 |
| 1351 | Ga0439453_0029842 | 3300041408 | Bacteria | 1028 |
| 1352 | Ga0439448_0058991 | 3300042005 | Bacteria | 1266 |
| 1353 | Ga0439462_0026944 | 3300042015 | Unclassified | 1516 |
| 1354 | Ga0439446_0053096 | 3300042156 | Unclassified | 1214 |
| 1355 | Ga0439458_0001390 | 3300042157 | Bacteria | 6114 |
| 1356 | Ga0439458_0024627 | 3300042157 | Bacteria | 1408 |
| 1357 | Ga0439434_0350666 | 3300042435 | Unclassified | 515 |
| 1358 | Ga0439464_0256326 | 3300042439 | Bacteria | 566 |
| 1359 | Ga0451577_0161360 | 3300042876 | Unclassified | 2019 |
| 1360 | Ga0453683_0461029 | 3300044673 | Bacteria | 823 |
| 1361 | Ga0453684_1265619 | 3300044712 | Bacteria | 771 |
| 1362 | Ga0451576_0303809 | 3300045051 | Bacteria | 1669 |
| 1363 | Ga0451576_0605443 | 3300045051 | Bacteria | 1152 |
| 1364 | Ga0451576_0772647 | 3300045051 | Unclassified | 1009 |
| 1365 | Ga0451576_1322367 | 3300045051 | Unclassified | 751 |
| 1366 | Ga0451576_1770856 | 3300045051 | Unclassified | 639 |
| 1367 | Ga0495603_0453818 | 3300046455 | Bacteria | 734 |
| 1368 | Ga0495620_0254198 | 3300046515 | Bacteria | 670 |
| 1369 | Ga0495663_0000212 | 3300046525 | Bacteria | 23260 |
| 1370 | Ga0495598_0047534 | 3300046537 | Bacteria | 1279 |
| 1371 | Ga0495598_0128292 | 3300046537 | Bacteria | 867 |
| 1372 | Ga0495621_0000419 | 3300046539 | Bacteria | 10471 |
| 1373 | Ga0495621_0047942 | 3300046539 | Bacteria | 1520 |
| 1374 | Ga0495621_0231151 | 3300046539 | Bacteria | 751 |
| 1375 | Ga0495633_0122663 | 3300046558 | Bacteria | 1204 |
| 1376 | Ga0495656_0039878 | 3300046615 | Bacteria | 1954 |
| 1377 | Ga0495656_0750143 | 3300046615 | Bacteria | 526 |
| 1378 | Ga0495668_0783072 | 3300046616 | Unclassified | 528 |
| 1379 | Ga0495659_0568651 | 3300046664 | Unclassified | 501 |
| 1380 | Ga0495658_0108012 | 3300046683 | Unclassified | 1670 |
| 1381 | Ga0495669_0623272 | 3300046684 | Unclassified | 525 |
| 1382 | Ga0495589_0192095 | 3300046794 | Unclassified | 966 |
| 1383 | Ga0495674_0599559 | 3300047319 | Bacteria | 873 |
| 1384 | Ga0495685_221417 | 3300047447 | Unclassified | 604 |
| 1385 | Ga0496100_1424384 | 3300048903 | Unclassified | 547 |
| 1386 | Ga0496102_1037549 | 3300048905 | Unclassified | 740 |
| 1387 | Ga0496102_1301009 | 3300048905 | Unclassified | 646 |
| 1388 | Ga0496104_0018973 | 3300048907 | Bacteria | 6284 |
| 1389 | Ga0496104_1190345 | 3300048907 | Unclassified | 665 |
| 1390 | Ga0496104_1544412 | 3300048907 | Bacteria | 567 |
| 1391 | Ga0496106_0327765 | 3300048909 | Bacteria | 1229 |
| 1392 | Ga0496106_0381121 | 3300048909 | Unclassified | 1133 |
| 1393 | Ga0496107_0101852 | 3300048910 | Bacteria | 2106 |
| 1394 | Ga0496107_0604809 | 3300048910 | Unclassified | 810 |
| 1395 | Ga0496107_0789125 | 3300048910 | Bacteria | 696 |
| 1396 | Ga0496108_0309535 | 3300048911 | Unclassified | 1376 |
| 1397 | Ga0496108_0456924 | 3300048911 | Bacteria | 1116 |
| 1398 | Ga0496109_1013366 | 3300048912 | Unclassified | 768 |
| 1399 | Ga0496112_0264580 | 3300048915 | Bacteria | 1669 |
| 1400 | Ga0496112_0378878 | 3300048915 | Bacteria | 1356 |
| 1401 | Ga0496112_1170947 | 3300048915 | Unclassified | 686 |
| 1402 | Ga0496113_1084320 | 3300048916 | Unclassified | 629 |
| 1403 | Ga0501290_044992 | 3300049513 | Unclassified | 672 |
| 1404 | Ga0501290_061300 | 3300049513 | Unclassified | 606 |
| 1405 | Ga0501290_066846 | 3300049513 | Bacteria | 589 |
| 1406 | Ga0501291_006199 | 3300049514 | Viruses | 1588 |
| 1407 | Ga0501291_111953 | 3300049514 | Bacteria | 582 |
| 1408 | Ga0501291_130231 | 3300049514 | Unclassified | 553 |
| 1409 | Ga0501292_010879 | 3300049515 | Bacteria | 1369 |
| 1410 | Ga0501292_071573 | 3300049515 | Bacteria | 645 |
| 1411 | Ga0501292_109854 | 3300049515 | Bacteria | 554 |
| 1412 | Ga0501296_000829 | 3300049519 | Bacteria | 3047 |
| 1413 | Ga0501296_012126 | 3300049519 | Unclassified | 1037 |
| 1414 | Ga0501296_022330 | 3300049519 | Unclassified | 814 |
| 1415 | Ga0501296_052072 | 3300049519 | Bacteria | 602 |
| 1416 | Ga0501298_002164 | 3300049521 | Bacteria | 2955 |
| 1417 | Ga0501298_008000 | 3300049521 | Unclassified | 1766 |
| 1418 | Ga0501299_000709 | 3300049522 | Bacteria | 4001 |
| 1419 | Ga0501299_036183 | 3300049522 | Bacteria | 973 |
| 1420 | Ga0501301_022858 | 3300049524 | Bacteria | 614 |
| 1421 | Ga0501303_010321 | 3300049526 | Bacteria | 873 |
| 1422 | Ga0501038_0005082 | 3300049574 | Bacteria | 12227 |
| 1423 | Ga0501072_1563219 | 3300049588 | Unclassified | 509 |
| 1424 | Ga0501074_0717952 | 3300049590 | Unclassified | 705 |
| 1425 | Ga0501077_0429495 | 3300049593 | Unclassified | 845 |
| 1426 | Ga0501198_006536 | 3300049649 | Bacteria | 1663 |
| 1427 | Ga0501198_020237 | 3300049649 | Bacteria | 1053 |
| 1428 | Ga0501198_066846 | 3300049649 | Bacteria | 670 |
| 1429 | Ga0501199_003906 | 3300049650 | Unclassified | 1449 |
| 1430 | Ga0501199_020139 | 3300049650 | Unclassified | 770 |
| 1431 | Ga0501202_015266 | 3300049652 | Unclassified | 1478 |
| 1432 | Ga0501202_038372 | 3300049652 | Bacteria | 1026 |
| 1433 | Ga0501202_106836 | 3300049652 | Unclassified | 688 |
| 1434 | Ga0501206_081078 | 3300049653 | Unclassified | 564 |
| 1435 | Ga0501207_002752 | 3300049654 | Bacteria | 2297 |
| 1436 | Ga0501207_120851 | 3300049654 | Unclassified | 543 |
| 1437 | Ga0501208_020740 | 3300049655 | Bacteria | 1072 |
| 1438 | Ga0501214_002537 | 3300049659 | Unclassified | 1546 |
| 1439 | Ga0501214_002696 | 3300049659 | Unclassified | 1516 |
| 1440 | Ga0501216_004065 | 3300049660 | Bacteria | 2158 |
| 1441 | Ga0501216_112336 | 3300049660 | Bacteria | 613 |
| 1442 | Ga0501217_000410 | 3300049661 | Bacteria | 6931 |
| 1443 | Ga0501217_003166 | 3300049661 | Bacteria | 3301 |
| 1444 | Ga0501217_016565 | 3300049661 | Bacteria | 1690 |
| 1445 | Ga0501217_310953 | 3300049661 | Unclassified | 522 |
| 1446 | Ga0501223_012361 | 3300049663 | Bacteria | 1707 |
| 1447 | Ga0501223_041375 | 3300049663 | Unclassified | 894 |
| 1448 | Ga0501223_109708 | 3300049663 | Unclassified | 575 |
| 1449 | Ga0501224_001708 | 3300049664 | Bacteria | 2942 |
| 1450 | Ga0501224_009538 | 3300049664 | Bacteria | 1421 |
| 1451 | Ga0501224_021697 | 3300049664 | Unclassified | 957 |
| 1452 | Ga0501227_000106 | 3300049665 | Bacteria | 14058 |
| 1453 | Ga0501227_014779 | 3300049665 | Unclassified | 1737 |
| 1454 | Ga0501227_021691 | 3300049665 | Unclassified | 1481 |
| 1455 | Ga0501230_002947 | 3300049667 | Bacteria | 2216 |
| 1456 | Ga0501233_213010 | 3300049668 | Bacteria | 567 |
| 1457 | Ga0501233_232233 | 3300049668 | Bacteria | 548 |
| 1458 | Ga0501235_004157 | 3300049669 | Bacteria | 3135 |
| 1459 | Ga0501235_006345 | 3300049669 | Bacteria | 2576 |
| 1460 | Ga0501235_010107 | 3300049669 | Unclassified | 2063 |
| 1461 | Ga0501235_013427 | 3300049669 | Bacteria | 1803 |
| 1462 | Ga0501235_091385 | 3300049669 | Bacteria | 735 |
| 1463 | Ga0501235_177904 | 3300049669 | Unclassified | 565 |
| 1464 | Ga0501236_001448 | 3300049670 | Bacteria | 2694 |
| 1465 | Ga0501239_009173 | 3300049672 | Bacteria | 1071 |
| 1466 | Ga0501239_082600 | 3300049672 | Bacteria | 517 |
| 1467 | Ga0501240_004240 | 3300049673 | Bacteria | 1652 |
| 1468 | Ga0501242_074176 | 3300049674 | Bacteria | 537 |
| 1469 | Ga0501243_012557 | 3300049675 | Unclassified | 1338 |
| 1470 | Ga0501243_061725 | 3300049675 | Bacteria | 696 |
| 1471 | Ga0501247_029429 | 3300049677 | Unclassified | 744 |
| 1472 | Ga0501248_006771 | 3300049678 | Unclassified | 941 |
| 1473 | Ga0501249_011428 | 3300049679 | Bacteria | 1863 |
| 1474 | Ga0501249_035636 | 3300049679 | Bacteria | 1119 |
| 1475 | Ga0501249_072683 | 3300049679 | Unclassified | 804 |
| 1476 | Ga0501249_206681 | 3300049679 | Bacteria | 517 |
| 1477 | Ga0501251_007135 | 3300049681 | Bacteria | 1235 |
| 1478 | Ga0501251_011940 | 3300049681 | Bacteria | 1043 |
| 1479 | Ga0501253_005133 | 3300049683 | Bacteria | 1697 |
| 1480 | Ga0501255_020660 | 3300049684 | Bacteria | 849 |
| 1481 | Ga0501256_002581 | 3300049685 | Bacteria | 1449 |
| 1482 | Ga0501256_006210 | 3300049685 | Bacteria | 1073 |
| 1483 | Ga0501257_007565 | 3300049686 | Bacteria | 2427 |
| 1484 | Ga0501257_031865 | 3300049686 | Unclassified | 1273 |
| 1485 | Ga0501258_019886 | 3300049687 | Bacteria | 783 |
| 1486 | Ga0501258_065308 | 3300049687 | Unclassified | 532 |
| 1487 | Ga0501259_007519 | 3300049688 | Bacteria | 1747 |
| 1488 | Ga0501259_010840 | 3300049688 | Bacteria | 1496 |
| 1489 | Ga0501260_000407 | 3300049689 | Unclassified | 3356 |
| 1490 | Ga0501260_000408 | 3300049689 | Bacteria | 3351 |
| 1491 | Ga0501260_007879 | 3300049689 | Bacteria | 1043 |
| 1492 | Ga0501260_037694 | 3300049689 | Bacteria | 577 |
| 1493 | Ga0501221_142846 | 3300049704 | Bacteria | 628 |
| 1494 | Ga0501221_156534 | 3300049704 | Unclassified | 607 |
| 1495 | Ga0501225_0000853 | 3300049705 | Bacteria | 9450 |
| 1496 | Ga0501225_0002070 | 3300049705 | Bacteria | 6240 |
| 1497 | Ga0501225_0007379 | 3300049705 | Bacteria | 3186 |
| 1498 | Ga0501225_0034099 | 3300049705 | Bacteria | 1401 |
| 1499 | Ga0501225_0184889 | 3300049705 | Bacteria | 653 |
| 1500 | Ga0501225_0263194 | 3300049705 | Bacteria | 571 |
| 1501 | Ga0501234_002675 | 3300049707 | Bacteria | 2803 |
| 1502 | Ga0501234_009967 | 3300049707 | Unclassified | 1481 |
| 1503 | Ga0501234_021859 | 3300049707 | Bacteria | 1020 |
| 1504 | Ga0501245_006567 | 3300049708 | Bacteria | 1628 |
| 1505 | Ga0501245_012305 | 3300049708 | Unclassified | 1254 |
| 1506 | Ga0501079_0107587 | 3300049741 | Bacteria | 2165 |
| 1507 | Ga0501079_0615472 | 3300049741 | Bacteria | 855 |
| 1508 | Ga0501081_1043620 | 3300049743 | Unclassified | 618 |
| 1509 | Ga0501241_155597 | 3300049758 | Bacteria | 529 |
| 1510 | Ga0501262_023315 | 3300049759 | Bacteria | 860 |
| 1511 | Ga0501263_051948 | 3300049760 | Unclassified | 625 |
| 1512 | Ga0501266_008989 | 3300049763 | Bacteria | 1260 |
| 1513 | Ga0501267_019021 | 3300049764 | Unclassified | 747 |
| 1514 | Ga0501268_006152 | 3300049765 | Unclassified | 1751 |
| 1515 | Ga0501269_032905 | 3300049766 | Unclassified | 670 |
| 1516 | Ga0501270_005388 | 3300049767 | Bacteria | 1486 |
| 1517 | Ga0501271_068344 | 3300049768 | Unclassified | 510 |
| 1518 | Ga0501272_003329 | 3300049769 | Unclassified | 1631 |
| 1519 | Ga0501272_031281 | 3300049769 | Bacteria | 677 |
| 1520 | Ga0501273_003524 | 3300049770 | Unclassified | 1667 |
| 1521 | Ga0501273_003954 | 3300049770 | Bacteria | 1603 |
| 1522 | Ga0501273_072765 | 3300049770 | Unclassified | 560 |
| 1523 | Ga0501279_014694 | 3300049775 | Bacteria | 1080 |
| 1524 | Ga0501279_022053 | 3300049775 | Bacteria | 912 |
| 1525 | Ga0501279_079571 | 3300049775 | Unclassified | 563 |
| 1526 | Ga0501282_027386 | 3300049778 | Unclassified | 644 |
| 1527 | Ga0501282_030952 | 3300049778 | Viruses | 613 |
| 1528 | Ga0501283_001419 | 3300049779 | Bacteria | 3120 |
| 1529 | Ga0501283_060345 | 3300049779 | Unclassified | 684 |
| 1530 | Ga0501200_01813 | 3300049849 | Unclassified | 843 |
| 1531 | Ga0501204_012812 | 3300049850 | Bacteria | 1011 |
| 1532 | Ga0501204_015760 | 3300049850 | Bacteria | 941 |
| 1533 | Ga0501204_017911 | 3300049850 | Bacteria | 901 |
| 1534 | Ga0501212_003935 | 3300049851 | Bacteria | 1890 |
| 1535 | Ga0501212_004876 | 3300049851 | Bacteria | 1750 |
| 1536 | Ga0501212_112833 | 3300049851 | Unclassified | 520 |
| 1537 | Ga0501226_000544 | 3300049853 | Bacteria | 5191 |
| 1538 | Ga0501226_006240 | 3300049853 | Unclassified | 1351 |
| 1539 | Ga0501226_006399 | 3300049853 | Unclassified | 1334 |
| 1540 | nmdc:mga05p37_1129131_c1 | 3300050507 | Unclassified | 818 |
| 1541 | nmdc:mga05p37_1359879_c1 | 3300050507 | Unclassified | 719 |
| 1542 | nmdc:mga05p37_1831209_c1 | 3300050507 | Bacteria | 584 |
| 1543 | nmdc:mga05p37_351269_c1 | 3300050507 | Bacteria | 1736 |
| 1544 | nmdc:mga05p37_504581_c1 | 3300050507 | Bacteria | 1387 |
| 1545 | nmdc:mga05p37_65136_c1 | 3300050507 | Bacteria | 4484 |
| 1546 | nmdc:mga05p37_672666_c1 | 3300050507 | Bacteria | 1155 |
| 1547 | nmdc:mga05p37_982361_c1 | 3300050507 | Bacteria | 899 |
| 1548 | nmdc:mga09592_121972_c1 | 3300050508 | Bacteria | 2239 |
| 1549 | nmdc:mga09592_1430098_c1 | 3300050508 | Bacteria | 565 |
| 1550 | nmdc:mga09592_1641612_c1 | 3300050508 | Unclassified | 520 |
| 1551 | nmdc:mga09592_539202_c1 | 3300050508 | Bacteria | 1003 |
| 1552 | nmdc:mga09592_57546_c1 | 3300050508 | Bacteria | 3286 |
| 1553 | nmdc:mga09592_799186_c1 | 3300050508 | Bacteria | 798 |
| 1554 | nmdc:mga0qj67_102600_c1 | 3300050509 | Bacteria | 2307 |
| 1555 | nmdc:mga0qj67_290008_c1 | 3300050509 | Bacteria | 1326 |
| 1556 | nmdc:mga06r32_1515427_c1 | 3300050510 | Bacteria | 610 |
| 1557 | nmdc:mga06r32_1864865_c1 | 3300050510 | Bacteria | 536 |
| 1558 | nmdc:mga06r32_304072_c1 | 3300050510 | Bacteria | 1581 |
| 1559 | nmdc:mga06r32_365984_c1 | 3300050510 | Bacteria | 1425 |
| 1560 | nmdc:mga06r32_451053_c1 | 3300050510 | Unclassified | 1266 |
| 1561 | nmdc:mga06r32_463071_c1 | 3300050510 | Bacteria | 1247 |
| 1562 | nmdc:mga06r32_923934_c1 | 3300050510 | Unclassified | 828 |
| 1563 | nmdc:mga08y16_13794_c1 | 3300050511 | Bacteria | 8504 |
| 1564 | nmdc:mga08y16_1449686_c1 | 3300050511 | Unclassified | 648 |
| 1565 | nmdc:mga08y16_1473233_c1 | 3300050511 | Unclassified | 642 |
| 1566 | nmdc:mga08y16_15928_c1 | 3300050511 | Bacteria | 7903 |
| 1567 | nmdc:mga08y16_3655_c1 | 3300050511 | Bacteria | 15997 |
| 1568 | nmdc:mga08y16_473637_c1 | 3300050511 | Unclassified | 1275 |
| 1569 | nmdc:mga08y16_70144_c1 | 3300050511 | Bacteria | 3653 |
| 1570 | nmdc:mga0n895_1308933_c1 | 3300050512 | Unclassified | 695 |
| 1571 | nmdc:mga0n895_1430135_c1 | 3300050512 | Bacteria | 659 |
| 1572 | nmdc:mga0n895_175069_c1 | 3300050512 | Bacteria | 2177 |
| 1573 | nmdc:mga0n895_2348_c1 | 3300050512 | Bacteria | 14747 |
| 1574 | nmdc:mga0n895_390244_c1 | 3300050512 | Unclassified | 1408 |
| 1575 | nmdc:mga0rr50_340302_c1 | 3300050513 | Bacteria | 1260 |
| 1576 | nmdc:mga0rr50_50385_c1 | 3300050513 | Bacteria | 3085 |
| 1577 | nmdc:mga0rr50_55_c1 | 3300050513 | Bacteria | 69116 |
| 1578 | nmdc:mga0rr50_827578_c1 | 3300050513 | Unclassified | 790 |
| 1579 | nmdc:mga0rr50_852928_c1 | 3300050513 | Bacteria | 777 |
| 1580 | nmdc:mga08x19_12_c1 | 3300050514 | Bacteria | 395395 |
| 1581 | nmdc:mga08x19_138782_c1 | 3300050514 | Bacteria | 1641 |
| 1582 | nmdc:mga08x19_442384_c1 | 3300050514 | Unclassified | 914 |
| 1583 | nmdc:mga0a205_1340761_c1 | 3300050515 | Bacteria | 563 |
| 1584 | nmdc:mga0a205_149622_c1 | 3300050515 | Bacteria | 2235 |
| 1585 | nmdc:mga0a205_21372_c1 | 3300050515 | Bacteria | 6123 |
| 1586 | nmdc:mga0a205_347572_c1 | 3300050515 | Unclassified | 1351 |
| 1587 | nmdc:mga0a205_383466_c1 | 3300050515 | Bacteria | 1270 |
| 1588 | nmdc:mga0a205_410603_c1 | 3300050515 | Bacteria | 1217 |
| 1589 | nmdc:mga0a205_522998_c1 | 3300050515 | Bacteria | 1043 |
| 1590 | nmdc:mga0a205_728520_c1 | 3300050515 | Bacteria | 841 |
| 1591 | nmdc:mga0a205_803134_c1 | 3300050515 | Bacteria | 789 |
| 1592 | nmdc:mga0a205_902153_c1 | 3300050515 | Bacteria | 731 |
| 1593 | Ga0530510_1235318 | 3300061734 | Bacteria | 573 |
| 1594 | Ga0070702_100521761 | |||
| 1595 | MRS2a_Contig_11610 | |||
| 1596 | SwRhRL3b_contig_1296301 | |||
| 1597 | SwRhRL3b_contig_2608105 | |||
| 1598 | SwRhRL3b_contig_3931003 | |||
| 1599 | MBSR1b_contig_5607604 | |||
| 1600 | CNAas_1000004 | |||
| 1601 | JGI24034J26672_10000002 | |||
| 1602 | JGI24742J22300_10007517 | |||
| 1603 | JGI24751J29686_10000017 | |||
| 1604 | JGI24751J29686_10000149 | |||
| 1605 | JGI25406J46586_10014972 | |||
| 1606 | JGI25406J46586_10015093 | |||
| 1607 | JGI25406J46586_10056700 | |||
| 1608 | rootH2_10239322 | |||
| 1609 | rootL2_10089685 | |||
| 1610 | Ga0058859_11445007 | |||
| 1611 | Ga0058860_12182722 | |||
| 1612 | Ga0065714_10064460 | |||
| 1613 | Ga0065704_10011042 | |||
| 1614 | Ga0065704_10083950 | |||
| 1615 | Ga0065704_10118959 | |||
| 1616 | Ga0065704_10300358 | |||
| 1617 | Ga0065704_10375249 | |||
| 1618 | Ga0065704_10509140 | |||
| 1619 | Ga0065712_10068069 | |||
| 1620 | Ga0065712_10072987 | |||
| 1621 | Ga0065712_10186778 | |||
| 1622 | Ga0065712_10189659 | |||
| 1623 | Ga0065712_10541569 | |||
| 1624 | Ga0065712_10633265 | |||
| 1625 | Ga0065712_10758371 | |||
| 1626 | Ga0065712_10762445 | |||
| 1627 | Ga0065712_10807805 | |||
| 1628 | Ga0065715_10089839 | |||
| 1629 | Ga0065715_10095392 | |||
| 1630 | Ga0065715_10107731 | |||
| 1631 | Ga0065715_10117551 | |||
| 1632 | Ga0065715_10131647 | |||
| 1633 | Ga0065715_10148470 | |||
| 1634 | Ga0065715_10237332 | |||
| 1635 | Ga0065715_10306895 | |||
| 1636 | Ga0065715_10344726 | |||
| 1637 | Ga0065715_10651527 | |||
| 1638 | Ga0065715_10765313 | |||
| 1639 | Ga0065715_10823858 | |||
| 1640 | Ga0065715_11082937 | |||
| 1641 | Ga0065707_10010856 | |||
| 1642 | Ga0065707_10201680 | |||
| 1643 | Ga0065707_10235308 | |||
| 1644 | Ga0065707_10294041 | |||
| 1645 | Ga0065707_10335170 | |||
| 1646 | Ga0065707_10519932 | |||
| 1647 | Ga0065707_10529747 | |||
| 1648 | Ga0065707_10658809 | |||
| 1649 | Ga0070676_10032637 | |||
| 1650 | Ga0070676_10243604 | |||
| 1651 | Ga0070676_10358790 | |||
| 1652 | Ga0070676_11021682 | |||
| 1653 | Ga0070676_11144689 | |||
| 1654 | Ga0070683_100151571 | |||
| 1655 | Ga0070690_100001046 | |||
| 1656 | Ga0070690_100037425 | |||
| 1657 | Ga0070690_100173822 | |||
| 1658 | Ga0070690_100188166 | |||
| 1659 | Ga0070690_100189860 | |||
| 1660 | Ga0070690_100958731 | |||
| 1661 | Ga0070690_101543130 | |||
| 1662 | Ga0070670_100005375 | |||
| 1663 | Ga0070670_100039124 | |||
| 1664 | Ga0070670_100085719 | |||
| 1665 | Ga0070670_100270379 | |||
| 1666 | Ga0070670_100339090 | |||
| 1667 | Ga0070670_100351613 | |||
| 1668 | Ga0070670_100351694 | |||
| 1669 | Ga0070670_100360744 | |||
| 1670 | Ga0070670_100737455 | |||
| 1671 | Ga0070670_100830129 | |||
| 1672 | Ga0070670_101506894 | |||
| 1673 | Ga0070677_10314608 | |||
| 1674 | Ga0070677_10665447 | |||
| 1675 | Ga0070677_10852453 | |||
| 1676 | Ga0068869_100007551 | |||
| 1677 | Ga0068869_100024467 | |||
| 1678 | Ga0068869_100049836 | |||
| 1679 | Ga0068869_100194191 | |||
| 1680 | Ga0068869_100223963 | |||
| 1681 | Ga0068869_100278987 | |||
| 1682 | Ga0068869_100280994 | |||
| 1683 | Ga0068869_100443435 | |||
| 1684 | Ga0068869_100705214 | |||
| 1685 | Ga0068869_100871428 | |||
| 1686 | Ga0068869_101208385 | |||
| 1687 | Ga0068869_101566084 | |||
| 1688 | Ga0068869_101705336 | |||
| 1689 | Ga0070666_10179611 | |||
| 1690 | Ga0070666_10743424 | |||
| 1691 | Ga0070680_100013569 | |||
| 1692 | Ga0070680_100057291 | |||
| 1693 | Ga0070680_100166982 | |||
| 1694 | Ga0070680_100169415 | |||
| 1695 | Ga0070680_100493796 | |||
| 1696 | Ga0070680_101726647 | |||
| 1697 | Ga0070682_100093931 | |||
| 1698 | Ga0070682_100290157 | |||
| 1699 | Ga0068868_100007808 | |||
| 1700 | Ga0068868_100415580 | |||
| 1701 | Ga0068868_100640344 | |||
| 1702 | Ga0068868_100942934 | |||
| 1703 | Ga0068868_100982438 | |||
| 1704 | Ga0070660_101673088 | |||
| 1705 | Ga0070689_100002993 | |||
| 1706 | Ga0070689_100096060 | |||
| 1707 | Ga0070689_100165309 | |||
| 1708 | Ga0070689_100169227 | |||
| 1709 | Ga0070689_100180065 | |||
| 1710 | Ga0070689_100189932 | |||
| 1711 | Ga0070689_100303314 | |||
| 1712 | Ga0070689_100930094 | |||
| 1713 | Ga0070689_102164220 | |||
| 1714 | Ga0070691_10070020 | |||
| 1715 | Ga0070691_10178249 | |||
| 1716 | Ga0070691_10415664 | |||
| 1717 | Ga0070687_100014088 | |||
| 1718 | Ga0070687_100023965 | |||
| 1719 | Ga0070687_100083621 | |||
| 1720 | Ga0070687_100190456 | |||
| 1721 | Ga0070687_100198919 | |||
| 1722 | Ga0070687_100302197 | |||
| 1723 | Ga0070687_100502200 | |||
| 1724 | Ga0070687_101401304 | |||
| 1725 | Ga0070661_100239167 | |||
| 1726 | Ga0070661_100867558 | |||
| 1727 | Ga0070692_10010290 | |||
| 1728 | Ga0070692_10102794 | |||
| 1729 | Ga0070692_10171622 | |||
| 1730 | Ga0070692_10339714 | |||
| 1731 | Ga0070692_10397043 | |||
| 1732 | Ga0070692_10399291 | |||
| 1733 | Ga0070692_10623561 | |||
| 1734 | Ga0070692_10678020 | |||
| 1735 | Ga0070692_10756924 | |||
| 1736 | Ga0070692_11128043 | |||
| 1737 | Ga0070692_11427125 | |||
| 1738 | Ga0070669_100002230 | |||
| 1739 | Ga0070669_100010477 | |||
| 1740 | Ga0070669_100113959 | |||
| 1741 | Ga0070669_100459268 | |||
| 1742 | Ga0070669_100680061 | |||
| 1743 | Ga0070669_101300527 | |||
| 1744 | Ga0070675_100228755 | |||
| 1745 | Ga0070675_100312349 | |||
| 1746 | Ga0070675_100475415 | |||
| 1747 | Ga0070675_100748491 | |||
| 1748 | Ga0070675_100862853 | |||
| 1749 | Ga0070675_101828494 | |||
| 1750 | Ga0070671_100002480 | |||
| 1751 | Ga0070671_100045419 | |||
| 1752 | Ga0070671_100114238 | |||
| 1753 | Ga0070671_100851201 | |||
| 1754 | Ga0070671_101064418 | |||
| 1755 | Ga0070674_100516308 | |||
| 1756 | Ga0070674_100577257 | |||
| 1757 | Ga0070673_100012429 | |||
| 1758 | Ga0070673_100029869 | |||
| 1759 | Ga0070673_100049169 | |||
| 1760 | Ga0070673_100105087 | |||
| 1761 | Ga0070673_100411888 | |||
| 1762 | Ga0070673_100788027 | |||
| 1763 | Ga0070673_100959241 | |||
| 1764 | Ga0070673_101015646 | |||
| 1765 | Ga0070673_101064959 | |||
| 1766 | Ga0070673_101612314 | |||
| 1767 | Ga0070673_101864297 | |||
| 1768 | Ga0070673_102076273 | |||
| 1769 | Ga0070688_100015368 | |||
| 1770 | Ga0070688_100487162 | |||
| 1771 | Ga0070688_100711450 | |||
| 1772 | Ga0070688_100895556 | |||
| 1773 | Ga0070688_101170034 | |||
| 1774 | Ga0070688_101754273 | |||
| 1775 | Ga0070659_100039290 | |||
| 1776 | Ga0070659_100128321 | |||
| 1777 | Ga0070659_100690065 | |||
| 1778 | Ga0070667_100021151 | |||
| 1779 | Ga0070667_100163170 | |||
| 1780 | Ga0070667_100965162 | |||
| 1781 | Ga0070667_101109108 | |||
| 1782 | Ga0070667_101760522 | |||
| 1783 | Ga0070703_10000081 | |||
| 1784 | Ga0070703_10015244 | |||
| 1785 | Ga0070703_10299019 | |||
| 1786 | Ga0070703_10415488 | |||
| 1787 | Ga0070703_10586856 | |||
| 1788 | Ga0070709_10332763 | |||
| 1789 | Ga0070701_10008309 | |||
| 1790 | Ga0070701_10014106 | |||
| 1791 | Ga0070701_10024681 | |||
| 1792 | Ga0070701_10053852 | |||
| 1793 | Ga0070701_10065518 | |||
| 1794 | Ga0070701_10065613 | |||
| 1795 | Ga0070701_10612105 | |||
| 1796 | Ga0070701_10963315 | |||
| 1797 | Ga0070711_101694197 | |||
| 1798 | Ga0070705_100080171 | |||
| 1799 | Ga0070705_100117897 | |||
| 1800 | Ga0070705_100234958 | |||
| 1801 | Ga0070705_100332245 | |||
| 1802 | Ga0070705_100385252 | |||
| 1803 | Ga0070705_100805526 | |||
| 1804 | Ga0070705_101072543 | |||
| 1805 | Ga0070705_101781812 | |||
| 1806 | Ga0070700_100000964 | |||
| 1807 | Ga0070700_100034359 | |||
| 1808 | Ga0070700_100056426 | |||
| 1809 | Ga0070700_100157664 | |||
| 1810 | Ga0070700_100161480 | |||
| 1811 | Ga0070700_100757436 | |||
| 1812 | Ga0070694_100000264 | |||
| 1813 | Ga0070694_100025104 | |||
| 1814 | Ga0070694_100035884 | |||
| 1815 | Ga0070694_100058270 | |||
| 1816 | Ga0070694_100123883 | |||
| 1817 | Ga0070694_100147570 | |||
| 1818 | Ga0070694_100184431 | |||
| 1819 | Ga0070694_100185495 | |||
| 1820 | Ga0070694_100247167 | |||
| 1821 | Ga0070694_100258289 | |||
| 1822 | Ga0070694_100294498 | |||
| 1823 | Ga0070694_100310204 | |||
| 1824 | Ga0070694_100361215 | |||
| 1825 | Ga0070694_100609897 | |||
| 1826 | Ga0070694_100737723 | |||
| 1827 | Ga0070694_100796830 | |||
| 1828 | Ga0070694_100817290 | |||
| 1829 | Ga0070694_100827429 | |||
| 1830 | Ga0070694_100859917 | |||
| 1831 | Ga0070694_100993926 | |||
| 1832 | Ga0070694_101140415 | |||
| 1833 | Ga0070694_101296620 | |||
| 1834 | Ga0070694_101313669 | |||
| 1835 | Ga0070694_101803010 | |||
| 1836 | Ga0070694_101959337 | |||
| 1837 | Ga0070708_100000508 | |||
| 1838 | Ga0070708_100033345 | |||
| 1839 | Ga0070708_100153039 | |||
| 1840 | Ga0070708_100253976 | |||
| 1841 | Ga0070708_100280968 | |||
| 1842 | Ga0070708_100457801 | |||
| 1843 | Ga0070708_100508299 | |||
| 1844 | Ga0070708_100678611 | |||
| 1845 | Ga0070708_101019249 | |||
| 1846 | Ga0070708_101091246 | |||
| 1847 | Ga0070678_100102215 | |||
| 1848 | Ga0070678_101256349 | |||
| 1849 | Ga0070662_100085451 | |||
| 1850 | Ga0070662_100275963 | |||
| 1851 | Ga0070662_100290873 | |||
| 1852 | Ga0070662_100352717 | |||
| 1853 | Ga0070662_100889246 | |||
| 1854 | Ga0070681_10000489 | |||
| 1855 | Ga0070681_10046425 | |||
| 1856 | Ga0070681_10047995 | |||
| 1857 | Ga0070681_10072586 | |||
| 1858 | Ga0070681_10231787 | |||
| 1859 | Ga0070681_10758840 | |||
| 1860 | Ga0068867_100014896 | |||
| 1861 | Ga0068867_100110352 | |||
| 1862 | Ga0068867_100282674 | |||
| 1863 | Ga0068867_100300247 | |||
| 1864 | Ga0068867_100331315 | |||
| 1865 | Ga0068867_100461314 | |||
| 1866 | Ga0068867_100518630 | |||
| 1867 | Ga0068867_100588590 | |||
| 1868 | Ga0068867_100780902 | |||
| 1869 | Ga0068867_101250038 | |||
| 1870 | Ga0068867_101374698 | |||
| 1871 | Ga0068867_101725079 | |||
| 1872 | Ga0068867_101849831 | |||
| 1873 | Ga0068867_102021214 | |||
| 1874 | Ga0070685_10007677 | |||
| 1875 | Ga0070685_11459654 | |||
| 1876 | Ga0070685_11487242 | |||
| 1877 | Ga0070706_100000088 | |||
| 1878 | Ga0070706_100009738 | |||
| 1879 | Ga0070706_100053420 | |||
| 1880 | Ga0070706_100070901 | |||
| 1881 | Ga0070706_100201747 | |||
| 1882 | Ga0070706_100993211 | |||
| 1883 | Ga0070707_100004499 | |||
| 1884 | Ga0070707_100116288 | |||
| 1885 | Ga0070707_100199261 | |||
| 1886 | Ga0070707_100199754 | |||
| 1887 | Ga0070707_100531602 | |||
| 1888 | Ga0070707_100650494 | |||
| 1889 | Ga0070707_101600686 | |||
| 1890 | Ga0070698_100002826 | |||
| 1891 | Ga0070698_100027844 | |||
| 1892 | Ga0070698_100031002 | |||
| 1893 | Ga0070698_100212505 | |||
| 1894 | Ga0070698_100339850 | |||
| 1895 | Ga0070698_100462162 | |||
| 1896 | Ga0070698_100585001 | |||
| 1897 | Ga0070699_100001427 | |||
| 1898 | Ga0070699_100017437 | |||
| 1899 | Ga0070699_100018214 | |||
| 1900 | Ga0070699_100020141 | |||
| 1901 | Ga0070699_100048311 | |||
| 1902 | Ga0070699_100167940 | |||
| 1903 | Ga0070699_100204447 | |||
| 1904 | Ga0070699_100206751 | |||
| 1905 | Ga0070699_100251603 | |||
| 1906 | Ga0070699_100657007 | |||
| 1907 | Ga0070699_101057025 | |||
| 1908 | Ga0070699_101317388 | |||
| 1909 | Ga0070699_101338864 | |||
| 1910 | Ga0070699_101427985 | |||
| 1911 | Ga0070699_101752523 | |||
| 1912 | Ga0070699_101811469 | |||
| 1913 | Ga0070679_100000604 | |||
| 1914 | Ga0070679_100054518 | |||
| 1915 | Ga0070679_100143251 | |||
| 1916 | Ga0070679_100919273 | |||
| 1917 | Ga0070684_101378791 | |||
| 1918 | Ga0070697_100000112 | |||
| 1919 | Ga0070697_100009364 | |||
| 1920 | Ga0070697_100116504 | |||
| 1921 | Ga0070697_100162734 | |||
| 1922 | Ga0070697_100192559 | |||
| 1923 | Ga0070697_100277985 | |||
| 1924 | Ga0070697_100465713 | |||
| 1925 | Ga0070697_100758312 | |||
| 1926 | Ga0070697_100976156 | |||
| 1927 | Ga0070697_101452268 | |||
| 1928 | Ga0068853_100075885 | |||
| 1929 | Ga0068853_100104662 | |||
| 1930 | Ga0068853_100269207 | |||
| 1931 | Ga0068853_100738906 | |||
| 1932 | Ga0068853_100952320 | |||
| 1933 | Ga0068853_101171820 | |||
| 1934 | Ga0070672_100047637 | |||
| 1935 | Ga0070672_100627693 | |||
| 1936 | Ga0070672_100914567 | |||
| 1937 | Ga0070686_100001026 | |||
| 1938 | Ga0070686_100013004 | |||
| 1939 | Ga0070686_100043948 | |||
| 1940 | Ga0070686_100056067 | |||
| 1941 | Ga0070686_100115294 | |||
| 1942 | Ga0070686_100596776 | |||
| 1943 | Ga0070686_101208605 | |||
| 1944 | Ga0070695_100020677 | |||
| 1945 | Ga0070695_100134413 | |||
| 1946 | Ga0070695_100154646 | |||
| 1947 | Ga0070695_100166176 | |||
| 1948 | Ga0070695_100188451 | |||
| 1949 | Ga0070695_100192513 | |||
| 1950 | Ga0070695_100225368 | |||
| 1951 | Ga0070695_100249585 | |||
| 1952 | Ga0070695_100531833 | |||
| 1953 | Ga0070695_100867899 | |||
| 1954 | Ga0070695_100871784 | |||
| 1955 | Ga0070695_101017137 | |||
| 1956 | Ga0070695_101815543 | |||
| 1957 | Ga0070696_100074135 | |||
| 1958 | Ga0070696_100098863 | |||
| 1959 | Ga0070696_100184570 | |||
| 1960 | Ga0070696_100218636 | |||
| 1961 | Ga0070696_100231303 | |||
| 1962 | Ga0070696_100270652 | |||
| 1963 | Ga0070696_100283287 | |||
| 1964 | Ga0070696_100305985 | |||
| 1965 | Ga0070696_100581649 | |||
| 1966 | Ga0070696_100677513 | |||
| 1967 | Ga0070696_101050765 | |||
| 1968 | Ga0070696_101185964 | |||
| 1969 | Ga0070696_101249926 | |||
| 1970 | Ga0070696_101290387 | |||
| 1971 | Ga0070696_101383130 | |||
| 1972 | Ga0070696_101383131 | |||
| 1973 | Ga0070693_100004578 | |||
| 1974 | Ga0070693_100083470 | |||
| 1975 | Ga0070693_100171149 | |||
| 1976 | Ga0070693_100421192 | |||
| 1977 | Ga0070693_100515140 | |||
| 1978 | Ga0070693_100694380 | |||
| 1979 | Ga0070693_100703635 | |||
| 1980 | Ga0070693_100738564 | |||
| 1981 | Ga0070693_100913465 | |||
| 1982 | Ga0070693_100935787 | |||
| 1983 | Ga0070693_101350213 | |||
| 1984 | Ga0070665_100326918 | |||
| 1985 | Ga0070665_100771023 | |||
| 1986 | Ga0070665_101020989 | |||
| 1987 | Ga0070704_100037629 | |||
| 1988 | Ga0070704_100048892 | |||
| 1989 | Ga0070704_100072040 | |||
| 1990 | Ga0070704_100110677 | |||
| 1991 | Ga0070704_100478727 | |||
| 1992 | Ga0070704_100544559 | |||
| 1993 | Ga0070704_100634299 | |||
| 1994 | Ga0070704_100636089 | |||
| 1995 | Ga0070704_100647101 | |||
| 1996 | Ga0070704_100717129 | |||
| 1997 | Ga0070704_100980118 | |||
| 1998 | Ga0070704_101331179 | |||
| 1999 | Ga0070704_101673133 | |||
| 2000 | Ga0068855_102087414 | |||
| 2001 | Ga0068855_102571540 | |||
| 2002 | Ga0070664_100003375 | |||
| 2003 | Ga0070664_100176818 | |||
| 2004 | Ga0070664_100296261 | |||
| 2005 | Ga0070664_100501036 | |||
| 2006 | Ga0070664_101290088 | |||
| 2007 | Ga0068857_100012945 | |||
| 2008 | Ga0068857_100113116 | |||
| 2009 | Ga0068857_100131800 | |||
| 2010 | Ga0068857_100273159 | |||
| 2011 | Ga0068857_100511241 | |||
| 2012 | Ga0068857_100775027 | |||
| 2013 | Ga0068857_100960290 | |||
| 2014 | Ga0068857_100975833 | |||
| 2015 | Ga0068857_100982123 | |||
| 2016 | Ga0068857_101423396 | |||
| 2017 | Ga0068857_101865428 | |||
| 2018 | Ga0068854_100222624 | |||
| 2019 | Ga0068854_100236070 | |||
| 2020 | Ga0068854_100295186 | |||
| 2021 | Ga0068854_100306412 | |||
| 2022 | Ga0068854_100398256 | |||
| 2023 | Ga0068854_100440219 | |||
| 2024 | Ga0068854_100628560 | |||
| 2025 | Ga0068854_100917510 | |||
| 2026 | Ga0068854_101578648 | |||
| 2027 | Ga0068854_101619442 | |||
| 2028 | Ga0068854_102268413 | |||
| 2029 | Ga0068856_100369411 | |||
| 2030 | Ga0068856_100546242 | |||
| 2031 | Ga0068856_100936536 | |||
| 2032 | Ga0068856_101288561 | |||
| 2033 | Ga0068856_102209051 | |||
| 2034 | Ga0070702_100054597 | |||
| 2035 | Ga0070702_100060215 | |||
| 2036 | Ga0070702_100139589 | |||
| 2037 | Ga0070702_100208162 | |||
| 2038 | Ga0070702_100291641 | |||
| 2039 | Ga0070702_100348747 | |||
| 2040 | Ga0070702_100568749 | |||
| 2041 | Ga0070702_100584046 | |||
| 2042 | Ga0070702_100796104 | |||
| 2043 | Ga0070702_100897417 | |||
| 2044 | Ga0070702_100921342 | |||
| 2045 | Ga0070702_100952270 | |||
| 2046 | Ga0070702_101817593 | |||
| 2047 | Ga0068852_100235114 | |||
| 2048 | Ga0068852_100427088 | |||
| 2049 | Ga0068852_101010790 | |||
| 2050 | Ga0068852_101715179 | |||
| 2051 | Ga0068852_102859879 | |||
| 2052 | Ga0068859_100002739 | |||
| 2053 | Ga0068859_100004457 | |||
| 2054 | Ga0068859_100012082 | |||
| 2055 | Ga0068859_100015155 | |||
| 2056 | Ga0068859_100046093 | |||
| 2057 | Ga0068859_100093048 | |||
| 2058 | Ga0068859_100110623 | |||
| 2059 | Ga0068859_100121851 | |||
| 2060 | Ga0068859_100138053 | |||
| 2061 | Ga0068859_100262271 | |||
| 2062 | Ga0068859_100283215 | |||
| 2063 | Ga0068859_100379771 | |||
| 2064 | Ga0068859_100552870 | |||
| 2065 | Ga0068859_100557490 | |||
| 2066 | Ga0068859_100637466 | |||
| 2067 | Ga0068859_100665811 | |||
| 2068 | Ga0068859_100682432 | |||
| 2069 | Ga0068859_100830421 | |||
| 2070 | Ga0068859_100863086 | |||
| 2071 | Ga0068859_100991537 | |||
| 2072 | Ga0068859_101972354 | |||
| 2073 | Ga0068859_102219544 | |||
| 2074 | Ga0068859_102284608 | |||
| 2075 | Ga0068859_102365219 | |||
| 2076 | Ga0068864_100001530 | |||
| 2077 | Ga0068864_100020573 | |||
| 2078 | Ga0068864_100042336 | |||
| 2079 | Ga0068864_100065888 | |||
| 2080 | Ga0068864_100124254 | |||
| 2081 | Ga0068864_100169193 | |||
| 2082 | Ga0068864_100187029 | |||
| 2083 | Ga0068864_100196096 | |||
| 2084 | Ga0068864_100257797 | |||
| 2085 | Ga0068864_100380687 | |||
| 2086 | Ga0068864_100519754 | |||
| 2087 | Ga0068864_100740898 | |||
| 2088 | Ga0068864_101352784 | |||
| 2089 | Ga0068864_101557328 | |||
| 2090 | Ga0068864_101927195 | |||
| 2091 | Ga0068864_102625498 | |||
| 2092 | Ga0068866_10020829 | |||
| 2093 | Ga0068866_10109457 | |||
| 2094 | Ga0068866_10486520 | |||
| 2095 | Ga0068861_100017567 | |||
| 2096 | Ga0068861_100033929 | |||
| 2097 | Ga0068861_100050519 | |||
| 2098 | Ga0068861_100091114 | |||
| 2099 | Ga0068861_100127543 | |||
| 2100 | Ga0068861_100143940 | |||
| 2101 | Ga0068861_100324439 | |||
| 2102 | Ga0068861_100505420 | |||
| 2103 | Ga0068861_100531612 | |||
| 2104 | Ga0068861_100585506 | |||
| 2105 | Ga0068861_100659592 | |||
| 2106 | Ga0068861_101184665 | |||
| 2107 | Ga0068861_101537536 | |||
| 2108 | Ga0068861_101747340 | |||
| 2109 | Ga0068861_102178462 | |||
| 2110 | Ga0068861_102492523 | |||
| 2111 | Ga0068851_11039033 | |||
| 2112 | Ga0068870_10008350 | |||
| 2113 | Ga0068870_10027938 | |||
| 2114 | Ga0068870_10057964 | |||
| 2115 | Ga0068870_10179502 | |||
| 2116 | Ga0068870_10354242 | |||
| 2117 | Ga0068870_10560422 | |||
| 2118 | Ga0068870_10623170 | |||
| 2119 | Ga0068870_10738148 | |||
| 2120 | Ga0068870_10840626 | |||
| 2121 | Ga0068863_100018044 | |||
| 2122 | Ga0068863_100128325 | |||
| 2123 | Ga0068863_100242354 | |||
| 2124 | Ga0068863_100483801 | |||
| 2125 | Ga0068863_100536414 | |||
| 2126 | Ga0068863_100800482 | |||
| 2127 | Ga0068863_100915019 | |||
| 2128 | Ga0068863_101166831 | |||
| 2129 | Ga0068863_101270606 | |||
| 2130 | Ga0068863_101445779 | |||
| 2131 | Ga0068863_101716145 | |||
| 2132 | Ga0068858_100000227 | |||
| 2133 | Ga0068858_100123442 | |||
| 2134 | Ga0068858_100127098 | |||
| 2135 | Ga0068858_100185364 | |||
| 2136 | Ga0068858_100315530 | |||
| 2137 | Ga0068858_100330592 | |||
| 2138 | Ga0068858_100370918 | |||
| 2139 | Ga0068858_100418693 | |||
| 2140 | Ga0068858_100444019 | |||
| 2141 | Ga0068858_100456053 | |||
| 2142 | Ga0068858_100492143 | |||
| 2143 | Ga0068858_101210707 | |||
| 2144 | Ga0068860_100004210 | |||
| 2145 | Ga0068860_100034116 | |||
| 2146 | Ga0068860_100053875 | |||
| 2147 | Ga0068860_100072351 | |||
| 2148 | Ga0068860_100079833 | |||
| 2149 | Ga0068860_100114891 | |||
| 2150 | Ga0068860_100177474 | |||
| 2151 | Ga0068860_100193004 | |||
| 2152 | Ga0068860_100273083 | |||
| 2153 | Ga0068860_100388220 | |||
| 2154 | Ga0068860_100405958 | |||
| 2155 | Ga0068860_101038929 | |||
| 2156 | Ga0068860_101059866 | |||
| 2157 | Ga0068860_101195298 | |||
| 2158 | Ga0068860_101308113 | |||
| 2159 | Ga0068860_101438552 | |||
| 2160 | Ga0068860_101791275 | |||
| 2161 | Ga0068862_100007975 | |||
| 2162 | Ga0068862_100019794 | |||
| 2163 | Ga0068862_100036723 | |||
| 2164 | Ga0068862_100075730 | |||
| 2165 | Ga0068862_100076530 | |||
| 2166 | Ga0068862_100093042 | |||
| 2167 | Ga0068862_100111498 | |||
| 2168 | Ga0068862_100129213 | |||
| 2169 | Ga0068862_100260238 | |||
| 2170 | Ga0068862_100398128 | |||
| 2171 | Ga0068862_100461823 | |||
| 2172 | Ga0068862_101429284 | |||
| 2173 | Ga0081539_10000043 | |||
| 2174 | Ga0081539_10000851 | |||
| 2175 | Ga0081539_10001474 | |||
| 2176 | Ga0081539_10005869 | |||
| 2177 | Ga0081539_10085004 | |||
| 2178 | Ga0081539_10114976 | |||
| 2179 | Ga0070715_10000007 | |||
| 2180 | Ga0070716_100000007 | |||
| 2181 | Ga0070716_100112996 | |||
| 2182 | Ga0070716_100292811 | |||
| 2183 | Ga0070716_100454963 | |||
| 2184 | Ga0070716_101472838 | |||
| 2185 | Ga0070716_101490476 | |||
| 2186 | Ga0097621_100081069 | |||
| 2187 | Ga0097621_100088346 | |||
| 2188 | Ga0097621_100152573 | |||
| 2189 | Ga0097621_100162804 | |||
| 2190 | Ga0097621_100522547 | |||
| 2191 | Ga0097621_100801102 | |||
| 2192 | Ga0097621_102401019 | |||
| 2193 | Ga0068871_100006022 | |||
| 2194 | Ga0068871_100015503 | |||
| 2195 | Ga0068871_100028784 | |||
| 2196 | Ga0068871_100104621 | |||
| 2197 | Ga0068871_101119555 | |||
| 2198 | Ga0075428_100136086 | |||
| 2199 | Ga0075428_100857025 | |||
| 2200 | Ga0075428_101253559 | |||
| 2201 | Ga0075430_100037954 | |||
| 2202 | Ga0075430_100360466 | |||
| 2203 | Ga0075430_101239324 | |||
| 2204 | Ga0075431_100064005 | |||
| 2205 | Ga0075431_100131761 | |||
| 2206 | Ga0075431_100451990 | |||
| 2207 | Ga0075431_100498545 | |||
| 2208 | Ga0075431_101736912 | |||
| 2209 | Ga0075433_10020255 | |||
| 2210 | Ga0075433_10020844 | |||
| 2211 | Ga0075433_10022972 | |||
| 2212 | Ga0075433_10416613 | |||
| 2213 | Ga0075433_10965815 | |||
| 2214 | Ga0075433_11062446 | |||
| 2215 | Ga0075433_11124778 | |||
| 2216 | Ga0075433_11142763 | |||
| 2217 | Ga0075433_11928193 | |||
| 2218 | Ga0075434_100032647 | |||
| 2219 | Ga0075434_100081851 | |||
| 2220 | Ga0075434_100134853 | |||
| 2221 | Ga0075434_100150631 | |||
| 2222 | Ga0075434_100417145 | |||
| 2223 | Ga0075434_101484527 | |||
| 2224 | Ga0075434_101727709 | |||
| 2225 | Ga0075429_100004845 | |||
| 2226 | Ga0075429_100072291 | |||
| 2227 | Ga0075429_100109852 | |||
| 2228 | Ga0075429_100224296 | |||
| 2229 | Ga0075429_100647729 | |||
| 2230 | Ga0075429_100946019 | |||
| 2231 | Ga0068865_100130776 | |||
| 2232 | Ga0068865_100323889 | |||
| 2233 | Ga0068865_100809230 | |||
| 2234 | Ga0068865_101592075 | |||
| 2235 | Ga0075436_100000018 | |||
| 2236 | Ga0075436_100041994 | |||
| 2237 | Ga0075436_100535602 | |||
| 2238 | Ga0097620_100002739 | |||
| 2239 | Ga0097620_100004457 | |||
| 2240 | Ga0097620_100012083 | |||
| 2241 | Ga0097620_100015156 | |||
| 2242 | Ga0097620_100046093 | |||
| 2243 | Ga0097620_100093051 | |||
| 2244 | Ga0097620_100110619 | |||
| 2245 | Ga0097620_100121856 | |||
| 2246 | Ga0097620_100138047 | |||
| 2247 | Ga0097620_100262260 | |||
| 2248 | Ga0097620_100283230 | |||
| 2249 | Ga0097620_100379749 | |||
| 2250 | Ga0097620_100552878 | |||
| 2251 | Ga0097620_100557553 | |||
| 2252 | Ga0097620_100637463 | |||
| 2253 | Ga0097620_100665819 | |||
| 2254 | Ga0097620_100682453 | |||
| 2255 | Ga0097620_100830456 | |||
| 2256 | Ga0097620_100863126 | |||
| 2257 | Ga0097620_100991515 | |||
| 2258 | Ga0097620_101972312 | |||
| 2259 | Ga0097620_102219349 | |||
| 2260 | Ga0097620_102284651 | |||
| 2261 | Ga0097620_102365137 | |||
| 2262 | Ga0075435_100000359 | |||
| 2263 | Ga0075435_100003678 | |||
| 2264 | Ga0075435_100117894 | |||
| 2265 | Ga0075435_100667224 | |||
| 2266 | Ga0075435_100908894 | |||
| 2267 | Ga0075435_101134427 | |||
| 2268 | Ga0099794_10004255 | |||
| 2269 | Ga0099794_10209875 | |||
| 2270 | Ga0099794_10378354 | |||
| 2271 | Ga0099794_10704353 | |||
| 2272 | Ga0105251_10140108 | |||
| 2273 | Ga0105251_10145842 | |||
| 2274 | Ga0105251_10368478 | |||
| 2275 | Ga0105250_10548024 | |||
| 2276 | Ga0105240_10195833 | |||
| 2277 | Ga0105240_10988408 | |||
| 2278 | Ga0105240_11684628 | |||
| 2279 | Ga0111539_10004262 | |||
| 2280 | Ga0111539_10012727 | |||
| 2281 | Ga0111539_10024482 | |||
| 2282 | Ga0111539_10091295 | |||
| 2283 | Ga0111539_10300357 | |||
| 2284 | Ga0111539_10531773 | |||
| 2285 | Ga0111539_10794095 | |||
| 2286 | Ga0111539_10903829 | |||
| 2287 | Ga0111539_11342174 | |||
| 2288 | Ga0105245_10024756 | |||
| 2289 | Ga0105245_10457960 | |||
| 2290 | Ga0105245_12479219 | |||
| 2291 | Ga0105247_10000001 | |||
| 2292 | Ga0105247_10089947 | |||
| 2293 | Ga0105247_10191004 | |||
| 2294 | Ga0105247_10208493 | |||
| 2295 | Ga0105247_10383210 | |||
| 2296 | Ga0105247_10484965 | |||
| 2297 | Ga0105247_10641300 | |||
| 2298 | Ga0105247_10743641 | |||
| 2299 | Ga0114129_10030857 | |||
| 2300 | Ga0114129_10055247 | |||
| 2301 | Ga0114129_10063314 | |||
| 2302 | Ga0114129_10103825 | |||
| 2303 | Ga0114129_10208718 | |||
| 2304 | Ga0114129_10354022 | |||
| 2305 | Ga0114129_10715081 | |||
| 2306 | Ga0114129_10747559 | |||
| 2307 | Ga0114129_10848454 | |||
| 2308 | Ga0114129_10978988 | |||
| 2309 | Ga0114129_11286196 | |||
| 2310 | Ga0114129_11317362 | |||
| 2311 | Ga0114129_12257170 | |||
| 2312 | Ga0114129_12390948 | |||
| 2313 | Ga0105243_10000024 | |||
| 2314 | Ga0105243_10048260 | |||
| 2315 | Ga0105243_10068303 | |||
| 2316 | Ga0105243_10086783 | |||
| 2317 | Ga0105243_10133790 | |||
| 2318 | Ga0105243_10284964 | |||
| 2319 | Ga0105243_10295494 | |||
| 2320 | Ga0105243_10360634 | |||
| 2321 | Ga0105243_10383972 | |||
| 2322 | Ga0105243_10418900 | |||
| 2323 | Ga0105243_10540840 | |||
| 2324 | Ga0105243_10764478 | |||
| 2325 | Ga0105243_10766658 | |||
| 2326 | Ga0105243_10772027 | |||
| 2327 | Ga0105243_11594481 | |||
| 2328 | Ga0105241_10019047 | |||
| 2329 | Ga0105241_10040109 | |||
| 2330 | Ga0105241_10055499 | |||
| 2331 | Ga0105241_10109573 | |||
| 2332 | Ga0105241_10137350 | |||
| 2333 | Ga0105241_10237460 | |||
| 2334 | Ga0105241_10358719 | |||
| 2335 | Ga0105241_10714956 | |||
| 2336 | Ga0105241_10727548 | |||
| 2337 | Ga0105241_10976599 | |||
| 2338 | Ga0105241_11178223 | |||
| 2339 | Ga0105241_12413291 | |||
| 2340 | Ga0105241_12520886 | |||
| 2341 | Ga0105242_10000249 | |||
| 2342 | Ga0105242_10007429 | |||
| 2343 | Ga0105242_10016672 | |||
| 2344 | Ga0105242_10484601 | |||
| 2345 | Ga0105242_10504552 | |||
| 2346 | Ga0105242_10686284 | |||
| 2347 | Ga0105242_11603761 | |||
| 2348 | Ga0105242_11612376 | |||
| 2349 | Ga0105242_11899135 | |||
| 2350 | Ga0105242_12100278 | |||
| 2351 | Ga0105248_10006056 | |||
| 2352 | Ga0105248_10017237 | |||
| 2353 | Ga0105248_10027995 | |||
| 2354 | Ga0105248_10094785 | |||
| 2355 | Ga0105248_10137959 | |||
| 2356 | Ga0105248_10146328 | |||
| 2357 | Ga0105248_10196840 | |||
| 2358 | Ga0105248_10322011 | |||
| 2359 | Ga0105248_10458735 | |||
| 2360 | Ga0105248_10491147 | |||
| 2361 | Ga0105248_10494443 | |||
| 2362 | Ga0105248_10519078 | |||
| 2363 | Ga0105248_10656251 | |||
| 2364 | Ga0105248_10671371 | |||
| 2365 | Ga0105248_10820932 | |||
| 2366 | Ga0105248_10839248 | |||
| 2367 | Ga0105248_11013285 | |||
| 2368 | Ga0105248_11431034 | |||
| 2369 | Ga0105248_11757502 | |||
| 2370 | Ga0105248_11797911 | |||
| 2371 | Ga0105248_12702830 | |||
| 2372 | Ga0105248_12912716 | |||
| 2373 | Ga0105248_13185443 | |||
| 2374 | Ga0105237_10752398 | |||
| 2375 | Ga0105237_11595497 | |||
| 2376 | Ga0105238_10007632 | |||
| 2377 | Ga0105238_10027606 | |||
| 2378 | Ga0105238_11208504 | |||
| 2379 | Ga0105238_11603688 | |||
| 2380 | Ga0105238_12913216 | |||
| 2381 | Ga0105249_10007021 | |||
| 2382 | Ga0105249_10056201 | |||
| 2383 | Ga0105249_10085714 | |||
| 2384 | Ga0105249_10219725 | |||
| 2385 | Ga0105249_10271328 | |||
| 2386 | Ga0105249_10440540 | |||
| 2387 | Ga0105249_10459448 | |||
| 2388 | Ga0105249_10627277 | |||
| 2389 | Ga0105249_11157472 | |||
| 2390 | Ga0105249_11292662 | |||
| 2391 | Ga0099796_10090181 | |||
| 2392 | Ga0099796_10141922 | |||
| 2393 | Ga0105239_10098779 | |||
| 2394 | Ga0105239_10136278 | |||
| 2395 | Ga0105239_10817672 | |||
| 2396 | Ga0105239_11012294 | |||
| 2397 | Ga0105239_11777823 | |||
| 2398 | Ga0105239_12073186 | |||
| 2399 | Ga0105239_12120510 | |||
| 2400 | Ga0105239_12263939 | |||
| 2401 | Ga0105246_10092959 | |||
| 2402 | Ga0105246_10094253 | |||
| 2403 | Ga0105246_10297765 | |||
| 2404 | Ga0105246_10307590 | |||
| 2405 | Ga0105246_10945204 | |||
| 2406 | Ga0105246_11261251 | |||
| 2407 | Ga0105246_11921716 | |||
| 2408 | Ga0105246_11949722 | |||
| 2409 | Ga0105246_12087577 | |||
| 2410 | Ga0105246_12543543 | |||
| 2411 | Ga0157373_10002883 | |||
| 2412 | Ga0157373_10008292 | |||
| 2413 | Ga0157373_10299751 | |||
| 2414 | Ga0157373_10333694 | |||
| 2415 | Ga0157373_10529883 | |||
| 2416 | Ga0157373_10590125 | |||
| 2417 | Ga0157373_10590298 | |||
| 2418 | Ga0157373_10825105 | |||
| 2419 | Ga0157373_11081738 | |||
| 2420 | Ga0157373_11143819 | |||
| 2421 | Ga0157373_11272214 | |||
| 2422 | Ga0157371_10191333 | |||
| 2423 | Ga0157371_10223987 | |||
| 2424 | Ga0157371_10908968 | |||
| 2425 | Ga0157369_10592547 | |||
| 2426 | Ga0157374_10026890 | |||
| 2427 | Ga0157374_10296798 | |||
| 2428 | Ga0157374_11534395 | |||
| 2429 | Ga0157374_11911154 | |||
| 2430 | Ga0157374_12226860 | |||
| 2431 | Ga0157374_12304669 | |||
| 2432 | Ga0157374_12747311 | |||
| 2433 | Ga0157378_10001968 | |||
| 2434 | Ga0157378_10012080 | |||
| 2435 | Ga0157378_10063010 | |||
| 2436 | Ga0157378_10078501 | |||
| 2437 | Ga0157378_10134439 | |||
| 2438 | Ga0157378_10149954 | |||
| 2439 | Ga0157378_10174969 | |||
| 2440 | Ga0157378_10274815 | |||
| 2441 | Ga0157378_10629917 | |||
| 2442 | Ga0157378_10765577 | |||
| 2443 | Ga0157378_11015645 | |||
| 2444 | Ga0157378_11195153 | |||
| 2445 | Ga0157378_11246657 | |||
| 2446 | Ga0157378_11297631 | |||
| 2447 | Ga0157378_11337511 | |||
| 2448 | Ga0157378_11431953 | |||
| 2449 | Ga0157378_11921246 | |||
| 2450 | Ga0157378_12296038 | |||
| 2451 | Ga0157378_12443924 | |||
| 2452 | Ga0163162_10002437 | |||
| 2453 | Ga0163162_10011708 | |||
| 2454 | Ga0163162_10012021 | |||
| 2455 | Ga0163162_10162770 | |||
| 2456 | Ga0163162_10175826 | |||
| 2457 | Ga0163162_10237280 | |||
| 2458 | Ga0163162_10334283 | |||
| 2459 | Ga0163162_10529386 | |||
| 2460 | Ga0163162_10683774 | |||
| 2461 | Ga0163162_10756571 | |||
| 2462 | Ga0163162_10899763 | |||
| 2463 | Ga0163162_11781558 | |||
| 2464 | Ga0163162_12170397 | |||
| 2465 | Ga0157372_10001564 | |||
| 2466 | Ga0157372_10113138 | |||
| 2467 | Ga0157372_10338510 | |||
| 2468 | Ga0157372_12010740 | |||
| 2469 | Ga0157375_10063548 | |||
| 2470 | Ga0157375_10133001 | |||
| 2471 | Ga0157375_10142189 | |||
| 2472 | Ga0157375_10147109 | |||
| 2473 | Ga0157375_10381537 | |||
| 2474 | Ga0157375_10501249 | |||
| 2475 | Ga0157375_10737006 | |||
| 2476 | Ga0157375_10949964 | |||
| 2477 | Ga0157375_11013889 | |||
| 2478 | Ga0157375_11458999 | |||
| 2479 | Ga0157375_11852458 | |||
| 2480 | Ga0157375_11963834 | |||
| 2481 | Ga0157375_12023587 | |||
| 2482 | Ga0157375_13683476 | |||
| 2483 | Ga0163163_10000862 | |||
| 2484 | Ga0163163_10004317 | |||
| 2485 | Ga0163163_10058608 | |||
| 2486 | Ga0163163_10062838 | |||
| 2487 | Ga0163163_10065206 | |||
| 2488 | Ga0163163_10067723 | |||
| 2489 | Ga0163163_10106824 | |||
| 2490 | Ga0163163_10235973 | |||
| 2491 | Ga0163163_10241251 | |||
| 2492 | Ga0163163_10318992 | |||
| 2493 | Ga0163163_10634198 | |||
| 2494 | Ga0163163_10963387 | |||
| 2495 | Ga0163163_11387267 | |||
| 2496 | Ga0163163_11777180 | |||
| 2497 | Ga0163163_13324639 | |||
| 2498 | Ga0157380_10004388 | |||
| 2499 | Ga0157380_10014633 | |||
| 2500 | Ga0157380_10053614 | |||
| 2501 | Ga0157380_10072771 | |||
| 2502 | Ga0157380_10079299 | |||
| 2503 | Ga0157380_10315847 | |||
| 2504 | Ga0157380_10396852 | |||
| 2505 | Ga0157380_10614569 | |||
| 2506 | Ga0157380_10810655 | |||
| 2507 | Ga0157380_11090362 | |||
| 2508 | Ga0157380_11249541 | |||
| 2509 | Ga0157380_12645064 | |||
| 2510 | Ga0157380_13039303 | |||
| 2511 | Ga0182008_10914109 | |||
| 2512 | Ga0157377_10075982 | |||
| 2513 | Ga0157377_10127036 | |||
| 2514 | Ga0157377_10265524 | |||
| 2515 | Ga0157377_10455023 | |||
| 2516 | Ga0157377_10714259 | |||
| 2517 | Ga0157379_10090780 | |||
| 2518 | Ga0157379_10353050 | |||
| 2519 | Ga0157379_10353334 | |||
| 2520 | Ga0157379_10475067 | |||
| 2521 | Ga0157379_11870751 | |||
| 2522 | Ga0157379_12079156 | |||
| 2523 | Ga0157376_10017462 | |||
| 2524 | Ga0157376_10638660 | |||
| 2525 | Ga0182007_10065245 | |||
| 2526 | Ga0163161_10015460 | |||
| 2527 | Ga0163161_10140454 | |||
| 2528 | Ga0163161_10320364 | |||
| 2529 | Ga0163161_10776946 | |||
| 2530 | Ga0163161_11065836 | |||
| 2531 | Ga0213876_10005036 | |||
| 2532 | Ga0207672_1000122 | |||
| 2533 | Ga0207666_1010072 | |||
| 2534 | Ga0207697_10031153 | |||
| 2535 | Ga0207713_1194727 | |||
| 2536 | Ga0207653_10000130 | |||
| 2537 | Ga0207653_10187401 | |||
| 2538 | Ga0207682_10413216 | |||
| 2539 | Ga0207642_10005892 | |||
| 2540 | Ga0207642_10521238 | |||
| 2541 | Ga0207710_10000003 | |||
| 2542 | Ga0207710_10001166 | |||
| 2543 | Ga0207710_10152193 | |||
| 2544 | Ga0207710_10182455 | |||
| 2545 | Ga0207710_10553664 | |||
| 2546 | Ga0207688_10244747 | |||
| 2547 | Ga0207688_10245451 | |||
| 2548 | Ga0207680_10116217 | |||
| 2549 | Ga0207680_10203388 | |||
| 2550 | Ga0207680_10374376 | |||
| 2551 | Ga0207680_10409524 | |||
| 2552 | Ga0207647_10000385 | |||
| 2553 | Ga0207647_10048111 | |||
| 2554 | Ga0207647_10503356 | |||
| 2555 | Ga0207685_10000007 | |||
| 2556 | Ga0207699_11015603 | |||
| 2557 | Ga0207645_10108720 | |||
| 2558 | Ga0207645_10466515 | |||
| 2559 | Ga0207645_10768014 | |||
| 2560 | Ga0207645_10893899 | |||
| 2561 | Ga0207643_10021068 | |||
| 2562 | Ga0207643_10042107 | |||
| 2563 | Ga0207643_10135729 | |||
| 2564 | Ga0207643_10190988 | |||
| 2565 | Ga0207643_10366713 | |||
| 2566 | Ga0207643_10653980 | |||
| 2567 | Ga0207684_10000131 | |||
| 2568 | Ga0207684_10032227 | |||
| 2569 | Ga0207684_10358230 | |||
| 2570 | Ga0207684_10377063 | |||
| 2571 | Ga0207654_10022993 | |||
| 2572 | Ga0207654_10073402 | |||
| 2573 | Ga0207654_10306150 | |||
| 2574 | Ga0207654_10422733 | |||
| 2575 | Ga0207654_10525608 | |||
| 2576 | Ga0207654_10835984 | |||
| 2577 | Ga0207654_10851681 | |||
| 2578 | Ga0207707_10000017 | |||
| 2579 | Ga0207707_10004243 | |||
| 2580 | Ga0207707_10109843 | |||
| 2581 | Ga0207707_10602079 | |||
| 2582 | Ga0207707_10608347 | |||
| 2583 | Ga0207695_10123112 | |||
| 2584 | Ga0207671_10148293 | |||
| 2585 | Ga0207671_10161583 | |||
| 2586 | Ga0207671_10674393 | |||
| 2587 | Ga0207660_10026986 | |||
| 2588 | Ga0207660_10135185 | |||
| 2589 | Ga0207660_10210627 | |||
| 2590 | Ga0207660_10735298 | |||
| 2591 | Ga0207660_11643311 | |||
| 2592 | Ga0207662_10005692 | |||
| 2593 | Ga0207662_10023437 | |||
| 2594 | Ga0207662_10069082 | |||
| 2595 | Ga0207662_10260706 | |||
| 2596 | Ga0207662_10282924 | |||
| 2597 | Ga0207662_10361470 | |||
| 2598 | Ga0207662_11323185 | |||
| 2599 | Ga0207657_10703100 | |||
| 2600 | Ga0207649_10448989 | |||
| 2601 | Ga0207649_11030574 | |||
| 2602 | Ga0207652_10000335 | |||
| 2603 | Ga0207652_10114949 | |||
| 2604 | Ga0207652_11100128 | |||
| 2605 | Ga0207646_10009704 | |||
| 2606 | Ga0207646_10100260 | |||
| 2607 | Ga0207646_10136843 | |||
| 2608 | Ga0207646_10467588 | |||
| 2609 | Ga0207646_10998948 | |||
| 2610 | Ga0207681_10011297 | |||
| 2611 | Ga0207681_10044905 | |||
| 2612 | Ga0207681_10106684 | |||
| 2613 | Ga0207681_10322741 | |||
| 2614 | Ga0207694_10049440 | |||
| 2615 | Ga0207694_10076122 | |||
| 2616 | Ga0207650_10000005 | |||
| 2617 | Ga0207650_10063251 | |||
| 2618 | Ga0207650_10163632 | |||
| 2619 | Ga0207650_10189159 | |||
| 2620 | Ga0207650_10302083 | |||
| 2621 | Ga0207650_10612480 | |||
| 2622 | Ga0207650_10633851 | |||
| 2623 | Ga0207650_10744741 | |||
| 2624 | Ga0207650_10765378 | |||
| 2625 | Ga0207659_10254107 | |||
| 2626 | Ga0207659_10378233 | |||
| 2627 | Ga0207659_10451059 | |||
| 2628 | Ga0207687_10080623 | |||
| 2629 | Ga0207687_10797720 | |||
| 2630 | Ga0207644_10000074 | |||
| 2631 | Ga0207644_10030944 | |||
| 2632 | Ga0207644_10100032 | |||
| 2633 | Ga0207644_11011304 | |||
| 2634 | Ga0207644_11402991 | |||
| 2635 | Ga0207690_10013967 | |||
| 2636 | Ga0207690_10056799 | |||
| 2637 | Ga0207690_10683952 | |||
| 2638 | Ga0207690_11395134 | |||
| 2639 | Ga0207706_10044092 | |||
| 2640 | Ga0207706_10125993 | |||
| 2641 | Ga0207706_10134256 | |||
| 2642 | Ga0207706_10360556 | |||
| 2643 | Ga0207706_10551675 | |||
| 2644 | Ga0207686_10000011 | |||
| 2645 | Ga0207686_10010343 | |||
| 2646 | Ga0207686_10017843 | |||
| 2647 | Ga0207686_10439152 | |||
| 2648 | Ga0207686_10797179 | |||
| 2649 | Ga0207709_10000042 | |||
| 2650 | Ga0207709_10074732 | |||
| 2651 | Ga0207709_10123016 | |||
| 2652 | Ga0207709_10272911 | |||
| 2653 | Ga0207709_10347634 | |||
| 2654 | Ga0207709_10423684 | |||
| 2655 | Ga0207709_10997707 | |||
| 2656 | Ga0207709_11154694 | |||
| 2657 | Ga0207709_11159774 | |||
| 2658 | Ga0207709_11452116 | |||
| 2659 | Ga0207709_11724738 | |||
| 2660 | Ga0207670_10017942 | |||
| 2661 | Ga0207670_10059135 | |||
| 2662 | Ga0207670_10390021 | |||
| 2663 | Ga0207670_10650281 | |||
| 2664 | Ga0207670_10779026 | |||
| 2665 | Ga0207670_11248002 | |||
| 2666 | Ga0207670_11260140 | |||
| 2667 | Ga0207669_10356127 | |||
| 2668 | Ga0207704_10083943 | |||
| 2669 | Ga0207704_10467027 | |||
| 2670 | Ga0207704_10835307 | |||
| 2671 | Ga0207704_11146927 | |||
| 2672 | Ga0207665_10000027 | |||
| 2673 | Ga0207665_10140145 | |||
| 2674 | Ga0207665_10349671 | |||
| 2675 | Ga0207665_10471511 | |||
| 2676 | Ga0207665_10556603 | |||
| 2677 | Ga0207665_11250822 | |||
| 2678 | Ga0207691_10001531 | |||
| 2679 | Ga0207691_10891538 | |||
| 2680 | Ga0207691_10899636 | |||
| 2681 | Ga0207711_10003667 | |||
| 2682 | Ga0207711_10025575 | |||
| 2683 | Ga0207711_10026824 | |||
| 2684 | Ga0207711_10064400 | |||
| 2685 | Ga0207711_10115243 | |||
| 2686 | Ga0207711_10177075 | |||
| 2687 | Ga0207711_10480815 | |||
| 2688 | Ga0207711_10512928 | |||
| 2689 | Ga0207711_10826120 | |||
| 2690 | Ga0207711_10853585 | |||
| 2691 | Ga0207711_10973120 | |||
| 2692 | Ga0207711_11761835 | |||
| 2693 | Ga0207711_11850396 | |||
| 2694 | Ga0207689_10008713 | |||
| 2695 | Ga0207689_10016842 | |||
| 2696 | Ga0207689_10046764 | |||
| 2697 | Ga0207689_10146107 | |||
| 2698 | Ga0207689_10169483 | |||
| 2699 | Ga0207689_10219895 | |||
| 2700 | Ga0207689_10244123 | |||
| 2701 | Ga0207689_10331929 | |||
| 2702 | Ga0207689_10459006 | |||
| 2703 | Ga0207689_10475000 | |||
| 2704 | Ga0207689_10951399 | |||
| 2705 | Ga0207689_11169271 | |||
| 2706 | Ga0207689_11364343 | |||
| 2707 | Ga0207661_10252955 | |||
| 2708 | Ga0207661_11800446 | |||
| 2709 | Ga0207679_10299917 | |||
| 2710 | Ga0207679_10325900 | |||
| 2711 | Ga0207679_10604760 | |||
| 2712 | Ga0207679_10789734 | |||
| 2713 | Ga0207679_11291505 | |||
| 2714 | Ga0207667_12049369 | |||
| 2715 | Ga0207651_10039329 | |||
| 2716 | Ga0207651_10094856 | |||
| 2717 | Ga0207651_10373390 | |||
| 2718 | Ga0207651_10493191 | |||
| 2719 | Ga0207651_10533004 | |||
| 2720 | Ga0207651_10608130 | |||
| 2721 | Ga0207651_10885752 | |||
| 2722 | Ga0207712_10019580 | |||
| 2723 | Ga0207712_10028818 | |||
| 2724 | Ga0207712_10044712 | |||
| 2725 | Ga0207712_10380598 | |||
| 2726 | Ga0207712_11181802 | |||
| 2727 | Ga0207712_11716441 | |||
| 2728 | Ga0207640_10081777 | |||
| 2729 | Ga0207640_10112579 | |||
| 2730 | Ga0207640_10162778 | |||
| 2731 | Ga0207640_10209832 | |||
| 2732 | Ga0207640_10219765 | |||
| 2733 | Ga0207640_10471093 | |||
| 2734 | Ga0207640_10669167 | |||
| 2735 | Ga0207640_10736941 | |||
| 2736 | Ga0207640_10774639 | |||
| 2737 | Ga0207640_11256543 | |||
| 2738 | Ga0207640_11901586 | |||
| 2739 | Ga0207640_12122058 | |||
| 2740 | Ga0207658_10068564 | |||
| 2741 | Ga0207658_10570205 | |||
| 2742 | Ga0207658_11480944 | |||
| 2743 | Ga0207677_10251485 | |||
| 2744 | Ga0207677_11069330 | |||
| 2745 | Ga0207677_11114819 | |||
| 2746 | Ga0207677_11886654 | |||
| 2747 | Ga0207703_10000101 | |||
| 2748 | Ga0207703_10073238 | |||
| 2749 | Ga0207703_10159449 | |||
| 2750 | Ga0207703_10184078 | |||
| 2751 | Ga0207703_10230270 | |||
| 2752 | Ga0207703_10258220 | |||
| 2753 | Ga0207703_10283261 | |||
| 2754 | Ga0207703_10386619 | |||
| 2755 | Ga0207703_10894211 | |||
| 2756 | Ga0207639_10061466 | |||
| 2757 | Ga0207639_10252918 | |||
| 2758 | Ga0207639_11284413 | |||
| 2759 | Ga0207708_10000043 | |||
| 2760 | Ga0207708_10002522 | |||
| 2761 | Ga0207708_10007831 | |||
| 2762 | Ga0207708_10053037 | |||
| 2763 | Ga0207708_10087926 | |||
| 2764 | Ga0207708_10192647 | |||
| 2765 | Ga0207708_10293813 | |||
| 2766 | Ga0207708_10461891 | |||
| 2767 | Ga0207708_11591261 | |||
| 2768 | Ga0207702_10150385 | |||
| 2769 | Ga0207702_11959942 | |||
| 2770 | Ga0207641_10109885 | |||
| 2771 | Ga0207641_10180752 | |||
| 2772 | Ga0207641_10246746 | |||
| 2773 | Ga0207641_10348820 | |||
| 2774 | Ga0207641_10476106 | |||
| 2775 | Ga0207641_10529446 | |||
| 2776 | Ga0207641_10652594 | |||
| 2777 | Ga0207641_10998635 | |||
| 2778 | Ga0207641_11012145 | |||
| 2779 | Ga0207641_11022677 | |||
| 2780 | Ga0207641_11136937 | |||
| 2781 | Ga0207641_11156421 | |||
| 2782 | Ga0207641_11176415 | |||
| 2783 | Ga0207641_11461741 | |||
| 2784 | Ga0207641_11477258 | |||
| 2785 | Ga0207641_11926792 | |||
| 2786 | Ga0207641_12024034 | |||
| 2787 | Ga0207641_12040738 | |||
| 2788 | Ga0207648_10015138 | |||
| 2789 | Ga0207648_10048951 | |||
| 2790 | Ga0207648_10121810 | |||
| 2791 | Ga0207648_10313067 | |||
| 2792 | Ga0207648_10439552 | |||
| 2793 | Ga0207648_10457671 | |||
| 2794 | Ga0207648_10695167 | |||
| 2795 | Ga0207648_10879578 | |||
| 2796 | Ga0207648_11068407 | |||
| 2797 | Ga0207648_11490987 | |||
| 2798 | Ga0207648_11636644 | |||
| 2799 | Ga0207648_11636662 | |||
| 2800 | Ga0207676_10004891 | |||
| 2801 | Ga0207676_10029953 | |||
| 2802 | Ga0207676_10158301 | |||
| 2803 | Ga0207676_10309008 | |||
| 2804 | Ga0207676_10361000 | |||
| 2805 | Ga0207676_10369391 | |||
| 2806 | Ga0207676_10902931 | |||
| 2807 | Ga0207676_10996562 | |||
| 2808 | Ga0207676_11028316 | |||
| 2809 | Ga0207676_11598995 | |||
| 2810 | Ga0207676_12175917 | |||
| 2811 | Ga0207674_10002367 | |||
| 2812 | Ga0207674_10236066 | |||
| 2813 | Ga0207674_10300871 | |||
| 2814 | Ga0207674_10349529 | |||
| 2815 | Ga0207674_10359862 | |||
| 2816 | Ga0207674_10417305 | |||
| 2817 | Ga0207674_10907232 | |||
| 2818 | Ga0207674_11204972 | |||
| 2819 | Ga0207674_11266136 | |||
| 2820 | Ga0207674_11383254 | |||
| 2821 | Ga0207674_11430754 | |||
| 2822 | Ga0207674_12119246 | |||
| 2823 | Ga0207675_100008740 | |||
| 2824 | Ga0207675_100021904 | |||
| 2825 | Ga0207675_100039921 | |||
| 2826 | Ga0207675_100059927 | |||
| 2827 | Ga0207675_100098854 | |||
| 2828 | Ga0207675_100140754 | |||
| 2829 | Ga0207675_100320494 | |||
| 2830 | Ga0207675_100391398 | |||
| 2831 | Ga0207675_100409058 | |||
| 2832 | Ga0207675_100477989 | |||
| 2833 | Ga0207675_100592840 | |||
| 2834 | Ga0207675_100768874 | |||
| 2835 | Ga0207675_101186281 | |||
| 2836 | Ga0207675_102135441 | |||
| 2837 | Ga0207683_10044488 | |||
| 2838 | Ga0207683_10623123 | |||
| 2839 | Ga0207683_10903689 | |||
| 2840 | Ga0207698_10381916 | |||
| 2841 | Ga0207698_10959572 | |||
| 2842 | Ga0207698_12671160 | |||
| 2843 | Ga0209588_1012523 | |||
| 2844 | Ga0207428_10013786 | |||
| 2845 | Ga0207428_10015457 | |||
| 2846 | Ga0207428_10047588 | |||
| 2847 | Ga0207428_10309009 | |||
| 2848 | Ga0268266_11792847 | |||
| 2849 | Ga0268266_11811724 | |||
| 2850 | Ga0268265_10006379 | |||
| 2851 | Ga0268265_10024099 | |||
| 2852 | Ga0268265_10058203 | |||
| 2853 | Ga0268265_10301028 | |||
| 2854 | Ga0268265_10332204 | |||
| 2855 | Ga0268265_10370946 | |||
| 2856 | Ga0268265_10393052 | |||
| 2857 | Ga0268265_10412492 | |||
| 2858 | Ga0268265_10588777 | |||
| 2859 | Ga0268265_10612213 | |||
| 2860 | Ga0268265_12330200 | |||
| 2861 | Ga0268264_10040717 | |||
| 2862 | Ga0268264_10065566 | |||
| 2863 | Ga0268264_10073497 | |||
| 2864 | Ga0268264_10081426 | |||
| 2865 | Ga0268264_10094055 | |||
| 2866 | Ga0268264_10113918 | |||
| 2867 | Ga0268264_10216347 | |||
| 2868 | Ga0268264_10229768 | |||
| 2869 | Ga0268264_10278375 | |||
| 2870 | Ga0268264_10302825 | |||
| 2871 | Ga0268264_10364595 | |||
| 2872 | Ga0268264_10886578 | |||
| 2873 | Ga0268264_10960291 | |||
| 2874 | Ga0268264_10980158 | |||
| 2875 | Ga0268264_11737297 | |||
| 2876 | Ga0307408_100011791 | |||
| 2877 | Ga0307408_100122608 | |||
| 2878 | Ga0307408_100161167 | |||
| 2879 | Ga0307408_102172747 | |||
| 2880 | Ga0307405_10079066 | |||
| 2881 | Ga0307405_10096007 | |||
| 2882 | Ga0307405_10293436 | |||
| 2883 | Ga0307405_10796673 | |||
| 2884 | Ga0307405_12161694 | |||
| 2885 | Ga0307410_10142349 | |||
| 2886 | Ga0307410_11133279 | |||
| 2887 | Ga0307406_10008963 | |||
| 2888 | Ga0307406_10563767 | |||
| 2889 | Ga0307407_10364056 | |||
| 2890 | Ga0307407_10537790 | |||
| 2891 | Ga0307407_10760830 | |||
| 2892 | Ga0307412_10008317 | |||
| 2893 | Ga0307412_10012400 | |||
| 2894 | Ga0307412_10202912 | |||
| 2895 | Ga0307412_10376790 | |||
| 2896 | Ga0307409_100157714 | |||
| 2897 | Ga0307409_100512853 | |||
| 2898 | Ga0307416_100002153 | |||
| 2899 | Ga0307416_100134836 | |||
| 2900 | Ga0307416_100748409 | |||
| 2901 | Ga0307416_101259722 | |||
| 2902 | Ga0307416_101655824 | |||
| 2903 | Ga0307416_103269924 | |||
| 2904 | Ga0307414_10001957 | |||
| 2905 | Ga0307414_10153795 | |||
| 2906 | Ga0307414_11803176 | |||
| 2907 | Ga0307411_10005777 | |||
| 2908 | Ga0307411_10012992 | |||
| 2909 | Ga0307411_10479196 | |||
| 2910 | Ga0307411_10738589 | |||
| 2911 | Ga0307411_11879461 | |||
| 2912 | Ga0307415_100009574 | |||
| 2913 | Ga0307415_100180309 | |||
| 2914 | Ga0307415_100444967 | |||
| 2915 | Ga0307415_100961815 | |||
| 2916 | Ga0307415_101742985 | |||
| 2917 | Ga0373928_0096405 | |||
| 2918 | Ga0373940_0106449 | |||
| 2919 | Ga0373949_0131460 | |||
| 2920 | Ga0373951_0001101 | |||
| 2921 | Ga0373932_0382033 | |||
| 2922 | Ga0373941_0342101 | |||
| 2923 | Ga0373942_0007648 | |||
| 2924 | Ga0373931_0158434 | |||
| 2925 | Ga0395899_0745589 | |||
| 2926 | Ga0395900_0168787 | |||
| 2927 | Ga0395900_0395234 | |||
| 2928 | Ga0395900_0654449 | |||
| 2929 | Ga0395900_0893323 | |||
| 2930 | Ga0395900_1010833 | |||
| 2931 | Ga0395898_0482532 | |||
| 2932 | Ga0395898_1259002 | |||
| 2933 | Ga0395905_0359368 | |||
| 2934 | Ga0395905_0610509 | |||
| 2935 | Ga0395905_1509350 | |||
| 2936 | Ga0395901_0256020 | |||
| 2937 | Ga0395901_1650284 | |||
| 2938 | Ga0395901_1952323 | |||
| 2939 | Ga0242420_000913 | |||
| 2940 | Ga0436365_0564234 | |||
| 2941 | Ga0436365_0671345 | |||
| 2942 | Ga0436362_0146661 | |||
| 2943 | Ga0439439_0006583 | |||
| 2944 | Ga0439453_0029842 | |||
| 2945 | Ga0439448_0058991 | |||
| 2946 | Ga0439462_0026944 | |||
| 2947 | Ga0439446_0053096 | |||
| 2948 | Ga0439458_0001390 | |||
| 2949 | Ga0439458_0024627 | |||
| 2950 | Ga0439434_0350666 | |||
| 2951 | Ga0439464_0256326 | |||
| 2952 | Ga0451577_0161360 | |||
| 2953 | Ga0453683_0461029 | |||
| 2954 | Ga0453684_1265619 | |||
| 2955 | Ga0451576_0303809 | |||
| 2956 | Ga0451576_0605443 | |||
| 2957 | Ga0451576_0772647 | |||
| 2958 | Ga0451576_1322367 | |||
| 2959 | Ga0451576_1770856 | |||
| 2960 | Ga0495603_0453818 | |||
| 2961 | Ga0495620_0254198 | |||
| 2962 | Ga0495663_0000212 | |||
| 2963 | Ga0495598_0047534 | |||
| 2964 | Ga0495598_0128292 | |||
| 2965 | Ga0495621_0000419 | |||
| 2966 | Ga0495621_0047942 | |||
| 2967 | Ga0495621_0231151 | |||
| 2968 | Ga0495633_0122663 | |||
| 2969 | Ga0495656_0039878 | |||
| 2970 | Ga0495656_0750143 | |||
| 2971 | Ga0495668_0783072 | |||
| 2972 | Ga0495659_0568651 | |||
| 2973 | Ga0495658_0108012 | |||
| 2974 | Ga0495669_0623272 | |||
| 2975 | Ga0495589_0192095 | |||
| 2976 | Ga0495674_0599559 | |||
| 2977 | Ga0495685_221417 | |||
| 2978 | Ga0496100_1424384 | |||
| 2979 | Ga0496102_1037549 | |||
| 2980 | Ga0496102_1301009 | |||
| 2981 | Ga0496104_0018973 | |||
| 2982 | Ga0496104_1190345 | |||
| 2983 | Ga0496104_1544412 | |||
| 2984 | Ga0496106_0327765 | |||
| 2985 | Ga0496106_0381121 | |||
| 2986 | Ga0496107_0101852 | |||
| 2987 | Ga0496107_0604809 | |||
| 2988 | Ga0496107_0789125 | |||
| 2989 | Ga0496108_0309535 | |||
| 2990 | Ga0496108_0456924 | |||
| 2991 | Ga0496109_1013366 | |||
| 2992 | Ga0496112_0264580 | |||
| 2993 | Ga0496112_0378878 | |||
| 2994 | Ga0496112_1170947 | |||
| 2995 | Ga0496113_1084320 | |||
| 2996 | Ga0501290_044992 | |||
| 2997 | Ga0501290_061300 | |||
| 2998 | Ga0501290_066846 | |||
| 2999 | Ga0501291_006199 | |||
| 3000 | Ga0501291_111953 | |||
| 3001 | Ga0501291_130231 | |||
| 3002 | Ga0501292_010879 | |||
| 3003 | Ga0501292_071573 | |||
| 3004 | Ga0501292_109854 | |||
| 3005 | Ga0501296_000829 | |||
| 3006 | Ga0501296_012126 | |||
| 3007 | Ga0501296_022330 | |||
| 3008 | Ga0501296_052072 | |||
| 3009 | Ga0501298_002164 | |||
| 3010 | Ga0501298_008000 | |||
| 3011 | Ga0501299_000709 | |||
| 3012 | Ga0501299_036183 | |||
| 3013 | Ga0501301_022858 | |||
| 3014 | Ga0501303_010321 | |||
| 3015 | Ga0501038_0005082 | |||
| 3016 | Ga0501072_1563219 | |||
| 3017 | Ga0501074_0717952 | |||
| 3018 | Ga0501077_0429495 | |||
| 3019 | Ga0501198_006536 | |||
| 3020 | Ga0501198_020237 | |||
| 3021 | Ga0501198_066846 | |||
| 3022 | Ga0501199_003906 | |||
| 3023 | Ga0501199_020139 | |||
| 3024 | Ga0501202_015266 | |||
| 3025 | Ga0501202_038372 | |||
| 3026 | Ga0501202_106836 | |||
| 3027 | Ga0501206_081078 | |||
| 3028 | Ga0501207_002752 | |||
| 3029 | Ga0501207_120851 | |||
| 3030 | Ga0501208_020740 | |||
| 3031 | Ga0501214_002537 | |||
| 3032 | Ga0501214_002696 | |||
| 3033 | Ga0501216_004065 | |||
| 3034 | Ga0501216_112336 | |||
| 3035 | Ga0501217_000410 | |||
| 3036 | Ga0501217_003166 | |||
| 3037 | Ga0501217_016565 | |||
| 3038 | Ga0501217_310953 | |||
| 3039 | Ga0501223_012361 | |||
| 3040 | Ga0501223_041375 | |||
| 3041 | Ga0501223_109708 | |||
| 3042 | Ga0501224_001708 | |||
| 3043 | Ga0501224_009538 | |||
| 3044 | Ga0501224_021697 | |||
| 3045 | Ga0501227_000106 | |||
| 3046 | Ga0501227_014779 | |||
| 3047 | Ga0501227_021691 | |||
| 3048 | Ga0501230_002947 | |||
| 3049 | Ga0501233_213010 | |||
| 3050 | Ga0501233_232233 | |||
| 3051 | Ga0501235_004157 | |||
| 3052 | Ga0501235_006345 | |||
| 3053 | Ga0501235_010107 | |||
| 3054 | Ga0501235_013427 | |||
| 3055 | Ga0501235_091385 | |||
| 3056 | Ga0501235_177904 | |||
| 3057 | Ga0501236_001448 | |||
| 3058 | Ga0501239_009173 | |||
| 3059 | Ga0501239_082600 | |||
| 3060 | Ga0501240_004240 | |||
| 3061 | Ga0501242_074176 | |||
| 3062 | Ga0501243_012557 | |||
| 3063 | Ga0501243_061725 | |||
| 3064 | Ga0501247_029429 | |||
| 3065 | Ga0501248_006771 | |||
| 3066 | Ga0501249_011428 | |||
| 3067 | Ga0501249_035636 | |||
| 3068 | Ga0501249_072683 | |||
| 3069 | Ga0501249_206681 | |||
| 3070 | Ga0501251_007135 | |||
| 3071 | Ga0501251_011940 | |||
| 3072 | Ga0501253_005133 | |||
| 3073 | Ga0501255_020660 | |||
| 3074 | Ga0501256_002581 | |||
| 3075 | Ga0501256_006210 | |||
| 3076 | Ga0501257_007565 | |||
| 3077 | Ga0501257_031865 | |||
| 3078 | Ga0501258_019886 | |||
| 3079 | Ga0501258_065308 | |||
| 3080 | Ga0501259_007519 | |||
| 3081 | Ga0501259_010840 | |||
| 3082 | Ga0501260_000407 | |||
| 3083 | Ga0501260_000408 | |||
| 3084 | Ga0501260_007879 | |||
| 3085 | Ga0501260_037694 | |||
| 3086 | Ga0501221_142846 | |||
| 3087 | Ga0501221_156534 | |||
| 3088 | Ga0501225_0000853 | |||
| 3089 | Ga0501225_0002070 | |||
| 3090 | Ga0501225_0007379 | |||
| 3091 | Ga0501225_0034099 | |||
| 3092 | Ga0501225_0184889 | |||
| 3093 | Ga0501225_0263194 | |||
| 3094 | Ga0501234_002675 | |||
| 3095 | Ga0501234_009967 | |||
| 3096 | Ga0501234_021859 | |||
| 3097 | Ga0501245_006567 | |||
| 3098 | Ga0501245_012305 | |||
| 3099 | Ga0501079_0107587 | |||
| 3100 | Ga0501079_0615472 | |||
| 3101 | Ga0501081_1043620 | |||
| 3102 | Ga0501241_155597 | |||
| 3103 | Ga0501262_023315 | |||
| 3104 | Ga0501263_051948 | |||
| 3105 | Ga0501266_008989 | |||
| 3106 | Ga0501267_019021 | |||
| 3107 | Ga0501268_006152 | |||
| 3108 | Ga0501269_032905 | |||
| 3109 | Ga0501270_005388 | |||
| 3110 | Ga0501271_068344 | |||
| 3111 | Ga0501272_003329 | |||
| 3112 | Ga0501272_031281 | |||
| 3113 | Ga0501273_003524 | |||
| 3114 | Ga0501273_003954 | |||
| 3115 | Ga0501273_072765 | |||
| 3116 | Ga0501279_014694 | |||
| 3117 | Ga0501279_022053 | |||
| 3118 | Ga0501279_079571 | |||
| 3119 | Ga0501282_027386 | |||
| 3120 | Ga0501282_030952 | |||
| 3121 | Ga0501283_001419 | |||
| 3122 | Ga0501283_060345 | |||
| 3123 | Ga0501200_01813 | |||
| 3124 | Ga0501204_012812 | |||
| 3125 | Ga0501204_015760 | |||
| 3126 | Ga0501204_017911 | |||
| 3127 | Ga0501212_003935 | |||
| 3128 | Ga0501212_004876 | |||
| 3129 | Ga0501212_112833 | |||
| 3130 | Ga0501226_000544 | |||
| 3131 | Ga0501226_006240 | |||
| 3132 | Ga0501226_006399 | |||
| 3133 | nmdc:mga05p37_1129131_c1 | |||
| 3134 | nmdc:mga05p37_1359879_c1 | |||
| 3135 | nmdc:mga05p37_1831209_c1 | |||
| 3136 | nmdc:mga05p37_351269_c1 | |||
| 3137 | nmdc:mga05p37_504581_c1 | |||
| 3138 | nmdc:mga05p37_65136_c1 | |||
| 3139 | nmdc:mga05p37_672666_c1 | |||
| 3140 | nmdc:mga05p37_982361_c1 | |||
| 3141 | nmdc:mga09592_121972_c1 | |||
| 3142 | nmdc:mga09592_1430098_c1 | |||
| 3143 | nmdc:mga09592_1641612_c1 | |||
| 3144 | nmdc:mga09592_539202_c1 | |||
| 3145 | nmdc:mga09592_57546_c1 | |||
| 3146 | nmdc:mga09592_799186_c1 | |||
| 3147 | nmdc:mga0qj67_102600_c1 | |||
| 3148 | nmdc:mga0qj67_290008_c1 | |||
| 3149 | nmdc:mga06r32_1515427_c1 | |||
| 3150 | nmdc:mga06r32_1864865_c1 | |||
| 3151 | nmdc:mga06r32_304072_c1 | |||
| 3152 | nmdc:mga06r32_365984_c1 | |||
| 3153 | nmdc:mga06r32_451053_c1 | |||
| 3154 | nmdc:mga06r32_463071_c1 | |||
| 3155 | nmdc:mga06r32_923934_c1 | |||
| 3156 | nmdc:mga08y16_13794_c1 | |||
| 3157 | nmdc:mga08y16_1449686_c1 | |||
| 3158 | nmdc:mga08y16_1473233_c1 | |||
| 3159 | nmdc:mga08y16_15928_c1 | |||
| 3160 | nmdc:mga08y16_3655_c1 | |||
| 3161 | nmdc:mga08y16_473637_c1 | |||
| 3162 | nmdc:mga08y16_70144_c1 | |||
| 3163 | nmdc:mga0n895_1308933_c1 | |||
| 3164 | nmdc:mga0n895_1430135_c1 | |||
| 3165 | nmdc:mga0n895_175069_c1 | |||
| 3166 | nmdc:mga0n895_2348_c1 | |||
| 3167 | nmdc:mga0n895_390244_c1 | |||
| 3168 | nmdc:mga0rr50_340302_c1 | |||
| 3169 | nmdc:mga0rr50_50385_c1 | |||
| 3170 | nmdc:mga0rr50_55_c1 | |||
| 3171 | nmdc:mga0rr50_827578_c1 | |||
| 3172 | nmdc:mga0rr50_852928_c1 | |||
| 3173 | nmdc:mga08x19_12_c1 | |||
| 3174 | nmdc:mga08x19_138782_c1 | |||
| 3175 | nmdc:mga08x19_442384_c1 | |||
| 3176 | nmdc:mga0a205_1340761_c1 | |||
| 3177 | nmdc:mga0a205_149622_c1 | |||
| 3178 | nmdc:mga0a205_21372_c1 | |||
| 3179 | nmdc:mga0a205_347572_c1 | |||
| 3180 | nmdc:mga0a205_383466_c1 | |||
| 3181 | nmdc:mga0a205_410603_c1 | |||
| 3182 | nmdc:mga0a205_522998_c1 | |||
| 3183 | nmdc:mga0a205_728520_c1 | |||
| 3184 | nmdc:mga0a205_803134_c1 | |||
| 3185 | nmdc:mga0a205_902153_c1 | |||
| 3186 | Ga0530510_1235318 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5bo5-assembly3.cif.gz_C | structure of a unique atp synthase subunit neqb from nanoarcheaum equitans | 0.786 | 34 | 76 |
| 5i7q-assembly1.cif.gz_A | crystal structure of fkbp12-if(slpa), a chimeric protein of human fkbp12 and the insert in flap domain of ecoli slpa | 0.7404 | 34 | 76 |
| 7oxj-assembly1.cif.gz_A | ttslyd with m8a pseudo-wild-type s2 peptide | 0.7373 | 34 | 76 |
| 6q45-assembly1.cif.gz_F | f1-atpase from fusobacterium nucleatum | 0.7186 | 21 | 76 |
| 5bn4-assembly1.cif.gz_B | structure of a unique atp synthase neqa-neqb in complex with anp from nanoarcheaum equitans | 0.7101 | 27 | 76 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5bo5B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8097 | 34 | 76 | 3.40.50.12240 |
| 5i7qA02 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.7438 | 34 | 77 | 2.40.10.330 |
| af_Q9XPJ9_41_108_2.40.30.20 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.7153 | 21 | 76 | 2.40.30.20 |
| 4dt4A02 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.7122 | 34 | 79 | 2.40.10.330 |
| af_P0AEM0_10_140_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.705 | 34 | 76 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8Q9W5-F1-model_v4 | Uncharacterized protein | 0.9571 | 22 | 88 |
|
| AF-A0A2V8Q9W5-F1-model_v4 | Uncharacterized protein | 0.9435 | 22 | 88 |
|
| AF-A0A7W1LV34-F1-model_v4 | Uncharacterized protein | 0.9356 | 1 | 88 |
|
| AF-A0A399WQ38-F1-model_v4 | Uncharacterized protein | 0.9309 | 10 | 88 |
|
| AF-A0A7T9GKC0-F1-model_v4 | deleted | 0.8957 | 1 | 88 |
|