F494950

General Info

Members Datasets Scaffolds Average Seq Length
1593 342 3186 88

Family's Representative Sequence

Representative Sequence 3300005615|Ga0070702_100521761|Ga0070702_1005217611
Length 107
Sequence MVVFVTASIRTSLKESDGPMPDEQRVANNSQTYVADADTFQFETVQQENGQATVIRFRLEDPRYHAGDVLVVLSGSEIHFHGMIGQLADGWAVASDHRGSLLAATVQ

Samples

Sample ID Description Type Environment
1 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
216 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
217 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
218 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
219 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
220 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
221 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
231 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
232 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
233 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
234 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
235 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
236 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
237 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
238 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
239 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
240 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
241 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
244 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
245 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
246 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
247 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
248 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
254 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
267 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
268 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
269 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
270 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
271 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
272 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
273 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
274 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
279 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
280 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
281 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
282 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
283 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
284 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
285 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
286 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
287 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
288 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
289 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
290 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
291 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
292 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
293 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
294 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
295 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
296 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
297 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
298 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
299 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
300 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
301 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
302 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
303 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
304 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
305 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
306 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
307 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
308 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
309 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
310 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
311 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
312 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
313 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
314 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
315 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
316 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
317 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
318 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
319 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
320 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
321 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
322 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
323 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
324 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
325 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
326 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
327 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
328 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
329 3300049849 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought Metagenome Rhizosphere
330 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
331 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
332 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
333 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
334 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
335 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
336 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
337 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
338 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
339 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
340 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
341 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
342 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.13
Rhizosphere 98.43
Stem 0
Stem Tuber 0
Unclassified 31.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070702_100521761 3300005615 Bacteria 876
2 MRS2a_Contig_11610 2124908027 Bacteria 673
3 SwRhRL3b_contig_1296301 2162886006 Bacteria 1376
4 SwRhRL3b_contig_2608105 2162886006 Unclassified 1569
5 SwRhRL3b_contig_3931003 2162886006 Unclassified 857
6 MBSR1b_contig_5607604 2162886012 Unclassified 941
7 CNAas_1000004 3300000532 Bacteria 14982
8 JGI24034J26672_10000002 3300002239 Bacteria 925353
9 JGI24742J22300_10007517 3300002244 Bacteria 1798
10 JGI24751J29686_10000017 3300002459 Bacteria 109415
11 JGI24751J29686_10000149 3300002459 Bacteria 33687
12 JGI25406J46586_10014972 3300003203 Unclassified 3282
13 JGI25406J46586_10015093 3300003203 Unclassified 3266
14 JGI25406J46586_10056700 3300003203 Bacteria 1284
15 rootH2_10239322 3300003320 Unclassified 1227
16 rootL2_10089685 3300003322 Bacteria 6450
17 Ga0058859_11445007 3300004798 Unclassified 814
18 Ga0058860_12182722 3300004801 Bacteria 619
19 Ga0065714_10064460 3300005288 Bacteria 66400
20 Ga0065704_10011042 3300005289 Unclassified 2166
21 Ga0065704_10083950 3300005289 Bacteria 3397
22 Ga0065704_10118959 3300005289 Bacteria 1808
23 Ga0065704_10300358 3300005289 Bacteria 886
24 Ga0065704_10375249 3300005289 Unclassified 780
25 Ga0065704_10509140 3300005289 Unclassified 661
26 Ga0065712_10068069 3300005290 Bacteria 15521
27 Ga0065712_10072987 3300005290 Bacteria 4544
28 Ga0065712_10186778 3300005290 Bacteria 1136
29 Ga0065712_10189659 3300005290 Bacteria 1153
30 Ga0065712_10541569 3300005290 Unclassified 623
31 Ga0065712_10633265 3300005290 Unclassified 575
32 Ga0065712_10758371 3300005290 Unclassified 526
33 Ga0065712_10762445 3300005290 Bacteria 522
34 Ga0065712_10807805 3300005290 Bacteria 510
35 Ga0065715_10089839 3300005293 Bacteria 8355
36 Ga0065715_10095392 3300005293 Bacteria 4095
37 Ga0065715_10107731 3300005293 Bacteria 2747
38 Ga0065715_10117551 3300005293 Bacteria 2344
39 Ga0065715_10131647 3300005293 Bacteria 1975
40 Ga0065715_10148470 3300005293 Bacteria 1732
41 Ga0065715_10237332 3300005293 Bacteria 1212
42 Ga0065715_10306895 3300005293 Bacteria 1029
43 Ga0065715_10344726 3300005293 Bacteria 961
44 Ga0065715_10651527 3300005293 Unclassified 678
45 Ga0065715_10765313 3300005293 Unclassified 555
46 Ga0065715_10823858 3300005293 Unclassified 601
47 Ga0065715_11082937 3300005293 Bacteria 524
48 Ga0065707_10010856 3300005295 Bacteria 2354
49 Ga0065707_10201680 3300005295 Unclassified 1307
50 Ga0065707_10235308 3300005295 Bacteria 1174
51 Ga0065707_10294041 3300005295 Bacteria 1019
52 Ga0065707_10335170 3300005295 Unclassified 943
53 Ga0065707_10519932 3300005295 Unclassified 743
54 Ga0065707_10529747 3300005295 Bacteria 731
55 Ga0065707_10658809 3300005295 Unclassified 659
56 Ga0070676_10032637 3300005328 Bacteria 2984
57 Ga0070676_10243604 3300005328 Bacteria 1197
58 Ga0070676_10358790 3300005328 Bacteria 1004
59 Ga0070676_11021682 3300005328 Unclassified 621
60 Ga0070676_11144689 3300005328 Unclassified 589
61 Ga0070683_100151571 3300005329 Bacteria 2198
62 Ga0070690_100001046 3300005330 Bacteria 14164
63 Ga0070690_100037425 3300005330 Bacteria 3057
64 Ga0070690_100173822 3300005330 Bacteria 1484
65 Ga0070690_100188166 3300005330 Bacteria 1430
66 Ga0070690_100189860 3300005330 Unclassified 1424
67 Ga0070690_100958731 3300005330 Unclassified 672
68 Ga0070690_101543130 3300005330 Unclassified 537
69 Ga0070670_100005375 3300005331 Bacteria 10812
70 Ga0070670_100039124 3300005331 Bacteria 4078
71 Ga0070670_100085719 3300005331 Bacteria 2706
72 Ga0070670_100270379 3300005331 Bacteria 1483
73 Ga0070670_100339090 3300005331 Unclassified 1319
74 Ga0070670_100351613 3300005331 Bacteria 1295
75 Ga0070670_100351694 3300005331 Bacteria 1294
76 Ga0070670_100360744 3300005331 Bacteria 1278
77 Ga0070670_100737455 3300005331 Unclassified 887
78 Ga0070670_100830129 3300005331 Bacteria 836
79 Ga0070670_101506894 3300005331 Unclassified 617
80 Ga0070677_10314608 3300005333 Bacteria 800
81 Ga0070677_10665447 3300005333 Unclassified 583
82 Ga0070677_10852453 3300005333 Bacteria 524
83 Ga0068869_100007551 3300005334 Bacteria 6960
84 Ga0068869_100024467 3300005334 Bacteria 4183
85 Ga0068869_100049836 3300005334 Bacteria 3033
86 Ga0068869_100194191 3300005334 Bacteria 1598
87 Ga0068869_100223963 3300005334 Bacteria 1492
88 Ga0068869_100278987 3300005334 Unclassified 1343
89 Ga0068869_100280994 3300005334 Bacteria 1339
90 Ga0068869_100443435 3300005334 Unclassified 1075
91 Ga0068869_100705214 3300005334 Unclassified 861
92 Ga0068869_100871428 3300005334 Bacteria 778
93 Ga0068869_101208385 3300005334 Bacteria 665
94 Ga0068869_101566084 3300005334 Bacteria 586
95 Ga0068869_101705336 3300005334 Unclassified 562
96 Ga0070666_10179611 3300005335 Bacteria 1484
97 Ga0070666_10743424 3300005335 Bacteria 721
98 Ga0070680_100013569 3300005336 Bacteria 6350
99 Ga0070680_100057291 3300005336 Bacteria 3186
100 Ga0070680_100166982 3300005336 Bacteria 1851
101 Ga0070680_100169415 3300005336 Bacteria 1837
102 Ga0070680_100493796 3300005336 Unclassified 1047
103 Ga0070680_101726647 3300005336 Unclassified 542
104 Ga0070682_100093931 3300005337 Bacteria 1967
105 Ga0070682_100290157 3300005337 Bacteria 1196
106 Ga0068868_100007808 3300005338 Bacteria 7637
107 Ga0068868_100415580 3300005338 Bacteria 1164
108 Ga0068868_100640344 3300005338 Bacteria 946
109 Ga0068868_100942934 3300005338 Bacteria 787
110 Ga0068868_100982438 3300005338 Unclassified 771
111 Ga0070660_101673088 3300005339 Unclassified 542
112 Ga0070689_100002993 3300005340 Bacteria 11113
113 Ga0070689_100096060 3300005340 Unclassified 2342
114 Ga0070689_100165309 3300005340 Bacteria 1791
115 Ga0070689_100169227 3300005340 Bacteria 1770
116 Ga0070689_100180065 3300005340 Unclassified 1716
117 Ga0070689_100189932 3300005340 Bacteria 1672
118 Ga0070689_100303314 3300005340 Unclassified 1330
119 Ga0070689_100930094 3300005340 Bacteria 770
120 Ga0070689_102164220 3300005340 Unclassified 510
121 Ga0070691_10070020 3300005341 Bacteria 1701
122 Ga0070691_10178249 3300005341 Bacteria 1105
123 Ga0070691_10415664 3300005341 Bacteria 761
124 Ga0070687_100014088 3300005343 Bacteria 3583
125 Ga0070687_100023965 3300005343 Bacteria 2907
126 Ga0070687_100083621 3300005343 Unclassified 1748
127 Ga0070687_100190456 3300005343 Bacteria 1236
128 Ga0070687_100198919 3300005343 Unclassified 1213
129 Ga0070687_100302197 3300005343 Bacteria 1016
130 Ga0070687_100502200 3300005343 Unclassified 817
131 Ga0070687_101401304 3300005343 Unclassified 522
132 Ga0070661_100239167 3300005344 Bacteria 1398
133 Ga0070661_100867558 3300005344 Bacteria 744
134 Ga0070692_10010290 3300005345 Bacteria 4251
135 Ga0070692_10102794 3300005345 Bacteria 1569
136 Ga0070692_10171622 3300005345 Bacteria 1250
137 Ga0070692_10339714 3300005345 Unclassified 929
138 Ga0070692_10397043 3300005345 Bacteria 869
139 Ga0070692_10399291 3300005345 Unclassified 867
140 Ga0070692_10623561 3300005345 Bacteria 716
141 Ga0070692_10678020 3300005345 Bacteria 691
142 Ga0070692_10756924 3300005345 Unclassified 659
143 Ga0070692_11128043 3300005345 Unclassified 555
144 Ga0070692_11427125 3300005345 Unclassified 501
145 Ga0070669_100002230 3300005353 Bacteria 14029
146 Ga0070669_100010477 3300005353 Bacteria 6584
147 Ga0070669_100113959 3300005353 Bacteria 2055
148 Ga0070669_100459268 3300005353 Bacteria 1051
149 Ga0070669_100680061 3300005353 Bacteria 868
150 Ga0070669_101300527 3300005353 Bacteria 630
151 Ga0070675_100228755 3300005354 Bacteria 1622
152 Ga0070675_100312349 3300005354 Bacteria 1387
153 Ga0070675_100475415 3300005354 Bacteria 1123
154 Ga0070675_100748491 3300005354 Unclassified 892
155 Ga0070675_100862853 3300005354 Unclassified 829
156 Ga0070675_101828494 3300005354 Bacteria 560
157 Ga0070671_100002480 3300005355 Bacteria 14270
158 Ga0070671_100045419 3300005355 Bacteria 3652
159 Ga0070671_100114238 3300005355 Bacteria 2269
160 Ga0070671_100851201 3300005355 Unclassified 795
161 Ga0070671_101064418 3300005355 Unclassified 710
162 Ga0070674_100516308 3300005356 Unclassified 997
163 Ga0070674_100577257 3300005356 Bacteria 947
164 Ga0070673_100012429 3300005364 Bacteria 5844
165 Ga0070673_100029869 3300005364 Bacteria 4070
166 Ga0070673_100049169 3300005364 Bacteria 3292
167 Ga0070673_100105087 3300005364 Bacteria 2332
168 Ga0070673_100411888 3300005364 Unclassified 1210
169 Ga0070673_100788027 3300005364 Unclassified 877
170 Ga0070673_100959241 3300005364 Bacteria 795
171 Ga0070673_101015646 3300005364 Unclassified 773
172 Ga0070673_101064959 3300005364 Unclassified 754
173 Ga0070673_101612314 3300005364 Bacteria 613
174 Ga0070673_101864297 3300005364 Unclassified 570
175 Ga0070673_102076273 3300005364 Unclassified 540
176 Ga0070688_100015368 3300005365 Bacteria 4354
177 Ga0070688_100487162 3300005365 Bacteria 928
178 Ga0070688_100711450 3300005365 Unclassified 779
179 Ga0070688_100895556 3300005365 Unclassified 699
180 Ga0070688_101170034 3300005365 Unclassified 617
181 Ga0070688_101754273 3300005365 Unclassified 509
182 Ga0070659_100039290 3300005366 Unclassified 3694
183 Ga0070659_100128321 3300005366 Bacteria 2058
184 Ga0070659_100690065 3300005366 Bacteria 882
185 Ga0070667_100021151 3300005367 Bacteria 5405
186 Ga0070667_100163170 3300005367 Bacteria 1964
187 Ga0070667_100965162 3300005367 Bacteria 795
188 Ga0070667_101109108 3300005367 Bacteria 740
189 Ga0070667_101760522 3300005367 Unclassified 583
190 Ga0070703_10000081 3300005406 Bacteria 47961
191 Ga0070703_10015244 3300005406 Unclassified 2199
192 Ga0070703_10299019 3300005406 Bacteria 670
193 Ga0070703_10415488 3300005406 Unclassified 589
194 Ga0070703_10586856 3300005406 Bacteria 512
195 Ga0070709_10332763 3300005434 Bacteria 1118
196 Ga0070701_10008309 3300005438 Bacteria 4484
197 Ga0070701_10014106 3300005438 Bacteria 3655
198 Ga0070701_10024681 3300005438 Bacteria 2910
199 Ga0070701_10053852 3300005438 Unclassified 2096
200 Ga0070701_10065518 3300005438 Unclassified 1928
201 Ga0070701_10065613 3300005438 Unclassified 1927
202 Ga0070701_10612105 3300005438 Unclassified 723
203 Ga0070701_10963315 3300005438 Bacteria 593
204 Ga0070711_101694197 3300005439 Bacteria 554
205 Ga0070705_100080171 3300005440 Unclassified 2002
206 Ga0070705_100117897 3300005440 Bacteria 1709
207 Ga0070705_100234958 3300005440 Bacteria 1277
208 Ga0070705_100332245 3300005440 Bacteria 1101
209 Ga0070705_100385252 3300005440 Bacteria 1033
210 Ga0070705_100805526 3300005440 Unclassified 748
211 Ga0070705_101072543 3300005440 Bacteria 658
212 Ga0070705_101781812 3300005440 Unclassified 522
213 Ga0070700_100000964 3300005441 Bacteria 14218
214 Ga0070700_100034359 3300005441 Bacteria 3062
215 Ga0070700_100056426 3300005441 Unclassified 2462
216 Ga0070700_100157664 3300005441 Bacteria 1559
217 Ga0070700_100161480 3300005441 Bacteria 1543
218 Ga0070700_100757436 3300005441 Bacteria 778
219 Ga0070694_100000264 3300005444 Bacteria 27824
220 Ga0070694_100025104 3300005444 Bacteria 3854
221 Ga0070694_100035884 3300005444 Unclassified 3281
222 Ga0070694_100058270 3300005444 Bacteria 2627
223 Ga0070694_100123883 3300005444 Bacteria 1858
224 Ga0070694_100147570 3300005444 Unclassified 1714
225 Ga0070694_100184431 3300005444 Bacteria 1545
226 Ga0070694_100185495 3300005444 Bacteria 1541
227 Ga0070694_100247167 3300005444 Unclassified 1348
228 Ga0070694_100258289 3300005444 Bacteria 1320
229 Ga0070694_100294498 3300005444 Bacteria 1241
230 Ga0070694_100310204 3300005444 Bacteria 1211
231 Ga0070694_100361215 3300005444 Unclassified 1128
232 Ga0070694_100609897 3300005444 Unclassified 880
233 Ga0070694_100737723 3300005444 Unclassified 803
234 Ga0070694_100796830 3300005444 Unclassified 774
235 Ga0070694_100817290 3300005444 Unclassified 765
236 Ga0070694_100827429 3300005444 Bacteria 761
237 Ga0070694_100859917 3300005444 Bacteria 747
238 Ga0070694_100993926 3300005444 Bacteria 696
239 Ga0070694_101140415 3300005444 Unclassified 651
240 Ga0070694_101296620 3300005444 Unclassified 612
241 Ga0070694_101313669 3300005444 Bacteria 609
242 Ga0070694_101803010 3300005444 Unclassified 521
243 Ga0070694_101959337 3300005444 Bacteria 501
244 Ga0070708_100000508 3300005445 Bacteria 29318
245 Ga0070708_100033345 3300005445 Bacteria 4474
246 Ga0070708_100153039 3300005445 Bacteria 2146
247 Ga0070708_100253976 3300005445 Bacteria 1652
248 Ga0070708_100280968 3300005445 Unclassified 1567
249 Ga0070708_100457801 3300005445 Bacteria 1204
250 Ga0070708_100508299 3300005445 Bacteria 1137
251 Ga0070708_100678611 3300005445 Unclassified 970
252 Ga0070708_101019249 3300005445 Unclassified 776
253 Ga0070708_101091246 3300005445 Bacteria 748
254 Ga0070678_100102215 3300005456 Bacteria 2224
255 Ga0070678_101256349 3300005456 Bacteria 688
256 Ga0070662_100085451 3300005457 Bacteria 2358
257 Ga0070662_100275963 3300005457 Unclassified 1359
258 Ga0070662_100290873 3300005457 Bacteria 1325
259 Ga0070662_100352717 3300005457 Bacteria 1206
260 Ga0070662_100889246 3300005457 Unclassified 760
261 Ga0070681_10000489 3300005458 Bacteria 32333
262 Ga0070681_10046425 3300005458 Bacteria 4343
263 Ga0070681_10047995 3300005458 Bacteria 4267
264 Ga0070681_10072586 3300005458 Unclassified 3404
265 Ga0070681_10231787 3300005458 Unclassified 1761
266 Ga0070681_10758840 3300005458 Bacteria 887
267 Ga0068867_100014896 3300005459 Bacteria 5510
268 Ga0068867_100110352 3300005459 Bacteria 2113
269 Ga0068867_100282674 3300005459 Unclassified 1361
270 Ga0068867_100300247 3300005459 Unclassified 1324
271 Ga0068867_100331315 3300005459 Bacteria 1264
272 Ga0068867_100461314 3300005459 Bacteria 1085
273 Ga0068867_100518630 3300005459 Unclassified 1027
274 Ga0068867_100588590 3300005459 Unclassified 969
275 Ga0068867_100780902 3300005459 Unclassified 850
276 Ga0068867_101250038 3300005459 Unclassified 684
277 Ga0068867_101374698 3300005459 Bacteria 654
278 Ga0068867_101725079 3300005459 Bacteria 588
279 Ga0068867_101849831 3300005459 Unclassified 568
280 Ga0068867_102021214 3300005459 Unclassified 545
281 Ga0070685_10007677 3300005466 Bacteria 5520
282 Ga0070685_11459654 3300005466 Unclassified 526
283 Ga0070685_11487242 3300005466 Bacteria 522
284 Ga0070706_100000088 3300005467 Bacteria 107818
285 Ga0070706_100009738 3300005467 Bacteria 8930
286 Ga0070706_100053420 3300005467 Bacteria 3730
287 Ga0070706_100070901 3300005467 Bacteria 3223
288 Ga0070706_100201747 3300005467 Bacteria 1858
289 Ga0070706_100993211 3300005467 Unclassified 774
290 Ga0070707_100004499 3300005468 Bacteria 13062
291 Ga0070707_100116288 3300005468 Bacteria 2596
292 Ga0070707_100199261 3300005468 Bacteria 1951
293 Ga0070707_100199754 3300005468 Bacteria 1949
294 Ga0070707_100531602 3300005468 Bacteria 1138
295 Ga0070707_100650494 3300005468 Unclassified 1017
296 Ga0070707_101600686 3300005468 Unclassified 618
297 Ga0070698_100002826 3300005471 Bacteria 19105
298 Ga0070698_100027844 3300005471 Bacteria 5872
299 Ga0070698_100031002 3300005471 Bacteria 5544
300 Ga0070698_100212505 3300005471 Bacteria 1868
301 Ga0070698_100339850 3300005471 Bacteria 1433
302 Ga0070698_100462162 3300005471 Unclassified 1205
303 Ga0070698_100585001 3300005471 Unclassified 1056
304 Ga0070699_100001427 3300005518 Bacteria 21970
305 Ga0070699_100017437 3300005518 Bacteria 6164
306 Ga0070699_100018214 3300005518 Bacteria 6034
307 Ga0070699_100020141 3300005518 Bacteria 5750
308 Ga0070699_100048311 3300005518 Bacteria 3682
309 Ga0070699_100167940 3300005518 Bacteria 1944
310 Ga0070699_100204447 3300005518 Bacteria 1757
311 Ga0070699_100206751 3300005518 Bacteria 1747
312 Ga0070699_100251603 3300005518 Bacteria 1579
313 Ga0070699_100657007 3300005518 Unclassified 957
314 Ga0070699_101057025 3300005518 Unclassified 745
315 Ga0070699_101317388 3300005518 Unclassified 662
316 Ga0070699_101338864 3300005518 Bacteria 657
317 Ga0070699_101427985 3300005518 Bacteria 635
318 Ga0070699_101752523 3300005518 Bacteria 569
319 Ga0070699_101811469 3300005518 Bacteria 559
320 Ga0070679_100000604 3300005530 Bacteria 30555
321 Ga0070679_100054518 3300005530 Bacteria 3980
322 Ga0070679_100143251 3300005530 Bacteria 2368
323 Ga0070679_100919273 3300005530 Bacteria 818
324 Ga0070684_101378791 3300005535 Bacteria 664
325 Ga0070697_100000112 3300005536 Bacteria 63499
326 Ga0070697_100009364 3300005536 Bacteria 7653
327 Ga0070697_100116504 3300005536 Bacteria 2231
328 Ga0070697_100162734 3300005536 Bacteria 1885
329 Ga0070697_100192559 3300005536 Unclassified 1731
330 Ga0070697_100277985 3300005536 Bacteria 1436
331 Ga0070697_100465713 3300005536 Bacteria 1102
332 Ga0070697_100758312 3300005536 Bacteria 858
333 Ga0070697_100976156 3300005536 Unclassified 753
334 Ga0070697_101452268 3300005536 Bacteria 613
335 Ga0068853_100075885 3300005539 Bacteria 2934
336 Ga0068853_100104662 3300005539 Bacteria 2506
337 Ga0068853_100269207 3300005539 Bacteria 1568
338 Ga0068853_100738906 3300005539 Unclassified 940
339 Ga0068853_100952320 3300005539 Unclassified 825
340 Ga0068853_101171820 3300005539 Bacteria 742
341 Ga0070672_100047637 3300005543 Bacteria 3327
342 Ga0070672_100627693 3300005543 Unclassified 937
343 Ga0070672_100914567 3300005543 Unclassified 775
344 Ga0070686_100001026 3300005544 Bacteria 16055
345 Ga0070686_100013004 3300005544 Bacteria 4751
346 Ga0070686_100043948 3300005544 Unclassified 2805
347 Ga0070686_100056067 3300005544 Bacteria 2526
348 Ga0070686_100115294 3300005544 Unclassified 1837
349 Ga0070686_100596776 3300005544 Unclassified 870
350 Ga0070686_101208605 3300005544 Bacteria 628
351 Ga0070695_100020677 3300005545 Bacteria 4020
352 Ga0070695_100134413 3300005545 Bacteria 1708
353 Ga0070695_100154646 3300005545 Bacteria 1604
354 Ga0070695_100166176 3300005545 Bacteria 1553
355 Ga0070695_100188451 3300005545 Bacteria 1466
356 Ga0070695_100192513 3300005545 Bacteria 1452
357 Ga0070695_100225368 3300005545 Unclassified 1353
358 Ga0070695_100249585 3300005545 Bacteria 1291
359 Ga0070695_100531833 3300005545 Unclassified 914
360 Ga0070695_100867899 3300005545 Unclassified 727
361 Ga0070695_100871784 3300005545 Bacteria 725
362 Ga0070695_101017137 3300005545 Unclassified 675
363 Ga0070695_101815543 3300005545 Bacteria 512
364 Ga0070696_100074135 3300005546 Bacteria 2399
365 Ga0070696_100098863 3300005546 Bacteria 2087
366 Ga0070696_100184570 3300005546 Bacteria 1549
367 Ga0070696_100218636 3300005546 Bacteria 1429
368 Ga0070696_100231303 3300005546 Bacteria 1391
369 Ga0070696_100270652 3300005546 Bacteria 1291
370 Ga0070696_100283287 3300005546 Unclassified 1264
371 Ga0070696_100305985 3300005546 Bacteria 1219
372 Ga0070696_100581649 3300005546 Unclassified 901
373 Ga0070696_100677513 3300005546 Bacteria 839
374 Ga0070696_101050765 3300005546 Bacteria 682
375 Ga0070696_101185964 3300005546 Unclassified 645
376 Ga0070696_101249926 3300005546 Unclassified 629
377 Ga0070696_101290387 3300005546 Bacteria 619
378 Ga0070696_101383130 3300005546 Bacteria 600
379 Ga0070696_101383131 3300005546 Bacteria 600
380 Ga0070693_100004578 3300005547 Bacteria 6560
381 Ga0070693_100083470 3300005547 Bacteria 1910
382 Ga0070693_100171149 3300005547 Bacteria 1391
383 Ga0070693_100421192 3300005547 Unclassified 930
384 Ga0070693_100515140 3300005547 Bacteria 851
385 Ga0070693_100694380 3300005547 Unclassified 744
386 Ga0070693_100703635 3300005547 Unclassified 740
387 Ga0070693_100738564 3300005547 Unclassified 724
388 Ga0070693_100913465 3300005547 Unclassified 659
389 Ga0070693_100935787 3300005547 Bacteria 652
390 Ga0070693_101350213 3300005547 Bacteria 552
391 Ga0070665_100326918 3300005548 Bacteria 1538
392 Ga0070665_100771023 3300005548 Bacteria 975
393 Ga0070665_101020989 3300005548 Bacteria 839
394 Ga0070704_100037629 3300005549 Bacteria 3308
395 Ga0070704_100048892 3300005549 Bacteria 2963
396 Ga0070704_100072040 3300005549 Bacteria 2513
397 Ga0070704_100110677 3300005549 Unclassified 2089
398 Ga0070704_100478727 3300005549 Unclassified 1077
399 Ga0070704_100544559 3300005549 Bacteria 1013
400 Ga0070704_100634299 3300005549 Bacteria 942
401 Ga0070704_100636089 3300005549 Bacteria 941
402 Ga0070704_100647101 3300005549 Bacteria 933
403 Ga0070704_100717129 3300005549 Unclassified 888
404 Ga0070704_100980118 3300005549 Unclassified 764
405 Ga0070704_101331179 3300005549 Unclassified 658
406 Ga0070704_101673133 3300005549 Bacteria 588
407 Ga0068855_102087414 3300005563 Unclassified 571
408 Ga0068855_102571540 3300005563 Unclassified 505
409 Ga0070664_100003375 3300005564 Bacteria 12898
410 Ga0070664_100176818 3300005564 Bacteria 1895
411 Ga0070664_100296261 3300005564 Unclassified 1461
412 Ga0070664_100501036 3300005564 Bacteria 1119
413 Ga0070664_101290088 3300005564 Bacteria 690
414 Ga0068857_100012945 3300005577 Bacteria 7269
415 Ga0068857_100113116 3300005577 Bacteria 2440
416 Ga0068857_100131800 3300005577 Bacteria 2255
417 Ga0068857_100273159 3300005577 Bacteria 1554
418 Ga0068857_100511241 3300005577 Unclassified 1128
419 Ga0068857_100775027 3300005577 Unclassified 915
420 Ga0068857_100960290 3300005577 Bacteria 821
421 Ga0068857_100975833 3300005577 Unclassified 815
422 Ga0068857_100982123 3300005577 Unclassified 812
423 Ga0068857_101423396 3300005577 Bacteria 674
424 Ga0068857_101865428 3300005577 Unclassified 589
425 Ga0068854_100222624 3300005578 Bacteria 1493
426 Ga0068854_100236070 3300005578 Bacteria 1454
427 Ga0068854_100295186 3300005578 Bacteria 1309
428 Ga0068854_100306412 3300005578 Bacteria 1287
429 Ga0068854_100398256 3300005578 Bacteria 1139
430 Ga0068854_100440219 3300005578 Bacteria 1086
431 Ga0068854_100628560 3300005578 Bacteria 920
432 Ga0068854_100917510 3300005578 Unclassified 771
433 Ga0068854_101578648 3300005578 Unclassified 597
434 Ga0068854_101619442 3300005578 Unclassified 590
435 Ga0068854_102268413 3300005578 Bacteria 503
436 Ga0068856_100369411 3300005614 Bacteria 1453
437 Ga0068856_100546242 3300005614 Bacteria 1180
438 Ga0068856_100936536 3300005614 Unclassified 885
439 Ga0068856_101288561 3300005614 Bacteria 746
440 Ga0068856_102209051 3300005614 Bacteria 559
441 Ga0070702_100054597 3300005615 Bacteria 2300
442 Ga0070702_100060215 3300005615 Bacteria 2207
443 Ga0070702_100139589 3300005615 Bacteria 1542
444 Ga0070702_100208162 3300005615 Bacteria 1299
445 Ga0070702_100291641 3300005615 Bacteria 1125
446 Ga0070702_100348747 3300005615 Unclassified 1042
447 Ga0070702_100568749 3300005615 Bacteria 844
448 Ga0070702_100584046 3300005615 Bacteria 835
449 Ga0070702_100796104 3300005615 Bacteria 730
450 Ga0070702_100897417 3300005615 Unclassified 694
451 Ga0070702_100921342 3300005615 Unclassified 686
452 Ga0070702_100952270 3300005615 Bacteria 676
453 Ga0070702_101817593 3300005615 Unclassified 509
454 Ga0068852_100235114 3300005616 Bacteria 1749
455 Ga0068852_100427088 3300005616 Bacteria 1308
456 Ga0068852_101010790 3300005616 Bacteria 850
457 Ga0068852_101715179 3300005616 Unclassified 651
458 Ga0068852_102859879 3300005616 Bacteria 501
459 Ga0068859_100002739 3300005617 Bacteria 17881
460 Ga0068859_100004457 3300005617 Bacteria 14286
461 Ga0068859_100012082 3300005617 Bacteria 8676
462 Ga0068859_100015155 3300005617 Bacteria 7738
463 Ga0068859_100046093 3300005617 Bacteria 4379
464 Ga0068859_100093048 3300005617 Bacteria 3066
465 Ga0068859_100110623 3300005617 Bacteria 2809
466 Ga0068859_100121851 3300005617 Bacteria 2674
467 Ga0068859_100138053 3300005617 Unclassified 2511
468 Ga0068859_100262271 3300005617 Bacteria 1819
469 Ga0068859_100283215 3300005617 Unclassified 1750
470 Ga0068859_100379771 3300005617 Unclassified 1508
471 Ga0068859_100552870 3300005617 Unclassified 1245
472 Ga0068859_100557490 3300005617 Bacteria 1240
473 Ga0068859_100637466 3300005617 Unclassified 1158
474 Ga0068859_100665811 3300005617 Bacteria 1132
475 Ga0068859_100682432 3300005617 Bacteria 1118
476 Ga0068859_100830421 3300005617 Unclassified 1011
477 Ga0068859_100863086 3300005617 Unclassified 991
478 Ga0068859_100991537 3300005617 Bacteria 922
479 Ga0068859_101972354 3300005617 Bacteria 645
480 Ga0068859_102219544 3300005617 Unclassified 606
481 Ga0068859_102284608 3300005617 Bacteria 596
482 Ga0068859_102365219 3300005617 Unclassified 586
483 Ga0068864_100001530 3300005618 Bacteria 19039
484 Ga0068864_100020573 3300005618 Bacteria 5521
485 Ga0068864_100042336 3300005618 Unclassified 3897
486 Ga0068864_100065888 3300005618 Bacteria 3142
487 Ga0068864_100124254 3300005618 Bacteria 2311
488 Ga0068864_100169193 3300005618 Bacteria 1991
489 Ga0068864_100187029 3300005618 Bacteria 1896
490 Ga0068864_100196096 3300005618 Bacteria 1853
491 Ga0068864_100257797 3300005618 Bacteria 1621
492 Ga0068864_100380687 3300005618 Bacteria 1337
493 Ga0068864_100519754 3300005618 Bacteria 1147
494 Ga0068864_100740898 3300005618 Bacteria 962
495 Ga0068864_101352784 3300005618 Unclassified 713
496 Ga0068864_101557328 3300005618 Bacteria 664
497 Ga0068864_101927195 3300005618 Bacteria 597
498 Ga0068864_102625498 3300005618 Bacteria 509
499 Ga0068866_10020829 3300005718 Bacteria 3011
500 Ga0068866_10109457 3300005718 Unclassified 1539
501 Ga0068866_10486520 3300005718 Unclassified 814
502 Ga0068861_100017567 3300005719 Bacteria 5082
503 Ga0068861_100033929 3300005719 Bacteria 3769
504 Ga0068861_100050519 3300005719 Unclassified 3153
505 Ga0068861_100091114 3300005719 Bacteria 2406
506 Ga0068861_100127543 3300005719 Unclassified 2061
507 Ga0068861_100143940 3300005719 Bacteria 1949
508 Ga0068861_100324439 3300005719 Bacteria 1342
509 Ga0068861_100505420 3300005719 Unclassified 1093
510 Ga0068861_100531612 3300005719 Bacteria 1068
511 Ga0068861_100585506 3300005719 Unclassified 1022
512 Ga0068861_100659592 3300005719 Bacteria 967
513 Ga0068861_101184665 3300005719 Unclassified 738
514 Ga0068861_101537536 3300005719 Unclassified 654
515 Ga0068861_101747340 3300005719 Bacteria 616
516 Ga0068861_102178462 3300005719 Unclassified 555
517 Ga0068861_102492523 3300005719 Bacteria 521
518 Ga0068851_11039033 3300005834 Unclassified 518
519 Ga0068870_10008350 3300005840 Bacteria 4656
520 Ga0068870_10027938 3300005840 Unclassified 2827
521 Ga0068870_10057964 3300005840 Bacteria 2072
522 Ga0068870_10179502 3300005840 Bacteria 1270
523 Ga0068870_10354242 3300005840 Bacteria 943
524 Ga0068870_10560422 3300005840 Unclassified 771
525 Ga0068870_10623170 3300005840 Bacteria 736
526 Ga0068870_10738148 3300005840 Unclassified 683
527 Ga0068870_10840626 3300005840 Bacteria 644
528 Ga0068863_100018044 3300005841 Bacteria 6756
529 Ga0068863_100128325 3300005841 Bacteria 2420
530 Ga0068863_100242354 3300005841 Bacteria 1740
531 Ga0068863_100483801 3300005841 Bacteria 1218
532 Ga0068863_100536414 3300005841 Unclassified 1154
533 Ga0068863_100800482 3300005841 Bacteria 940
534 Ga0068863_100915019 3300005841 Unclassified 878
535 Ga0068863_101166831 3300005841 Bacteria 776
536 Ga0068863_101270606 3300005841 Bacteria 743
537 Ga0068863_101445779 3300005841 Unclassified 695
538 Ga0068863_101716145 3300005841 Bacteria 638
539 Ga0068858_100000227 3300005842 Bacteria 60951
540 Ga0068858_100123442 3300005842 Bacteria 2423
541 Ga0068858_100127098 3300005842 Bacteria 2388
542 Ga0068858_100185364 3300005842 Bacteria 1966
543 Ga0068858_100315530 3300005842 Unclassified 1493
544 Ga0068858_100330592 3300005842 Bacteria 1458
545 Ga0068858_100370918 3300005842 Bacteria 1373
546 Ga0068858_100418693 3300005842 Bacteria 1288
547 Ga0068858_100444019 3300005842 Unclassified 1250
548 Ga0068858_100456053 3300005842 Bacteria 1232
549 Ga0068858_100492143 3300005842 Bacteria 1184
550 Ga0068858_101210707 3300005842 Unclassified 742
551 Ga0068860_100004210 3300005843 Bacteria 14745
552 Ga0068860_100034116 3300005843 Bacteria 4881
553 Ga0068860_100053875 3300005843 Unclassified 3824
554 Ga0068860_100072351 3300005843 Bacteria 3276
555 Ga0068860_100079833 3300005843 Bacteria 3111
556 Ga0068860_100114891 3300005843 Bacteria 2574
557 Ga0068860_100177474 3300005843 Bacteria 2059
558 Ga0068860_100193004 3300005843 Bacteria 1971
559 Ga0068860_100273083 3300005843 Unclassified 1650
560 Ga0068860_100388220 3300005843 Unclassified 1379
561 Ga0068860_100405958 3300005843 Bacteria 1348
562 Ga0068860_101038929 3300005843 Bacteria 838
563 Ga0068860_101059866 3300005843 Bacteria 829
564 Ga0068860_101195298 3300005843 Unclassified 780
565 Ga0068860_101308113 3300005843 Unclassified 746
566 Ga0068860_101438552 3300005843 Bacteria 711
567 Ga0068860_101791275 3300005843 Unclassified 636
568 Ga0068862_100007975 3300005844 Bacteria 8759
569 Ga0068862_100019794 3300005844 Bacteria 5622
570 Ga0068862_100036723 3300005844 Bacteria 4153
571 Ga0068862_100075730 3300005844 Bacteria 2911
572 Ga0068862_100076530 3300005844 Bacteria 2896
573 Ga0068862_100093042 3300005844 Bacteria 2628
574 Ga0068862_100111498 3300005844 Unclassified 2402
575 Ga0068862_100129213 3300005844 Bacteria 2233
576 Ga0068862_100260238 3300005844 Bacteria 1584
577 Ga0068862_100398128 3300005844 Unclassified 1288
578 Ga0068862_100461823 3300005844 Bacteria 1199
579 Ga0068862_101429284 3300005844 Unclassified 695
580 Ga0081539_10000043 3300005985 Bacteria 288108
581 Ga0081539_10000851 3300005985 Bacteria 58399
582 Ga0081539_10001474 3300005985 Bacteria 39921
583 Ga0081539_10005869 3300005985 Bacteria 12167
584 Ga0081539_10085004 3300005985 Bacteria 1652
585 Ga0081539_10114976 3300005985 Bacteria 1347
586 Ga0070715_10000007 3300006163 Bacteria 192075
587 Ga0070716_100000007 3300006173 Bacteria 256300
588 Ga0070716_100112996 3300006173 Bacteria 1686
589 Ga0070716_100292811 3300006173 Bacteria 1129
590 Ga0070716_100454963 3300006173 Unclassified 934
591 Ga0070716_101472838 3300006173 Bacteria 556
592 Ga0070716_101490476 3300006173 Bacteria 553
593 Ga0097621_100081069 3300006237 Bacteria 2700
594 Ga0097621_100088346 3300006237 Bacteria 2589
595 Ga0097621_100152573 3300006237 Unclassified 1982
596 Ga0097621_100162804 3300006237 Unclassified 1919
597 Ga0097621_100522547 3300006237 Bacteria 1077
598 Ga0097621_100801102 3300006237 Bacteria 873
599 Ga0097621_102401019 3300006237 Bacteria 505
600 Ga0068871_100006022 3300006358 Bacteria 8535
601 Ga0068871_100015503 3300006358 Bacteria 5706
602 Ga0068871_100028784 3300006358 Bacteria 4359
603 Ga0068871_100104621 3300006358 Bacteria 2374
604 Ga0068871_101119555 3300006358 Bacteria 737
605 Ga0075428_100136086 3300006844 Bacteria 2671
606 Ga0075428_100857025 3300006844 Bacteria 964
607 Ga0075428_101253559 3300006844 Unclassified 781
608 Ga0075430_100037954 3300006846 Bacteria 4083
609 Ga0075430_100360466 3300006846 Bacteria 1200
610 Ga0075430_101239324 3300006846 Bacteria 614
611 Ga0075431_100064005 3300006847 Bacteria 3796
612 Ga0075431_100131761 3300006847 Bacteria 2578
613 Ga0075431_100451990 3300006847 Bacteria 1280
614 Ga0075431_100498545 3300006847 Bacteria 1209
615 Ga0075431_101736912 3300006847 Bacteria 581
616 Ga0075433_10020255 3300006852 Bacteria 5558
617 Ga0075433_10020844 3300006852 Bacteria 5487
618 Ga0075433_10022972 3300006852 Bacteria 5243
619 Ga0075433_10416613 3300006852 Bacteria 1185
620 Ga0075433_10965815 3300006852 Bacteria 743
621 Ga0075433_11062446 3300006852 Unclassified 704
622 Ga0075433_11124778 3300006852 Unclassified 683
623 Ga0075433_11142763 3300006852 Bacteria 677
624 Ga0075433_11928193 3300006852 Bacteria 507
625 Ga0075434_100032647 3300006871 Bacteria 5135
626 Ga0075434_100081851 3300006871 Bacteria 3225
627 Ga0075434_100134853 3300006871 Bacteria 2488
628 Ga0075434_100150631 3300006871 Bacteria 2346
629 Ga0075434_100417145 3300006871 Unclassified 1363
630 Ga0075434_101484527 3300006871 Unclassified 687
631 Ga0075434_101727709 3300006871 Bacteria 633
632 Ga0075429_100004845 3300006880 Bacteria 11595
633 Ga0075429_100072291 3300006880 Bacteria 3004
634 Ga0075429_100109852 3300006880 Bacteria 2411
635 Ga0075429_100224296 3300006880 Bacteria 1646
636 Ga0075429_100647729 3300006880 Bacteria 926
637 Ga0075429_100946019 3300006880 Bacteria 754
638 Ga0068865_100130776 3300006881 Bacteria 1880
639 Ga0068865_100323889 3300006881 Unclassified 1241
640 Ga0068865_100809230 3300006881 Bacteria 809
641 Ga0068865_101592075 3300006881 Unclassified 587
642 Ga0075436_100000018 3300006914 Bacteria 139195
643 Ga0075436_100041994 3300006914 Bacteria 3154
644 Ga0075436_100535602 3300006914 Bacteria 859
645 Ga0097620_100002739 3300006931 Bacteria 17881
646 Ga0097620_100004457 3300006931 Bacteria 14286
647 Ga0097620_100012083 3300006931 Bacteria 8676
648 Ga0097620_100015156 3300006931 Bacteria 7738
649 Ga0097620_100046093 3300006931 Bacteria 4379
650 Ga0097620_100093051 3300006931 Bacteria 3066
651 Ga0097620_100110619 3300006931 Bacteria 2809
652 Ga0097620_100121856 3300006931 Bacteria 2674
653 Ga0097620_100138047 3300006931 Unclassified 2511
654 Ga0097620_100262260 3300006931 Bacteria 1819
655 Ga0097620_100283230 3300006931 Unclassified 1750
656 Ga0097620_100379749 3300006931 Unclassified 1508
657 Ga0097620_100552878 3300006931 Unclassified 1245
658 Ga0097620_100557553 3300006931 Bacteria 1240
659 Ga0097620_100637463 3300006931 Unclassified 1158
660 Ga0097620_100665819 3300006931 Bacteria 1132
661 Ga0097620_100682453 3300006931 Bacteria 1118
662 Ga0097620_100830456 3300006931 Unclassified 1011
663 Ga0097620_100863126 3300006931 Unclassified 991
664 Ga0097620_100991515 3300006931 Bacteria 922
665 Ga0097620_101972312 3300006931 Bacteria 645
666 Ga0097620_102219349 3300006931 Unclassified 606
667 Ga0097620_102284651 3300006931 Bacteria 596
668 Ga0097620_102365137 3300006931 Unclassified 586
669 Ga0075435_100000359 3300007076 Bacteria 27892
670 Ga0075435_100003678 3300007076 Bacteria 10443
671 Ga0075435_100117894 3300007076 Bacteria 2212
672 Ga0075435_100667224 3300007076 Unclassified 903
673 Ga0075435_100908894 3300007076 Bacteria 768
674 Ga0075435_101134427 3300007076 Bacteria 684
675 Ga0099794_10004255 3300007265 Bacteria 5592
676 Ga0099794_10209875 3300007265 Unclassified 999
677 Ga0099794_10378354 3300007265 Bacteria 738
678 Ga0099794_10704353 3300007265 Unclassified 538
679 Ga0105251_10140108 3300009011 Unclassified 1094
680 Ga0105251_10145842 3300009011 Bacteria 1070
681 Ga0105251_10368478 3300009011 Unclassified 657
682 Ga0105250_10548024 3300009092 Bacteria 530
683 Ga0105240_10195833 3300009093 Bacteria 2373
684 Ga0105240_10988408 3300009093 Unclassified 901
685 Ga0105240_11684628 3300009093 Unclassified 662
686 Ga0111539_10004262 3300009094 Bacteria 18727
687 Ga0111539_10012727 3300009094 Bacteria 10536
688 Ga0111539_10024482 3300009094 Bacteria 7405
689 Ga0111539_10091295 3300009094 Bacteria 3578
690 Ga0111539_10300357 3300009094 Bacteria 1869
691 Ga0111539_10531773 3300009094 Bacteria 1370
692 Ga0111539_10794095 3300009094 Bacteria 1102
693 Ga0111539_10903829 3300009094 Bacteria 1027
694 Ga0111539_11342174 3300009094 Bacteria 830
695 Ga0105245_10024756 3300009098 Bacteria 5273
696 Ga0105245_10457960 3300009098 Unclassified 1285
697 Ga0105245_12479219 3300009098 Unclassified 572
698 Ga0105247_10000001 3300009101 Bacteria 739726
699 Ga0105247_10089947 3300009101 Bacteria 1947
700 Ga0105247_10191004 3300009101 Unclassified 1371
701 Ga0105247_10208493 3300009101 Bacteria 1317
702 Ga0105247_10383210 3300009101 Unclassified 997
703 Ga0105247_10484965 3300009101 Unclassified 898
704 Ga0105247_10641300 3300009101 Unclassified 792
705 Ga0105247_10743641 3300009101 Bacteria 743
706 Ga0114129_10030857 3300009147 Bacteria 7580
707 Ga0114129_10055247 3300009147 Bacteria 5566
708 Ga0114129_10063314 3300009147 Bacteria 5165
709 Ga0114129_10103825 3300009147 Bacteria 3929
710 Ga0114129_10208718 3300009147 Bacteria 2642
711 Ga0114129_10354022 3300009147 Bacteria 1944
712 Ga0114129_10715081 3300009147 Bacteria 1286
713 Ga0114129_10747559 3300009147 Unclassified 1252
714 Ga0114129_10848454 3300009147 Bacteria 1161
715 Ga0114129_10978988 3300009147 Unclassified 1067
716 Ga0114129_11286196 3300009147 Bacteria 907
717 Ga0114129_11317362 3300009147 Unclassified 894
718 Ga0114129_12257170 3300009147 Bacteria 654
719 Ga0114129_12390948 3300009147 Bacteria 633
720 Ga0105243_10000024 3300009148 Bacteria 197391
721 Ga0105243_10048260 3300009148 Bacteria 3356
722 Ga0105243_10068303 3300009148 Bacteria 2864
723 Ga0105243_10086783 3300009148 Bacteria 2567
724 Ga0105243_10133790 3300009148 Unclassified 2107
725 Ga0105243_10284964 3300009148 Unclassified 1490
726 Ga0105243_10295494 3300009148 Bacteria 1466
727 Ga0105243_10360634 3300009148 Bacteria 1338
728 Ga0105243_10383972 3300009148 Unclassified 1300
729 Ga0105243_10418900 3300009148 Unclassified 1249
730 Ga0105243_10540840 3300009148 Unclassified 1111
731 Ga0105243_10764478 3300009148 Unclassified 949
732 Ga0105243_10766658 3300009148 Unclassified 947
733 Ga0105243_10772027 3300009148 Bacteria 944
734 Ga0105243_11594481 3300009148 Unclassified 679
735 Ga0105241_10019047 3300009174 Bacteria 5061
736 Ga0105241_10040109 3300009174 Bacteria 3534
737 Ga0105241_10055499 3300009174 Bacteria 3035
738 Ga0105241_10109573 3300009174 Bacteria 2208
739 Ga0105241_10137350 3300009174 Unclassified 1987
740 Ga0105241_10237460 3300009174 Bacteria 1539
741 Ga0105241_10358719 3300009174 Bacteria 1268
742 Ga0105241_10714956 3300009174 Unclassified 916
743 Ga0105241_10727548 3300009174 Bacteria 908
744 Ga0105241_10976599 3300009174 Bacteria 791
745 Ga0105241_11178223 3300009174 Bacteria 725
746 Ga0105241_12413291 3300009174 Unclassified 525
747 Ga0105241_12520886 3300009174 Unclassified 515
748 Ga0105242_10000249 3300009176 Bacteria 42499
749 Ga0105242_10007429 3300009176 Bacteria 8437
750 Ga0105242_10016672 3300009176 Bacteria 5715
751 Ga0105242_10484601 3300009176 Bacteria 1173
752 Ga0105242_10504552 3300009176 Bacteria 1151
753 Ga0105242_10686284 3300009176 Unclassified 1000
754 Ga0105242_11603761 3300009176 Bacteria 684
755 Ga0105242_11612376 3300009176 Unclassified 683
756 Ga0105242_11899135 3300009176 Unclassified 636
757 Ga0105242_12100278 3300009176 Bacteria 609
758 Ga0105248_10006056 3300009177 Bacteria 13274
759 Ga0105248_10017237 3300009177 Bacteria 7959
760 Ga0105248_10027995 3300009177 Bacteria 6276
761 Ga0105248_10094785 3300009177 Bacteria 3361
762 Ga0105248_10137959 3300009177 Unclassified 2751
763 Ga0105248_10146328 3300009177 Unclassified 2666
764 Ga0105248_10196840 3300009177 Unclassified 2271
765 Ga0105248_10322011 3300009177 Bacteria 1741
766 Ga0105248_10458735 3300009177 Bacteria 1436
767 Ga0105248_10491147 3300009177 Bacteria 1384
768 Ga0105248_10494443 3300009177 Bacteria 1379
769 Ga0105248_10519078 3300009177 Bacteria 1343
770 Ga0105248_10656251 3300009177 Unclassified 1184
771 Ga0105248_10671371 3300009177 Bacteria 1169
772 Ga0105248_10820932 3300009177 Unclassified 1049
773 Ga0105248_10839248 3300009177 Bacteria 1037
774 Ga0105248_11013285 3300009177 Unclassified 938
775 Ga0105248_11431034 3300009177 Unclassified 782
776 Ga0105248_11757502 3300009177 Unclassified 703
777 Ga0105248_11797911 3300009177 Bacteria 695
778 Ga0105248_12702830 3300009177 Unclassified 566
779 Ga0105248_12912716 3300009177 Bacteria 545
780 Ga0105248_13185443 3300009177 Unclassified 522
781 Ga0105237_10752398 3300009545 Bacteria 981
782 Ga0105237_11595497 3300009545 Bacteria 659
783 Ga0105238_10007632 3300009551 Bacteria 10835
784 Ga0105238_10027606 3300009551 Bacteria 5785
785 Ga0105238_11208504 3300009551 Unclassified 780
786 Ga0105238_11603688 3300009551 Bacteria 681
787 Ga0105238_12913216 3300009551 Unclassified 514
788 Ga0105249_10007021 3300009553 Bacteria 9829
789 Ga0105249_10056201 3300009553 Bacteria 3603
790 Ga0105249_10085714 3300009553 Bacteria 2936
791 Ga0105249_10219725 3300009553 Bacteria 1869
792 Ga0105249_10271328 3300009553 Unclassified 1690
793 Ga0105249_10440540 3300009553 Unclassified 1340
794 Ga0105249_10459448 3300009553 Unclassified 1313
795 Ga0105249_10627277 3300009553 Unclassified 1131
796 Ga0105249_11157472 3300009553 Bacteria 844
797 Ga0105249_11292662 3300009553 Unclassified 801
798 Ga0099796_10090181 3300010159 Bacteria 1138
799 Ga0099796_10141922 3300010159 Unclassified 939
800 Ga0105239_10098779 3300010375 Bacteria 3227
801 Ga0105239_10136278 3300010375 Bacteria 2733
802 Ga0105239_10817672 3300010375 Bacteria 1068
803 Ga0105239_11012294 3300010375 Unclassified 955
804 Ga0105239_11777823 3300010375 Unclassified 714
805 Ga0105239_12073186 3300010375 Bacteria 661
806 Ga0105239_12120510 3300010375 Bacteria 653
807 Ga0105239_12263939 3300010375 Unclassified 632
808 Ga0105246_10092959 3300011119 Bacteria 2178
809 Ga0105246_10094253 3300011119 Bacteria 2165
810 Ga0105246_10297765 3300011119 Unclassified 1301
811 Ga0105246_10307590 3300011119 Bacteria 1282
812 Ga0105246_10945204 3300011119 Bacteria 776
813 Ga0105246_11261251 3300011119 Bacteria 683
814 Ga0105246_11921716 3300011119 Bacteria 569
815 Ga0105246_11949722 3300011119 Unclassified 565
816 Ga0105246_12087577 3300011119 Bacteria 549
817 Ga0105246_12543543 3300011119 Unclassified 505
818 Ga0157373_10002883 3300013100 Bacteria 13006
819 Ga0157373_10008292 3300013100 Bacteria 7720
820 Ga0157373_10299751 3300013100 Unclassified 1141
821 Ga0157373_10333694 3300013100 Unclassified 1080
822 Ga0157373_10529883 3300013100 Bacteria 853
823 Ga0157373_10590125 3300013100 Unclassified 808
824 Ga0157373_10590298 3300013100 Bacteria 808
825 Ga0157373_10825105 3300013100 Bacteria 685
826 Ga0157373_11081738 3300013100 Bacteria 601
827 Ga0157373_11143819 3300013100 Bacteria 585
828 Ga0157373_11272214 3300013100 Unclassified 556
829 Ga0157371_10191333 3300013102 Bacteria 1465
830 Ga0157371_10223987 3300013102 Bacteria 1351
831 Ga0157371_10908968 3300013102 Bacteria 668
832 Ga0157369_10592547 3300013105 Bacteria 1145
833 Ga0157374_10026890 3300013296 Bacteria 5182
834 Ga0157374_10296798 3300013296 Bacteria 1598
835 Ga0157374_11534395 3300013296 Unclassified 690
836 Ga0157374_11911154 3300013296 Bacteria 619
837 Ga0157374_12226860 3300013296 Bacteria 575
838 Ga0157374_12304669 3300013296 Bacteria 566
839 Ga0157374_12747311 3300013296 Unclassified 520
840 Ga0157378_10001968 3300013297 Bacteria 18403
841 Ga0157378_10012080 3300013297 Bacteria 7562
842 Ga0157378_10063010 3300013297 Bacteria 3312
843 Ga0157378_10078501 3300013297 Bacteria 2978
844 Ga0157378_10134439 3300013297 Bacteria 2292
845 Ga0157378_10149954 3300013297 Bacteria 2172
846 Ga0157378_10174969 3300013297 Bacteria 2015
847 Ga0157378_10274815 3300013297 Bacteria 1622
848 Ga0157378_10629917 3300013297 Bacteria 1086
849 Ga0157378_10765577 3300013297 Bacteria 989
850 Ga0157378_11015645 3300013297 Unclassified 864
851 Ga0157378_11195153 3300013297 Unclassified 800
852 Ga0157378_11246657 3300013297 Unclassified 784
853 Ga0157378_11297631 3300013297 Bacteria 769
854 Ga0157378_11337511 3300013297 Bacteria 758
855 Ga0157378_11431953 3300013297 Bacteria 734
856 Ga0157378_11921246 3300013297 Bacteria 641
857 Ga0157378_12296038 3300013297 Unclassified 591
858 Ga0157378_12443924 3300013297 Unclassified 574
859 Ga0163162_10002437 3300013306 Bacteria 17536
860 Ga0163162_10011708 3300013306 Bacteria 8555
861 Ga0163162_10012021 3300013306 Bacteria 8441
862 Ga0163162_10162770 3300013306 Bacteria 2353
863 Ga0163162_10175826 3300013306 Bacteria 2266
864 Ga0163162_10237280 3300013306 Bacteria 1954
865 Ga0163162_10334283 3300013306 Bacteria 1647
866 Ga0163162_10529386 3300013306 Unclassified 1308
867 Ga0163162_10683774 3300013306 Bacteria 1148
868 Ga0163162_10756571 3300013306 Bacteria 1091
869 Ga0163162_10899763 3300013306 Bacteria 998
870 Ga0163162_11781558 3300013306 Unclassified 704
871 Ga0163162_12170397 3300013306 Bacteria 637
872 Ga0157372_10001564 3300013307 Bacteria 24928
873 Ga0157372_10113138 3300013307 Bacteria 3111
874 Ga0157372_10338510 3300013307 Bacteria 1752
875 Ga0157372_12010740 3300013307 Unclassified 664
876 Ga0157375_10063548 3300013308 Bacteria 3673
877 Ga0157375_10133001 3300013308 Bacteria 2608
878 Ga0157375_10142189 3300013308 Bacteria 2527
879 Ga0157375_10147109 3300013308 Unclassified 2487
880 Ga0157375_10381537 3300013308 Bacteria 1576
881 Ga0157375_10501249 3300013308 Bacteria 1378
882 Ga0157375_10737006 3300013308 Unclassified 1137
883 Ga0157375_10949964 3300013308 Unclassified 1001
884 Ga0157375_11013889 3300013308 Unclassified 969
885 Ga0157375_11458999 3300013308 Bacteria 807
886 Ga0157375_11852458 3300013308 Unclassified 716
887 Ga0157375_11963834 3300013308 Bacteria 695
888 Ga0157375_12023587 3300013308 Bacteria 685
889 Ga0157375_13683476 3300013308 Unclassified 510
890 Ga0163163_10000862 3300014325 Bacteria 25852
891 Ga0163163_10004317 3300014325 Bacteria 12113
892 Ga0163163_10058608 3300014325 Bacteria 3808
893 Ga0163163_10062838 3300014325 Bacteria 3680
894 Ga0163163_10065206 3300014325 Unclassified 3614
895 Ga0163163_10067723 3300014325 Unclassified 3550
896 Ga0163163_10106824 3300014325 Bacteria 2825
897 Ga0163163_10235973 3300014325 Unclassified 1878
898 Ga0163163_10241251 3300014325 Bacteria 1857
899 Ga0163163_10318992 3300014325 Bacteria 1608
900 Ga0163163_10634198 3300014325 Bacteria 1132
901 Ga0163163_10963387 3300014325 Bacteria 916
902 Ga0163163_11387267 3300014325 Unclassified 764
903 Ga0163163_11777180 3300014325 Bacteria 677
904 Ga0163163_13324639 3300014325 Unclassified 501
905 Ga0157380_10004388 3300014326 Bacteria 9778
906 Ga0157380_10014633 3300014326 Bacteria 5745
907 Ga0157380_10053614 3300014326 Bacteria 3198
908 Ga0157380_10072771 3300014326 Bacteria 2785
909 Ga0157380_10079299 3300014326 Bacteria 2681
910 Ga0157380_10315847 3300014326 Bacteria 1446
911 Ga0157380_10396852 3300014326 Bacteria 1307
912 Ga0157380_10614569 3300014326 Bacteria 1078
913 Ga0157380_10810655 3300014326 Bacteria 954
914 Ga0157380_11090362 3300014326 Bacteria 837
915 Ga0157380_11249541 3300014326 Bacteria 788
916 Ga0157380_12645064 3300014326 Unclassified 568
917 Ga0157380_13039303 3300014326 Bacteria 535
918 Ga0182008_10914109 3300014497 Unclassified 517
919 Ga0157377_10075982 3300014745 Bacteria 1952
920 Ga0157377_10127036 3300014745 Bacteria 1552
921 Ga0157377_10265524 3300014745 Bacteria 1119
922 Ga0157377_10455023 3300014745 Bacteria 885
923 Ga0157377_10714259 3300014745 Unclassified 729
924 Ga0157379_10090780 3300014968 Bacteria 2740
925 Ga0157379_10353050 3300014968 Bacteria 1346
926 Ga0157379_10353334 3300014968 Bacteria 1346
927 Ga0157379_10475067 3300014968 Bacteria 1156
928 Ga0157379_11870751 3300014968 Bacteria 591
929 Ga0157379_12079156 3300014968 Bacteria 562
930 Ga0157376_10017462 3300014969 Bacteria 5474
931 Ga0157376_10638660 3300014969 Bacteria 1064
932 Ga0182007_10065245 3300015262 Unclassified 1193
933 Ga0163161_10015460 3300017792 Bacteria 5320
934 Ga0163161_10140454 3300017792 Unclassified 1829
935 Ga0163161_10320364 3300017792 Bacteria 1225
936 Ga0163161_10776946 3300017792 Bacteria 803
937 Ga0163161_11065836 3300017792 Bacteria 693
938 Ga0213876_10005036 3300021384 Bacteria 7288
939 Ga0207672_1000122 3300025223 Bacteria 10489
940 Ga0207666_1010072 3300025271 Bacteria 1288
941 Ga0207697_10031153 3300025315 Bacteria 2182
942 Ga0207713_1194727 3300025735 Unclassified 625
943 Ga0207653_10000130 3300025885 Bacteria 53391
944 Ga0207653_10187401 3300025885 Unclassified 776
945 Ga0207682_10413216 3300025893 Bacteria 638
946 Ga0207642_10005892 3300025899 Bacteria 4035
947 Ga0207642_10521238 3300025899 Unclassified 730
948 Ga0207710_10000003 3300025900 Bacteria 1071597
949 Ga0207710_10001166 3300025900 Bacteria 13372
950 Ga0207710_10152193 3300025900 Unclassified 1123
951 Ga0207710_10182455 3300025900 Unclassified 1030
952 Ga0207710_10553664 3300025900 Unclassified 599
953 Ga0207688_10244747 3300025901 Bacteria 1085
954 Ga0207688_10245451 3300025901 Unclassified 1083
955 Ga0207680_10116217 3300025903 Bacteria 1743
956 Ga0207680_10203388 3300025903 Unclassified 1351
957 Ga0207680_10374376 3300025903 Bacteria 1003
958 Ga0207680_10409524 3300025903 Unclassified 959
959 Ga0207647_10000385 3300025904 Bacteria 35983
960 Ga0207647_10048111 3300025904 Bacteria 2649
961 Ga0207647_10503356 3300025904 Bacteria 675
962 Ga0207685_10000007 3300025905 Bacteria 278341
963 Ga0207699_11015603 3300025906 Bacteria 613
964 Ga0207645_10108720 3300025907 Bacteria 1794
965 Ga0207645_10466515 3300025907 Unclassified 853
966 Ga0207645_10768014 3300025907 Bacteria 655
967 Ga0207645_10893899 3300025907 Bacteria 603
968 Ga0207643_10021068 3300025908 Bacteria 3579
969 Ga0207643_10042107 3300025908 Unclassified 2574
970 Ga0207643_10135729 3300025908 Unclassified 1467
971 Ga0207643_10190988 3300025908 Bacteria 1243
972 Ga0207643_10366713 3300025908 Unclassified 906
973 Ga0207643_10653980 3300025908 Bacteria 678
974 Ga0207684_10000131 3300025910 Bacteria 137508
975 Ga0207684_10032227 3300025910 Bacteria 4457
976 Ga0207684_10358230 3300025910 Unclassified 1255
977 Ga0207684_10377063 3300025910 Bacteria 1220
978 Ga0207654_10022993 3300025911 Bacteria 3334
979 Ga0207654_10073402 3300025911 Unclassified 2039
980 Ga0207654_10306150 3300025911 Unclassified 1082
981 Ga0207654_10422733 3300025911 Unclassified 930
982 Ga0207654_10525608 3300025911 Bacteria 838
983 Ga0207654_10835984 3300025911 Unclassified 666
984 Ga0207654_10851681 3300025911 Unclassified 660
985 Ga0207707_10000017 3300025912 Bacteria 237068
986 Ga0207707_10004243 3300025912 Bacteria 12691
987 Ga0207707_10109843 3300025912 Bacteria 2410
988 Ga0207707_10602079 3300025912 Unclassified 930
989 Ga0207707_10608347 3300025912 Unclassified 924
990 Ga0207695_10123112 3300025913 Bacteria 2559
991 Ga0207671_10148293 3300025914 Bacteria 1811
992 Ga0207671_10161583 3300025914 Bacteria 1735
993 Ga0207671_10674393 3300025914 Bacteria 823
994 Ga0207660_10026986 3300025917 Bacteria 3915
995 Ga0207660_10135185 3300025917 Bacteria 1880
996 Ga0207660_10210627 3300025917 Bacteria 1522
997 Ga0207660_10735298 3300025917 Bacteria 805
998 Ga0207660_11643311 3300025917 Unclassified 517
999 Ga0207662_10005692 3300025918 Bacteria 6667
1000 Ga0207662_10023437 3300025918 Bacteria 3546
1001 Ga0207662_10069082 3300025918 Bacteria 2134
1002 Ga0207662_10260706 3300025918 Bacteria 1141
1003 Ga0207662_10282924 3300025918 Unclassified 1098
1004 Ga0207662_10361470 3300025918 Bacteria 977
1005 Ga0207662_11323185 3300025918 Unclassified 512
1006 Ga0207657_10703100 3300025919 Unclassified 785
1007 Ga0207649_10448989 3300025920 Bacteria 973
1008 Ga0207649_11030574 3300025920 Bacteria 648
1009 Ga0207652_10000335 3300025921 Bacteria 48903
1010 Ga0207652_10114949 3300025921 Bacteria 2390
1011 Ga0207652_11100128 3300025921 Unclassified 695
1012 Ga0207646_10009704 3300025922 Bacteria 9490
1013 Ga0207646_10100260 3300025922 Bacteria 2596
1014 Ga0207646_10136843 3300025922 Bacteria 2206
1015 Ga0207646_10467588 3300025922 Unclassified 1137
1016 Ga0207646_10998948 3300025922 Unclassified 739
1017 Ga0207681_10011297 3300025923 Bacteria 5486
1018 Ga0207681_10044905 3300025923 Bacteria 2963
1019 Ga0207681_10106684 3300025923 Bacteria 2030
1020 Ga0207681_10322741 3300025923 Bacteria 1228
1021 Ga0207694_10049440 3300025924 Bacteria 3255
1022 Ga0207694_10076122 3300025924 Bacteria 2628
1023 Ga0207650_10000005 3300025925 Bacteria 663190
1024 Ga0207650_10063251 3300025925 Bacteria 2766
1025 Ga0207650_10163632 3300025925 Bacteria 1764
1026 Ga0207650_10189159 3300025925 Bacteria 1644
1027 Ga0207650_10302083 3300025925 Unclassified 1307
1028 Ga0207650_10612480 3300025925 Bacteria 916
1029 Ga0207650_10633851 3300025925 Unclassified 900
1030 Ga0207650_10744741 3300025925 Bacteria 829
1031 Ga0207650_10765378 3300025925 Unclassified 817
1032 Ga0207659_10254107 3300025926 Unclassified 1427
1033 Ga0207659_10378233 3300025926 Bacteria 1180
1034 Ga0207659_10451059 3300025926 Bacteria 1083
1035 Ga0207687_10080623 3300025927 Bacteria 2350
1036 Ga0207687_10797720 3300025927 Unclassified 805
1037 Ga0207644_10000074 3300025931 Bacteria 73369
1038 Ga0207644_10030944 3300025931 Bacteria 3726
1039 Ga0207644_10100032 3300025931 Bacteria 2177
1040 Ga0207644_11011304 3300025931 Bacteria 698
1041 Ga0207644_11402991 3300025931 Unclassified 587
1042 Ga0207690_10013967 3300025932 Bacteria 4839
1043 Ga0207690_10056799 3300025932 Bacteria 2642
1044 Ga0207690_10683952 3300025932 Bacteria 843
1045 Ga0207690_11395134 3300025932 Bacteria 586
1046 Ga0207706_10044092 3300025933 Bacteria 3953
1047 Ga0207706_10125993 3300025933 Bacteria 2253
1048 Ga0207706_10134256 3300025933 Bacteria 2177
1049 Ga0207706_10360556 3300025933 Bacteria 1263
1050 Ga0207706_10551675 3300025933 Unclassified 992
1051 Ga0207686_10000011 3300025934 Bacteria 216046
1052 Ga0207686_10010343 3300025934 Bacteria 5078
1053 Ga0207686_10017843 3300025934 Unclassified 4006
1054 Ga0207686_10439152 3300025934 Bacteria 1002
1055 Ga0207686_10797179 3300025934 Bacteria 757
1056 Ga0207709_10000042 3300025935 Bacteria 254145
1057 Ga0207709_10074732 3300025935 Bacteria 2164
1058 Ga0207709_10123016 3300025935 Unclassified 1755
1059 Ga0207709_10272911 3300025935 Bacteria 1246
1060 Ga0207709_10347634 3300025935 Unclassified 1118
1061 Ga0207709_10423684 3300025935 Unclassified 1023
1062 Ga0207709_10997707 3300025935 Unclassified 684
1063 Ga0207709_11154694 3300025935 Bacteria 637
1064 Ga0207709_11159774 3300025935 Unclassified 636
1065 Ga0207709_11452116 3300025935 Bacteria 568
1066 Ga0207709_11724738 3300025935 Unclassified 521
1067 Ga0207670_10017942 3300025936 Bacteria 4288
1068 Ga0207670_10059135 3300025936 Bacteria 2606
1069 Ga0207670_10390021 3300025936 Unclassified 1111
1070 Ga0207670_10650281 3300025936 Unclassified 869
1071 Ga0207670_10779026 3300025936 Bacteria 796
1072 Ga0207670_11248002 3300025936 Bacteria 630
1073 Ga0207670_11260140 3300025936 Bacteria 627
1074 Ga0207669_10356127 3300025937 Bacteria 1132
1075 Ga0207704_10083943 3300025938 Bacteria 2069
1076 Ga0207704_10467027 3300025938 Bacteria 1010
1077 Ga0207704_10835307 3300025938 Bacteria 771
1078 Ga0207704_11146927 3300025938 Unclassified 661
1079 Ga0207665_10000027 3300025939 Bacteria 96926
1080 Ga0207665_10140145 3300025939 Bacteria 1723
1081 Ga0207665_10349671 3300025939 Bacteria 1116
1082 Ga0207665_10471511 3300025939 Bacteria 966
1083 Ga0207665_10556603 3300025939 Bacteria 892
1084 Ga0207665_11250822 3300025939 Bacteria 592
1085 Ga0207691_10001531 3300025940 Bacteria 22999
1086 Ga0207691_10891538 3300025940 Bacteria 745
1087 Ga0207691_10899636 3300025940 Unclassified 741
1088 Ga0207711_10003667 3300025941 Bacteria 13273
1089 Ga0207711_10025575 3300025941 Bacteria 4951
1090 Ga0207711_10026824 3300025941 Bacteria 4835
1091 Ga0207711_10064400 3300025941 Unclassified 3166
1092 Ga0207711_10115243 3300025941 Bacteria 2394
1093 Ga0207711_10177075 3300025941 Unclassified 1938
1094 Ga0207711_10480815 3300025941 Bacteria 1157
1095 Ga0207711_10512928 3300025941 Bacteria 1118
1096 Ga0207711_10826120 3300025941 Unclassified 863
1097 Ga0207711_10853585 3300025941 Bacteria 847
1098 Ga0207711_10973120 3300025941 Unclassified 788
1099 Ga0207711_11761835 3300025941 Unclassified 563
1100 Ga0207711_11850396 3300025941 Unclassified 547
1101 Ga0207689_10008713 3300025942 Bacteria 8828
1102 Ga0207689_10016842 3300025942 Bacteria 6185
1103 Ga0207689_10046764 3300025942 Bacteria 3575
1104 Ga0207689_10146107 3300025942 Bacteria 1948
1105 Ga0207689_10169483 3300025942 Bacteria 1799
1106 Ga0207689_10219895 3300025942 Bacteria 1569
1107 Ga0207689_10244123 3300025942 Unclassified 1485
1108 Ga0207689_10331929 3300025942 Bacteria 1263
1109 Ga0207689_10459006 3300025942 Bacteria 1065
1110 Ga0207689_10475000 3300025942 Bacteria 1046
1111 Ga0207689_10951399 3300025942 Bacteria 725
1112 Ga0207689_11169271 3300025942 Bacteria 648
1113 Ga0207689_11364343 3300025942 Bacteria 595
1114 Ga0207661_10252955 3300025944 Bacteria 1567
1115 Ga0207661_11800446 3300025944 Unclassified 558
1116 Ga0207679_10299917 3300025945 Bacteria 1385
1117 Ga0207679_10325900 3300025945 Bacteria 1331
1118 Ga0207679_10604760 3300025945 Bacteria 988
1119 Ga0207679_10789734 3300025945 Bacteria 865
1120 Ga0207679_11291505 3300025945 Unclassified 670
1121 Ga0207667_12049369 3300025949 Unclassified 532
1122 Ga0207651_10039329 3300025960 Bacteria 3118
1123 Ga0207651_10094856 3300025960 Bacteria 2195
1124 Ga0207651_10373390 3300025960 Unclassified 1207
1125 Ga0207651_10493191 3300025960 Unclassified 1058
1126 Ga0207651_10533004 3300025960 Bacteria 1019
1127 Ga0207651_10608130 3300025960 Unclassified 956
1128 Ga0207651_10885752 3300025960 Unclassified 794
1129 Ga0207712_10019580 3300025961 Bacteria 4423
1130 Ga0207712_10028818 3300025961 Bacteria 3718
1131 Ga0207712_10044712 3300025961 Bacteria 3062
1132 Ga0207712_10380598 3300025961 Bacteria 1181
1133 Ga0207712_11181802 3300025961 Bacteria 682
1134 Ga0207712_11716441 3300025961 Bacteria 563
1135 Ga0207640_10081777 3300025981 Bacteria 2210
1136 Ga0207640_10112579 3300025981 Bacteria 1933
1137 Ga0207640_10162778 3300025981 Bacteria 1653
1138 Ga0207640_10209832 3300025981 Bacteria 1483
1139 Ga0207640_10219765 3300025981 Bacteria 1454
1140 Ga0207640_10471093 3300025981 Bacteria 1039
1141 Ga0207640_10669167 3300025981 Unclassified 887
1142 Ga0207640_10736941 3300025981 Bacteria 848
1143 Ga0207640_10774639 3300025981 Bacteria 829
1144 Ga0207640_11256543 3300025981 Bacteria 660
1145 Ga0207640_11901586 3300025981 Bacteria 538
1146 Ga0207640_12122058 3300025981 Unclassified 510
1147 Ga0207658_10068564 3300025986 Bacteria 2677
1148 Ga0207658_10570205 3300025986 Bacteria 1014
1149 Ga0207658_11480944 3300025986 Unclassified 621
1150 Ga0207677_10251485 3300026023 Bacteria 1435
1151 Ga0207677_11069330 3300026023 Bacteria 734
1152 Ga0207677_11114819 3300026023 Bacteria 720
1153 Ga0207677_11886654 3300026023 Unclassified 555
1154 Ga0207703_10000101 3300026035 Bacteria 101290
1155 Ga0207703_10073238 3300026035 Bacteria 2833
1156 Ga0207703_10159449 3300026035 Unclassified 1975
1157 Ga0207703_10184078 3300026035 Bacteria 1845
1158 Ga0207703_10230270 3300026035 Bacteria 1661
1159 Ga0207703_10258220 3300026035 Bacteria 1574
1160 Ga0207703_10283261 3300026035 Unclassified 1506
1161 Ga0207703_10386619 3300026035 Bacteria 1295
1162 Ga0207703_10894211 3300026035 Bacteria 850
1163 Ga0207639_10061466 3300026041 Bacteria 2901
1164 Ga0207639_10252918 3300026041 Bacteria 1537
1165 Ga0207639_11284413 3300026041 Unclassified 687
1166 Ga0207708_10000043 3300026075 Bacteria 121725
1167 Ga0207708_10002522 3300026075 Bacteria 13464
1168 Ga0207708_10007831 3300026075 Bacteria 7914
1169 Ga0207708_10053037 3300026075 Bacteria 3089
1170 Ga0207708_10087926 3300026075 Unclassified 2393
1171 Ga0207708_10192647 3300026075 Bacteria 1623
1172 Ga0207708_10293813 3300026075 Unclassified 1320
1173 Ga0207708_10461891 3300026075 Bacteria 1059
1174 Ga0207708_11591261 3300026075 Bacteria 574
1175 Ga0207702_10150385 3300026078 Bacteria 2117
1176 Ga0207702_11959942 3300026078 Bacteria 576
1177 Ga0207641_10109885 3300026088 Bacteria 2442
1178 Ga0207641_10180752 3300026088 Bacteria 1932
1179 Ga0207641_10246746 3300026088 Bacteria 1666
1180 Ga0207641_10348820 3300026088 Unclassified 1410
1181 Ga0207641_10476106 3300026088 Unclassified 1210
1182 Ga0207641_10529446 3300026088 Unclassified 1147
1183 Ga0207641_10652594 3300026088 Bacteria 1033
1184 Ga0207641_10998635 3300026088 Bacteria 833
1185 Ga0207641_11012145 3300026088 Unclassified 828
1186 Ga0207641_11022677 3300026088 Bacteria 823
1187 Ga0207641_11136937 3300026088 Unclassified 780
1188 Ga0207641_11156421 3300026088 Unclassified 773
1189 Ga0207641_11176415 3300026088 Bacteria 766
1190 Ga0207641_11461741 3300026088 Unclassified 685
1191 Ga0207641_11477258 3300026088 Bacteria 681
1192 Ga0207641_11926792 3300026088 Bacteria 592
1193 Ga0207641_12024034 3300026088 Unclassified 577
1194 Ga0207641_12040738 3300026088 Bacteria 575
1195 Ga0207648_10015138 3300026089 Bacteria 7099
1196 Ga0207648_10048951 3300026089 Bacteria 3700
1197 Ga0207648_10121810 3300026089 Viruses 2293
1198 Ga0207648_10313067 3300026089 Bacteria 1409
1199 Ga0207648_10439552 3300026089 Unclassified 1186
1200 Ga0207648_10457671 3300026089 Bacteria 1163
1201 Ga0207648_10695167 3300026089 Bacteria 942
1202 Ga0207648_10879578 3300026089 Unclassified 836
1203 Ga0207648_11068407 3300026089 Unclassified 757
1204 Ga0207648_11490987 3300026089 Unclassified 636
1205 Ga0207648_11636644 3300026089 Bacteria 605
1206 Ga0207648_11636662 3300026089 Unclassified 605
1207 Ga0207676_10004891 3300026095 Bacteria 9491
1208 Ga0207676_10029953 3300026095 Bacteria 4079
1209 Ga0207676_10158301 3300026095 Bacteria 1959
1210 Ga0207676_10309008 3300026095 Bacteria 1446
1211 Ga0207676_10361000 3300026095 Bacteria 1346
1212 Ga0207676_10369391 3300026095 Bacteria 1332
1213 Ga0207676_10902931 3300026095 Unclassified 866
1214 Ga0207676_10996562 3300026095 Bacteria 825
1215 Ga0207676_11028316 3300026095 Unclassified 813
1216 Ga0207676_11598995 3300026095 Bacteria 649
1217 Ga0207676_12175917 3300026095 Unclassified 553
1218 Ga0207674_10002367 3300026116 Bacteria 23830
1219 Ga0207674_10236066 3300026116 Bacteria 1776
1220 Ga0207674_10300871 3300026116 Bacteria 1553
1221 Ga0207674_10349529 3300026116 Bacteria 1429
1222 Ga0207674_10359862 3300026116 Unclassified 1407
1223 Ga0207674_10417305 3300026116 Bacteria 1297
1224 Ga0207674_10907232 3300026116 Unclassified 849
1225 Ga0207674_11204972 3300026116 Bacteria 727
1226 Ga0207674_11266136 3300026116 Bacteria 707
1227 Ga0207674_11383254 3300026116 Bacteria 673
1228 Ga0207674_11430754 3300026116 Bacteria 660
1229 Ga0207674_12119246 3300026116 Unclassified 526
1230 Ga0207675_100008740 3300026118 Bacteria 9514
1231 Ga0207675_100021904 3300026118 Bacteria 5950
1232 Ga0207675_100039921 3300026118 Bacteria 4379
1233 Ga0207675_100059927 3300026118 Bacteria 3553
1234 Ga0207675_100098854 3300026118 Bacteria 2749
1235 Ga0207675_100140754 3300026118 Bacteria 2292
1236 Ga0207675_100320494 3300026118 Bacteria 1513
1237 Ga0207675_100391398 3300026118 Bacteria 1368
1238 Ga0207675_100409058 3300026118 Bacteria 1338
1239 Ga0207675_100477989 3300026118 Bacteria 1238
1240 Ga0207675_100592840 3300026118 Bacteria 1111
1241 Ga0207675_100768874 3300026118 Bacteria 975
1242 Ga0207675_101186281 3300026118 Unclassified 784
1243 Ga0207675_102135441 3300026118 Unclassified 576
1244 Ga0207683_10044488 3300026121 Bacteria 3881
1245 Ga0207683_10623123 3300026121 Bacteria 999
1246 Ga0207683_10903689 3300026121 Unclassified 820
1247 Ga0207698_10381916 3300026142 Bacteria 1340
1248 Ga0207698_10959572 3300026142 Bacteria 864
1249 Ga0207698_12671160 3300026142 Unclassified 508
1250 Ga0209588_1012523 3300027671 Bacteria 2576
1251 Ga0207428_10013786 3300027907 Bacteria 7044
1252 Ga0207428_10015457 3300027907 Bacteria 6603
1253 Ga0207428_10047588 3300027907 Bacteria 3443
1254 Ga0207428_10309009 3300027907 Bacteria 1169
1255 Ga0268266_11792847 3300028379 Bacteria 588
1256 Ga0268266_11811724 3300028379 Bacteria 585
1257 Ga0268265_10006379 3300028380 Bacteria 7995
1258 Ga0268265_10024099 3300028380 Bacteria 4300
1259 Ga0268265_10058203 3300028380 Unclassified 2949
1260 Ga0268265_10301028 3300028380 Unclassified 1444
1261 Ga0268265_10332204 3300028380 Bacteria 1381
1262 Ga0268265_10370946 3300028380 Bacteria 1313
1263 Ga0268265_10393052 3300028380 Bacteria 1279
1264 Ga0268265_10412492 3300028380 Bacteria 1252
1265 Ga0268265_10588777 3300028380 Bacteria 1061
1266 Ga0268265_10612213 3300028380 Bacteria 1042
1267 Ga0268265_12330200 3300028380 Bacteria 542
1268 Ga0268264_10040717 3300028381 Unclassified 3839
1269 Ga0268264_10065566 3300028381 Bacteria 3060
1270 Ga0268264_10073497 3300028381 Bacteria 2902
1271 Ga0268264_10081426 3300028381 Bacteria 2767
1272 Ga0268264_10094055 3300028381 Bacteria 2591
1273 Ga0268264_10113918 3300028381 Bacteria 2373
1274 Ga0268264_10216347 3300028381 Bacteria 1761
1275 Ga0268264_10229768 3300028381 Bacteria 1713
1276 Ga0268264_10278375 3300028381 Unclassified 1566
1277 Ga0268264_10302825 3300028381 Bacteria 1505
1278 Ga0268264_10364595 3300028381 Unclassified 1379
1279 Ga0268264_10886578 3300028381 Bacteria 895
1280 Ga0268264_10960291 3300028381 Bacteria 860
1281 Ga0268264_10980158 3300028381 Unclassified 851
1282 Ga0268264_11737297 3300028381 Unclassified 634
1283 Ga0307408_100011791 3300031548 Bacteria 5781
1284 Ga0307408_100122608 3300031548 Bacteria 2016
1285 Ga0307408_100161167 3300031548 Bacteria 1782
1286 Ga0307408_102172747 3300031548 Bacteria 536
1287 Ga0307405_10079066 3300031731 Bacteria 2142
1288 Ga0307405_10096007 3300031731 Bacteria 1975
1289 Ga0307405_10293436 3300031731 Unclassified 1230
1290 Ga0307405_10796673 3300031731 Bacteria 791
1291 Ga0307405_12161694 3300031731 Bacteria 500
1292 Ga0307410_10142349 3300031852 Bacteria 1776
1293 Ga0307410_11133279 3300031852 Bacteria 679
1294 Ga0307406_10008963 3300031901 Bacteria 5594
1295 Ga0307406_10563767 3300031901 Bacteria 934
1296 Ga0307407_10364056 3300031903 Bacteria 1028
1297 Ga0307407_10537790 3300031903 Bacteria 862
1298 Ga0307407_10760830 3300031903 Unclassified 734
1299 Ga0307412_10008317 3300031911 Bacteria 5914
1300 Ga0307412_10012400 3300031911 Bacteria 4969
1301 Ga0307412_10202912 3300031911 Unclassified 1507
1302 Ga0307412_10376790 3300031911 Bacteria 1148
1303 Ga0307409_100157714 3300031995 Bacteria 1980
1304 Ga0307409_100512853 3300031995 Bacteria 1170
1305 Ga0307416_100002153 3300032002 Bacteria 11158
1306 Ga0307416_100134836 3300032002 Bacteria 2231
1307 Ga0307416_100748409 3300032002 Unclassified 1070
1308 Ga0307416_101259722 3300032002 Unclassified 845
1309 Ga0307416_101655824 3300032002 Unclassified 745
1310 Ga0307416_103269924 3300032002 Bacteria 542
1311 Ga0307414_10001957 3300032004 Bacteria 10653
1312 Ga0307414_10153795 3300032004 Unclassified 1818
1313 Ga0307414_11803176 3300032004 Bacteria 571
1314 Ga0307411_10005777 3300032005 Bacteria 6123
1315 Ga0307411_10012992 3300032005 Bacteria 4574
1316 Ga0307411_10479196 3300032005 Unclassified 1047
1317 Ga0307411_10738589 3300032005 Unclassified 861
1318 Ga0307411_11879461 3300032005 Bacteria 557
1319 Ga0307415_100009574 3300032126 Bacteria 5441
1320 Ga0307415_100180309 3300032126 Bacteria 1656
1321 Ga0307415_100444967 3300032126 Unclassified 1119
1322 Ga0307415_100961815 3300032126 Unclassified 791
1323 Ga0307415_101742985 3300032126 Unclassified 601
1324 Ga0373928_0096405 3300035084 Bacteria 766
1325 Ga0373940_0106449 3300035088 Bacteria 856
1326 Ga0373949_0131460 3300035090 Unclassified 711
1327 Ga0373951_0001101 3300035091 Bacteria 7209
1328 Ga0373932_0382033 3300035112 Bacteria 541
1329 Ga0373941_0342101 3300035115 Bacteria 606
1330 Ga0373942_0007648 3300035207 Bacteria 2511
1331 Ga0373931_0158434 3300035691 Bacteria 1325
1332 Ga0395899_0745589 3300037312 Bacteria 610
1333 Ga0395900_0168787 3300037418 Unclassified 2229
1334 Ga0395900_0395234 3300037418 Bacteria 1348
1335 Ga0395900_0654449 3300037418 Bacteria 987
1336 Ga0395900_0893323 3300037418 Bacteria 812
1337 Ga0395900_1010833 3300037418 Unclassified 751
1338 Ga0395898_0482532 3300037466 Bacteria 1179
1339 Ga0395898_1259002 3300037466 Unclassified 670
1340 Ga0395905_0359368 3300037471 Bacteria 1349
1341 Ga0395905_0610509 3300037471 Bacteria 993
1342 Ga0395905_1509350 3300037471 Unclassified 576
1343 Ga0395901_0256020 3300038443 Unclassified 1823
1344 Ga0395901_1650284 3300038443 Bacteria 593
1345 Ga0395901_1952323 3300038443 Bacteria 534
1346 Ga0242420_000913 3300038996 Bacteria 3685
1347 Ga0436365_0564234 3300039437 Bacteria 5801
1348 Ga0436365_0671345 3300039437 Bacteria 6054
1349 Ga0436362_0146661 3300039453 Bacteria 696
1350 Ga0439439_0006583 3300041406 Bacteria 2690
1351 Ga0439453_0029842 3300041408 Bacteria 1028
1352 Ga0439448_0058991 3300042005 Bacteria 1266
1353 Ga0439462_0026944 3300042015 Unclassified 1516
1354 Ga0439446_0053096 3300042156 Unclassified 1214
1355 Ga0439458_0001390 3300042157 Bacteria 6114
1356 Ga0439458_0024627 3300042157 Bacteria 1408
1357 Ga0439434_0350666 3300042435 Unclassified 515
1358 Ga0439464_0256326 3300042439 Bacteria 566
1359 Ga0451577_0161360 3300042876 Unclassified 2019
1360 Ga0453683_0461029 3300044673 Bacteria 823
1361 Ga0453684_1265619 3300044712 Bacteria 771
1362 Ga0451576_0303809 3300045051 Bacteria 1669
1363 Ga0451576_0605443 3300045051 Bacteria 1152
1364 Ga0451576_0772647 3300045051 Unclassified 1009
1365 Ga0451576_1322367 3300045051 Unclassified 751
1366 Ga0451576_1770856 3300045051 Unclassified 639
1367 Ga0495603_0453818 3300046455 Bacteria 734
1368 Ga0495620_0254198 3300046515 Bacteria 670
1369 Ga0495663_0000212 3300046525 Bacteria 23260
1370 Ga0495598_0047534 3300046537 Bacteria 1279
1371 Ga0495598_0128292 3300046537 Bacteria 867
1372 Ga0495621_0000419 3300046539 Bacteria 10471
1373 Ga0495621_0047942 3300046539 Bacteria 1520
1374 Ga0495621_0231151 3300046539 Bacteria 751
1375 Ga0495633_0122663 3300046558 Bacteria 1204
1376 Ga0495656_0039878 3300046615 Bacteria 1954
1377 Ga0495656_0750143 3300046615 Bacteria 526
1378 Ga0495668_0783072 3300046616 Unclassified 528
1379 Ga0495659_0568651 3300046664 Unclassified 501
1380 Ga0495658_0108012 3300046683 Unclassified 1670
1381 Ga0495669_0623272 3300046684 Unclassified 525
1382 Ga0495589_0192095 3300046794 Unclassified 966
1383 Ga0495674_0599559 3300047319 Bacteria 873
1384 Ga0495685_221417 3300047447 Unclassified 604
1385 Ga0496100_1424384 3300048903 Unclassified 547
1386 Ga0496102_1037549 3300048905 Unclassified 740
1387 Ga0496102_1301009 3300048905 Unclassified 646
1388 Ga0496104_0018973 3300048907 Bacteria 6284
1389 Ga0496104_1190345 3300048907 Unclassified 665
1390 Ga0496104_1544412 3300048907 Bacteria 567
1391 Ga0496106_0327765 3300048909 Bacteria 1229
1392 Ga0496106_0381121 3300048909 Unclassified 1133
1393 Ga0496107_0101852 3300048910 Bacteria 2106
1394 Ga0496107_0604809 3300048910 Unclassified 810
1395 Ga0496107_0789125 3300048910 Bacteria 696
1396 Ga0496108_0309535 3300048911 Unclassified 1376
1397 Ga0496108_0456924 3300048911 Bacteria 1116
1398 Ga0496109_1013366 3300048912 Unclassified 768
1399 Ga0496112_0264580 3300048915 Bacteria 1669
1400 Ga0496112_0378878 3300048915 Bacteria 1356
1401 Ga0496112_1170947 3300048915 Unclassified 686
1402 Ga0496113_1084320 3300048916 Unclassified 629
1403 Ga0501290_044992 3300049513 Unclassified 672
1404 Ga0501290_061300 3300049513 Unclassified 606
1405 Ga0501290_066846 3300049513 Bacteria 589
1406 Ga0501291_006199 3300049514 Viruses 1588
1407 Ga0501291_111953 3300049514 Bacteria 582
1408 Ga0501291_130231 3300049514 Unclassified 553
1409 Ga0501292_010879 3300049515 Bacteria 1369
1410 Ga0501292_071573 3300049515 Bacteria 645
1411 Ga0501292_109854 3300049515 Bacteria 554
1412 Ga0501296_000829 3300049519 Bacteria 3047
1413 Ga0501296_012126 3300049519 Unclassified 1037
1414 Ga0501296_022330 3300049519 Unclassified 814
1415 Ga0501296_052072 3300049519 Bacteria 602
1416 Ga0501298_002164 3300049521 Bacteria 2955
1417 Ga0501298_008000 3300049521 Unclassified 1766
1418 Ga0501299_000709 3300049522 Bacteria 4001
1419 Ga0501299_036183 3300049522 Bacteria 973
1420 Ga0501301_022858 3300049524 Bacteria 614
1421 Ga0501303_010321 3300049526 Bacteria 873
1422 Ga0501038_0005082 3300049574 Bacteria 12227
1423 Ga0501072_1563219 3300049588 Unclassified 509
1424 Ga0501074_0717952 3300049590 Unclassified 705
1425 Ga0501077_0429495 3300049593 Unclassified 845
1426 Ga0501198_006536 3300049649 Bacteria 1663
1427 Ga0501198_020237 3300049649 Bacteria 1053
1428 Ga0501198_066846 3300049649 Bacteria 670
1429 Ga0501199_003906 3300049650 Unclassified 1449
1430 Ga0501199_020139 3300049650 Unclassified 770
1431 Ga0501202_015266 3300049652 Unclassified 1478
1432 Ga0501202_038372 3300049652 Bacteria 1026
1433 Ga0501202_106836 3300049652 Unclassified 688
1434 Ga0501206_081078 3300049653 Unclassified 564
1435 Ga0501207_002752 3300049654 Bacteria 2297
1436 Ga0501207_120851 3300049654 Unclassified 543
1437 Ga0501208_020740 3300049655 Bacteria 1072
1438 Ga0501214_002537 3300049659 Unclassified 1546
1439 Ga0501214_002696 3300049659 Unclassified 1516
1440 Ga0501216_004065 3300049660 Bacteria 2158
1441 Ga0501216_112336 3300049660 Bacteria 613
1442 Ga0501217_000410 3300049661 Bacteria 6931
1443 Ga0501217_003166 3300049661 Bacteria 3301
1444 Ga0501217_016565 3300049661 Bacteria 1690
1445 Ga0501217_310953 3300049661 Unclassified 522
1446 Ga0501223_012361 3300049663 Bacteria 1707
1447 Ga0501223_041375 3300049663 Unclassified 894
1448 Ga0501223_109708 3300049663 Unclassified 575
1449 Ga0501224_001708 3300049664 Bacteria 2942
1450 Ga0501224_009538 3300049664 Bacteria 1421
1451 Ga0501224_021697 3300049664 Unclassified 957
1452 Ga0501227_000106 3300049665 Bacteria 14058
1453 Ga0501227_014779 3300049665 Unclassified 1737
1454 Ga0501227_021691 3300049665 Unclassified 1481
1455 Ga0501230_002947 3300049667 Bacteria 2216
1456 Ga0501233_213010 3300049668 Bacteria 567
1457 Ga0501233_232233 3300049668 Bacteria 548
1458 Ga0501235_004157 3300049669 Bacteria 3135
1459 Ga0501235_006345 3300049669 Bacteria 2576
1460 Ga0501235_010107 3300049669 Unclassified 2063
1461 Ga0501235_013427 3300049669 Bacteria 1803
1462 Ga0501235_091385 3300049669 Bacteria 735
1463 Ga0501235_177904 3300049669 Unclassified 565
1464 Ga0501236_001448 3300049670 Bacteria 2694
1465 Ga0501239_009173 3300049672 Bacteria 1071
1466 Ga0501239_082600 3300049672 Bacteria 517
1467 Ga0501240_004240 3300049673 Bacteria 1652
1468 Ga0501242_074176 3300049674 Bacteria 537
1469 Ga0501243_012557 3300049675 Unclassified 1338
1470 Ga0501243_061725 3300049675 Bacteria 696
1471 Ga0501247_029429 3300049677 Unclassified 744
1472 Ga0501248_006771 3300049678 Unclassified 941
1473 Ga0501249_011428 3300049679 Bacteria 1863
1474 Ga0501249_035636 3300049679 Bacteria 1119
1475 Ga0501249_072683 3300049679 Unclassified 804
1476 Ga0501249_206681 3300049679 Bacteria 517
1477 Ga0501251_007135 3300049681 Bacteria 1235
1478 Ga0501251_011940 3300049681 Bacteria 1043
1479 Ga0501253_005133 3300049683 Bacteria 1697
1480 Ga0501255_020660 3300049684 Bacteria 849
1481 Ga0501256_002581 3300049685 Bacteria 1449
1482 Ga0501256_006210 3300049685 Bacteria 1073
1483 Ga0501257_007565 3300049686 Bacteria 2427
1484 Ga0501257_031865 3300049686 Unclassified 1273
1485 Ga0501258_019886 3300049687 Bacteria 783
1486 Ga0501258_065308 3300049687 Unclassified 532
1487 Ga0501259_007519 3300049688 Bacteria 1747
1488 Ga0501259_010840 3300049688 Bacteria 1496
1489 Ga0501260_000407 3300049689 Unclassified 3356
1490 Ga0501260_000408 3300049689 Bacteria 3351
1491 Ga0501260_007879 3300049689 Bacteria 1043
1492 Ga0501260_037694 3300049689 Bacteria 577
1493 Ga0501221_142846 3300049704 Bacteria 628
1494 Ga0501221_156534 3300049704 Unclassified 607
1495 Ga0501225_0000853 3300049705 Bacteria 9450
1496 Ga0501225_0002070 3300049705 Bacteria 6240
1497 Ga0501225_0007379 3300049705 Bacteria 3186
1498 Ga0501225_0034099 3300049705 Bacteria 1401
1499 Ga0501225_0184889 3300049705 Bacteria 653
1500 Ga0501225_0263194 3300049705 Bacteria 571
1501 Ga0501234_002675 3300049707 Bacteria 2803
1502 Ga0501234_009967 3300049707 Unclassified 1481
1503 Ga0501234_021859 3300049707 Bacteria 1020
1504 Ga0501245_006567 3300049708 Bacteria 1628
1505 Ga0501245_012305 3300049708 Unclassified 1254
1506 Ga0501079_0107587 3300049741 Bacteria 2165
1507 Ga0501079_0615472 3300049741 Bacteria 855
1508 Ga0501081_1043620 3300049743 Unclassified 618
1509 Ga0501241_155597 3300049758 Bacteria 529
1510 Ga0501262_023315 3300049759 Bacteria 860
1511 Ga0501263_051948 3300049760 Unclassified 625
1512 Ga0501266_008989 3300049763 Bacteria 1260
1513 Ga0501267_019021 3300049764 Unclassified 747
1514 Ga0501268_006152 3300049765 Unclassified 1751
1515 Ga0501269_032905 3300049766 Unclassified 670
1516 Ga0501270_005388 3300049767 Bacteria 1486
1517 Ga0501271_068344 3300049768 Unclassified 510
1518 Ga0501272_003329 3300049769 Unclassified 1631
1519 Ga0501272_031281 3300049769 Bacteria 677
1520 Ga0501273_003524 3300049770 Unclassified 1667
1521 Ga0501273_003954 3300049770 Bacteria 1603
1522 Ga0501273_072765 3300049770 Unclassified 560
1523 Ga0501279_014694 3300049775 Bacteria 1080
1524 Ga0501279_022053 3300049775 Bacteria 912
1525 Ga0501279_079571 3300049775 Unclassified 563
1526 Ga0501282_027386 3300049778 Unclassified 644
1527 Ga0501282_030952 3300049778 Viruses 613
1528 Ga0501283_001419 3300049779 Bacteria 3120
1529 Ga0501283_060345 3300049779 Unclassified 684
1530 Ga0501200_01813 3300049849 Unclassified 843
1531 Ga0501204_012812 3300049850 Bacteria 1011
1532 Ga0501204_015760 3300049850 Bacteria 941
1533 Ga0501204_017911 3300049850 Bacteria 901
1534 Ga0501212_003935 3300049851 Bacteria 1890
1535 Ga0501212_004876 3300049851 Bacteria 1750
1536 Ga0501212_112833 3300049851 Unclassified 520
1537 Ga0501226_000544 3300049853 Bacteria 5191
1538 Ga0501226_006240 3300049853 Unclassified 1351
1539 Ga0501226_006399 3300049853 Unclassified 1334
1540 nmdc:mga05p37_1129131_c1 3300050507 Unclassified 818
1541 nmdc:mga05p37_1359879_c1 3300050507 Unclassified 719
1542 nmdc:mga05p37_1831209_c1 3300050507 Bacteria 584
1543 nmdc:mga05p37_351269_c1 3300050507 Bacteria 1736
1544 nmdc:mga05p37_504581_c1 3300050507 Bacteria 1387
1545 nmdc:mga05p37_65136_c1 3300050507 Bacteria 4484
1546 nmdc:mga05p37_672666_c1 3300050507 Bacteria 1155
1547 nmdc:mga05p37_982361_c1 3300050507 Bacteria 899
1548 nmdc:mga09592_121972_c1 3300050508 Bacteria 2239
1549 nmdc:mga09592_1430098_c1 3300050508 Bacteria 565
1550 nmdc:mga09592_1641612_c1 3300050508 Unclassified 520
1551 nmdc:mga09592_539202_c1 3300050508 Bacteria 1003
1552 nmdc:mga09592_57546_c1 3300050508 Bacteria 3286
1553 nmdc:mga09592_799186_c1 3300050508 Bacteria 798
1554 nmdc:mga0qj67_102600_c1 3300050509 Bacteria 2307
1555 nmdc:mga0qj67_290008_c1 3300050509 Bacteria 1326
1556 nmdc:mga06r32_1515427_c1 3300050510 Bacteria 610
1557 nmdc:mga06r32_1864865_c1 3300050510 Bacteria 536
1558 nmdc:mga06r32_304072_c1 3300050510 Bacteria 1581
1559 nmdc:mga06r32_365984_c1 3300050510 Bacteria 1425
1560 nmdc:mga06r32_451053_c1 3300050510 Unclassified 1266
1561 nmdc:mga06r32_463071_c1 3300050510 Bacteria 1247
1562 nmdc:mga06r32_923934_c1 3300050510 Unclassified 828
1563 nmdc:mga08y16_13794_c1 3300050511 Bacteria 8504
1564 nmdc:mga08y16_1449686_c1 3300050511 Unclassified 648
1565 nmdc:mga08y16_1473233_c1 3300050511 Unclassified 642
1566 nmdc:mga08y16_15928_c1 3300050511 Bacteria 7903
1567 nmdc:mga08y16_3655_c1 3300050511 Bacteria 15997
1568 nmdc:mga08y16_473637_c1 3300050511 Unclassified 1275
1569 nmdc:mga08y16_70144_c1 3300050511 Bacteria 3653
1570 nmdc:mga0n895_1308933_c1 3300050512 Unclassified 695
1571 nmdc:mga0n895_1430135_c1 3300050512 Bacteria 659
1572 nmdc:mga0n895_175069_c1 3300050512 Bacteria 2177
1573 nmdc:mga0n895_2348_c1 3300050512 Bacteria 14747
1574 nmdc:mga0n895_390244_c1 3300050512 Unclassified 1408
1575 nmdc:mga0rr50_340302_c1 3300050513 Bacteria 1260
1576 nmdc:mga0rr50_50385_c1 3300050513 Bacteria 3085
1577 nmdc:mga0rr50_55_c1 3300050513 Bacteria 69116
1578 nmdc:mga0rr50_827578_c1 3300050513 Unclassified 790
1579 nmdc:mga0rr50_852928_c1 3300050513 Bacteria 777
1580 nmdc:mga08x19_12_c1 3300050514 Bacteria 395395
1581 nmdc:mga08x19_138782_c1 3300050514 Bacteria 1641
1582 nmdc:mga08x19_442384_c1 3300050514 Unclassified 914
1583 nmdc:mga0a205_1340761_c1 3300050515 Bacteria 563
1584 nmdc:mga0a205_149622_c1 3300050515 Bacteria 2235
1585 nmdc:mga0a205_21372_c1 3300050515 Bacteria 6123
1586 nmdc:mga0a205_347572_c1 3300050515 Unclassified 1351
1587 nmdc:mga0a205_383466_c1 3300050515 Bacteria 1270
1588 nmdc:mga0a205_410603_c1 3300050515 Bacteria 1217
1589 nmdc:mga0a205_522998_c1 3300050515 Bacteria 1043
1590 nmdc:mga0a205_728520_c1 3300050515 Bacteria 841
1591 nmdc:mga0a205_803134_c1 3300050515 Bacteria 789
1592 nmdc:mga0a205_902153_c1 3300050515 Bacteria 731
1593 Ga0530510_1235318 3300061734 Bacteria 573
1594 Ga0070702_100521761
1595 MRS2a_Contig_11610
1596 SwRhRL3b_contig_1296301
1597 SwRhRL3b_contig_2608105
1598 SwRhRL3b_contig_3931003
1599 MBSR1b_contig_5607604
1600 CNAas_1000004
1601 JGI24034J26672_10000002
1602 JGI24742J22300_10007517
1603 JGI24751J29686_10000017
1604 JGI24751J29686_10000149
1605 JGI25406J46586_10014972
1606 JGI25406J46586_10015093
1607 JGI25406J46586_10056700
1608 rootH2_10239322
1609 rootL2_10089685
1610 Ga0058859_11445007
1611 Ga0058860_12182722
1612 Ga0065714_10064460
1613 Ga0065704_10011042
1614 Ga0065704_10083950
1615 Ga0065704_10118959
1616 Ga0065704_10300358
1617 Ga0065704_10375249
1618 Ga0065704_10509140
1619 Ga0065712_10068069
1620 Ga0065712_10072987
1621 Ga0065712_10186778
1622 Ga0065712_10189659
1623 Ga0065712_10541569
1624 Ga0065712_10633265
1625 Ga0065712_10758371
1626 Ga0065712_10762445
1627 Ga0065712_10807805
1628 Ga0065715_10089839
1629 Ga0065715_10095392
1630 Ga0065715_10107731
1631 Ga0065715_10117551
1632 Ga0065715_10131647
1633 Ga0065715_10148470
1634 Ga0065715_10237332
1635 Ga0065715_10306895
1636 Ga0065715_10344726
1637 Ga0065715_10651527
1638 Ga0065715_10765313
1639 Ga0065715_10823858
1640 Ga0065715_11082937
1641 Ga0065707_10010856
1642 Ga0065707_10201680
1643 Ga0065707_10235308
1644 Ga0065707_10294041
1645 Ga0065707_10335170
1646 Ga0065707_10519932
1647 Ga0065707_10529747
1648 Ga0065707_10658809
1649 Ga0070676_10032637
1650 Ga0070676_10243604
1651 Ga0070676_10358790
1652 Ga0070676_11021682
1653 Ga0070676_11144689
1654 Ga0070683_100151571
1655 Ga0070690_100001046
1656 Ga0070690_100037425
1657 Ga0070690_100173822
1658 Ga0070690_100188166
1659 Ga0070690_100189860
1660 Ga0070690_100958731
1661 Ga0070690_101543130
1662 Ga0070670_100005375
1663 Ga0070670_100039124
1664 Ga0070670_100085719
1665 Ga0070670_100270379
1666 Ga0070670_100339090
1667 Ga0070670_100351613
1668 Ga0070670_100351694
1669 Ga0070670_100360744
1670 Ga0070670_100737455
1671 Ga0070670_100830129
1672 Ga0070670_101506894
1673 Ga0070677_10314608
1674 Ga0070677_10665447
1675 Ga0070677_10852453
1676 Ga0068869_100007551
1677 Ga0068869_100024467
1678 Ga0068869_100049836
1679 Ga0068869_100194191
1680 Ga0068869_100223963
1681 Ga0068869_100278987
1682 Ga0068869_100280994
1683 Ga0068869_100443435
1684 Ga0068869_100705214
1685 Ga0068869_100871428
1686 Ga0068869_101208385
1687 Ga0068869_101566084
1688 Ga0068869_101705336
1689 Ga0070666_10179611
1690 Ga0070666_10743424
1691 Ga0070680_100013569
1692 Ga0070680_100057291
1693 Ga0070680_100166982
1694 Ga0070680_100169415
1695 Ga0070680_100493796
1696 Ga0070680_101726647
1697 Ga0070682_100093931
1698 Ga0070682_100290157
1699 Ga0068868_100007808
1700 Ga0068868_100415580
1701 Ga0068868_100640344
1702 Ga0068868_100942934
1703 Ga0068868_100982438
1704 Ga0070660_101673088
1705 Ga0070689_100002993
1706 Ga0070689_100096060
1707 Ga0070689_100165309
1708 Ga0070689_100169227
1709 Ga0070689_100180065
1710 Ga0070689_100189932
1711 Ga0070689_100303314
1712 Ga0070689_100930094
1713 Ga0070689_102164220
1714 Ga0070691_10070020
1715 Ga0070691_10178249
1716 Ga0070691_10415664
1717 Ga0070687_100014088
1718 Ga0070687_100023965
1719 Ga0070687_100083621
1720 Ga0070687_100190456
1721 Ga0070687_100198919
1722 Ga0070687_100302197
1723 Ga0070687_100502200
1724 Ga0070687_101401304
1725 Ga0070661_100239167
1726 Ga0070661_100867558
1727 Ga0070692_10010290
1728 Ga0070692_10102794
1729 Ga0070692_10171622
1730 Ga0070692_10339714
1731 Ga0070692_10397043
1732 Ga0070692_10399291
1733 Ga0070692_10623561
1734 Ga0070692_10678020
1735 Ga0070692_10756924
1736 Ga0070692_11128043
1737 Ga0070692_11427125
1738 Ga0070669_100002230
1739 Ga0070669_100010477
1740 Ga0070669_100113959
1741 Ga0070669_100459268
1742 Ga0070669_100680061
1743 Ga0070669_101300527
1744 Ga0070675_100228755
1745 Ga0070675_100312349
1746 Ga0070675_100475415
1747 Ga0070675_100748491
1748 Ga0070675_100862853
1749 Ga0070675_101828494
1750 Ga0070671_100002480
1751 Ga0070671_100045419
1752 Ga0070671_100114238
1753 Ga0070671_100851201
1754 Ga0070671_101064418
1755 Ga0070674_100516308
1756 Ga0070674_100577257
1757 Ga0070673_100012429
1758 Ga0070673_100029869
1759 Ga0070673_100049169
1760 Ga0070673_100105087
1761 Ga0070673_100411888
1762 Ga0070673_100788027
1763 Ga0070673_100959241
1764 Ga0070673_101015646
1765 Ga0070673_101064959
1766 Ga0070673_101612314
1767 Ga0070673_101864297
1768 Ga0070673_102076273
1769 Ga0070688_100015368
1770 Ga0070688_100487162
1771 Ga0070688_100711450
1772 Ga0070688_100895556
1773 Ga0070688_101170034
1774 Ga0070688_101754273
1775 Ga0070659_100039290
1776 Ga0070659_100128321
1777 Ga0070659_100690065
1778 Ga0070667_100021151
1779 Ga0070667_100163170
1780 Ga0070667_100965162
1781 Ga0070667_101109108
1782 Ga0070667_101760522
1783 Ga0070703_10000081
1784 Ga0070703_10015244
1785 Ga0070703_10299019
1786 Ga0070703_10415488
1787 Ga0070703_10586856
1788 Ga0070709_10332763
1789 Ga0070701_10008309
1790 Ga0070701_10014106
1791 Ga0070701_10024681
1792 Ga0070701_10053852
1793 Ga0070701_10065518
1794 Ga0070701_10065613
1795 Ga0070701_10612105
1796 Ga0070701_10963315
1797 Ga0070711_101694197
1798 Ga0070705_100080171
1799 Ga0070705_100117897
1800 Ga0070705_100234958
1801 Ga0070705_100332245
1802 Ga0070705_100385252
1803 Ga0070705_100805526
1804 Ga0070705_101072543
1805 Ga0070705_101781812
1806 Ga0070700_100000964
1807 Ga0070700_100034359
1808 Ga0070700_100056426
1809 Ga0070700_100157664
1810 Ga0070700_100161480
1811 Ga0070700_100757436
1812 Ga0070694_100000264
1813 Ga0070694_100025104
1814 Ga0070694_100035884
1815 Ga0070694_100058270
1816 Ga0070694_100123883
1817 Ga0070694_100147570
1818 Ga0070694_100184431
1819 Ga0070694_100185495
1820 Ga0070694_100247167
1821 Ga0070694_100258289
1822 Ga0070694_100294498
1823 Ga0070694_100310204
1824 Ga0070694_100361215
1825 Ga0070694_100609897
1826 Ga0070694_100737723
1827 Ga0070694_100796830
1828 Ga0070694_100817290
1829 Ga0070694_100827429
1830 Ga0070694_100859917
1831 Ga0070694_100993926
1832 Ga0070694_101140415
1833 Ga0070694_101296620
1834 Ga0070694_101313669
1835 Ga0070694_101803010
1836 Ga0070694_101959337
1837 Ga0070708_100000508
1838 Ga0070708_100033345
1839 Ga0070708_100153039
1840 Ga0070708_100253976
1841 Ga0070708_100280968
1842 Ga0070708_100457801
1843 Ga0070708_100508299
1844 Ga0070708_100678611
1845 Ga0070708_101019249
1846 Ga0070708_101091246
1847 Ga0070678_100102215
1848 Ga0070678_101256349
1849 Ga0070662_100085451
1850 Ga0070662_100275963
1851 Ga0070662_100290873
1852 Ga0070662_100352717
1853 Ga0070662_100889246
1854 Ga0070681_10000489
1855 Ga0070681_10046425
1856 Ga0070681_10047995
1857 Ga0070681_10072586
1858 Ga0070681_10231787
1859 Ga0070681_10758840
1860 Ga0068867_100014896
1861 Ga0068867_100110352
1862 Ga0068867_100282674
1863 Ga0068867_100300247
1864 Ga0068867_100331315
1865 Ga0068867_100461314
1866 Ga0068867_100518630
1867 Ga0068867_100588590
1868 Ga0068867_100780902
1869 Ga0068867_101250038
1870 Ga0068867_101374698
1871 Ga0068867_101725079
1872 Ga0068867_101849831
1873 Ga0068867_102021214
1874 Ga0070685_10007677
1875 Ga0070685_11459654
1876 Ga0070685_11487242
1877 Ga0070706_100000088
1878 Ga0070706_100009738
1879 Ga0070706_100053420
1880 Ga0070706_100070901
1881 Ga0070706_100201747
1882 Ga0070706_100993211
1883 Ga0070707_100004499
1884 Ga0070707_100116288
1885 Ga0070707_100199261
1886 Ga0070707_100199754
1887 Ga0070707_100531602
1888 Ga0070707_100650494
1889 Ga0070707_101600686
1890 Ga0070698_100002826
1891 Ga0070698_100027844
1892 Ga0070698_100031002
1893 Ga0070698_100212505
1894 Ga0070698_100339850
1895 Ga0070698_100462162
1896 Ga0070698_100585001
1897 Ga0070699_100001427
1898 Ga0070699_100017437
1899 Ga0070699_100018214
1900 Ga0070699_100020141
1901 Ga0070699_100048311
1902 Ga0070699_100167940
1903 Ga0070699_100204447
1904 Ga0070699_100206751
1905 Ga0070699_100251603
1906 Ga0070699_100657007
1907 Ga0070699_101057025
1908 Ga0070699_101317388
1909 Ga0070699_101338864
1910 Ga0070699_101427985
1911 Ga0070699_101752523
1912 Ga0070699_101811469
1913 Ga0070679_100000604
1914 Ga0070679_100054518
1915 Ga0070679_100143251
1916 Ga0070679_100919273
1917 Ga0070684_101378791
1918 Ga0070697_100000112
1919 Ga0070697_100009364
1920 Ga0070697_100116504
1921 Ga0070697_100162734
1922 Ga0070697_100192559
1923 Ga0070697_100277985
1924 Ga0070697_100465713
1925 Ga0070697_100758312
1926 Ga0070697_100976156
1927 Ga0070697_101452268
1928 Ga0068853_100075885
1929 Ga0068853_100104662
1930 Ga0068853_100269207
1931 Ga0068853_100738906
1932 Ga0068853_100952320
1933 Ga0068853_101171820
1934 Ga0070672_100047637
1935 Ga0070672_100627693
1936 Ga0070672_100914567
1937 Ga0070686_100001026
1938 Ga0070686_100013004
1939 Ga0070686_100043948
1940 Ga0070686_100056067
1941 Ga0070686_100115294
1942 Ga0070686_100596776
1943 Ga0070686_101208605
1944 Ga0070695_100020677
1945 Ga0070695_100134413
1946 Ga0070695_100154646
1947 Ga0070695_100166176
1948 Ga0070695_100188451
1949 Ga0070695_100192513
1950 Ga0070695_100225368
1951 Ga0070695_100249585
1952 Ga0070695_100531833
1953 Ga0070695_100867899
1954 Ga0070695_100871784
1955 Ga0070695_101017137
1956 Ga0070695_101815543
1957 Ga0070696_100074135
1958 Ga0070696_100098863
1959 Ga0070696_100184570
1960 Ga0070696_100218636
1961 Ga0070696_100231303
1962 Ga0070696_100270652
1963 Ga0070696_100283287
1964 Ga0070696_100305985
1965 Ga0070696_100581649
1966 Ga0070696_100677513
1967 Ga0070696_101050765
1968 Ga0070696_101185964
1969 Ga0070696_101249926
1970 Ga0070696_101290387
1971 Ga0070696_101383130
1972 Ga0070696_101383131
1973 Ga0070693_100004578
1974 Ga0070693_100083470
1975 Ga0070693_100171149
1976 Ga0070693_100421192
1977 Ga0070693_100515140
1978 Ga0070693_100694380
1979 Ga0070693_100703635
1980 Ga0070693_100738564
1981 Ga0070693_100913465
1982 Ga0070693_100935787
1983 Ga0070693_101350213
1984 Ga0070665_100326918
1985 Ga0070665_100771023
1986 Ga0070665_101020989
1987 Ga0070704_100037629
1988 Ga0070704_100048892
1989 Ga0070704_100072040
1990 Ga0070704_100110677
1991 Ga0070704_100478727
1992 Ga0070704_100544559
1993 Ga0070704_100634299
1994 Ga0070704_100636089
1995 Ga0070704_100647101
1996 Ga0070704_100717129
1997 Ga0070704_100980118
1998 Ga0070704_101331179
1999 Ga0070704_101673133
2000 Ga0068855_102087414
2001 Ga0068855_102571540
2002 Ga0070664_100003375
2003 Ga0070664_100176818
2004 Ga0070664_100296261
2005 Ga0070664_100501036
2006 Ga0070664_101290088
2007 Ga0068857_100012945
2008 Ga0068857_100113116
2009 Ga0068857_100131800
2010 Ga0068857_100273159
2011 Ga0068857_100511241
2012 Ga0068857_100775027
2013 Ga0068857_100960290
2014 Ga0068857_100975833
2015 Ga0068857_100982123
2016 Ga0068857_101423396
2017 Ga0068857_101865428
2018 Ga0068854_100222624
2019 Ga0068854_100236070
2020 Ga0068854_100295186
2021 Ga0068854_100306412
2022 Ga0068854_100398256
2023 Ga0068854_100440219
2024 Ga0068854_100628560
2025 Ga0068854_100917510
2026 Ga0068854_101578648
2027 Ga0068854_101619442
2028 Ga0068854_102268413
2029 Ga0068856_100369411
2030 Ga0068856_100546242
2031 Ga0068856_100936536
2032 Ga0068856_101288561
2033 Ga0068856_102209051
2034 Ga0070702_100054597
2035 Ga0070702_100060215
2036 Ga0070702_100139589
2037 Ga0070702_100208162
2038 Ga0070702_100291641
2039 Ga0070702_100348747
2040 Ga0070702_100568749
2041 Ga0070702_100584046
2042 Ga0070702_100796104
2043 Ga0070702_100897417
2044 Ga0070702_100921342
2045 Ga0070702_100952270
2046 Ga0070702_101817593
2047 Ga0068852_100235114
2048 Ga0068852_100427088
2049 Ga0068852_101010790
2050 Ga0068852_101715179
2051 Ga0068852_102859879
2052 Ga0068859_100002739
2053 Ga0068859_100004457
2054 Ga0068859_100012082
2055 Ga0068859_100015155
2056 Ga0068859_100046093
2057 Ga0068859_100093048
2058 Ga0068859_100110623
2059 Ga0068859_100121851
2060 Ga0068859_100138053
2061 Ga0068859_100262271
2062 Ga0068859_100283215
2063 Ga0068859_100379771
2064 Ga0068859_100552870
2065 Ga0068859_100557490
2066 Ga0068859_100637466
2067 Ga0068859_100665811
2068 Ga0068859_100682432
2069 Ga0068859_100830421
2070 Ga0068859_100863086
2071 Ga0068859_100991537
2072 Ga0068859_101972354
2073 Ga0068859_102219544
2074 Ga0068859_102284608
2075 Ga0068859_102365219
2076 Ga0068864_100001530
2077 Ga0068864_100020573
2078 Ga0068864_100042336
2079 Ga0068864_100065888
2080 Ga0068864_100124254
2081 Ga0068864_100169193
2082 Ga0068864_100187029
2083 Ga0068864_100196096
2084 Ga0068864_100257797
2085 Ga0068864_100380687
2086 Ga0068864_100519754
2087 Ga0068864_100740898
2088 Ga0068864_101352784
2089 Ga0068864_101557328
2090 Ga0068864_101927195
2091 Ga0068864_102625498
2092 Ga0068866_10020829
2093 Ga0068866_10109457
2094 Ga0068866_10486520
2095 Ga0068861_100017567
2096 Ga0068861_100033929
2097 Ga0068861_100050519
2098 Ga0068861_100091114
2099 Ga0068861_100127543
2100 Ga0068861_100143940
2101 Ga0068861_100324439
2102 Ga0068861_100505420
2103 Ga0068861_100531612
2104 Ga0068861_100585506
2105 Ga0068861_100659592
2106 Ga0068861_101184665
2107 Ga0068861_101537536
2108 Ga0068861_101747340
2109 Ga0068861_102178462
2110 Ga0068861_102492523
2111 Ga0068851_11039033
2112 Ga0068870_10008350
2113 Ga0068870_10027938
2114 Ga0068870_10057964
2115 Ga0068870_10179502
2116 Ga0068870_10354242
2117 Ga0068870_10560422
2118 Ga0068870_10623170
2119 Ga0068870_10738148
2120 Ga0068870_10840626
2121 Ga0068863_100018044
2122 Ga0068863_100128325
2123 Ga0068863_100242354
2124 Ga0068863_100483801
2125 Ga0068863_100536414
2126 Ga0068863_100800482
2127 Ga0068863_100915019
2128 Ga0068863_101166831
2129 Ga0068863_101270606
2130 Ga0068863_101445779
2131 Ga0068863_101716145
2132 Ga0068858_100000227
2133 Ga0068858_100123442
2134 Ga0068858_100127098
2135 Ga0068858_100185364
2136 Ga0068858_100315530
2137 Ga0068858_100330592
2138 Ga0068858_100370918
2139 Ga0068858_100418693
2140 Ga0068858_100444019
2141 Ga0068858_100456053
2142 Ga0068858_100492143
2143 Ga0068858_101210707
2144 Ga0068860_100004210
2145 Ga0068860_100034116
2146 Ga0068860_100053875
2147 Ga0068860_100072351
2148 Ga0068860_100079833
2149 Ga0068860_100114891
2150 Ga0068860_100177474
2151 Ga0068860_100193004
2152 Ga0068860_100273083
2153 Ga0068860_100388220
2154 Ga0068860_100405958
2155 Ga0068860_101038929
2156 Ga0068860_101059866
2157 Ga0068860_101195298
2158 Ga0068860_101308113
2159 Ga0068860_101438552
2160 Ga0068860_101791275
2161 Ga0068862_100007975
2162 Ga0068862_100019794
2163 Ga0068862_100036723
2164 Ga0068862_100075730
2165 Ga0068862_100076530
2166 Ga0068862_100093042
2167 Ga0068862_100111498
2168 Ga0068862_100129213
2169 Ga0068862_100260238
2170 Ga0068862_100398128
2171 Ga0068862_100461823
2172 Ga0068862_101429284
2173 Ga0081539_10000043
2174 Ga0081539_10000851
2175 Ga0081539_10001474
2176 Ga0081539_10005869
2177 Ga0081539_10085004
2178 Ga0081539_10114976
2179 Ga0070715_10000007
2180 Ga0070716_100000007
2181 Ga0070716_100112996
2182 Ga0070716_100292811
2183 Ga0070716_100454963
2184 Ga0070716_101472838
2185 Ga0070716_101490476
2186 Ga0097621_100081069
2187 Ga0097621_100088346
2188 Ga0097621_100152573
2189 Ga0097621_100162804
2190 Ga0097621_100522547
2191 Ga0097621_100801102
2192 Ga0097621_102401019
2193 Ga0068871_100006022
2194 Ga0068871_100015503
2195 Ga0068871_100028784
2196 Ga0068871_100104621
2197 Ga0068871_101119555
2198 Ga0075428_100136086
2199 Ga0075428_100857025
2200 Ga0075428_101253559
2201 Ga0075430_100037954
2202 Ga0075430_100360466
2203 Ga0075430_101239324
2204 Ga0075431_100064005
2205 Ga0075431_100131761
2206 Ga0075431_100451990
2207 Ga0075431_100498545
2208 Ga0075431_101736912
2209 Ga0075433_10020255
2210 Ga0075433_10020844
2211 Ga0075433_10022972
2212 Ga0075433_10416613
2213 Ga0075433_10965815
2214 Ga0075433_11062446
2215 Ga0075433_11124778
2216 Ga0075433_11142763
2217 Ga0075433_11928193
2218 Ga0075434_100032647
2219 Ga0075434_100081851
2220 Ga0075434_100134853
2221 Ga0075434_100150631
2222 Ga0075434_100417145
2223 Ga0075434_101484527
2224 Ga0075434_101727709
2225 Ga0075429_100004845
2226 Ga0075429_100072291
2227 Ga0075429_100109852
2228 Ga0075429_100224296
2229 Ga0075429_100647729
2230 Ga0075429_100946019
2231 Ga0068865_100130776
2232 Ga0068865_100323889
2233 Ga0068865_100809230
2234 Ga0068865_101592075
2235 Ga0075436_100000018
2236 Ga0075436_100041994
2237 Ga0075436_100535602
2238 Ga0097620_100002739
2239 Ga0097620_100004457
2240 Ga0097620_100012083
2241 Ga0097620_100015156
2242 Ga0097620_100046093
2243 Ga0097620_100093051
2244 Ga0097620_100110619
2245 Ga0097620_100121856
2246 Ga0097620_100138047
2247 Ga0097620_100262260
2248 Ga0097620_100283230
2249 Ga0097620_100379749
2250 Ga0097620_100552878
2251 Ga0097620_100557553
2252 Ga0097620_100637463
2253 Ga0097620_100665819
2254 Ga0097620_100682453
2255 Ga0097620_100830456
2256 Ga0097620_100863126
2257 Ga0097620_100991515
2258 Ga0097620_101972312
2259 Ga0097620_102219349
2260 Ga0097620_102284651
2261 Ga0097620_102365137
2262 Ga0075435_100000359
2263 Ga0075435_100003678
2264 Ga0075435_100117894
2265 Ga0075435_100667224
2266 Ga0075435_100908894
2267 Ga0075435_101134427
2268 Ga0099794_10004255
2269 Ga0099794_10209875
2270 Ga0099794_10378354
2271 Ga0099794_10704353
2272 Ga0105251_10140108
2273 Ga0105251_10145842
2274 Ga0105251_10368478
2275 Ga0105250_10548024
2276 Ga0105240_10195833
2277 Ga0105240_10988408
2278 Ga0105240_11684628
2279 Ga0111539_10004262
2280 Ga0111539_10012727
2281 Ga0111539_10024482
2282 Ga0111539_10091295
2283 Ga0111539_10300357
2284 Ga0111539_10531773
2285 Ga0111539_10794095
2286 Ga0111539_10903829
2287 Ga0111539_11342174
2288 Ga0105245_10024756
2289 Ga0105245_10457960
2290 Ga0105245_12479219
2291 Ga0105247_10000001
2292 Ga0105247_10089947
2293 Ga0105247_10191004
2294 Ga0105247_10208493
2295 Ga0105247_10383210
2296 Ga0105247_10484965
2297 Ga0105247_10641300
2298 Ga0105247_10743641
2299 Ga0114129_10030857
2300 Ga0114129_10055247
2301 Ga0114129_10063314
2302 Ga0114129_10103825
2303 Ga0114129_10208718
2304 Ga0114129_10354022
2305 Ga0114129_10715081
2306 Ga0114129_10747559
2307 Ga0114129_10848454
2308 Ga0114129_10978988
2309 Ga0114129_11286196
2310 Ga0114129_11317362
2311 Ga0114129_12257170
2312 Ga0114129_12390948
2313 Ga0105243_10000024
2314 Ga0105243_10048260
2315 Ga0105243_10068303
2316 Ga0105243_10086783
2317 Ga0105243_10133790
2318 Ga0105243_10284964
2319 Ga0105243_10295494
2320 Ga0105243_10360634
2321 Ga0105243_10383972
2322 Ga0105243_10418900
2323 Ga0105243_10540840
2324 Ga0105243_10764478
2325 Ga0105243_10766658
2326 Ga0105243_10772027
2327 Ga0105243_11594481
2328 Ga0105241_10019047
2329 Ga0105241_10040109
2330 Ga0105241_10055499
2331 Ga0105241_10109573
2332 Ga0105241_10137350
2333 Ga0105241_10237460
2334 Ga0105241_10358719
2335 Ga0105241_10714956
2336 Ga0105241_10727548
2337 Ga0105241_10976599
2338 Ga0105241_11178223
2339 Ga0105241_12413291
2340 Ga0105241_12520886
2341 Ga0105242_10000249
2342 Ga0105242_10007429
2343 Ga0105242_10016672
2344 Ga0105242_10484601
2345 Ga0105242_10504552
2346 Ga0105242_10686284
2347 Ga0105242_11603761
2348 Ga0105242_11612376
2349 Ga0105242_11899135
2350 Ga0105242_12100278
2351 Ga0105248_10006056
2352 Ga0105248_10017237
2353 Ga0105248_10027995
2354 Ga0105248_10094785
2355 Ga0105248_10137959
2356 Ga0105248_10146328
2357 Ga0105248_10196840
2358 Ga0105248_10322011
2359 Ga0105248_10458735
2360 Ga0105248_10491147
2361 Ga0105248_10494443
2362 Ga0105248_10519078
2363 Ga0105248_10656251
2364 Ga0105248_10671371
2365 Ga0105248_10820932
2366 Ga0105248_10839248
2367 Ga0105248_11013285
2368 Ga0105248_11431034
2369 Ga0105248_11757502
2370 Ga0105248_11797911
2371 Ga0105248_12702830
2372 Ga0105248_12912716
2373 Ga0105248_13185443
2374 Ga0105237_10752398
2375 Ga0105237_11595497
2376 Ga0105238_10007632
2377 Ga0105238_10027606
2378 Ga0105238_11208504
2379 Ga0105238_11603688
2380 Ga0105238_12913216
2381 Ga0105249_10007021
2382 Ga0105249_10056201
2383 Ga0105249_10085714
2384 Ga0105249_10219725
2385 Ga0105249_10271328
2386 Ga0105249_10440540
2387 Ga0105249_10459448
2388 Ga0105249_10627277
2389 Ga0105249_11157472
2390 Ga0105249_11292662
2391 Ga0099796_10090181
2392 Ga0099796_10141922
2393 Ga0105239_10098779
2394 Ga0105239_10136278
2395 Ga0105239_10817672
2396 Ga0105239_11012294
2397 Ga0105239_11777823
2398 Ga0105239_12073186
2399 Ga0105239_12120510
2400 Ga0105239_12263939
2401 Ga0105246_10092959
2402 Ga0105246_10094253
2403 Ga0105246_10297765
2404 Ga0105246_10307590
2405 Ga0105246_10945204
2406 Ga0105246_11261251
2407 Ga0105246_11921716
2408 Ga0105246_11949722
2409 Ga0105246_12087577
2410 Ga0105246_12543543
2411 Ga0157373_10002883
2412 Ga0157373_10008292
2413 Ga0157373_10299751
2414 Ga0157373_10333694
2415 Ga0157373_10529883
2416 Ga0157373_10590125
2417 Ga0157373_10590298
2418 Ga0157373_10825105
2419 Ga0157373_11081738
2420 Ga0157373_11143819
2421 Ga0157373_11272214
2422 Ga0157371_10191333
2423 Ga0157371_10223987
2424 Ga0157371_10908968
2425 Ga0157369_10592547
2426 Ga0157374_10026890
2427 Ga0157374_10296798
2428 Ga0157374_11534395
2429 Ga0157374_11911154
2430 Ga0157374_12226860
2431 Ga0157374_12304669
2432 Ga0157374_12747311
2433 Ga0157378_10001968
2434 Ga0157378_10012080
2435 Ga0157378_10063010
2436 Ga0157378_10078501
2437 Ga0157378_10134439
2438 Ga0157378_10149954
2439 Ga0157378_10174969
2440 Ga0157378_10274815
2441 Ga0157378_10629917
2442 Ga0157378_10765577
2443 Ga0157378_11015645
2444 Ga0157378_11195153
2445 Ga0157378_11246657
2446 Ga0157378_11297631
2447 Ga0157378_11337511
2448 Ga0157378_11431953
2449 Ga0157378_11921246
2450 Ga0157378_12296038
2451 Ga0157378_12443924
2452 Ga0163162_10002437
2453 Ga0163162_10011708
2454 Ga0163162_10012021
2455 Ga0163162_10162770
2456 Ga0163162_10175826
2457 Ga0163162_10237280
2458 Ga0163162_10334283
2459 Ga0163162_10529386
2460 Ga0163162_10683774
2461 Ga0163162_10756571
2462 Ga0163162_10899763
2463 Ga0163162_11781558
2464 Ga0163162_12170397
2465 Ga0157372_10001564
2466 Ga0157372_10113138
2467 Ga0157372_10338510
2468 Ga0157372_12010740
2469 Ga0157375_10063548
2470 Ga0157375_10133001
2471 Ga0157375_10142189
2472 Ga0157375_10147109
2473 Ga0157375_10381537
2474 Ga0157375_10501249
2475 Ga0157375_10737006
2476 Ga0157375_10949964
2477 Ga0157375_11013889
2478 Ga0157375_11458999
2479 Ga0157375_11852458
2480 Ga0157375_11963834
2481 Ga0157375_12023587
2482 Ga0157375_13683476
2483 Ga0163163_10000862
2484 Ga0163163_10004317
2485 Ga0163163_10058608
2486 Ga0163163_10062838
2487 Ga0163163_10065206
2488 Ga0163163_10067723
2489 Ga0163163_10106824
2490 Ga0163163_10235973
2491 Ga0163163_10241251
2492 Ga0163163_10318992
2493 Ga0163163_10634198
2494 Ga0163163_10963387
2495 Ga0163163_11387267
2496 Ga0163163_11777180
2497 Ga0163163_13324639
2498 Ga0157380_10004388
2499 Ga0157380_10014633
2500 Ga0157380_10053614
2501 Ga0157380_10072771
2502 Ga0157380_10079299
2503 Ga0157380_10315847
2504 Ga0157380_10396852
2505 Ga0157380_10614569
2506 Ga0157380_10810655
2507 Ga0157380_11090362
2508 Ga0157380_11249541
2509 Ga0157380_12645064
2510 Ga0157380_13039303
2511 Ga0182008_10914109
2512 Ga0157377_10075982
2513 Ga0157377_10127036
2514 Ga0157377_10265524
2515 Ga0157377_10455023
2516 Ga0157377_10714259
2517 Ga0157379_10090780
2518 Ga0157379_10353050
2519 Ga0157379_10353334
2520 Ga0157379_10475067
2521 Ga0157379_11870751
2522 Ga0157379_12079156
2523 Ga0157376_10017462
2524 Ga0157376_10638660
2525 Ga0182007_10065245
2526 Ga0163161_10015460
2527 Ga0163161_10140454
2528 Ga0163161_10320364
2529 Ga0163161_10776946
2530 Ga0163161_11065836
2531 Ga0213876_10005036
2532 Ga0207672_1000122
2533 Ga0207666_1010072
2534 Ga0207697_10031153
2535 Ga0207713_1194727
2536 Ga0207653_10000130
2537 Ga0207653_10187401
2538 Ga0207682_10413216
2539 Ga0207642_10005892
2540 Ga0207642_10521238
2541 Ga0207710_10000003
2542 Ga0207710_10001166
2543 Ga0207710_10152193
2544 Ga0207710_10182455
2545 Ga0207710_10553664
2546 Ga0207688_10244747
2547 Ga0207688_10245451
2548 Ga0207680_10116217
2549 Ga0207680_10203388
2550 Ga0207680_10374376
2551 Ga0207680_10409524
2552 Ga0207647_10000385
2553 Ga0207647_10048111
2554 Ga0207647_10503356
2555 Ga0207685_10000007
2556 Ga0207699_11015603
2557 Ga0207645_10108720
2558 Ga0207645_10466515
2559 Ga0207645_10768014
2560 Ga0207645_10893899
2561 Ga0207643_10021068
2562 Ga0207643_10042107
2563 Ga0207643_10135729
2564 Ga0207643_10190988
2565 Ga0207643_10366713
2566 Ga0207643_10653980
2567 Ga0207684_10000131
2568 Ga0207684_10032227
2569 Ga0207684_10358230
2570 Ga0207684_10377063
2571 Ga0207654_10022993
2572 Ga0207654_10073402
2573 Ga0207654_10306150
2574 Ga0207654_10422733
2575 Ga0207654_10525608
2576 Ga0207654_10835984
2577 Ga0207654_10851681
2578 Ga0207707_10000017
2579 Ga0207707_10004243
2580 Ga0207707_10109843
2581 Ga0207707_10602079
2582 Ga0207707_10608347
2583 Ga0207695_10123112
2584 Ga0207671_10148293
2585 Ga0207671_10161583
2586 Ga0207671_10674393
2587 Ga0207660_10026986
2588 Ga0207660_10135185
2589 Ga0207660_10210627
2590 Ga0207660_10735298
2591 Ga0207660_11643311
2592 Ga0207662_10005692
2593 Ga0207662_10023437
2594 Ga0207662_10069082
2595 Ga0207662_10260706
2596 Ga0207662_10282924
2597 Ga0207662_10361470
2598 Ga0207662_11323185
2599 Ga0207657_10703100
2600 Ga0207649_10448989
2601 Ga0207649_11030574
2602 Ga0207652_10000335
2603 Ga0207652_10114949
2604 Ga0207652_11100128
2605 Ga0207646_10009704
2606 Ga0207646_10100260
2607 Ga0207646_10136843
2608 Ga0207646_10467588
2609 Ga0207646_10998948
2610 Ga0207681_10011297
2611 Ga0207681_10044905
2612 Ga0207681_10106684
2613 Ga0207681_10322741
2614 Ga0207694_10049440
2615 Ga0207694_10076122
2616 Ga0207650_10000005
2617 Ga0207650_10063251
2618 Ga0207650_10163632
2619 Ga0207650_10189159
2620 Ga0207650_10302083
2621 Ga0207650_10612480
2622 Ga0207650_10633851
2623 Ga0207650_10744741
2624 Ga0207650_10765378
2625 Ga0207659_10254107
2626 Ga0207659_10378233
2627 Ga0207659_10451059
2628 Ga0207687_10080623
2629 Ga0207687_10797720
2630 Ga0207644_10000074
2631 Ga0207644_10030944
2632 Ga0207644_10100032
2633 Ga0207644_11011304
2634 Ga0207644_11402991
2635 Ga0207690_10013967
2636 Ga0207690_10056799
2637 Ga0207690_10683952
2638 Ga0207690_11395134
2639 Ga0207706_10044092
2640 Ga0207706_10125993
2641 Ga0207706_10134256
2642 Ga0207706_10360556
2643 Ga0207706_10551675
2644 Ga0207686_10000011
2645 Ga0207686_10010343
2646 Ga0207686_10017843
2647 Ga0207686_10439152
2648 Ga0207686_10797179
2649 Ga0207709_10000042
2650 Ga0207709_10074732
2651 Ga0207709_10123016
2652 Ga0207709_10272911
2653 Ga0207709_10347634
2654 Ga0207709_10423684
2655 Ga0207709_10997707
2656 Ga0207709_11154694
2657 Ga0207709_11159774
2658 Ga0207709_11452116
2659 Ga0207709_11724738
2660 Ga0207670_10017942
2661 Ga0207670_10059135
2662 Ga0207670_10390021
2663 Ga0207670_10650281
2664 Ga0207670_10779026
2665 Ga0207670_11248002
2666 Ga0207670_11260140
2667 Ga0207669_10356127
2668 Ga0207704_10083943
2669 Ga0207704_10467027
2670 Ga0207704_10835307
2671 Ga0207704_11146927
2672 Ga0207665_10000027
2673 Ga0207665_10140145
2674 Ga0207665_10349671
2675 Ga0207665_10471511
2676 Ga0207665_10556603
2677 Ga0207665_11250822
2678 Ga0207691_10001531
2679 Ga0207691_10891538
2680 Ga0207691_10899636
2681 Ga0207711_10003667
2682 Ga0207711_10025575
2683 Ga0207711_10026824
2684 Ga0207711_10064400
2685 Ga0207711_10115243
2686 Ga0207711_10177075
2687 Ga0207711_10480815
2688 Ga0207711_10512928
2689 Ga0207711_10826120
2690 Ga0207711_10853585
2691 Ga0207711_10973120
2692 Ga0207711_11761835
2693 Ga0207711_11850396
2694 Ga0207689_10008713
2695 Ga0207689_10016842
2696 Ga0207689_10046764
2697 Ga0207689_10146107
2698 Ga0207689_10169483
2699 Ga0207689_10219895
2700 Ga0207689_10244123
2701 Ga0207689_10331929
2702 Ga0207689_10459006
2703 Ga0207689_10475000
2704 Ga0207689_10951399
2705 Ga0207689_11169271
2706 Ga0207689_11364343
2707 Ga0207661_10252955
2708 Ga0207661_11800446
2709 Ga0207679_10299917
2710 Ga0207679_10325900
2711 Ga0207679_10604760
2712 Ga0207679_10789734
2713 Ga0207679_11291505
2714 Ga0207667_12049369
2715 Ga0207651_10039329
2716 Ga0207651_10094856
2717 Ga0207651_10373390
2718 Ga0207651_10493191
2719 Ga0207651_10533004
2720 Ga0207651_10608130
2721 Ga0207651_10885752
2722 Ga0207712_10019580
2723 Ga0207712_10028818
2724 Ga0207712_10044712
2725 Ga0207712_10380598
2726 Ga0207712_11181802
2727 Ga0207712_11716441
2728 Ga0207640_10081777
2729 Ga0207640_10112579
2730 Ga0207640_10162778
2731 Ga0207640_10209832
2732 Ga0207640_10219765
2733 Ga0207640_10471093
2734 Ga0207640_10669167
2735 Ga0207640_10736941
2736 Ga0207640_10774639
2737 Ga0207640_11256543
2738 Ga0207640_11901586
2739 Ga0207640_12122058
2740 Ga0207658_10068564
2741 Ga0207658_10570205
2742 Ga0207658_11480944
2743 Ga0207677_10251485
2744 Ga0207677_11069330
2745 Ga0207677_11114819
2746 Ga0207677_11886654
2747 Ga0207703_10000101
2748 Ga0207703_10073238
2749 Ga0207703_10159449
2750 Ga0207703_10184078
2751 Ga0207703_10230270
2752 Ga0207703_10258220
2753 Ga0207703_10283261
2754 Ga0207703_10386619
2755 Ga0207703_10894211
2756 Ga0207639_10061466
2757 Ga0207639_10252918
2758 Ga0207639_11284413
2759 Ga0207708_10000043
2760 Ga0207708_10002522
2761 Ga0207708_10007831
2762 Ga0207708_10053037
2763 Ga0207708_10087926
2764 Ga0207708_10192647
2765 Ga0207708_10293813
2766 Ga0207708_10461891
2767 Ga0207708_11591261
2768 Ga0207702_10150385
2769 Ga0207702_11959942
2770 Ga0207641_10109885
2771 Ga0207641_10180752
2772 Ga0207641_10246746
2773 Ga0207641_10348820
2774 Ga0207641_10476106
2775 Ga0207641_10529446
2776 Ga0207641_10652594
2777 Ga0207641_10998635
2778 Ga0207641_11012145
2779 Ga0207641_11022677
2780 Ga0207641_11136937
2781 Ga0207641_11156421
2782 Ga0207641_11176415
2783 Ga0207641_11461741
2784 Ga0207641_11477258
2785 Ga0207641_11926792
2786 Ga0207641_12024034
2787 Ga0207641_12040738
2788 Ga0207648_10015138
2789 Ga0207648_10048951
2790 Ga0207648_10121810
2791 Ga0207648_10313067
2792 Ga0207648_10439552
2793 Ga0207648_10457671
2794 Ga0207648_10695167
2795 Ga0207648_10879578
2796 Ga0207648_11068407
2797 Ga0207648_11490987
2798 Ga0207648_11636644
2799 Ga0207648_11636662
2800 Ga0207676_10004891
2801 Ga0207676_10029953
2802 Ga0207676_10158301
2803 Ga0207676_10309008
2804 Ga0207676_10361000
2805 Ga0207676_10369391
2806 Ga0207676_10902931
2807 Ga0207676_10996562
2808 Ga0207676_11028316
2809 Ga0207676_11598995
2810 Ga0207676_12175917
2811 Ga0207674_10002367
2812 Ga0207674_10236066
2813 Ga0207674_10300871
2814 Ga0207674_10349529
2815 Ga0207674_10359862
2816 Ga0207674_10417305
2817 Ga0207674_10907232
2818 Ga0207674_11204972
2819 Ga0207674_11266136
2820 Ga0207674_11383254
2821 Ga0207674_11430754
2822 Ga0207674_12119246
2823 Ga0207675_100008740
2824 Ga0207675_100021904
2825 Ga0207675_100039921
2826 Ga0207675_100059927
2827 Ga0207675_100098854
2828 Ga0207675_100140754
2829 Ga0207675_100320494
2830 Ga0207675_100391398
2831 Ga0207675_100409058
2832 Ga0207675_100477989
2833 Ga0207675_100592840
2834 Ga0207675_100768874
2835 Ga0207675_101186281
2836 Ga0207675_102135441
2837 Ga0207683_10044488
2838 Ga0207683_10623123
2839 Ga0207683_10903689
2840 Ga0207698_10381916
2841 Ga0207698_10959572
2842 Ga0207698_12671160
2843 Ga0209588_1012523
2844 Ga0207428_10013786
2845 Ga0207428_10015457
2846 Ga0207428_10047588
2847 Ga0207428_10309009
2848 Ga0268266_11792847
2849 Ga0268266_11811724
2850 Ga0268265_10006379
2851 Ga0268265_10024099
2852 Ga0268265_10058203
2853 Ga0268265_10301028
2854 Ga0268265_10332204
2855 Ga0268265_10370946
2856 Ga0268265_10393052
2857 Ga0268265_10412492
2858 Ga0268265_10588777
2859 Ga0268265_10612213
2860 Ga0268265_12330200
2861 Ga0268264_10040717
2862 Ga0268264_10065566
2863 Ga0268264_10073497
2864 Ga0268264_10081426
2865 Ga0268264_10094055
2866 Ga0268264_10113918
2867 Ga0268264_10216347
2868 Ga0268264_10229768
2869 Ga0268264_10278375
2870 Ga0268264_10302825
2871 Ga0268264_10364595
2872 Ga0268264_10886578
2873 Ga0268264_10960291
2874 Ga0268264_10980158
2875 Ga0268264_11737297
2876 Ga0307408_100011791
2877 Ga0307408_100122608
2878 Ga0307408_100161167
2879 Ga0307408_102172747
2880 Ga0307405_10079066
2881 Ga0307405_10096007
2882 Ga0307405_10293436
2883 Ga0307405_10796673
2884 Ga0307405_12161694
2885 Ga0307410_10142349
2886 Ga0307410_11133279
2887 Ga0307406_10008963
2888 Ga0307406_10563767
2889 Ga0307407_10364056
2890 Ga0307407_10537790
2891 Ga0307407_10760830
2892 Ga0307412_10008317
2893 Ga0307412_10012400
2894 Ga0307412_10202912
2895 Ga0307412_10376790
2896 Ga0307409_100157714
2897 Ga0307409_100512853
2898 Ga0307416_100002153
2899 Ga0307416_100134836
2900 Ga0307416_100748409
2901 Ga0307416_101259722
2902 Ga0307416_101655824
2903 Ga0307416_103269924
2904 Ga0307414_10001957
2905 Ga0307414_10153795
2906 Ga0307414_11803176
2907 Ga0307411_10005777
2908 Ga0307411_10012992
2909 Ga0307411_10479196
2910 Ga0307411_10738589
2911 Ga0307411_11879461
2912 Ga0307415_100009574
2913 Ga0307415_100180309
2914 Ga0307415_100444967
2915 Ga0307415_100961815
2916 Ga0307415_101742985
2917 Ga0373928_0096405
2918 Ga0373940_0106449
2919 Ga0373949_0131460
2920 Ga0373951_0001101
2921 Ga0373932_0382033
2922 Ga0373941_0342101
2923 Ga0373942_0007648
2924 Ga0373931_0158434
2925 Ga0395899_0745589
2926 Ga0395900_0168787
2927 Ga0395900_0395234
2928 Ga0395900_0654449
2929 Ga0395900_0893323
2930 Ga0395900_1010833
2931 Ga0395898_0482532
2932 Ga0395898_1259002
2933 Ga0395905_0359368
2934 Ga0395905_0610509
2935 Ga0395905_1509350
2936 Ga0395901_0256020
2937 Ga0395901_1650284
2938 Ga0395901_1952323
2939 Ga0242420_000913
2940 Ga0436365_0564234
2941 Ga0436365_0671345
2942 Ga0436362_0146661
2943 Ga0439439_0006583
2944 Ga0439453_0029842
2945 Ga0439448_0058991
2946 Ga0439462_0026944
2947 Ga0439446_0053096
2948 Ga0439458_0001390
2949 Ga0439458_0024627
2950 Ga0439434_0350666
2951 Ga0439464_0256326
2952 Ga0451577_0161360
2953 Ga0453683_0461029
2954 Ga0453684_1265619
2955 Ga0451576_0303809
2956 Ga0451576_0605443
2957 Ga0451576_0772647
2958 Ga0451576_1322367
2959 Ga0451576_1770856
2960 Ga0495603_0453818
2961 Ga0495620_0254198
2962 Ga0495663_0000212
2963 Ga0495598_0047534
2964 Ga0495598_0128292
2965 Ga0495621_0000419
2966 Ga0495621_0047942
2967 Ga0495621_0231151
2968 Ga0495633_0122663
2969 Ga0495656_0039878
2970 Ga0495656_0750143
2971 Ga0495668_0783072
2972 Ga0495659_0568651
2973 Ga0495658_0108012
2974 Ga0495669_0623272
2975 Ga0495589_0192095
2976 Ga0495674_0599559
2977 Ga0495685_221417
2978 Ga0496100_1424384
2979 Ga0496102_1037549
2980 Ga0496102_1301009
2981 Ga0496104_0018973
2982 Ga0496104_1190345
2983 Ga0496104_1544412
2984 Ga0496106_0327765
2985 Ga0496106_0381121
2986 Ga0496107_0101852
2987 Ga0496107_0604809
2988 Ga0496107_0789125
2989 Ga0496108_0309535
2990 Ga0496108_0456924
2991 Ga0496109_1013366
2992 Ga0496112_0264580
2993 Ga0496112_0378878
2994 Ga0496112_1170947
2995 Ga0496113_1084320
2996 Ga0501290_044992
2997 Ga0501290_061300
2998 Ga0501290_066846
2999 Ga0501291_006199
3000 Ga0501291_111953
3001 Ga0501291_130231
3002 Ga0501292_010879
3003 Ga0501292_071573
3004 Ga0501292_109854
3005 Ga0501296_000829
3006 Ga0501296_012126
3007 Ga0501296_022330
3008 Ga0501296_052072
3009 Ga0501298_002164
3010 Ga0501298_008000
3011 Ga0501299_000709
3012 Ga0501299_036183
3013 Ga0501301_022858
3014 Ga0501303_010321
3015 Ga0501038_0005082
3016 Ga0501072_1563219
3017 Ga0501074_0717952
3018 Ga0501077_0429495
3019 Ga0501198_006536
3020 Ga0501198_020237
3021 Ga0501198_066846
3022 Ga0501199_003906
3023 Ga0501199_020139
3024 Ga0501202_015266
3025 Ga0501202_038372
3026 Ga0501202_106836
3027 Ga0501206_081078
3028 Ga0501207_002752
3029 Ga0501207_120851
3030 Ga0501208_020740
3031 Ga0501214_002537
3032 Ga0501214_002696
3033 Ga0501216_004065
3034 Ga0501216_112336
3035 Ga0501217_000410
3036 Ga0501217_003166
3037 Ga0501217_016565
3038 Ga0501217_310953
3039 Ga0501223_012361
3040 Ga0501223_041375
3041 Ga0501223_109708
3042 Ga0501224_001708
3043 Ga0501224_009538
3044 Ga0501224_021697
3045 Ga0501227_000106
3046 Ga0501227_014779
3047 Ga0501227_021691
3048 Ga0501230_002947
3049 Ga0501233_213010
3050 Ga0501233_232233
3051 Ga0501235_004157
3052 Ga0501235_006345
3053 Ga0501235_010107
3054 Ga0501235_013427
3055 Ga0501235_091385
3056 Ga0501235_177904
3057 Ga0501236_001448
3058 Ga0501239_009173
3059 Ga0501239_082600
3060 Ga0501240_004240
3061 Ga0501242_074176
3062 Ga0501243_012557
3063 Ga0501243_061725
3064 Ga0501247_029429
3065 Ga0501248_006771
3066 Ga0501249_011428
3067 Ga0501249_035636
3068 Ga0501249_072683
3069 Ga0501249_206681
3070 Ga0501251_007135
3071 Ga0501251_011940
3072 Ga0501253_005133
3073 Ga0501255_020660
3074 Ga0501256_002581
3075 Ga0501256_006210
3076 Ga0501257_007565
3077 Ga0501257_031865
3078 Ga0501258_019886
3079 Ga0501258_065308
3080 Ga0501259_007519
3081 Ga0501259_010840
3082 Ga0501260_000407
3083 Ga0501260_000408
3084 Ga0501260_007879
3085 Ga0501260_037694
3086 Ga0501221_142846
3087 Ga0501221_156534
3088 Ga0501225_0000853
3089 Ga0501225_0002070
3090 Ga0501225_0007379
3091 Ga0501225_0034099
3092 Ga0501225_0184889
3093 Ga0501225_0263194
3094 Ga0501234_002675
3095 Ga0501234_009967
3096 Ga0501234_021859
3097 Ga0501245_006567
3098 Ga0501245_012305
3099 Ga0501079_0107587
3100 Ga0501079_0615472
3101 Ga0501081_1043620
3102 Ga0501241_155597
3103 Ga0501262_023315
3104 Ga0501263_051948
3105 Ga0501266_008989
3106 Ga0501267_019021
3107 Ga0501268_006152
3108 Ga0501269_032905
3109 Ga0501270_005388
3110 Ga0501271_068344
3111 Ga0501272_003329
3112 Ga0501272_031281
3113 Ga0501273_003524
3114 Ga0501273_003954
3115 Ga0501273_072765
3116 Ga0501279_014694
3117 Ga0501279_022053
3118 Ga0501279_079571
3119 Ga0501282_027386
3120 Ga0501282_030952
3121 Ga0501283_001419
3122 Ga0501283_060345
3123 Ga0501200_01813
3124 Ga0501204_012812
3125 Ga0501204_015760
3126 Ga0501204_017911
3127 Ga0501212_003935
3128 Ga0501212_004876
3129 Ga0501212_112833
3130 Ga0501226_000544
3131 Ga0501226_006240
3132 Ga0501226_006399
3133 nmdc:mga05p37_1129131_c1
3134 nmdc:mga05p37_1359879_c1
3135 nmdc:mga05p37_1831209_c1
3136 nmdc:mga05p37_351269_c1
3137 nmdc:mga05p37_504581_c1
3138 nmdc:mga05p37_65136_c1
3139 nmdc:mga05p37_672666_c1
3140 nmdc:mga05p37_982361_c1
3141 nmdc:mga09592_121972_c1
3142 nmdc:mga09592_1430098_c1
3143 nmdc:mga09592_1641612_c1
3144 nmdc:mga09592_539202_c1
3145 nmdc:mga09592_57546_c1
3146 nmdc:mga09592_799186_c1
3147 nmdc:mga0qj67_102600_c1
3148 nmdc:mga0qj67_290008_c1
3149 nmdc:mga06r32_1515427_c1
3150 nmdc:mga06r32_1864865_c1
3151 nmdc:mga06r32_304072_c1
3152 nmdc:mga06r32_365984_c1
3153 nmdc:mga06r32_451053_c1
3154 nmdc:mga06r32_463071_c1
3155 nmdc:mga06r32_923934_c1
3156 nmdc:mga08y16_13794_c1
3157 nmdc:mga08y16_1449686_c1
3158 nmdc:mga08y16_1473233_c1
3159 nmdc:mga08y16_15928_c1
3160 nmdc:mga08y16_3655_c1
3161 nmdc:mga08y16_473637_c1
3162 nmdc:mga08y16_70144_c1
3163 nmdc:mga0n895_1308933_c1
3164 nmdc:mga0n895_1430135_c1
3165 nmdc:mga0n895_175069_c1
3166 nmdc:mga0n895_2348_c1
3167 nmdc:mga0n895_390244_c1
3168 nmdc:mga0rr50_340302_c1
3169 nmdc:mga0rr50_50385_c1
3170 nmdc:mga0rr50_55_c1
3171 nmdc:mga0rr50_827578_c1
3172 nmdc:mga0rr50_852928_c1
3173 nmdc:mga08x19_12_c1
3174 nmdc:mga08x19_138782_c1
3175 nmdc:mga08x19_442384_c1
3176 nmdc:mga0a205_1340761_c1
3177 nmdc:mga0a205_149622_c1
3178 nmdc:mga0a205_21372_c1
3179 nmdc:mga0a205_347572_c1
3180 nmdc:mga0a205_383466_c1
3181 nmdc:mga0a205_410603_c1
3182 nmdc:mga0a205_522998_c1
3183 nmdc:mga0a205_728520_c1
3184 nmdc:mga0a205_803134_c1
3185 nmdc:mga0a205_902153_c1
3186 Ga0530510_1235318

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bo5-assembly3.cif.gz_C structure of a unique atp synthase subunit neqb from nanoarcheaum equitans 0.786 34 76
5i7q-assembly1.cif.gz_A crystal structure of fkbp12-if(slpa), a chimeric protein of human fkbp12 and the insert in flap domain of ecoli slpa 0.7404 34 76
7oxj-assembly1.cif.gz_A ttslyd with m8a pseudo-wild-type s2 peptide 0.7373 34 76
6q45-assembly1.cif.gz_F f1-atpase from fusobacterium nucleatum 0.7186 21 76
5bn4-assembly1.cif.gz_B structure of a unique atp synthase neqa-neqb in complex with anp from nanoarcheaum equitans 0.7101 27 76
ID Description Score Start End Superfamily
5bo5B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8097 34 76 3.40.50.12240
5i7qA02 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.7438 34 77 2.40.10.330
af_Q9XPJ9_41_108_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.7153 21 76 2.40.30.20
4dt4A02 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.7122 34 79 2.40.10.330
af_P0AEM0_10_140_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.705 34 76 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2V8Q9W5-F1-model_v4 Uncharacterized protein 0.9571 22 88
AF-A0A2V8Q9W5-F1-model_v4 Uncharacterized protein 0.9435 22 88
AF-A0A7W1LV34-F1-model_v4 Uncharacterized protein 0.9356 1 88
AF-A0A399WQ38-F1-model_v4 Uncharacterized protein 0.9309 10 88
AF-A0A7T9GKC0-F1-model_v4 deleted 0.8957 1 88

Map