F494935
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1591 | 647 | 1509 | 77 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_101302768|Ga0070708_1013027682 |
| Length | 85 |
| Sequence | MAAKSGSAVVNAYILIQTEVGKAAAVAKSAAQIKGVLSAEDVTGPYDVIVRAEAKNVDDLGKLVVARIQGVEGITRTLTCPVVHL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 3 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 4 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 5 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 6 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 7 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 8 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 9 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 10 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 11 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 12 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 13 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 14 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 15 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 16 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 17 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 18 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 19 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 20 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 21 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 22 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 23 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 24 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 25 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 26 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 27 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 28 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 29 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 30 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 31 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 32 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 33 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 34 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 35 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 36 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 37 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 38 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 39 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 40 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 41 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 42 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 43 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 44 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 45 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 46 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 47 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 48 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 49 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 50 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 51 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 52 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 53 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 54 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 55 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 56 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 57 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 58 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 59 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 60 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 61 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 62 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 63 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 64 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 65 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 66 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 67 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 68 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 69 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 70 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 71 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 72 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 73 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 74 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 75 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 76 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 77 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 79 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 80 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 84 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 86 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 90 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 92 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 103 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 119 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 120 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 121 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 122 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 123 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 125 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 126 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 127 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 128 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 130 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 131 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 135 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 136 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 138 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 139 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 140 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 142 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 143 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 144 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 145 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 146 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 147 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 148 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 149 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 150 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 151 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 152 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 153 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 154 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 156 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 157 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 158 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 159 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 160 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 161 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 162 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 163 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 164 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 165 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 167 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 168 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 169 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 170 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 171 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 172 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 173 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 174 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 175 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 176 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 178 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 196 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 197 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 198 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 199 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 200 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 201 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 202 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 214 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 218 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 219 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 220 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 221 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 222 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 223 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 224 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 225 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 226 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 227 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 228 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 230 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 231 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 232 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 301 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 302 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 306 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 307 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 308 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 309 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 310 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 311 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 313 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 314 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 315 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 316 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 317 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 318 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 319 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 320 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 321 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 322 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 323 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 324 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 325 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 326 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 327 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 328 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 329 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 330 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 331 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 332 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 333 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 335 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 336 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 337 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 338 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 339 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 340 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 341 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 342 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 343 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 344 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 345 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 346 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 347 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 348 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 349 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 350 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 351 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 352 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 353 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 354 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 355 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 356 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 357 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 358 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 359 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 360 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 361 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 362 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 363 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 364 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 365 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 366 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 367 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 368 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 369 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 370 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 371 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 372 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 373 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 374 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 375 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 376 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 377 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 378 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 379 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 380 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 381 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 382 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 383 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 384 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 385 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 386 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 387 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 388 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 389 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 390 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 391 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 392 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 393 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 394 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 395 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 396 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 397 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 398 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 399 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 400 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 401 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 402 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 403 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 404 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 405 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 406 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 407 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 408 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 409 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 410 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 411 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 412 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 413 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 414 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 415 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 416 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 417 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 418 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 419 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 420 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 421 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 422 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 423 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 424 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 425 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 426 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 427 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 428 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 429 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 430 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 511 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 512 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 513 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 514 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 515 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 516 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 517 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 518 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 519 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 520 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 521 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 522 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 523 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 524 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 525 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 526 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 527 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 528 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 530 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 531 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 532 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 533 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 534 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 535 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 536 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 537 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 538 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 539 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 540 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 541 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 542 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 543 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 544 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 545 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 546 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 547 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 548 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 549 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 550 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 551 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 552 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 553 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 554 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 555 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 556 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 557 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 558 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 559 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 560 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 561 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 562 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 563 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 564 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 565 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 566 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 567 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 568 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 569 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 570 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 571 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 572 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 573 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 574 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 575 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 576 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 577 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 578 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 579 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 585 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 586 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 587 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 588 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 589 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 590 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 591 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 592 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 593 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 594 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 595 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 596 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 597 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 598 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 599 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 600 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 601 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 602 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 603 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 604 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 605 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 606 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 607 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 608 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 609 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 610 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 611 | 3300053152 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere | Metagenome | Endosphere |
| 612 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 613 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 614 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 615 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 616 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 617 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 618 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 619 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 620 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 621 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 622 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 623 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 624 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 625 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 626 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 627 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 628 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 629 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 630 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 631 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 632 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 633 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 634 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 635 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 636 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 637 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 638 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 639 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 640 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 641 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 642 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 643 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 644 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 645 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 646 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 647 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.9 |
| Metatranscriptomes | 1.82 |
| Isolates | 5.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.33 |
| Nodule | 0.13 |
| Rhizoplane | 3.58 |
| Rhizosphere | 87.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1038130 | 3300001976 | Bacteria | 641 |
| 2 | JGI24746J21847_1070487 | 3300001977 | Bacteria | 508 |
| 3 | JGI24737J22298_10003653 | 3300001990 | Bacteria | 5419 |
| 4 | JGI24737J22298_10063356 | 3300001990 | Bacteria | 1110 |
| 5 | JGI24735J21928_10021020 | 3300002067 | Bacteria | 1995 |
| 6 | JGI24738J21930_10055472 | 3300002075 | Bacteria | 810 |
| 7 | JGI24744J21845_10079380 | 3300002077 | Bacteria | 600 |
| 8 | JGI24751J29686_10027934 | 3300002459 | Bacteria | 1172 |
| 9 | rootH1_10041734 | 3300003316 | Bacteria | 4023 |
| 10 | rootH1_10041734 | 3300003323 | Bacteria | 3489 |
| 11 | rootH2_10067360 | 3300003320 | Bacteria | 1763 |
| 12 | rootL2_10041928 | 3300003322 | Bacteria | 1698 |
| 13 | rootL2_10063672 | 3300003322 | Bacteria | 1560 |
| 14 | rootH1_10009634 | 3300003323 | Bacteria | 3564 |
| 15 | rootH1_10030202 | 3300003323 | Bacteria | 1809 |
| 16 | rootH1_10030203 | 3300003316 | Bacteria | 5567 |
| 17 | rootH1_10030203 | 3300003323 | Bacteria | 1477 |
| 18 | JGI25407J50210_10045851 | 3300003373 | Bacteria | 1114 |
| 19 | Ga0007427J51700_123488 | 3300003559 | Bacteria | 734 |
| 20 | Ga0058863_11889194 | 3300004799 | Bacteria | 601 |
| 21 | Ga0070658_10002606 | 3300005327 | Bacteria | 15025 |
| 22 | Ga0070658_10017488 | 3300005327 | Bacteria | 5736 |
| 23 | Ga0070658_10211772 | 3300005327 | Bacteria | 1637 |
| 24 | Ga0070658_10290895 | 3300005327 | Bacteria | 1392 |
| 25 | Ga0070676_10194093 | 3300005328 | Bacteria | 1327 |
| 26 | Ga0070676_11167441 | 3300005328 | Bacteria | 584 |
| 27 | Ga0070683_100094876 | 3300005329 | Bacteria | 2804 |
| 28 | Ga0070683_100741609 | 3300005329 | Bacteria | 941 |
| 29 | Ga0070683_100997461 | 3300005329 | Bacteria | 804 |
| 30 | Ga0070683_101053993 | 3300005329 | Bacteria | 781 |
| 31 | Ga0070683_102370549 | 3300005329 | Bacteria | 509 |
| 32 | Ga0070690_100026467 | 3300005330 | Bacteria | 3578 |
| 33 | Ga0070690_100504626 | 3300005330 | Bacteria | 905 |
| 34 | Ga0070690_100553406 | 3300005330 | Bacteria | 868 |
| 35 | Ga0070670_100399061 | 3300005331 | Bacteria | 1214 |
| 36 | Ga0068869_100047601 | 3300005334 | Bacteria | 3097 |
| 37 | Ga0068869_100080194 | 3300005334 | Bacteria | 2434 |
| 38 | Ga0068869_100142285 | 3300005334 | Bacteria | 1853 |
| 39 | Ga0068869_101415583 | 3300005334 | Bacteria | 616 |
| 40 | Ga0070666_10243862 | 3300005335 | Bacteria | 1271 |
| 41 | Ga0070680_100010848 | 3300005336 | Bacteria | 7037 |
| 42 | Ga0070680_100081816 | 3300005336 | Bacteria | 2664 |
| 43 | Ga0070680_100504165 | 3300005336 | Bacteria | 1036 |
| 44 | Ga0070680_101238269 | 3300005336 | Bacteria | 646 |
| 45 | Ga0070682_100016723 | 3300005337 | Bacteria | 4269 |
| 46 | Ga0070682_100295407 | 3300005337 | Bacteria | 1186 |
| 47 | Ga0070682_100333382 | 3300005337 | Bacteria | 1125 |
| 48 | Ga0070682_100356082 | 3300005337 | Bacteria | 1093 |
| 49 | Ga0068868_100008400 | 3300005338 | Bacteria | 7391 |
| 50 | Ga0068868_100230523 | 3300005338 | Bacteria | 1553 |
| 51 | Ga0068868_100286586 | 3300005338 | Bacteria | 1395 |
| 52 | Ga0068868_100511960 | 3300005338 | Bacteria | 1052 |
| 53 | Ga0068868_101236380 | 3300005338 | Bacteria | 692 |
| 54 | Ga0068868_101418932 | 3300005338 | Bacteria | 648 |
| 55 | Ga0068868_101927925 | 3300005338 | Bacteria | 560 |
| 56 | Ga0070660_100020384 | 3300005339 | Bacteria | 4873 |
| 57 | Ga0070660_100297132 | 3300005339 | Bacteria | 1323 |
| 58 | Ga0070660_100638871 | 3300005339 | Bacteria | 891 |
| 59 | Ga0070660_101448560 | 3300005339 | Bacteria | 584 |
| 60 | Ga0070689_100135688 | 3300005340 | Bacteria | 1976 |
| 61 | Ga0070689_100264718 | 3300005340 | Bacteria | 1422 |
| 62 | Ga0070691_10119418 | 3300005341 | Bacteria | 1326 |
| 63 | Ga0070691_10209610 | 3300005341 | Bacteria | 1028 |
| 64 | Ga0070691_10837424 | 3300005341 | Bacteria | 563 |
| 65 | Ga0070687_100045504 | 3300005343 | Bacteria | 2242 |
| 66 | Ga0070687_100263442 | 3300005343 | Bacteria | 1077 |
| 67 | Ga0070687_100589783 | 3300005343 | Bacteria | 762 |
| 68 | Ga0070687_100863039 | 3300005343 | Bacteria | 646 |
| 69 | Ga0070661_100317573 | 3300005344 | Bacteria | 1216 |
| 70 | Ga0070692_10090763 | 3300005345 | Bacteria | 1660 |
| 71 | Ga0070692_10179902 | 3300005345 | Bacteria | 1225 |
| 72 | Ga0070692_10481120 | 3300005345 | Bacteria | 801 |
| 73 | Ga0070668_100507403 | 3300005347 | Bacteria | 1045 |
| 74 | Ga0070668_101237749 | 3300005347 | Bacteria | 677 |
| 75 | Ga0070669_100113141 | 3300005353 | Bacteria | 2062 |
| 76 | Ga0070675_100004208 | 3300005354 | Bacteria | 10936 |
| 77 | Ga0070675_100521069 | 3300005354 | Bacteria | 1073 |
| 78 | Ga0070675_101290541 | 3300005354 | Bacteria | 673 |
| 79 | Ga0070671_100001993 | 3300005355 | Bacteria | 15683 |
| 80 | Ga0070671_100460874 | 3300005355 | Bacteria | 1091 |
| 81 | Ga0070671_100597275 | 3300005355 | Bacteria | 954 |
| 82 | Ga0070674_100356443 | 3300005356 | Bacteria | 1183 |
| 83 | Ga0070674_101189748 | 3300005356 | Bacteria | 676 |
| 84 | Ga0070673_100004884 | 3300005364 | Bacteria | 8534 |
| 85 | Ga0070673_100581137 | 3300005364 | Bacteria | 1020 |
| 86 | Ga0070688_100112668 | 3300005365 | Bacteria | 1812 |
| 87 | Ga0070659_100002405 | 3300005366 | Bacteria | 13298 |
| 88 | Ga0070659_100020513 | 3300005366 | Bacteria | 5022 |
| 89 | Ga0070659_100275939 | 3300005366 | Bacteria | 1398 |
| 90 | Ga0070659_102088356 | 3300005366 | Bacteria | 509 |
| 91 | Ga0070667_101137246 | 3300005367 | Bacteria | 730 |
| 92 | Ga0070667_101195776 | 3300005367 | Bacteria | 711 |
| 93 | Ga0070709_10014255 | 3300005434 | Bacteria | 4494 |
| 94 | Ga0070709_11216682 | 3300005434 | Bacteria | 606 |
| 95 | Ga0070714_100009390 | 3300005435 | Bacteria | 7687 |
| 96 | Ga0070714_100016298 | 3300005435 | Bacteria | 5996 |
| 97 | Ga0070714_100019750 | 3300005435 | Bacteria | 5495 |
| 98 | Ga0070714_101612938 | 3300005435 | Bacteria | 634 |
| 99 | Ga0070713_100006832 | 3300005436 | Bacteria | 7950 |
| 100 | Ga0070713_100143478 | 3300005436 | Bacteria | 2117 |
| 101 | Ga0070713_100375319 | 3300005436 | Bacteria | 1324 |
| 102 | Ga0070713_101042885 | 3300005436 | Bacteria | 789 |
| 103 | Ga0070710_10113375 | 3300005437 | Bacteria | 1631 |
| 104 | Ga0070710_10831655 | 3300005437 | Bacteria | 662 |
| 105 | Ga0070701_10130586 | 3300005438 | Bacteria | 1427 |
| 106 | Ga0070701_10293836 | 3300005438 | Bacteria | 996 |
| 107 | Ga0070711_100001086 | 3300005439 | Bacteria | 14531 |
| 108 | Ga0070711_100201208 | 3300005439 | Bacteria | 1537 |
| 109 | Ga0070705_100097124 | 3300005440 | Bacteria | 1851 |
| 110 | Ga0070700_100014074 | 3300005441 | Bacteria | 4511 |
| 111 | Ga0070694_101919948 | 3300005444 | Bacteria | 506 |
| 112 | Ga0070708_100006735 | 3300005445 | Bacteria | 9153 |
| 113 | Ga0070708_100098106 | 3300005445 | Bacteria | 2679 |
| 114 | Ga0070708_100133949 | 3300005445 | Bacteria | 2294 |
| 115 | Ga0070708_100236745 | 3300005445 | Bacteria | 1714 |
| 116 | Ga0070708_100272583 | 3300005445 | Bacteria | 1592 |
| 117 | Ga0070708_101302768 | 3300005445 | Bacteria | 679 |
| 118 | Ga0070663_100082281 | 3300005455 | Bacteria | 2368 |
| 119 | Ga0070663_100679015 | 3300005455 | Bacteria | 874 |
| 120 | Ga0070663_100756894 | 3300005455 | Bacteria | 830 |
| 121 | Ga0070678_100001267 | 3300005456 | Bacteria | 13414 |
| 122 | Ga0070678_100626753 | 3300005456 | Bacteria | 962 |
| 123 | Ga0070678_100975294 | 3300005456 | Bacteria | 778 |
| 124 | Ga0070678_101950197 | 3300005456 | Bacteria | 555 |
| 125 | Ga0070662_100007273 | 3300005457 | Bacteria | 7174 |
| 126 | Ga0070662_100281198 | 3300005457 | Bacteria | 1347 |
| 127 | Ga0070662_101328954 | 3300005457 | Bacteria | 619 |
| 128 | Ga0070681_10000046 | 3300005458 | Bacteria | 84043 |
| 129 | Ga0070681_10002542 | 3300005458 | Bacteria | 16737 |
| 130 | Ga0070681_10059510 | 3300005458 | Bacteria | 3800 |
| 131 | Ga0070681_10798072 | 3300005458 | Bacteria | 861 |
| 132 | Ga0070681_10863061 | 3300005458 | Bacteria | 823 |
| 133 | Ga0068867_100011982 | 3300005459 | Bacteria | 6126 |
| 134 | Ga0068867_100083090 | 3300005459 | Bacteria | 2417 |
| 135 | Ga0068867_100795119 | 3300005459 | Bacteria | 843 |
| 136 | Ga0068867_101692293 | 3300005459 | Bacteria | 593 |
| 137 | Ga0070706_100003607 | 3300005467 | Bacteria | 15167 |
| 138 | Ga0070706_100003790 | 3300005467 | Bacteria | 14762 |
| 139 | Ga0070706_100010869 | 3300005467 | Bacteria | 8449 |
| 140 | Ga0070706_100050423 | 3300005467 | Bacteria | 3841 |
| 141 | Ga0070706_100254086 | 3300005467 | Bacteria | 1641 |
| 142 | Ga0070706_100277831 | 3300005467 | Bacteria | 1563 |
| 143 | Ga0070707_100003265 | 3300005468 | Bacteria | 15362 |
| 144 | Ga0070707_100005057 | 3300005468 | Bacteria | 12361 |
| 145 | Ga0070707_100008692 | 3300005468 | Bacteria | 9417 |
| 146 | Ga0070707_100084153 | 3300005468 | Bacteria | 3073 |
| 147 | Ga0070707_100463351 | 3300005468 | Bacteria | 1228 |
| 148 | Ga0070707_100540171 | 3300005468 | Bacteria | 1128 |
| 149 | Ga0070698_100001113 | 3300005471 | Bacteria | 29670 |
| 150 | Ga0070698_100028531 | 3300005471 | Bacteria | 5796 |
| 151 | Ga0070698_100031028 | 3300005471 | Bacteria | 5542 |
| 152 | Ga0070698_100060083 | 3300005471 | Bacteria | 3836 |
| 153 | Ga0070698_100522246 | 3300005471 | Bacteria | 1126 |
| 154 | Ga0070698_101312455 | 3300005471 | Bacteria | 674 |
| 155 | Ga0070698_101435958 | 3300005471 | Bacteria | 641 |
| 156 | Ga0070699_100145208 | 3300005518 | Bacteria | 2096 |
| 157 | Ga0070679_100001623 | 3300005530 | Bacteria | 20251 |
| 158 | Ga0070679_100007199 | 3300005530 | Bacteria | 10389 |
| 159 | Ga0070679_100025362 | 3300005530 | Bacteria | 5817 |
| 160 | Ga0070679_100067238 | 3300005530 | Bacteria | 3574 |
| 161 | Ga0070679_100069299 | 3300005530 | Bacteria | 3518 |
| 162 | Ga0070679_100411525 | 3300005530 | Bacteria | 1298 |
| 163 | Ga0070679_101109460 | 3300005530 | Bacteria | 736 |
| 164 | Ga0070679_102148866 | 3300005530 | Bacteria | 508 |
| 165 | Ga0070684_100003597 | 3300005535 | Bacteria | 11666 |
| 166 | Ga0070684_100232644 | 3300005535 | Bacteria | 1683 |
| 167 | Ga0070684_100706452 | 3300005535 | Bacteria | 940 |
| 168 | Ga0070684_101741503 | 3300005535 | Bacteria | 588 |
| 169 | Ga0070697_100024673 | 3300005536 | Bacteria | 4789 |
| 170 | Ga0070697_100044501 | 3300005536 | Bacteria | 3596 |
| 171 | Ga0068853_100029100 | 3300005539 | Bacteria | 4653 |
| 172 | Ga0068853_100291323 | 3300005539 | Bacteria | 1507 |
| 173 | Ga0068853_101725594 | 3300005539 | Bacteria | 607 |
| 174 | Ga0070672_101928585 | 3300005543 | Bacteria | 532 |
| 175 | Ga0070686_100100101 | 3300005544 | Bacteria | 1956 |
| 176 | Ga0070686_100288427 | 3300005544 | Bacteria | 1213 |
| 177 | Ga0070695_100091599 | 3300005545 | Bacteria | 2031 |
| 178 | Ga0070695_100375328 | 3300005545 | Bacteria | 1072 |
| 179 | Ga0070696_100090898 | 3300005546 | Bacteria | 2173 |
| 180 | Ga0070693_100308034 | 3300005547 | Bacteria | 1070 |
| 181 | Ga0070693_100665321 | 3300005547 | Bacteria | 759 |
| 182 | Ga0070693_100795504 | 3300005547 | Bacteria | 700 |
| 183 | Ga0070665_100021695 | 3300005548 | Bacteria | 6458 |
| 184 | Ga0070665_100436018 | 3300005548 | Bacteria | 1319 |
| 185 | Ga0070665_101111229 | 3300005548 | Bacteria | 802 |
| 186 | Ga0070704_100032625 | 3300005549 | Bacteria | 3514 |
| 187 | Ga0068855_100333298 | 3300005563 | Bacteria | 1675 |
| 188 | Ga0068855_100731405 | 3300005563 | Bacteria | 1057 |
| 189 | Ga0068855_101175757 | 3300005563 | Bacteria | 799 |
| 190 | Ga0068855_101484090 | 3300005563 | Bacteria | 697 |
| 191 | Ga0068855_102140500 | 3300005563 | Bacteria | 563 |
| 192 | Ga0070664_101305891 | 3300005564 | Bacteria | 685 |
| 193 | Ga0068857_101599873 | 3300005577 | Bacteria | 636 |
| 194 | Ga0068854_100042731 | 3300005578 | Bacteria | 3209 |
| 195 | Ga0068854_100501014 | 3300005578 | Bacteria | 1023 |
| 196 | Ga0068854_100589408 | 3300005578 | Bacteria | 948 |
| 197 | Ga0068854_101917209 | 3300005578 | Bacteria | 545 |
| 198 | Ga0068856_100005097 | 3300005614 | Bacteria | 12983 |
| 199 | Ga0068856_100057717 | 3300005614 | Bacteria | 3832 |
| 200 | Ga0068856_101808229 | 3300005614 | Bacteria | 623 |
| 201 | Ga0070702_100004225 | 3300005615 | Bacteria | 6537 |
| 202 | Ga0070702_100080927 | 3300005615 | Bacteria | 1945 |
| 203 | Ga0070702_100313064 | 3300005615 | Bacteria | 1091 |
| 204 | Ga0068852_100656752 | 3300005616 | Bacteria | 1056 |
| 205 | Ga0068859_100103322 | 3300005617 | Bacteria | 2907 |
| 206 | Ga0068859_100743162 | 3300005617 | Bacteria | 1070 |
| 207 | Ga0068864_100150583 | 3300005618 | Bacteria | 2107 |
| 208 | Ga0068861_100856385 | 3300005719 | Bacteria | 857 |
| 209 | Ga0068861_101805216 | 3300005719 | Bacteria | 607 |
| 210 | Ga0068851_10004867 | 3300005834 | Bacteria | 6078 |
| 211 | Ga0068870_10000527 | 3300005840 | Bacteria | 14400 |
| 212 | Ga0068870_10383754 | 3300005840 | Bacteria | 910 |
| 213 | Ga0068863_100551384 | 3300005841 | Bacteria | 1138 |
| 214 | Ga0068860_100011881 | 3300005843 | Bacteria | 8584 |
| 215 | Ga0068860_100382222 | 3300005843 | Bacteria | 1390 |
| 216 | Ga0068862_101638029 | 3300005844 | Bacteria | 651 |
| 217 | Ga0081455_10043358 | 3300005937 | Bacteria | 3936 |
| 218 | Ga0081455_10117743 | 3300005937 | Bacteria | 2099 |
| 219 | Ga0081455_10119826 | 3300005937 | Bacteria | 2075 |
| 220 | Ga0081538_10002364 | 3300005981 | Bacteria | 18542 |
| 221 | Ga0081538_10005374 | 3300005981 | Bacteria | 11513 |
| 222 | Ga0081538_10007077 | 3300005981 | Bacteria | 9748 |
| 223 | Ga0081538_10081668 | 3300005981 | Bacteria | 1718 |
| 224 | Ga0081540_1030633 | 3300005983 | Bacteria | 2976 |
| 225 | Ga0081539_10003373 | 3300005985 | Bacteria | 19777 |
| 226 | Ga0081539_10027511 | 3300005985 | Bacteria | 3599 |
| 227 | Ga0081539_10108528 | 3300005985 | Bacteria | 1402 |
| 228 | Ga0081539_10133968 | 3300005985 | Bacteria | 1213 |
| 229 | Ga0081539_10285595 | 3300005985 | Bacteria | 716 |
| 230 | Ga0070717_10001330 | 3300006028 | Bacteria | 16956 |
| 231 | Ga0070717_10127505 | 3300006028 | Bacteria | 2186 |
| 232 | Ga0070717_10244269 | 3300006028 | Bacteria | 1584 |
| 233 | Ga0075365_10116531 | 3300006038 | Bacteria | 1840 |
| 234 | Ga0075368_10016793 | 3300006042 | Bacteria | 2731 |
| 235 | Ga0075363_100004041 | 3300006048 | Bacteria | 6348 |
| 236 | Ga0075363_100049434 | 3300006048 | Bacteria | 2239 |
| 237 | Ga0075432_10006062 | 3300006058 | Bacteria | 4114 |
| 238 | Ga0070715_10041515 | 3300006163 | Bacteria | 1928 |
| 239 | Ga0070716_100030422 | 3300006173 | Bacteria | 2928 |
| 240 | Ga0070716_100193030 | 3300006173 | Bacteria | 1347 |
| 241 | Ga0070716_100598449 | 3300006173 | Bacteria | 829 |
| 242 | Ga0070712_100011977 | 3300006175 | Bacteria | 5513 |
| 243 | Ga0070712_100187544 | 3300006175 | Bacteria | 1616 |
| 244 | Ga0070712_100400537 | 3300006175 | Bacteria | 1133 |
| 245 | Ga0070712_101759396 | 3300006175 | Bacteria | 543 |
| 246 | Ga0075367_10133995 | 3300006178 | Bacteria | 1532 |
| 247 | Ga0075369_10096581 | 3300006186 | Bacteria | 1323 |
| 248 | Ga0075427_10054111 | 3300006194 | Bacteria | 695 |
| 249 | Ga0097621_101583515 | 3300006237 | Bacteria | 623 |
| 250 | Ga0075370_10589045 | 3300006353 | Bacteria | 673 |
| 251 | Ga0068871_100564435 | 3300006358 | Bacteria | 1032 |
| 252 | Ga0068871_101251433 | 3300006358 | Bacteria | 697 |
| 253 | Ga0075428_100269707 | 3300006844 | Bacteria | 1831 |
| 254 | Ga0075428_102123594 | 3300006844 | Bacteria | 581 |
| 255 | Ga0075430_100120579 | 3300006846 | Bacteria | 2186 |
| 256 | Ga0075430_101445355 | 3300006846 | Bacteria | 565 |
| 257 | Ga0075431_100251599 | 3300006847 | Bacteria | 1795 |
| 258 | Ga0075431_101037325 | 3300006847 | Bacteria | 786 |
| 259 | Ga0075433_10117521 | 3300006852 | Bacteria | 2360 |
| 260 | Ga0075433_10131394 | 3300006852 | Bacteria | 2224 |
| 261 | Ga0075433_10225470 | 3300006852 | Bacteria | 1664 |
| 262 | Ga0075433_11444570 | 3300006852 | Bacteria | 594 |
| 263 | Ga0075434_100087552 | 3300006871 | Bacteria | 3115 |
| 264 | Ga0075434_100613869 | 3300006871 | Bacteria | 1106 |
| 265 | Ga0075429_100035629 | 3300006880 | Bacteria | 4328 |
| 266 | Ga0075429_100796680 | 3300006880 | Bacteria | 827 |
| 267 | Ga0075429_100901602 | 3300006880 | Bacteria | 774 |
| 268 | Ga0068865_100015369 | 3300006881 | Bacteria | 4881 |
| 269 | Ga0068865_100792231 | 3300006881 | Bacteria | 817 |
| 270 | Ga0075436_100006077 | 3300006914 | Bacteria | 8287 |
| 271 | Ga0075436_100309015 | 3300006914 | Bacteria | 1134 |
| 272 | Ga0075436_100572094 | 3300006914 | Bacteria | 831 |
| 273 | Ga0097620_100103333 | 3300006931 | Bacteria | 2907 |
| 274 | Ga0097620_100743018 | 3300006931 | Bacteria | 1070 |
| 275 | Ga0075435_100022736 | 3300007076 | Bacteria | 4839 |
| 276 | Ga0105251_10009941 | 3300009011 | Bacteria | 5568 |
| 277 | Ga0105251_10067454 | 3300009011 | Bacteria | 1671 |
| 278 | Ga0105251_10375366 | 3300009011 | Bacteria | 651 |
| 279 | Ga0105244_10029526 | 3300009036 | Bacteria | 2929 |
| 280 | Ga0105244_10506751 | 3300009036 | Bacteria | 556 |
| 281 | Ga0105250_10113357 | 3300009092 | Bacteria | 1111 |
| 282 | Ga0105240_10032907 | 3300009093 | Bacteria | 6705 |
| 283 | Ga0105240_10181039 | 3300009093 | Bacteria | 2487 |
| 284 | Ga0105240_10319795 | 3300009093 | Bacteria | 1769 |
| 285 | Ga0105240_11006790 | 3300009093 | Bacteria | 891 |
| 286 | Ga0111539_10017829 | 3300009094 | Bacteria | 8791 |
| 287 | Ga0111539_10059096 | 3300009094 | Bacteria | 4548 |
| 288 | Ga0105245_10017915 | 3300009098 | Bacteria | 6185 |
| 289 | Ga0105245_10060270 | 3300009098 | Bacteria | 3418 |
| 290 | Ga0105245_10179536 | 3300009098 | Bacteria | 2021 |
| 291 | Ga0105245_10371275 | 3300009098 | Bacteria | 1422 |
| 292 | Ga0105245_10488273 | 3300009098 | Bacteria | 1246 |
| 293 | Ga0105245_10818897 | 3300009098 | Bacteria | 970 |
| 294 | Ga0105245_11197458 | 3300009098 | Bacteria | 807 |
| 295 | Ga0105245_11419024 | 3300009098 | Bacteria | 744 |
| 296 | Ga0105245_11457142 | 3300009098 | Bacteria | 735 |
| 297 | Ga0105245_12326789 | 3300009098 | Bacteria | 589 |
| 298 | Ga0105245_12886651 | 3300009098 | Bacteria | 533 |
| 299 | Ga0105245_13238202 | 3300009098 | Bacteria | 504 |
| 300 | Ga0105247_10027969 | 3300009101 | Bacteria | 3411 |
| 301 | Ga0114129_10254651 | 3300009147 | Bacteria | 2355 |
| 302 | Ga0114129_10919485 | 3300009147 | Bacteria | 1107 |
| 303 | Ga0105243_10003463 | 3300009148 | Bacteria | 12742 |
| 304 | Ga0105243_10090981 | 3300009148 | Bacteria | 2512 |
| 305 | Ga0105243_10307892 | 3300009148 | Bacteria | 1438 |
| 306 | Ga0105243_11422868 | 3300009148 | Bacteria | 715 |
| 307 | Ga0105243_12176516 | 3300009148 | Bacteria | 591 |
| 308 | Ga0105241_10030071 | 3300009174 | Bacteria | 4057 |
| 309 | Ga0105241_11064862 | 3300009174 | Bacteria | 760 |
| 310 | Ga0105241_12327124 | 3300009174 | Bacteria | 534 |
| 311 | Ga0105241_12494513 | 3300009174 | Bacteria | 518 |
| 312 | Ga0105242_10002867 | 3300009176 | Bacteria | 13505 |
| 313 | Ga0105242_10008779 | 3300009176 | Bacteria | 7754 |
| 314 | Ga0105242_10035559 | 3300009176 | Bacteria | 3994 |
| 315 | Ga0105242_10195487 | 3300009176 | Bacteria | 1793 |
| 316 | Ga0105242_10474130 | 3300009176 | Bacteria | 1185 |
| 317 | Ga0105242_10510739 | 3300009176 | Bacteria | 1145 |
| 318 | Ga0105242_10753568 | 3300009176 | Bacteria | 959 |
| 319 | Ga0105242_10833574 | 3300009176 | Bacteria | 916 |
| 320 | Ga0105242_11143954 | 3300009176 | Bacteria | 795 |
| 321 | Ga0105242_11424747 | 3300009176 | Bacteria | 721 |
| 322 | Ga0105248_10003481 | 3300009177 | Bacteria | 17473 |
| 323 | Ga0105248_10093019 | 3300009177 | Bacteria | 3395 |
| 324 | Ga0105248_12085505 | 3300009177 | Bacteria | 645 |
| 325 | Ga0105237_10078772 | 3300009545 | Bacteria | 3285 |
| 326 | Ga0105237_10631744 | 3300009545 | Bacteria | 1078 |
| 327 | Ga0105237_10662312 | 3300009545 | Bacteria | 1051 |
| 328 | Ga0105237_11697000 | 3300009545 | Bacteria | 639 |
| 329 | Ga0105238_10078051 | 3300009551 | Bacteria | 3302 |
| 330 | Ga0105238_11024704 | 3300009551 | Bacteria | 847 |
| 331 | Ga0105238_12498524 | 3300009551 | Bacteria | 553 |
| 332 | Ga0105249_11188012 | 3300009553 | Bacteria | 834 |
| 333 | Ga0105249_12223255 | 3300009553 | Bacteria | 621 |
| 334 | Ga0105249_12338792 | 3300009553 | Bacteria | 607 |
| 335 | Ga0105239_10084743 | 3300010375 | Bacteria | 3492 |
| 336 | Ga0105239_10373470 | 3300010375 | Bacteria | 1612 |
| 337 | Ga0105239_10614933 | 3300010375 | Bacteria | 1240 |
| 338 | Ga0105239_10641253 | 3300010375 | Bacteria | 1213 |
| 339 | Ga0105239_10643461 | 3300010375 | Bacteria | 1211 |
| 340 | Ga0105239_10728044 | 3300010375 | Bacteria | 1135 |
| 341 | Ga0105239_11134548 | 3300010375 | Bacteria | 900 |
| 342 | Ga0105239_11586667 | 3300010375 | Bacteria | 757 |
| 343 | Ga0105239_13111694 | 3300010375 | Bacteria | 540 |
| 344 | Ga0105246_10000043 | 3300011119 | Bacteria | 47690 |
| 345 | Ga0105246_10031384 | 3300011119 | Bacteria | 3516 |
| 346 | Ga0105246_10041465 | 3300011119 | Bacteria | 3111 |
| 347 | Ga0105246_10466383 | 3300011119 | Bacteria | 1065 |
| 348 | Ga0105246_11055673 | 3300011119 | Bacteria | 739 |
| 349 | Ga0157317_1017853 | 3300012475 | Bacteria | 609 |
| 350 | Ga0157335_1026195 | 3300012492 | Bacteria | 586 |
| 351 | Ga0157319_1033671 | 3300012497 | Bacteria | 567 |
| 352 | Ga0157345_1031719 | 3300012498 | Bacteria | 596 |
| 353 | Ga0157313_1002065 | 3300012503 | Bacteria | 1162 |
| 354 | Ga0157324_1008608 | 3300012506 | Bacteria | 825 |
| 355 | Ga0157327_1042893 | 3300012512 | Bacteria | 615 |
| 356 | Ga0157373_10053758 | 3300013100 | Bacteria | 2863 |
| 357 | Ga0157373_10336419 | 3300013100 | Bacteria | 1075 |
| 358 | Ga0157373_10565652 | 3300013100 | Bacteria | 825 |
| 359 | Ga0157373_10977254 | 3300013100 | Bacteria | 631 |
| 360 | Ga0157373_11356028 | 3300013100 | Bacteria | 540 |
| 361 | Ga0157371_10017120 | 3300013102 | Bacteria | 5392 |
| 362 | Ga0157371_10080787 | 3300013102 | Bacteria | 2302 |
| 363 | Ga0157371_10571147 | 3300013102 | Bacteria | 839 |
| 364 | Ga0157371_10842869 | 3300013102 | Bacteria | 693 |
| 365 | Ga0157371_10943151 | 3300013102 | Bacteria | 656 |
| 366 | Ga0157370_10067578 | 3300013104 | Bacteria | 3378 |
| 367 | Ga0157370_10117335 | 3300013104 | Bacteria | 2486 |
| 368 | Ga0157370_10420426 | 3300013104 | Bacteria | 1230 |
| 369 | Ga0157370_10926837 | 3300013104 | Bacteria | 790 |
| 370 | Ga0157369_10000870 | 3300013105 | Bacteria | 38542 |
| 371 | Ga0157369_10054557 | 3300013105 | Bacteria | 4316 |
| 372 | Ga0157369_10102442 | 3300013105 | Bacteria | 3051 |
| 373 | Ga0157369_10227184 | 3300013105 | Bacteria | 1952 |
| 374 | Ga0157369_10241307 | 3300013105 | Bacteria | 1888 |
| 375 | Ga0157369_10973780 | 3300013105 | Bacteria | 869 |
| 376 | Ga0157369_11735141 | 3300013105 | Bacteria | 634 |
| 377 | Ga0157369_11823400 | 3300013105 | Bacteria | 618 |
| 378 | Ga0157369_12471059 | 3300013105 | Bacteria | 526 |
| 379 | Ga0157374_10017768 | 3300013296 | Bacteria | 6267 |
| 380 | Ga0157374_10027093 | 3300013296 | Bacteria | 5165 |
| 381 | Ga0157374_10093890 | 3300013296 | Bacteria | 2865 |
| 382 | Ga0157374_10229907 | 3300013296 | Bacteria | 1821 |
| 383 | Ga0157374_10599384 | 3300013296 | Bacteria | 1112 |
| 384 | Ga0157374_11584229 | 3300013296 | Bacteria | 679 |
| 385 | Ga0157374_12416973 | 3300013296 | Bacteria | 553 |
| 386 | Ga0157378_11041478 | 3300013297 | Bacteria | 854 |
| 387 | Ga0157378_11186342 | 3300013297 | Bacteria | 802 |
| 388 | Ga0157378_12061621 | 3300013297 | Bacteria | 621 |
| 389 | Ga0157378_13112107 | 3300013297 | Bacteria | 515 |
| 390 | Ga0163162_10055426 | 3300013306 | Bacteria | 3991 |
| 391 | Ga0163162_10332005 | 3300013306 | Bacteria | 1653 |
| 392 | Ga0163162_11132157 | 3300013306 | Bacteria | 887 |
| 393 | Ga0163162_11541457 | 3300013306 | Bacteria | 757 |
| 394 | Ga0157372_10224670 | 3300013307 | Bacteria | 2177 |
| 395 | Ga0157372_10346837 | 3300013307 | Bacteria | 1730 |
| 396 | Ga0157372_10703483 | 3300013307 | Bacteria | 1176 |
| 397 | Ga0157372_11411986 | 3300013307 | Bacteria | 802 |
| 398 | Ga0157372_13086784 | 3300013307 | Bacteria | 532 |
| 399 | Ga0157375_10015233 | 3300013308 | Bacteria | 6880 |
| 400 | Ga0157375_11332668 | 3300013308 | Bacteria | 844 |
| 401 | Ga0157375_11986119 | 3300013308 | Bacteria | 691 |
| 402 | Ga0163163_10058272 | 3300014325 | Bacteria | 3819 |
| 403 | Ga0163163_10616569 | 3300014325 | Bacteria | 1148 |
| 404 | Ga0163163_10654633 | 3300014325 | Bacteria | 1114 |
| 405 | Ga0163163_10712683 | 3300014325 | Bacteria | 1067 |
| 406 | Ga0157380_10356865 | 3300014326 | Bacteria | 1370 |
| 407 | Ga0182008_10000253 | 3300014497 | Bacteria | 41589 |
| 408 | Ga0182008_10225902 | 3300014497 | Bacteria | 959 |
| 409 | Ga0157377_10124756 | 3300014745 | Bacteria | 1565 |
| 410 | Ga0157377_10166097 | 3300014745 | Bacteria | 1376 |
| 411 | Ga0157377_10618015 | 3300014745 | Bacteria | 775 |
| 412 | Ga0157377_11273819 | 3300014745 | Bacteria | 573 |
| 413 | Ga0157379_10007721 | 3300014968 | Bacteria | 9312 |
| 414 | Ga0157379_10041025 | 3300014968 | Bacteria | 4131 |
| 415 | Ga0157379_11734809 | 3300014968 | Bacteria | 612 |
| 416 | Ga0157376_10190203 | 3300014969 | Bacteria | 1882 |
| 417 | Ga0157376_11333464 | 3300014969 | Bacteria | 748 |
| 418 | Ga0182007_10000295 | 3300015262 | Bacteria | 32455 |
| 419 | Ga0182005_1015457 | 3300015265 | Bacteria | 2128 |
| 420 | Ga0183367_1013 | 3300015688 | Bacteria | 334176 |
| 421 | Ga0163161_10037148 | 3300017792 | Bacteria | 3491 |
| 422 | Ga0163161_10378022 | 3300017792 | Bacteria | 1131 |
| 423 | Ga0163161_10559656 | 3300017792 | Bacteria | 938 |
| 424 | Ga0197907_11056749 | 3300020069 | Bacteria | 863 |
| 425 | Ga0197907_11151097 | 3300020069 | Bacteria | 550 |
| 426 | Ga0197907_11496031 | 3300020069 | Bacteria | 1027 |
| 427 | Ga0206356_10780096 | 3300020070 | Bacteria | 768 |
| 428 | Ga0206351_10456640 | 3300020077 | Bacteria | 591 |
| 429 | Ga0206351_10506274 | 3300020077 | Bacteria | 748 |
| 430 | Ga0206352_10837226 | 3300020078 | Bacteria | 507 |
| 431 | Ga0206350_10519492 | 3300020080 | Bacteria | 817 |
| 432 | Ga0206354_10849213 | 3300020081 | Bacteria | 3978 |
| 433 | Ga0206354_11155629 | 3300020081 | Bacteria | 593 |
| 434 | Ga0206354_11532524 | 3300020081 | Bacteria | 860 |
| 435 | Ga0206353_10486774 | 3300020082 | Bacteria | 3880 |
| 436 | Ga0206353_10633777 | 3300020082 | Bacteria | 2049 |
| 437 | Ga0206353_11701529 | 3300020082 | Bacteria | 571 |
| 438 | Ga0154015_1302778 | 3300020610 | Bacteria | 501 |
| 439 | Ga0154015_1492505 | 3300020610 | Bacteria | 505 |
| 440 | Ga0213876_10006371 | 3300021384 | Bacteria | 6433 |
| 441 | Ga0213875_10496586 | 3300021388 | Bacteria | 586 |
| 442 | Ga0224712_10283858 | 3300022467 | Bacteria | 771 |
| 443 | Ga0224712_10315480 | 3300022467 | Bacteria | 734 |
| 444 | Ga0224712_10492403 | 3300022467 | Bacteria | 592 |
| 445 | Ga0224712_10506072 | 3300022467 | Bacteria | 584 |
| 446 | Ga0224712_10644212 | 3300022467 | Bacteria | 519 |
| 447 | Ga0207426_1003865 | 3300025302 | Bacteria | 7721 |
| 448 | Ga0207656_10012144 | 3300025321 | Bacteria | 3269 |
| 449 | Ga0207656_10286373 | 3300025321 | Bacteria | 813 |
| 450 | Ga0207696_1129341 | 3300025711 | Bacteria | 679 |
| 451 | Ga0207692_10044802 | 3300025898 | Bacteria | 2209 |
| 452 | Ga0207642_10028544 | 3300025899 | Bacteria | 2299 |
| 453 | Ga0207710_10047867 | 3300025900 | Bacteria | 1912 |
| 454 | Ga0207688_10012469 | 3300025901 | Bacteria | 4626 |
| 455 | Ga0207688_10101487 | 3300025901 | Bacteria | 1662 |
| 456 | Ga0207688_10333190 | 3300025901 | Bacteria | 933 |
| 457 | Ga0207647_10037633 | 3300025904 | Bacteria | 3066 |
| 458 | Ga0207647_10192034 | 3300025904 | Bacteria | 1183 |
| 459 | Ga0207647_10425785 | 3300025904 | Bacteria | 746 |
| 460 | Ga0207685_10006249 | 3300025905 | Bacteria | 3227 |
| 461 | Ga0207699_10029683 | 3300025906 | Bacteria | 3051 |
| 462 | Ga0207699_10044698 | 3300025906 | Bacteria | 2579 |
| 463 | Ga0207645_10026096 | 3300025907 | Bacteria | 3777 |
| 464 | Ga0207645_10143196 | 3300025907 | Bacteria | 1558 |
| 465 | Ga0207643_10000255 | 3300025908 | Bacteria | 37233 |
| 466 | Ga0207643_10363098 | 3300025908 | Bacteria | 910 |
| 467 | Ga0207643_10890807 | 3300025908 | Bacteria | 577 |
| 468 | Ga0207705_10002517 | 3300025909 | Bacteria | 14126 |
| 469 | Ga0207705_10017293 | 3300025909 | Bacteria | 5163 |
| 470 | Ga0207705_10189930 | 3300025909 | Bacteria | 1553 |
| 471 | Ga0207705_10251660 | 3300025909 | Bacteria | 1347 |
| 472 | Ga0207705_11118594 | 3300025909 | Bacteria | 606 |
| 473 | Ga0207684_10000844 | 3300025910 | Bacteria | 35321 |
| 474 | Ga0207684_10002346 | 3300025910 | Bacteria | 19173 |
| 475 | Ga0207684_10008439 | 3300025910 | Bacteria | 9165 |
| 476 | Ga0207684_10053046 | 3300025910 | Bacteria | 3442 |
| 477 | Ga0207684_10123941 | 3300025910 | Bacteria | 2216 |
| 478 | Ga0207654_10185165 | 3300025911 | Bacteria | 1361 |
| 479 | Ga0207707_10000737 | 3300025912 | Bacteria | 32379 |
| 480 | Ga0207707_10010925 | 3300025912 | Bacteria | 7896 |
| 481 | Ga0207707_10315609 | 3300025912 | Bacteria | 1350 |
| 482 | Ga0207707_10661816 | 3300025912 | Bacteria | 879 |
| 483 | Ga0207707_10953806 | 3300025912 | Bacteria | 706 |
| 484 | Ga0207707_11030224 | 3300025912 | Bacteria | 674 |
| 485 | Ga0207695_10034116 | 3300025913 | Bacteria | 5539 |
| 486 | Ga0207695_10276393 | 3300025913 | Bacteria | 1574 |
| 487 | Ga0207695_11256014 | 3300025913 | Bacteria | 621 |
| 488 | Ga0207671_10114753 | 3300025914 | Bacteria | 2053 |
| 489 | Ga0207671_10142489 | 3300025914 | Bacteria | 1847 |
| 490 | Ga0207671_10412602 | 3300025914 | Bacteria | 1074 |
| 491 | Ga0207693_10019809 | 3300025915 | Bacteria | 5349 |
| 492 | Ga0207693_10165584 | 3300025915 | Bacteria | 1740 |
| 493 | Ga0207663_10021541 | 3300025916 | Bacteria | 3671 |
| 494 | Ga0207663_10033418 | 3300025916 | Bacteria | 3064 |
| 495 | Ga0207663_10224703 | 3300025916 | Bacteria | 1368 |
| 496 | Ga0207660_10001218 | 3300025917 | Bacteria | 17215 |
| 497 | Ga0207660_10041213 | 3300025917 | Bacteria | 3235 |
| 498 | Ga0207660_10418974 | 3300025917 | Bacteria | 1080 |
| 499 | Ga0207660_10818317 | 3300025917 | Bacteria | 760 |
| 500 | Ga0207660_11314426 | 3300025917 | Bacteria | 587 |
| 501 | Ga0207662_10067495 | 3300025918 | Bacteria | 2157 |
| 502 | Ga0207662_10144665 | 3300025918 | Bacteria | 1508 |
| 503 | Ga0207662_10272767 | 3300025918 | Bacteria | 1117 |
| 504 | Ga0207657_10020354 | 3300025919 | Bacteria | 6272 |
| 505 | Ga0207657_10046041 | 3300025919 | Bacteria | 3822 |
| 506 | Ga0207657_10109524 | 3300025919 | Bacteria | 2282 |
| 507 | Ga0207657_10309157 | 3300025919 | Bacteria | 1251 |
| 508 | Ga0207657_10666670 | 3300025919 | Bacteria | 809 |
| 509 | Ga0207657_10997148 | 3300025919 | Bacteria | 643 |
| 510 | Ga0207649_10005364 | 3300025920 | Bacteria | 6940 |
| 511 | Ga0207652_10000461 | 3300025921 | Bacteria | 41921 |
| 512 | Ga0207652_10028585 | 3300025921 | Bacteria | 4653 |
| 513 | Ga0207652_10047136 | 3300025921 | Bacteria | 3681 |
| 514 | Ga0207652_10235615 | 3300025921 | Bacteria | 1650 |
| 515 | Ga0207652_10261428 | 3300025921 | Bacteria | 1561 |
| 516 | Ga0207652_11109790 | 3300025921 | Bacteria | 691 |
| 517 | Ga0207652_11297042 | 3300025921 | Bacteria | 631 |
| 518 | Ga0207646_10000990 | 3300025922 | Bacteria | 36476 |
| 519 | Ga0207646_10009844 | 3300025922 | Bacteria | 9409 |
| 520 | Ga0207646_10020576 | 3300025922 | Bacteria | 6113 |
| 521 | Ga0207646_10110919 | 3300025922 | Bacteria | 2461 |
| 522 | Ga0207646_10273879 | 3300025922 | Bacteria | 1526 |
| 523 | Ga0207681_10140457 | 3300025923 | Bacteria | 1798 |
| 524 | Ga0207694_10053554 | 3300025924 | Bacteria | 3129 |
| 525 | Ga0207694_11790513 | 3300025924 | Bacteria | 516 |
| 526 | Ga0207650_10008935 | 3300025925 | Bacteria | 6847 |
| 527 | Ga0207650_11036479 | 3300025925 | Bacteria | 698 |
| 528 | Ga0207650_11850837 | 3300025925 | Bacteria | 510 |
| 529 | Ga0207659_10076266 | 3300025926 | Bacteria | 2463 |
| 530 | Ga0207659_10101779 | 3300025926 | Bacteria | 2167 |
| 531 | Ga0207659_10272224 | 3300025926 | Bacteria | 1381 |
| 532 | Ga0207687_10054509 | 3300025927 | Bacteria | 2798 |
| 533 | Ga0207687_10082022 | 3300025927 | Bacteria | 2332 |
| 534 | Ga0207687_10089960 | 3300025927 | Bacteria | 2236 |
| 535 | Ga0207687_10651963 | 3300025927 | Bacteria | 891 |
| 536 | Ga0207687_11178823 | 3300025927 | Bacteria | 658 |
| 537 | Ga0207687_11685403 | 3300025927 | Bacteria | 543 |
| 538 | Ga0207687_11881367 | 3300025927 | Bacteria | 512 |
| 539 | Ga0207700_10002007 | 3300025928 | Bacteria | 11610 |
| 540 | Ga0207700_10012146 | 3300025928 | Bacteria | 5539 |
| 541 | Ga0207700_10111827 | 3300025928 | Bacteria | 2199 |
| 542 | Ga0207700_10280663 | 3300025928 | Bacteria | 1433 |
| 543 | Ga0207700_10292892 | 3300025928 | Bacteria | 1403 |
| 544 | Ga0207700_11980278 | 3300025928 | Bacteria | 509 |
| 545 | Ga0207664_10000722 | 3300025929 | Bacteria | 22530 |
| 546 | Ga0207664_10005405 | 3300025929 | Bacteria | 8722 |
| 547 | Ga0207664_10087450 | 3300025929 | Bacteria | 2548 |
| 548 | Ga0207664_10254777 | 3300025929 | Bacteria | 1533 |
| 549 | Ga0207664_10316678 | 3300025929 | Bacteria | 1376 |
| 550 | Ga0207664_11752017 | 3300025929 | Bacteria | 543 |
| 551 | Ga0207644_10010248 | 3300025931 | Bacteria | 6176 |
| 552 | Ga0207644_10464129 | 3300025931 | Bacteria | 1041 |
| 553 | Ga0207690_10000157 | 3300025932 | Bacteria | 53457 |
| 554 | Ga0207690_10027235 | 3300025932 | Bacteria | 3611 |
| 555 | Ga0207690_10652843 | 3300025932 | Bacteria | 862 |
| 556 | Ga0207690_11312936 | 3300025932 | Bacteria | 605 |
| 557 | Ga0207706_10031749 | 3300025933 | Bacteria | 4703 |
| 558 | Ga0207706_10179613 | 3300025933 | Bacteria | 1859 |
| 559 | Ga0207706_10221032 | 3300025933 | Bacteria | 1658 |
| 560 | Ga0207706_10374031 | 3300025933 | Bacteria | 1237 |
| 561 | Ga0207686_10097534 | 3300025934 | Bacteria | 1955 |
| 562 | Ga0207686_10173656 | 3300025934 | Bacteria | 1522 |
| 563 | Ga0207686_10201462 | 3300025934 | Bacteria | 1426 |
| 564 | Ga0207686_10295432 | 3300025934 | Bacteria | 1201 |
| 565 | Ga0207686_10693801 | 3300025934 | Bacteria | 809 |
| 566 | Ga0207709_10012443 | 3300025935 | Bacteria | 4687 |
| 567 | Ga0207709_10024868 | 3300025935 | Bacteria | 3425 |
| 568 | Ga0207709_10907226 | 3300025935 | Bacteria | 716 |
| 569 | Ga0207709_11762192 | 3300025935 | Bacteria | 515 |
| 570 | Ga0207670_10075697 | 3300025936 | Bacteria | 2340 |
| 571 | Ga0207670_11059885 | 3300025936 | Bacteria | 683 |
| 572 | Ga0207669_10115037 | 3300025937 | Bacteria | 1812 |
| 573 | Ga0207669_11267313 | 3300025937 | Bacteria | 626 |
| 574 | Ga0207669_11442598 | 3300025937 | Bacteria | 586 |
| 575 | Ga0207669_11540877 | 3300025937 | Bacteria | 567 |
| 576 | Ga0207704_10027324 | 3300025938 | Bacteria | 3146 |
| 577 | Ga0207704_10364624 | 3300025938 | Bacteria | 1129 |
| 578 | Ga0207704_10656248 | 3300025938 | Bacteria | 865 |
| 579 | Ga0207704_11448080 | 3300025938 | Bacteria | 589 |
| 580 | Ga0207665_10036641 | 3300025939 | Bacteria | 3263 |
| 581 | Ga0207665_10673246 | 3300025939 | Bacteria | 812 |
| 582 | Ga0207665_11249280 | 3300025939 | Bacteria | 592 |
| 583 | Ga0207691_10085403 | 3300025940 | Bacteria | 2832 |
| 584 | Ga0207691_11418964 | 3300025940 | Bacteria | 570 |
| 585 | Ga0207711_10076181 | 3300025941 | Bacteria | 2921 |
| 586 | Ga0207711_10127941 | 3300025941 | Bacteria | 2274 |
| 587 | Ga0207689_10001805 | 3300025942 | Bacteria | 20198 |
| 588 | Ga0207689_10098506 | 3300025942 | Bacteria | 2402 |
| 589 | Ga0207689_10099790 | 3300025942 | Bacteria | 2386 |
| 590 | Ga0207689_10152879 | 3300025942 | Bacteria | 1902 |
| 591 | Ga0207689_10332318 | 3300025942 | Bacteria | 1262 |
| 592 | Ga0207689_10916969 | 3300025942 | Bacteria | 739 |
| 593 | Ga0207661_10573680 | 3300025944 | Bacteria | 1035 |
| 594 | Ga0207661_10749136 | 3300025944 | Bacteria | 899 |
| 595 | Ga0207661_11047948 | 3300025944 | Bacteria | 751 |
| 596 | Ga0207661_11464208 | 3300025944 | Bacteria | 626 |
| 597 | Ga0207679_10007228 | 3300025945 | Bacteria | 7037 |
| 598 | Ga0207679_10334475 | 3300025945 | Bacteria | 1315 |
| 599 | Ga0207667_10415696 | 3300025949 | Bacteria | 1369 |
| 600 | Ga0207667_11105460 | 3300025949 | Bacteria | 776 |
| 601 | Ga0207667_12155100 | 3300025949 | Bacteria | 515 |
| 602 | Ga0207651_10461626 | 3300025960 | Bacteria | 1091 |
| 603 | Ga0207712_10289015 | 3300025961 | Bacteria | 1341 |
| 604 | Ga0207712_10536035 | 3300025961 | Bacteria | 1005 |
| 605 | Ga0207712_11629043 | 3300025961 | Bacteria | 578 |
| 606 | Ga0207668_10544345 | 3300025972 | Bacteria | 1005 |
| 607 | Ga0207668_10753516 | 3300025972 | Bacteria | 859 |
| 608 | Ga0207640_10139129 | 3300025981 | Bacteria | 1767 |
| 609 | Ga0207640_10377000 | 3300025981 | Bacteria | 1148 |
| 610 | Ga0207640_10670966 | 3300025981 | Bacteria | 885 |
| 611 | Ga0207658_11275082 | 3300025986 | Bacteria | 672 |
| 612 | Ga0207677_10112573 | 3300026023 | Bacteria | 2030 |
| 613 | Ga0207677_10173635 | 3300026023 | Bacteria | 1688 |
| 614 | Ga0207677_10374139 | 3300026023 | Bacteria | 1200 |
| 615 | Ga0207677_11107215 | 3300026023 | Bacteria | 722 |
| 616 | Ga0207677_12198084 | 3300026023 | Bacteria | 513 |
| 617 | Ga0207703_10216285 | 3300026035 | Bacteria | 1711 |
| 618 | Ga0207639_10141052 | 3300026041 | Bacteria | 2008 |
| 619 | Ga0207639_10202575 | 3300026041 | Bacteria | 1703 |
| 620 | Ga0207639_11057010 | 3300026041 | Bacteria | 761 |
| 621 | Ga0207678_10000346 | 3300026067 | Bacteria | 41986 |
| 622 | Ga0207678_10026744 | 3300026067 | Bacteria | 5033 |
| 623 | Ga0207678_10811878 | 3300026067 | Bacteria | 826 |
| 624 | Ga0207678_11545765 | 3300026067 | Bacteria | 585 |
| 625 | Ga0207708_10002817 | 3300026075 | Bacteria | 12776 |
| 626 | Ga0207708_10062705 | 3300026075 | Bacteria | 2840 |
| 627 | Ga0207708_10884848 | 3300026075 | Bacteria | 772 |
| 628 | Ga0207702_10000631 | 3300026078 | Bacteria | 38615 |
| 629 | Ga0207702_10027378 | 3300026078 | Bacteria | 4734 |
| 630 | Ga0207702_10062252 | 3300026078 | Bacteria | 3186 |
| 631 | Ga0207702_11313692 | 3300026078 | Bacteria | 717 |
| 632 | Ga0207702_11773658 | 3300026078 | Bacteria | 609 |
| 633 | Ga0207702_12228336 | 3300026078 | Bacteria | 536 |
| 634 | Ga0207702_12315784 | 3300026078 | Bacteria | 525 |
| 635 | Ga0207641_10070634 | 3300026088 | Bacteria | 3000 |
| 636 | Ga0207641_11456503 | 3300026088 | Bacteria | 686 |
| 637 | Ga0207648_10003949 | 3300026089 | Bacteria | 15426 |
| 638 | Ga0207648_10007069 | 3300026089 | Bacteria | 11079 |
| 639 | Ga0207676_10001535 | 3300026095 | Bacteria | 17033 |
| 640 | Ga0207676_10087045 | 3300026095 | Bacteria | 2554 |
| 641 | Ga0207674_10050592 | 3300026116 | Bacteria | 4244 |
| 642 | Ga0207674_11237809 | 3300026116 | Bacteria | 716 |
| 643 | Ga0207674_11698784 | 3300026116 | Bacteria | 599 |
| 644 | Ga0207675_100025855 | 3300026118 | Bacteria | 5461 |
| 645 | Ga0207675_100321669 | 3300026118 | Bacteria | 1510 |
| 646 | Ga0207683_10000342 | 3300026121 | Bacteria | 42329 |
| 647 | Ga0207683_10045766 | 3300026121 | Bacteria | 3827 |
| 648 | Ga0207683_10858280 | 3300026121 | Bacteria | 843 |
| 649 | Ga0207698_10031800 | 3300026142 | Bacteria | 3814 |
| 650 | Ga0209371_1042187 | 3300027312 | Bacteria | 919 |
| 651 | Ga0209371_1054914 | 3300027312 | Bacteria | 751 |
| 652 | Ga0209966_1114722 | 3300027695 | Bacteria | 615 |
| 653 | Ga0209813_10008344 | 3300027866 | Bacteria | 2613 |
| 654 | Ga0207428_10001881 | 3300027907 | Bacteria | 21371 |
| 655 | Ga0207428_10035741 | 3300027907 | Bacteria | 4058 |
| 656 | Ga0268266_10006950 | 3300028379 | Bacteria | 10287 |
| 657 | Ga0268266_10062053 | 3300028379 | Bacteria | 3225 |
| 658 | Ga0268266_10518359 | 3300028379 | Bacteria | 1140 |
| 659 | Ga0268266_11227628 | 3300028379 | Bacteria | 725 |
| 660 | Ga0268266_11633878 | 3300028379 | Bacteria | 620 |
| 661 | Ga0268265_10694174 | 3300028380 | Bacteria | 983 |
| 662 | Ga0268264_10403094 | 3300028381 | Bacteria | 1315 |
| 663 | Ga0268264_10625715 | 3300028381 | Bacteria | 1063 |
| 664 | Ga0307517_10000616 | 3300028786 | Bacteria | 60799 |
| 665 | Ga0307517_10064449 | 3300028786 | Bacteria | 3407 |
| 666 | Ga0307515_10000785 | 3300028794 | Bacteria | 73213 |
| 667 | Ga0307515_10079858 | 3300028794 | Bacteria | 4277 |
| 668 | Ga0268256_1039230 | 3300030500 | Bacteria | 1071 |
| 669 | Ga0268256_1083396 | 3300030500 | Bacteria | 594 |
| 670 | Ga0307511_10001704 | 3300030521 | Bacteria | 23130 |
| 671 | Ga0307511_10070638 | 3300030521 | Bacteria | 2555 |
| 672 | Ga0307511_10103443 | 3300030521 | Bacteria | 1855 |
| 673 | Ga0307511_10142563 | 3300030521 | Bacteria | 1402 |
| 674 | Ga0307511_10145519 | 3300030521 | Bacteria | 1378 |
| 675 | Ga0307512_10005071 | 3300030522 | Bacteria | 13997 |
| 676 | Ga0307512_10362610 | 3300030522 | Bacteria | 631 |
| 677 | Ga0316179_1085721 | 3300030734 | Bacteria | 663 |
| 678 | Ga0265760_10132617 | 3300031090 | Bacteria | 807 |
| 679 | Ga0307513_10779502 | 3300031456 | Bacteria | 662 |
| 680 | Ga0307509_10116525 | 3300031507 | Bacteria | 2661 |
| 681 | Ga0307509_10120432 | 3300031507 | Bacteria | 2603 |
| 682 | Ga0307509_10250321 | 3300031507 | Bacteria | 1556 |
| 683 | Ga0307408_100160846 | 3300031548 | Bacteria | 1783 |
| 684 | Ga0307408_100194616 | 3300031548 | Bacteria | 1636 |
| 685 | Ga0307408_100805547 | 3300031548 | Bacteria | 853 |
| 686 | Ga0307508_10009811 | 3300031616 | Bacteria | 8773 |
| 687 | Ga0307508_10042968 | 3300031616 | Bacteria | 4051 |
| 688 | Ga0307508_10048153 | 3300031616 | Bacteria | 3798 |
| 689 | Ga0307508_10071032 | 3300031616 | Bacteria | 3054 |
| 690 | Ga0307508_10102457 | 3300031616 | Bacteria | 2458 |
| 691 | Ga0307508_10192267 | 3300031616 | Bacteria | 1642 |
| 692 | Ga0307508_10923375 | 3300031616 | Bacteria | 501 |
| 693 | Ga0307514_10017611 | 3300031649 | Bacteria | 5872 |
| 694 | Ga0316576_10033659 | 3300031727 | Bacteria | 3649 |
| 695 | Ga0316578_10403236 | 3300031728 | Bacteria | 810 |
| 696 | Ga0307516_10006885 | 3300031730 | Bacteria | 13238 |
| 697 | Ga0307516_10033062 | 3300031730 | Bacteria | 5207 |
| 698 | Ga0307405_10004991 | 3300031731 | Bacteria | 6343 |
| 699 | Ga0307405_10012545 | 3300031731 | Bacteria | 4492 |
| 700 | Ga0307405_10152741 | 3300031731 | Bacteria | 1625 |
| 701 | Ga0307405_11136572 | 3300031731 | Bacteria | 673 |
| 702 | Ga0307405_11371576 | 3300031731 | Bacteria | 617 |
| 703 | Ga0307413_10010340 | 3300031824 | Bacteria | 4520 |
| 704 | Ga0307413_10033503 | 3300031824 | Bacteria | 2926 |
| 705 | Ga0307413_10052232 | 3300031824 | Bacteria | 2467 |
| 706 | Ga0307413_10118605 | 3300031824 | Bacteria | 1787 |
| 707 | Ga0307413_10241777 | 3300031824 | Bacteria | 1333 |
| 708 | Ga0307413_10297416 | 3300031824 | Bacteria | 1222 |
| 709 | Ga0307413_10376821 | 3300031824 | Bacteria | 1104 |
| 710 | Ga0307410_10043621 | 3300031852 | Bacteria | 2973 |
| 711 | Ga0307410_10044978 | 3300031852 | Bacteria | 2936 |
| 712 | Ga0307410_10123949 | 3300031852 | Bacteria | 1888 |
| 713 | Ga0307410_10176213 | 3300031852 | Bacteria | 1615 |
| 714 | Ga0307410_10186697 | 3300031852 | Bacteria | 1574 |
| 715 | Ga0307410_11023848 | 3300031852 | Bacteria | 713 |
| 716 | Ga0307410_11392283 | 3300031852 | Bacteria | 615 |
| 717 | Ga0307406_10009972 | 3300031901 | Bacteria | 5343 |
| 718 | Ga0307406_10056284 | 3300031901 | Bacteria | 2517 |
| 719 | Ga0307406_10060010 | 3300031901 | Bacteria | 2451 |
| 720 | Ga0307406_10341765 | 3300031901 | Bacteria | 1166 |
| 721 | Ga0307407_10031727 | 3300031903 | Bacteria | 2865 |
| 722 | Ga0307407_10032507 | 3300031903 | Bacteria | 2837 |
| 723 | Ga0307407_10064675 | 3300031903 | Bacteria | 2150 |
| 724 | Ga0307407_10273585 | 3300031903 | Bacteria | 1167 |
| 725 | Ga0307407_10277977 | 3300031903 | Bacteria | 1158 |
| 726 | Ga0307407_10892285 | 3300031903 | Bacteria | 682 |
| 727 | Ga0307412_10032183 | 3300031911 | Bacteria | 3320 |
| 728 | Ga0307412_10390952 | 3300031911 | Bacteria | 1129 |
| 729 | Ga0307412_10523528 | 3300031911 | Bacteria | 991 |
| 730 | Ga0307412_10731183 | 3300031911 | Bacteria | 852 |
| 731 | Ga0307412_11503781 | 3300031911 | Bacteria | 612 |
| 732 | Ga0307409_100031324 | 3300031995 | Bacteria | 3836 |
| 733 | Ga0307409_100051919 | 3300031995 | Bacteria | 3140 |
| 734 | Ga0307409_100057907 | 3300031995 | Bacteria | 3006 |
| 735 | Ga0307409_100179771 | 3300031995 | Bacteria | 1871 |
| 736 | Ga0307409_100599435 | 3300031995 | Bacteria | 1088 |
| 737 | Ga0307409_100930347 | 3300031995 | Bacteria | 884 |
| 738 | Ga0307416_100002858 | 3300032002 | Bacteria | 10049 |
| 739 | Ga0307416_100062131 | 3300032002 | Bacteria | 3052 |
| 740 | Ga0307416_100259855 | 3300032002 | Bacteria | 1696 |
| 741 | Ga0307416_100456040 | 3300032002 | Bacteria | 1332 |
| 742 | Ga0307416_100987867 | 3300032002 | Bacteria | 944 |
| 743 | Ga0307414_10061425 | 3300032004 | Bacteria | 2662 |
| 744 | Ga0307414_10660101 | 3300032004 | Bacteria | 943 |
| 745 | Ga0307414_10760414 | 3300032004 | Bacteria | 881 |
| 746 | Ga0307411_10138399 | 3300032005 | Bacteria | 1791 |
| 747 | Ga0307411_10149189 | 3300032005 | Bacteria | 1735 |
| 748 | Ga0307411_10253669 | 3300032005 | Bacteria | 1385 |
| 749 | Ga0307415_100001231 | 3300032126 | Bacteria | 11998 |
| 750 | Ga0307415_100046044 | 3300032126 | Bacteria | 2928 |
| 751 | Ga0307415_100061596 | 3300032126 | Bacteria | 2598 |
| 752 | Ga0307415_100087992 | 3300032126 | Bacteria | 2240 |
| 753 | Ga0307415_100159352 | 3300032126 | Bacteria | 1747 |
| 754 | Ga0307415_100173443 | 3300032126 | Bacteria | 1684 |
| 755 | Ga0307415_101590273 | 3300032126 | Bacteria | 628 |
| 756 | Ga0307415_102008890 | 3300032126 | Bacteria | 563 |
| 757 | Ga0307415_102388879 | 3300032126 | Bacteria | 519 |
| 758 | Ga0307507_10000004 | 3300033179 | Bacteria | 289641 |
| 759 | Ga0307507_10019522 | 3300033179 | Bacteria | 7630 |
| 760 | Ga0307507_10048643 | 3300033179 | Bacteria | 4121 |
| 761 | Ga0307507_10265614 | 3300033179 | Bacteria | 1090 |
| 762 | Ga0307510_10178454 | 3300033180 | Bacteria | 1690 |
| 763 | Ga0307510_10616655 | 3300033180 | Bacteria | 538 |
| 764 | Ga0316596_1238806 | 3300033541 | Bacteria | 511 |
| 765 | Ga0373926_0103561 | 3300035083 | Bacteria | 1066 |
| 766 | Ga0373928_0242519 | 3300035084 | Bacteria | 534 |
| 767 | Ga0373934_0081727 | 3300035086 | Bacteria | 1298 |
| 768 | Ga0373944_0186231 | 3300035089 | Bacteria | 746 |
| 769 | Ga0373923_0232371 | 3300035111 | Bacteria | 859 |
| 770 | Ga0373936_0002652 | 3300035113 | Bacteria | 6692 |
| 771 | Ga0373945_0032972 | 3300035116 | Bacteria | 1838 |
| 772 | Ga0373953_0039958 | 3300035117 | Bacteria | 1861 |
| 773 | Ga0373954_0109839 | 3300035118 | Bacteria | 1333 |
| 774 | Ga0373956_0009853 | 3300035119 | Bacteria | 3892 |
| 775 | Ga0373957_0004739 | 3300035120 | Bacteria | 4162 |
| 776 | Ga0373943_0086429 | 3300035170 | Bacteria | 1617 |
| 777 | Ga0373943_0105489 | 3300035170 | Bacteria | 1479 |
| 778 | Ga0373943_0275242 | 3300035170 | Bacteria | 950 |
| 779 | Ga0373943_0926660 | 3300035170 | Bacteria | 521 |
| 780 | Ga0373946_0055434 | 3300035171 | Bacteria | 1671 |
| 781 | Ga0373946_0562780 | 3300035171 | Bacteria | 589 |
| 782 | Ga0373955_0618701 | 3300035172 | Bacteria | 663 |
| 783 | Ga0316574_0006775 | 3300035398 | Bacteria | 6226 |
| 784 | Ga0316574_0024958 | 3300035398 | Bacteria | 3583 |
| 785 | Ga0373924_0046395 | 3300035410 | Bacteria | 1789 |
| 786 | Ga0373931_0211674 | 3300035691 | Bacteria | 1163 |
| 787 | Ga0373935_0032879 | 3300035692 | Bacteria | 3225 |
| 788 | Ga0373935_0629943 | 3300035692 | Bacteria | 786 |
| 789 | Ga0373935_1002202 | 3300035692 | Bacteria | 620 |
| 790 | Ga0373935_1486592 | 3300035692 | Bacteria | 507 |
| 791 | Ga0373927_0140364 | 3300035695 | Bacteria | 1580 |
| 792 | Ga0373933_0048564 | 3300035724 | Bacteria | 2527 |
| 793 | Ga0373947_0045323 | 3300035725 | Bacteria | 2631 |
| 794 | Ga0373947_0740988 | 3300035725 | Bacteria | 670 |
| 795 | Ga0373947_0771829 | 3300035725 | Bacteria | 656 |
| 796 | Ga0373947_0970465 | 3300035725 | Bacteria | 580 |
| 797 | Ga0373937_0219523 | 3300036401 | Bacteria | 1789 |
| 798 | Ga0373925_0073378 | 3300037068 | Bacteria | 2590 |
| 799 | Ga0373925_0192091 | 3300037068 | Bacteria | 1620 |
| 800 | Ga0373925_0647254 | 3300037068 | Bacteria | 871 |
| 801 | Ga0395899_0043872 | 3300037312 | Bacteria | 3333 |
| 802 | Ga0395899_0063189 | 3300037312 | Bacteria | 2724 |
| 803 | Ga0395899_0559152 | 3300037312 | Bacteria | 734 |
| 804 | Ga0395900_0049812 | 3300037418 | Bacteria | 4316 |
| 805 | Ga0395900_0254888 | 3300037418 | Bacteria | 1754 |
| 806 | Ga0395900_0400701 | 3300037418 | Bacteria | 1336 |
| 807 | Ga0395900_0738160 | 3300037418 | Bacteria | 916 |
| 808 | Ga0395900_1515235 | 3300037418 | Bacteria | 583 |
| 809 | Ga0395898_0004957 | 3300037466 | Bacteria | 14451 |
| 810 | Ga0395898_0020289 | 3300037466 | Bacteria | 6750 |
| 811 | Ga0395898_0204323 | 3300037466 | Bacteria | 1885 |
| 812 | Ga0395898_0423014 | 3300037466 | Bacteria | 1269 |
| 813 | Ga0395905_0140072 | 3300037471 | Bacteria | 2276 |
| 814 | Ga0395905_0912000 | 3300037471 | Bacteria | 782 |
| 815 | Ga0436364_0211036 | 3300037853 | Bacteria | 730 |
| 816 | Ga0436364_1387664 | 3300037853 | Bacteria | 4015 |
| 817 | Ga0436364_1513228 | 3300037853 | Bacteria | 4039 |
| 818 | Ga0395901_0025589 | 3300038443 | Bacteria | 6058 |
| 819 | Ga0395901_0028245 | 3300038443 | Bacteria | 5771 |
| 820 | Ga0395901_0142136 | 3300038443 | Bacteria | 2522 |
| 821 | Ga0395901_0220165 | 3300038443 | Bacteria | 1984 |
| 822 | Ga0395901_1218419 | 3300038443 | Bacteria | 718 |
| 823 | Ga0436365_1800393 | 3300039437 | Bacteria | 8156 |
| 824 | Ga0436363_1600108 | 3300039450 | Bacteria | 685 |
| 825 | Ga0439461_0108410 | 3300041410 | Bacteria | 683 |
| 826 | Ga0451791_0732074 | 3300041451 | Bacteria | 665 |
| 827 | Ga0451793_0443263 | 3300041452 | Bacteria | 721 |
| 828 | Ga0451797_0046928 | 3300041453 | Bacteria | 561 |
| 829 | Ga0451797_0063387 | 3300041453 | Bacteria | 810 |
| 830 | Ga0451795_0944170 | 3300041456 | Bacteria | 1218 |
| 831 | Ga0451804_0709125 | 3300041463 | Bacteria | 506 |
| 832 | Ga0451807_2146582 | 3300041486 | Bacteria | 1462 |
| 833 | Ga0451833_0363118 | 3300041491 | Bacteria | 816 |
| 834 | Ga0451841_1156208 | 3300041498 | Bacteria | 1382 |
| 835 | Ga0451851_0539892 | 3300041507 | Bacteria | 997 |
| 836 | Ga0451843_1399856 | 3300041509 | Bacteria | 609 |
| 837 | Ga0451853_0201250 | 3300041512 | Bacteria | 3896 |
| 838 | Ga0451853_2009892 | 3300041512 | Bacteria | 1260 |
| 839 | Ga0439433_0090839 | 3300041999 | Bacteria | 751 |
| 840 | Ga0439442_034627 | 3300042002 | Bacteria | 1056 |
| 841 | Ga0439443_068009 | 3300042003 | Bacteria | 646 |
| 842 | Ga0439448_0000543 | 3300042005 | Bacteria | 8788 |
| 843 | Ga0439448_0001808 | 3300042005 | Bacteria | 5658 |
| 844 | Ga0439448_0001912 | 3300042005 | Bacteria | 5542 |
| 845 | Ga0439448_0053491 | 3300042005 | Bacteria | 1325 |
| 846 | Ga0439432_096512 | 3300042006 | Bacteria | 886 |
| 847 | Ga0439449_0002001 | 3300042007 | Bacteria | 8009 |
| 848 | Ga0439449_0092550 | 3300042007 | Bacteria | 1116 |
| 849 | Ga0439450_001186 | 3300042008 | Bacteria | 3743 |
| 850 | Ga0439450_003903 | 3300042008 | Bacteria | 2505 |
| 851 | Ga0439451_007224 | 3300042009 | Bacteria | 2268 |
| 852 | Ga0439451_010546 | 3300042009 | Bacteria | 1862 |
| 853 | Ga0439454_010919 | 3300042011 | Bacteria | 1204 |
| 854 | Ga0439454_071041 | 3300042011 | Bacteria | 618 |
| 855 | Ga0439455_0000702 | 3300042012 | Bacteria | 4953 |
| 856 | Ga0439455_0035109 | 3300042012 | Bacteria | 1264 |
| 857 | Ga0439456_043433 | 3300042013 | Bacteria | 977 |
| 858 | Ga0439457_016546 | 3300042014 | Bacteria | 1643 |
| 859 | Ga0439463_000211 | 3300042016 | Bacteria | 15803 |
| 860 | Ga0439463_007150 | 3300042016 | Bacteria | 2755 |
| 861 | Ga0439463_094634 | 3300042016 | Bacteria | 769 |
| 862 | Ga0450912_002482 | 3300042116 | Bacteria | 1244 |
| 863 | Ga0450914_003043 | 3300042118 | Bacteria | 1258 |
| 864 | Ga0450915_002074 | 3300042119 | Bacteria | 1012 |
| 865 | Ga0450922_018805 | 3300042124 | Bacteria | 703 |
| 866 | Ga0450923_092472 | 3300042125 | Bacteria | 691 |
| 867 | Ga0450894_000582 | 3300042131 | Bacteria | 6155 |
| 868 | Ga0450895_010376 | 3300042132 | Bacteria | 795 |
| 869 | Ga0450896_006854 | 3300042133 | Bacteria | 1566 |
| 870 | Ga0450898_002954 | 3300042134 | Bacteria | 2401 |
| 871 | Ga0450900_000637 | 3300042136 | Bacteria | 2924 |
| 872 | Ga0450900_004755 | 3300042136 | Bacteria | 1575 |
| 873 | Ga0450900_023785 | 3300042136 | Bacteria | 866 |
| 874 | Ga0450902_007496 | 3300042137 | Bacteria | 1690 |
| 875 | Ga0450903_000222 | 3300042138 | Bacteria | 12668 |
| 876 | Ga0450903_004285 | 3300042138 | Bacteria | 2442 |
| 877 | Ga0450906_001179 | 3300042145 | Bacteria | 5782 |
| 878 | Ga0450910_084117 | 3300042147 | Bacteria | 558 |
| 879 | Ga0439446_0086653 | 3300042156 | Bacteria | 976 |
| 880 | Ga0439458_0002925 | 3300042157 | Bacteria | 4102 |
| 881 | Ga0439458_0020266 | 3300042157 | Bacteria | 1535 |
| 882 | Ga0450908_001963 | 3300042184 | Bacteria | 4032 |
| 883 | Ga0439435_0002840 | 3300042436 | Bacteria | 3510 |
| 884 | Ga0439435_0118145 | 3300042436 | Bacteria | 828 |
| 885 | Ga0439444_0003239 | 3300042437 | Bacteria | 2290 |
| 886 | Ga0439444_0014537 | 3300042437 | Bacteria | 1317 |
| 887 | Ga0439444_0169981 | 3300042437 | Bacteria | 536 |
| 888 | Ga0439459_0004527 | 3300042438 | Bacteria | 2240 |
| 889 | Ga0439459_0077429 | 3300042438 | Bacteria | 779 |
| 890 | Ga0439464_0000089 | 3300042439 | Bacteria | 13293 |
| 891 | Ga0439464_0237172 | 3300042439 | Bacteria | 587 |
| 892 | Ga0450916_019008 | 3300042530 | Bacteria | 929 |
| 893 | Ga0450893_0019003 | 3300042532 | Bacteria | 1174 |
| 894 | Ga0450901_032004 | 3300042533 | Bacteria | 582 |
| 895 | Ga0439440_0000033 | 3300042993 | Bacteria | 17433 |
| 896 | Ga0439440_0024212 | 3300042993 | Bacteria | 1390 |
| 897 | Ga0466969_0000873 | 3300044656 | Bacteria | 16345 |
| 898 | Ga0466969_0008468 | 3300044656 | Bacteria | 5456 |
| 899 | Ga0466969_0139742 | 3300044656 | Bacteria | 1120 |
| 900 | Ga0466969_0264710 | 3300044656 | Bacteria | 779 |
| 901 | Ga0466969_0610860 | 3300044656 | Bacteria | 501 |
| 902 | Ga0466972_0003355 | 3300044658 | Bacteria | 7935 |
| 903 | Ga0466972_0105820 | 3300044658 | Bacteria | 1330 |
| 904 | Ga0466965_0000614 | 3300044683 | Bacteria | 13014 |
| 905 | Ga0466965_0128809 | 3300044683 | Bacteria | 1311 |
| 906 | Ga0466965_0285966 | 3300044683 | Bacteria | 892 |
| 907 | Ga0466966_0007105 | 3300044684 | Bacteria | 7420 |
| 908 | Ga0466966_0058977 | 3300044684 | Bacteria | 2425 |
| 909 | Ga0466966_0060711 | 3300044684 | Bacteria | 2386 |
| 910 | Ga0466966_0088433 | 3300044684 | Bacteria | 1925 |
| 911 | Ga0466966_0313783 | 3300044684 | Bacteria | 942 |
| 912 | Ga0466966_0410879 | 3300044684 | Bacteria | 813 |
| 913 | Ga0466966_0776219 | 3300044684 | Bacteria | 578 |
| 914 | Ga0466966_0900509 | 3300044684 | Bacteria | 533 |
| 915 | Ga0466961_0001921 | 3300044693 | Bacteria | 12946 |
| 916 | Ga0466961_0009405 | 3300044693 | Bacteria | 6225 |
| 917 | Ga0466961_0023817 | 3300044693 | Bacteria | 3939 |
| 918 | Ga0466961_0026189 | 3300044693 | Bacteria | 3751 |
| 919 | Ga0466961_0059572 | 3300044693 | Bacteria | 2428 |
| 920 | Ga0466961_0072197 | 3300044693 | Bacteria | 2189 |
| 921 | Ga0466961_0155752 | 3300044693 | Bacteria | 1425 |
| 922 | Ga0466961_0208213 | 3300044693 | Bacteria | 1208 |
| 923 | Ga0466961_0575026 | 3300044693 | Bacteria | 678 |
| 924 | Ga0466963_0004618 | 3300044694 | Bacteria | 8027 |
| 925 | Ga0466963_0021337 | 3300044694 | Bacteria | 4084 |
| 926 | Ga0466963_0056243 | 3300044694 | Bacteria | 2618 |
| 927 | Ga0466963_0282237 | 3300044694 | Bacteria | 1167 |
| 928 | Ga0466963_0284409 | 3300044694 | Bacteria | 1162 |
| 929 | Ga0466963_0288668 | 3300044694 | Bacteria | 1153 |
| 930 | Ga0466963_0302482 | 3300044694 | Bacteria | 1125 |
| 931 | Ga0466963_0535370 | 3300044694 | Bacteria | 827 |
| 932 | Ga0466963_0549153 | 3300044694 | Bacteria | 816 |
| 933 | Ga0466963_0831908 | 3300044694 | Bacteria | 651 |
| 934 | Ga0466964_0032966 | 3300044706 | Bacteria | 2061 |
| 935 | Ga0466964_0061865 | 3300044706 | Bacteria | 1560 |
| 936 | Ga0466964_0230905 | 3300044706 | Bacteria | 903 |
| 937 | Ga0466964_0354057 | 3300044706 | Bacteria | 755 |
| 938 | Ga0466964_0391946 | 3300044706 | Bacteria | 723 |
| 939 | Ga0466964_0408856 | 3300044706 | Bacteria | 711 |
| 940 | Ga0466971_0000629 | 3300044719 | Bacteria | 14080 |
| 941 | Ga0466971_0016721 | 3300044719 | Bacteria | 3240 |
| 942 | Ga0466971_0098445 | 3300044719 | Bacteria | 1343 |
| 943 | Ga0466971_0116813 | 3300044719 | Bacteria | 1233 |
| 944 | Ga0466971_0145427 | 3300044719 | Bacteria | 1105 |
| 945 | Ga0466971_0179353 | 3300044719 | Bacteria | 995 |
| 946 | Ga0466971_0415339 | 3300044719 | Bacteria | 657 |
| 947 | Ga0466971_0645134 | 3300044719 | Bacteria | 530 |
| 948 | Ga0466968_0136969 | 3300044735 | Bacteria | 1117 |
| 949 | Ga0466970_0001377 | 3300044765 | Bacteria | 11706 |
| 950 | Ga0466970_0030083 | 3300044765 | Bacteria | 2863 |
| 951 | Ga0466970_0209856 | 3300044765 | Bacteria | 1085 |
| 952 | Ga0466970_0222763 | 3300044765 | Bacteria | 1053 |
| 953 | Ga0466970_0280012 | 3300044765 | Bacteria | 938 |
| 954 | Ga0466970_0367753 | 3300044765 | Bacteria | 817 |
| 955 | Ga0466970_0773766 | 3300044765 | Bacteria | 561 |
| 956 | Ga0466957_0006278 | 3300044842 | Bacteria | 6705 |
| 957 | Ga0466957_0010382 | 3300044842 | Bacteria | 5343 |
| 958 | Ga0466957_0366712 | 3300044842 | Bacteria | 980 |
| 959 | Ga0466957_0462526 | 3300044842 | Bacteria | 875 |
| 960 | Ga0466957_0616643 | 3300044842 | Bacteria | 761 |
| 961 | Ga0466957_0792033 | 3300044842 | Bacteria | 673 |
| 962 | Ga0466957_0871388 | 3300044842 | Bacteria | 642 |
| 963 | Ga0466957_1331580 | 3300044842 | Bacteria | 522 |
| 964 | Ga0466957_1384974 | 3300044842 | Bacteria | 512 |
| 965 | Ga0466960_0109978 | 3300044901 | Bacteria | 1430 |
| 966 | Ga0466960_0517916 | 3300044901 | Bacteria | 700 |
| 967 | Ga0466960_0607372 | 3300044901 | Bacteria | 650 |
| 968 | Ga0466959_0000365 | 3300045049 | Bacteria | 26771 |
| 969 | Ga0466959_0000617 | 3300045049 | Bacteria | 20706 |
| 970 | Ga0466959_0036475 | 3300045049 | Bacteria | 3633 |
| 971 | Ga0466959_0796026 | 3300045049 | Bacteria | 632 |
| 972 | Ga0466959_1067356 | 3300045049 | Bacteria | 537 |
| 973 | Ga0466958_0000185 | 3300045836 | Bacteria | 22546 |
| 974 | Ga0466958_0013097 | 3300045836 | Bacteria | 4713 |
| 975 | Ga0466958_0015443 | 3300045836 | Bacteria | 4375 |
| 976 | Ga0466958_0034058 | 3300045836 | Bacteria | 3037 |
| 977 | Ga0466958_0050301 | 3300045836 | Bacteria | 2523 |
| 978 | Ga0466958_0177273 | 3300045836 | Bacteria | 1352 |
| 979 | Ga0466958_0434593 | 3300045836 | Bacteria | 849 |
| 980 | Ga0466958_0434798 | 3300045836 | Bacteria | 849 |
| 981 | Ga0466958_0612196 | 3300045836 | Bacteria | 708 |
| 982 | Ga0466958_0882127 | 3300045836 | Bacteria | 583 |
| 983 | Ga0466958_0887339 | 3300045836 | Bacteria | 582 |
| 984 | Ga0466967_0012726 | 3300045976 | Bacteria | 6458 |
| 985 | Ga0466967_0024439 | 3300045976 | Bacteria | 4968 |
| 986 | Ga0466967_0042374 | 3300045976 | Bacteria | 3933 |
| 987 | Ga0466967_0162097 | 3300045976 | Bacteria | 2100 |
| 988 | Ga0466967_0186708 | 3300045976 | Bacteria | 1958 |
| 989 | Ga0466967_0191205 | 3300045976 | Bacteria | 1934 |
| 990 | Ga0466967_0200361 | 3300045976 | Bacteria | 1890 |
| 991 | Ga0466967_0252272 | 3300045976 | Bacteria | 1686 |
| 992 | Ga0466967_0494070 | 3300045976 | Bacteria | 1200 |
| 993 | Ga0466967_0657819 | 3300045976 | Bacteria | 1036 |
| 994 | Ga0466967_1004103 | 3300045976 | Bacteria | 831 |
| 995 | Ga0466967_1137537 | 3300045976 | Bacteria | 778 |
| 996 | Ga0466967_1879981 | 3300045976 | Bacteria | 595 |
| 997 | Ga0495617_113804 | 3300046452 | Bacteria | 874 |
| 998 | Ga0495592_0003261 | 3300046454 | Bacteria | 11634 |
| 999 | Ga0495592_0020580 | 3300046454 | Bacteria | 5021 |
| 1000 | Ga0495592_0022586 | 3300046454 | Bacteria | 4785 |
| 1001 | Ga0495603_0004326 | 3300046455 | Bacteria | 8470 |
| 1002 | Ga0495603_0006636 | 3300046455 | Bacteria | 6942 |
| 1003 | Ga0495603_0035572 | 3300046455 | Bacteria | 2991 |
| 1004 | Ga0495603_0306303 | 3300046455 | Bacteria | 912 |
| 1005 | Ga0495603_0593524 | 3300046455 | Bacteria | 634 |
| 1006 | Ga0495629_0000710 | 3300046459 | Bacteria | 26980 |
| 1007 | Ga0495629_0008081 | 3300046459 | Bacteria | 7744 |
| 1008 | Ga0495629_0009932 | 3300046459 | Bacteria | 6946 |
| 1009 | Ga0495629_0034307 | 3300046459 | Bacteria | 3587 |
| 1010 | Ga0495629_0045243 | 3300046459 | Bacteria | 3088 |
| 1011 | Ga0495638_0019718 | 3300046460 | Bacteria | 4459 |
| 1012 | Ga0495641_0033691 | 3300046461 | Bacteria | 2429 |
| 1013 | Ga0495641_0253296 | 3300046461 | Bacteria | 792 |
| 1014 | Ga0495641_0487062 | 3300046461 | Bacteria | 562 |
| 1015 | Ga0495651_0001993 | 3300046462 | Bacteria | 15807 |
| 1016 | Ga0495651_0002231 | 3300046462 | Bacteria | 14956 |
| 1017 | Ga0495651_0005685 | 3300046462 | Bacteria | 9503 |
| 1018 | Ga0495651_0031302 | 3300046462 | Bacteria | 4149 |
| 1019 | Ga0495653_0020146 | 3300046463 | Bacteria | 5406 |
| 1020 | Ga0495580_0368845 | 3300046472 | Bacteria | 971 |
| 1021 | Ga0495582_0105708 | 3300046473 | Bacteria | 1578 |
| 1022 | Ga0495639_0008151 | 3300046475 | Bacteria | 4499 |
| 1023 | Ga0495639_0027525 | 3300046475 | Bacteria | 2517 |
| 1024 | Ga0495639_0054394 | 3300046475 | Bacteria | 1825 |
| 1025 | Ga0495662_0031072 | 3300046476 | Bacteria | 2579 |
| 1026 | Ga0495662_0080214 | 3300046476 | Bacteria | 1587 |
| 1027 | Ga0495662_0083229 | 3300046476 | Bacteria | 1557 |
| 1028 | Ga0495662_0084294 | 3300046476 | Bacteria | 1547 |
| 1029 | Ga0495664_0000321 | 3300046477 | Bacteria | 23117 |
| 1030 | Ga0495664_0088739 | 3300046477 | Bacteria | 1858 |
| 1031 | Ga0495664_0095726 | 3300046477 | Bacteria | 1787 |
| 1032 | Ga0495664_0098595 | 3300046477 | Bacteria | 1760 |
| 1033 | Ga0495664_0314144 | 3300046477 | Bacteria | 945 |
| 1034 | Ga0495664_0395118 | 3300046477 | Bacteria | 830 |
| 1035 | Ga0495584_0136123 | 3300046491 | Bacteria | 1247 |
| 1036 | Ga0495585_0017733 | 3300046492 | Bacteria | 4111 |
| 1037 | Ga0495585_0033369 | 3300046492 | Bacteria | 2914 |
| 1038 | Ga0495585_0111064 | 3300046492 | Bacteria | 1458 |
| 1039 | Ga0495594_0039331 | 3300046499 | Bacteria | 2586 |
| 1040 | Ga0495594_0145721 | 3300046499 | Bacteria | 1343 |
| 1041 | Ga0495594_0150653 | 3300046499 | Bacteria | 1320 |
| 1042 | Ga0495594_0802764 | 3300046499 | Bacteria | 530 |
| 1043 | Ga0495596_0082647 | 3300046500 | Bacteria | 1247 |
| 1044 | Ga0495607_0206477 | 3300046501 | Bacteria | 969 |
| 1045 | Ga0495583_0099426 | 3300046506 | Bacteria | 1243 |
| 1046 | Ga0495608_0006672 | 3300046511 | Bacteria | 8185 |
| 1047 | Ga0495616_0077806 | 3300046513 | Bacteria | 1592 |
| 1048 | Ga0495618_0010799 | 3300046514 | Bacteria | 5531 |
| 1049 | Ga0495618_0080528 | 3300046514 | Bacteria | 2078 |
| 1050 | Ga0495618_0103068 | 3300046514 | Bacteria | 1826 |
| 1051 | Ga0495618_0220040 | 3300046514 | Bacteria | 1198 |
| 1052 | Ga0495628_0039915 | 3300046516 | Bacteria | 3753 |
| 1053 | Ga0495628_0165401 | 3300046516 | Bacteria | 1679 |
| 1054 | Ga0495628_0238241 | 3300046516 | Bacteria | 1361 |
| 1055 | Ga0495630_0016999 | 3300046517 | Bacteria | 5324 |
| 1056 | Ga0495630_0084225 | 3300046517 | Bacteria | 2400 |
| 1057 | Ga0495630_0216871 | 3300046517 | Bacteria | 1461 |
| 1058 | Ga0495630_0636853 | 3300046517 | Bacteria | 817 |
| 1059 | Ga0495630_0676156 | 3300046517 | Bacteria | 790 |
| 1060 | Ga0495630_0713047 | 3300046517 | Bacteria | 767 |
| 1061 | Ga0495632_0020483 | 3300046519 | Bacteria | 3580 |
| 1062 | Ga0495643_0001559 | 3300046522 | Bacteria | 20433 |
| 1063 | Ga0495644_0063076 | 3300046523 | Bacteria | 1393 |
| 1064 | Ga0495644_0083621 | 3300046523 | Bacteria | 1203 |
| 1065 | Ga0495663_0056690 | 3300046525 | Bacteria | 1224 |
| 1066 | Ga0495666_0084330 | 3300046526 | Bacteria | 1501 |
| 1067 | Ga0495642_0223776 | 3300046528 | Bacteria | 822 |
| 1068 | Ga0495642_0511575 | 3300046528 | Bacteria | 532 |
| 1069 | Ga0495652_0017484 | 3300046529 | Bacteria | 6398 |
| 1070 | Ga0495652_0025898 | 3300046529 | Bacteria | 5182 |
| 1071 | Ga0495652_0034744 | 3300046529 | Bacteria | 4392 |
| 1072 | Ga0495652_0352308 | 3300046529 | Bacteria | 1054 |
| 1073 | Ga0495652_0377922 | 3300046529 | Bacteria | 1008 |
| 1074 | Ga0495652_1033179 | 3300046529 | Bacteria | 536 |
| 1075 | Ga0495665_0008441 | 3300046531 | Bacteria | 5587 |
| 1076 | Ga0495665_0010940 | 3300046531 | Bacteria | 4909 |
| 1077 | Ga0495665_0017919 | 3300046531 | Bacteria | 3806 |
| 1078 | Ga0495665_0211559 | 3300046531 | Bacteria | 1004 |
| 1079 | Ga0495665_0339482 | 3300046531 | Bacteria | 766 |
| 1080 | Ga0495640_0096099 | 3300046533 | Bacteria | 1949 |
| 1081 | Ga0495640_0109840 | 3300046533 | Bacteria | 1803 |
| 1082 | Ga0495640_0121285 | 3300046533 | Bacteria | 1699 |
| 1083 | Ga0495640_0815792 | 3300046533 | Bacteria | 555 |
| 1084 | Ga0495586_0003363 | 3300046535 | Bacteria | 8577 |
| 1085 | Ga0495586_0126535 | 3300046535 | Bacteria | 1429 |
| 1086 | Ga0495586_0379976 | 3300046535 | Bacteria | 812 |
| 1087 | Ga0495586_0430274 | 3300046535 | Bacteria | 760 |
| 1088 | Ga0495586_0677679 | 3300046535 | Bacteria | 595 |
| 1089 | Ga0495587_0002686 | 3300046536 | Bacteria | 11874 |
| 1090 | Ga0495587_0007528 | 3300046536 | Bacteria | 7052 |
| 1091 | Ga0495587_0066958 | 3300046536 | Bacteria | 2094 |
| 1092 | Ga0495598_0044534 | 3300046537 | Bacteria | 1311 |
| 1093 | Ga0495645_0020552 | 3300046543 | Bacteria | 4766 |
| 1094 | Ga0495645_0153683 | 3300046543 | Bacteria | 1596 |
| 1095 | Ga0495622_0085722 | 3300046557 | Bacteria | 1449 |
| 1096 | Ga0495622_0108014 | 3300046557 | Bacteria | 1274 |
| 1097 | Ga0495622_0141533 | 3300046557 | Bacteria | 1092 |
| 1098 | Ga0495633_0212677 | 3300046558 | Bacteria | 886 |
| 1099 | Ga0495633_0562945 | 3300046558 | Bacteria | 513 |
| 1100 | Ga0495667_0023497 | 3300046559 | Bacteria | 4153 |
| 1101 | Ga0495656_0006417 | 3300046615 | Bacteria | 4126 |
| 1102 | Ga0495656_0015188 | 3300046615 | Bacteria | 2903 |
| 1103 | Ga0495656_0523719 | 3300046615 | Bacteria | 630 |
| 1104 | Ga0495668_0274835 | 3300046616 | Bacteria | 923 |
| 1105 | Ga0495634_0001805 | 3300046642 | Bacteria | 18484 |
| 1106 | Ga0495634_0024244 | 3300046642 | Bacteria | 4259 |
| 1107 | Ga0495634_0536005 | 3300046642 | Bacteria | 683 |
| 1108 | Ga0495611_0051654 | 3300046648 | Bacteria | 1853 |
| 1109 | Ga0495611_0162654 | 3300046648 | Bacteria | 1043 |
| 1110 | Ga0495611_0231408 | 3300046648 | Bacteria | 859 |
| 1111 | Ga0495625_0002573 | 3300046660 | Bacteria | 19482 |
| 1112 | Ga0495635_0002591 | 3300046663 | Bacteria | 12376 |
| 1113 | Ga0495635_0006046 | 3300046663 | Bacteria | 8443 |
| 1114 | Ga0495635_0052660 | 3300046663 | Bacteria | 2803 |
| 1115 | Ga0495635_0398335 | 3300046663 | Bacteria | 915 |
| 1116 | Ga0495635_0853723 | 3300046663 | Bacteria | 585 |
| 1117 | Ga0495659_0142221 | 3300046664 | Bacteria | 958 |
| 1118 | Ga0495661_0164531 | 3300046665 | Bacteria | 1188 |
| 1119 | Ga0495661_0622543 | 3300046665 | Bacteria | 506 |
| 1120 | Ga0495588_0000642 | 3300046674 | Bacteria | 16256 |
| 1121 | Ga0495588_0002751 | 3300046674 | Bacteria | 7549 |
| 1122 | Ga0495588_0142205 | 3300046674 | Bacteria | 1267 |
| 1123 | Ga0495657_0003132 | 3300046675 | Bacteria | 13662 |
| 1124 | Ga0495657_0038819 | 3300046675 | Bacteria | 3274 |
| 1125 | Ga0495657_0191587 | 3300046675 | Bacteria | 1249 |
| 1126 | Ga0495599_0072878 | 3300046678 | Bacteria | 2143 |
| 1127 | Ga0495599_0263261 | 3300046678 | Bacteria | 1047 |
| 1128 | Ga0495623_0013318 | 3300046679 | Bacteria | 5334 |
| 1129 | Ga0495623_0026406 | 3300046679 | Bacteria | 3738 |
| 1130 | Ga0495623_0278068 | 3300046679 | Bacteria | 932 |
| 1131 | Ga0495646_0000324 | 3300046680 | Bacteria | 24548 |
| 1132 | Ga0495646_0015431 | 3300046680 | Bacteria | 4849 |
| 1133 | Ga0495646_0095738 | 3300046680 | Bacteria | 1707 |
| 1134 | Ga0495647_0129790 | 3300046681 | Bacteria | 1067 |
| 1135 | Ga0495658_0008765 | 3300046683 | Bacteria | 5024 |
| 1136 | Ga0495658_0051207 | 3300046683 | Bacteria | 2338 |
| 1137 | Ga0495658_0279756 | 3300046683 | Bacteria | 1053 |
| 1138 | Ga0495658_0374186 | 3300046683 | Bacteria | 906 |
| 1139 | Ga0495669_0222810 | 3300046684 | Bacteria | 904 |
| 1140 | Ga0495613_0000764 | 3300046689 | Bacteria | 25140 |
| 1141 | Ga0495613_0006537 | 3300046689 | Bacteria | 8713 |
| 1142 | Ga0495613_0010964 | 3300046689 | Bacteria | 6728 |
| 1143 | Ga0495613_0015577 | 3300046689 | Bacteria | 5655 |
| 1144 | Ga0495613_0404236 | 3300046689 | Bacteria | 931 |
| 1145 | Ga0495613_0716355 | 3300046689 | Bacteria | 658 |
| 1146 | Ga0495613_1035109 | 3300046689 | Bacteria | 526 |
| 1147 | Ga0495624_0026063 | 3300046690 | Bacteria | 3833 |
| 1148 | Ga0495624_0058275 | 3300046690 | Bacteria | 2426 |
| 1149 | Ga0495624_0355367 | 3300046690 | Bacteria | 881 |
| 1150 | Ga0495670_0013814 | 3300046691 | Bacteria | 3970 |
| 1151 | Ga0495670_0019327 | 3300046691 | Bacteria | 3356 |
| 1152 | Ga0495670_0051167 | 3300046691 | Bacteria | 2067 |
| 1153 | Ga0495670_0077290 | 3300046691 | Bacteria | 1692 |
| 1154 | Ga0495671_0036258 | 3300046692 | Bacteria | 2499 |
| 1155 | Ga0495671_0070031 | 3300046692 | Bacteria | 1723 |
| 1156 | Ga0495589_0116420 | 3300046794 | Bacteria | 1288 |
| 1157 | Ga0495589_0282406 | 3300046794 | Bacteria | 772 |
| 1158 | Ga0495589_0313285 | 3300046794 | Bacteria | 726 |
| 1159 | Ga0495600_0004577 | 3300046809 | Bacteria | 8294 |
| 1160 | Ga0495600_0013881 | 3300046809 | Bacteria | 5073 |
| 1161 | Ga0495600_0017958 | 3300046809 | Bacteria | 4503 |
| 1162 | Ga0495600_0031433 | 3300046809 | Bacteria | 3439 |
| 1163 | Ga0495660_0054464 | 3300046810 | Bacteria | 2167 |
| 1164 | Ga0495581_0000238 | 3300047315 | Bacteria | 26091 |
| 1165 | Ga0495581_0003747 | 3300047315 | Bacteria | 8754 |
| 1166 | Ga0495581_0019051 | 3300047315 | Bacteria | 3983 |
| 1167 | Ga0495581_0049246 | 3300047315 | Bacteria | 2433 |
| 1168 | Ga0495581_0050619 | 3300047315 | Bacteria | 2399 |
| 1169 | Ga0495581_0064715 | 3300047315 | Bacteria | 2113 |
| 1170 | Ga0495604_0002587 | 3300047317 | Bacteria | 14490 |
| 1171 | Ga0495604_0014277 | 3300047317 | Bacteria | 6333 |
| 1172 | Ga0495604_0015750 | 3300047317 | Bacteria | 6034 |
| 1173 | Ga0495604_0124864 | 3300047317 | Bacteria | 1857 |
| 1174 | Ga0495636_0001805 | 3300047318 | Bacteria | 8178 |
| 1175 | Ga0495636_0020472 | 3300047318 | Bacteria | 2666 |
| 1176 | Ga0495636_0054268 | 3300047318 | Bacteria | 1684 |
| 1177 | Ga0495636_0123511 | 3300047318 | Bacteria | 1147 |
| 1178 | Ga0495674_0046634 | 3300047319 | Bacteria | 3846 |
| 1179 | Ga0495674_0125423 | 3300047319 | Bacteria | 2167 |
| 1180 | Ga0495674_0174904 | 3300047319 | Bacteria | 1789 |
| 1181 | Ga0495674_1241798 | 3300047319 | Bacteria | 561 |
| 1182 | Ga0495676_0001601 | 3300047321 | Bacteria | 19648 |
| 1183 | Ga0495676_0016702 | 3300047321 | Bacteria | 6500 |
| 1184 | Ga0495676_0025794 | 3300047321 | Bacteria | 5069 |
| 1185 | Ga0495676_0049046 | 3300047321 | Bacteria | 3399 |
| 1186 | Ga0495676_0230854 | 3300047321 | Bacteria | 1271 |
| 1187 | Ga0495676_0589931 | 3300047321 | Bacteria | 724 |
| 1188 | Ga0495676_0694091 | 3300047321 | Bacteria | 659 |
| 1189 | Ga0495676_0777352 | 3300047321 | Bacteria | 617 |
| 1190 | Ga0495676_0922942 | 3300047321 | Bacteria | 559 |
| 1191 | Ga0495680_0013650 | 3300047322 | Bacteria | 7077 |
| 1192 | Ga0495680_0227853 | 3300047322 | Bacteria | 1328 |
| 1193 | Ga0495687_001481 | 3300047443 | Bacteria | 21470 |
| 1194 | Ga0495675_0003598 | 3300047444 | Bacteria | 9346 |
| 1195 | Ga0495675_0225808 | 3300047444 | Bacteria | 1131 |
| 1196 | Ga0495677_0090778 | 3300047445 | Bacteria | 1151 |
| 1197 | Ga0495685_000247 | 3300047447 | Bacteria | 18692 |
| 1198 | Ga0495685_133299 | 3300047447 | Bacteria | 812 |
| 1199 | Ga0495685_215545 | 3300047447 | Bacteria | 613 |
| 1200 | Ga0495681_0000245 | 3300047470 | Bacteria | 45204 |
| 1201 | Ga0495681_0002253 | 3300047470 | Bacteria | 13865 |
| 1202 | Ga0495684_0029888 | 3300047471 | Bacteria | 4182 |
| 1203 | Ga0495686_0016970 | 3300047472 | Bacteria | 4918 |
| 1204 | Ga0495686_0145358 | 3300047472 | Bacteria | 1396 |
| 1205 | Ga0495593_0000138 | 3300047673 | Bacteria | 35243 |
| 1206 | Ga0495593_0027904 | 3300047673 | Bacteria | 3103 |
| 1207 | Ga0495593_0419964 | 3300047673 | Bacteria | 669 |
| 1208 | Ga0495602_0025051 | 3300048088 | Bacteria | 5781 |
| 1209 | Ga0495602_0106055 | 3300048088 | Bacteria | 2294 |
| 1210 | Ga0495602_0280340 | 3300048088 | Bacteria | 1228 |
| 1211 | Ga0495602_0425073 | 3300048088 | Bacteria | 943 |
| 1212 | Ga0495614_0003797 | 3300048089 | Bacteria | 6791 |
| 1213 | Ga0495614_0007036 | 3300048089 | Bacteria | 5024 |
| 1214 | Ga0495614_0115694 | 3300048089 | Bacteria | 1179 |
| 1215 | Ga0495626_0254129 | 3300048091 | Bacteria | 704 |
| 1216 | Ga0496100_0075470 | 3300048903 | Bacteria | 2261 |
| 1217 | Ga0496100_0099232 | 3300048903 | Bacteria | 2003 |
| 1218 | Ga0496101_0045807 | 3300048904 | Bacteria | 3134 |
| 1219 | Ga0496101_0755843 | 3300048904 | Bacteria | 767 |
| 1220 | Ga0496101_0969990 | 3300048904 | Bacteria | 669 |
| 1221 | Ga0496102_0005011 | 3300048905 | Bacteria | 11218 |
| 1222 | Ga0496102_0010869 | 3300048905 | Bacteria | 7837 |
| 1223 | Ga0496102_0035508 | 3300048905 | Bacteria | 4487 |
| 1224 | Ga0496103_0027147 | 3300048906 | Bacteria | 3467 |
| 1225 | Ga0496103_0113802 | 3300048906 | Bacteria | 1720 |
| 1226 | Ga0496103_0137800 | 3300048906 | Bacteria | 1560 |
| 1227 | Ga0496103_1059738 | 3300048906 | Bacteria | 503 |
| 1228 | Ga0496104_0008259 | 3300048907 | Bacteria | 9243 |
| 1229 | Ga0496104_0751688 | 3300048907 | Bacteria | 882 |
| 1230 | Ga0496104_1126017 | 3300048907 | Bacteria | 688 |
| 1231 | Ga0496105_0060824 | 3300048908 | Bacteria | 3117 |
| 1232 | Ga0496105_0353605 | 3300048908 | Bacteria | 1173 |
| 1233 | Ga0496105_0520553 | 3300048908 | Bacteria | 932 |
| 1234 | Ga0496105_0527843 | 3300048908 | Bacteria | 924 |
| 1235 | Ga0496106_0047288 | 3300048909 | Bacteria | 3237 |
| 1236 | Ga0496106_0063796 | 3300048909 | Bacteria | 2801 |
| 1237 | Ga0496106_0118244 | 3300048909 | Bacteria | 2069 |
| 1238 | Ga0496107_0002569 | 3300048910 | Bacteria | 11842 |
| 1239 | Ga0496107_0060942 | 3300048910 | Bacteria | 2731 |
| 1240 | Ga0496108_0058515 | 3300048911 | Bacteria | 3239 |
| 1241 | Ga0496108_0085285 | 3300048911 | Bacteria | 2680 |
| 1242 | Ga0496108_0188911 | 3300048911 | Bacteria | 1785 |
| 1243 | Ga0496109_0127666 | 3300048912 | Bacteria | 2371 |
| 1244 | Ga0496109_0544574 | 3300048912 | Bacteria | 1095 |
| 1245 | Ga0496109_0716823 | 3300048912 | Bacteria | 938 |
| 1246 | Ga0496109_0764108 | 3300048912 | Bacteria | 904 |
| 1247 | Ga0496109_1056385 | 3300048912 | Bacteria | 749 |
| 1248 | Ga0496109_1462390 | 3300048912 | Bacteria | 618 |
| 1249 | Ga0496110_0027642 | 3300048913 | Bacteria | 4863 |
| 1250 | Ga0496110_0038230 | 3300048913 | Bacteria | 4174 |
| 1251 | Ga0496110_0174858 | 3300048913 | Bacteria | 1949 |
| 1252 | Ga0496110_1864313 | 3300048913 | Bacteria | 511 |
| 1253 | Ga0496111_0035067 | 3300048914 | Bacteria | 3584 |
| 1254 | Ga0496111_0741937 | 3300048914 | Bacteria | 713 |
| 1255 | Ga0496112_0113328 | 3300048915 | Bacteria | 2682 |
| 1256 | Ga0496112_0404333 | 3300048915 | Bacteria | 1305 |
| 1257 | Ga0496112_0832628 | 3300048915 | Bacteria | 847 |
| 1258 | Ga0496113_0040177 | 3300048916 | Bacteria | 3446 |
| 1259 | Ga0496113_0088139 | 3300048916 | Bacteria | 2387 |
| 1260 | Ga0496113_0720869 | 3300048916 | Bacteria | 795 |
| 1261 | Ga0496114_0038329 | 3300048917 | Bacteria | 3965 |
| 1262 | Ga0496114_0107652 | 3300048917 | Bacteria | 2386 |
| 1263 | Ga0496114_1802307 | 3300048917 | Bacteria | 500 |
| 1264 | Ga0496115_0400190 | 3300048918 | Bacteria | 1114 |
| 1265 | Ga0496119_0234972 | 3300048922 | Bacteria | 931 |
| 1266 | Ga0496126_0684430 | 3300048929 | Bacteria | 799 |
| 1267 | Ga0501318_081340 | 3300049534 | Bacteria | 525 |
| 1268 | Ga0501031_0001780 | 3300049568 | Bacteria | 13515 |
| 1269 | Ga0501031_0017177 | 3300049568 | Bacteria | 4701 |
| 1270 | Ga0501031_0029479 | 3300049568 | Bacteria | 3579 |
| 1271 | Ga0501031_0061817 | 3300049568 | Bacteria | 2440 |
| 1272 | Ga0501031_0898503 | 3300049568 | Bacteria | 567 |
| 1273 | Ga0501031_0936363 | 3300049568 | Bacteria | 554 |
| 1274 | Ga0501032_0028713 | 3300049569 | Bacteria | 3821 |
| 1275 | Ga0501032_0123909 | 3300049569 | Bacteria | 1708 |
| 1276 | Ga0501032_0552085 | 3300049569 | Bacteria | 734 |
| 1277 | Ga0501032_0722735 | 3300049569 | Bacteria | 631 |
| 1278 | Ga0501033_0006059 | 3300049570 | Bacteria | 9482 |
| 1279 | Ga0501033_0021304 | 3300049570 | Bacteria | 4889 |
| 1280 | Ga0501033_0037724 | 3300049570 | Bacteria | 3616 |
| 1281 | Ga0501033_0072646 | 3300049570 | Bacteria | 2526 |
| 1282 | Ga0501033_0192030 | 3300049570 | Bacteria | 1461 |
| 1283 | Ga0501033_1007595 | 3300049570 | Bacteria | 556 |
| 1284 | Ga0501033_1019594 | 3300049570 | Bacteria | 553 |
| 1285 | Ga0501034_0000924 | 3300049571 | Bacteria | 42892 |
| 1286 | Ga0501034_0002789 | 3300049571 | Bacteria | 20464 |
| 1287 | Ga0501034_0022110 | 3300049571 | Bacteria | 6478 |
| 1288 | Ga0501034_0171104 | 3300049571 | Bacteria | 2139 |
| 1289 | Ga0501034_0172536 | 3300049571 | Bacteria | 2129 |
| 1290 | Ga0501034_0495594 | 3300049571 | Bacteria | 1136 |
| 1291 | Ga0501036_0000311 | 3300049572 | Bacteria | 33892 |
| 1292 | Ga0501036_0035488 | 3300049572 | Bacteria | 4219 |
| 1293 | Ga0501036_0056446 | 3300049572 | Bacteria | 3328 |
| 1294 | Ga0501036_0060193 | 3300049572 | Bacteria | 3217 |
| 1295 | Ga0501036_0322210 | 3300049572 | Bacteria | 1291 |
| 1296 | Ga0501036_0392960 | 3300049572 | Bacteria | 1157 |
| 1297 | Ga0501036_1090149 | 3300049572 | Bacteria | 652 |
| 1298 | Ga0501037_0056238 | 3300049573 | Bacteria | 2874 |
| 1299 | Ga0501037_0096108 | 3300049573 | Bacteria | 2141 |
| 1300 | Ga0501037_0111730 | 3300049573 | Bacteria | 1968 |
| 1301 | Ga0501037_0180209 | 3300049573 | Bacteria | 1499 |
| 1302 | Ga0501038_0000729 | 3300049574 | Bacteria | 29347 |
| 1303 | Ga0501038_0001008 | 3300049574 | Bacteria | 25385 |
| 1304 | Ga0501038_0001438 | 3300049574 | Bacteria | 21853 |
| 1305 | Ga0501038_0003450 | 3300049574 | Bacteria | 14741 |
| 1306 | Ga0501038_0022056 | 3300049574 | Bacteria | 5711 |
| 1307 | Ga0501038_0183858 | 3300049574 | Bacteria | 1685 |
| 1308 | Ga0501039_0001818 | 3300049575 | Bacteria | 15776 |
| 1309 | Ga0501039_0012672 | 3300049575 | Bacteria | 6443 |
| 1310 | Ga0501039_0395712 | 3300049575 | Bacteria | 1085 |
| 1311 | Ga0501039_0493035 | 3300049575 | Bacteria | 962 |
| 1312 | Ga0501040_0000601 | 3300049576 | Bacteria | 21952 |
| 1313 | Ga0501040_0030966 | 3300049576 | Bacteria | 3615 |
| 1314 | Ga0501040_0357376 | 3300049576 | Bacteria | 1047 |
| 1315 | Ga0501041_0000058 | 3300049577 | Bacteria | 40571 |
| 1316 | Ga0501041_0017390 | 3300049577 | Bacteria | 4279 |
| 1317 | Ga0501042_0000028 | 3300049578 | Bacteria | 47448 |
| 1318 | Ga0501042_0001191 | 3300049578 | Bacteria | 15071 |
| 1319 | Ga0501042_0163184 | 3300049578 | Bacteria | 1607 |
| 1320 | Ga0501042_0164637 | 3300049578 | Bacteria | 1600 |
| 1321 | Ga0501043_0006711 | 3300049579 | Bacteria | 9191 |
| 1322 | Ga0501043_0047630 | 3300049579 | Bacteria | 3370 |
| 1323 | Ga0501043_0248654 | 3300049579 | Bacteria | 1370 |
| 1324 | Ga0501043_0374102 | 3300049579 | Bacteria | 1079 |
| 1325 | Ga0501046_0000269 | 3300049580 | Bacteria | 52979 |
| 1326 | Ga0501046_0002221 | 3300049580 | Bacteria | 18318 |
| 1327 | Ga0501046_0138238 | 3300049580 | Bacteria | 1845 |
| 1328 | Ga0501046_0332087 | 3300049580 | Bacteria | 1106 |
| 1329 | Ga0501046_0948634 | 3300049580 | Bacteria | 599 |
| 1330 | Ga0501047_0000029 | 3300049581 | Bacteria | 218396 |
| 1331 | Ga0501047_0051999 | 3300049581 | Bacteria | 3959 |
| 1332 | Ga0501047_0100758 | 3300049581 | Bacteria | 2768 |
| 1333 | Ga0501047_0124606 | 3300049581 | Bacteria | 2457 |
| 1334 | Ga0501047_0199083 | 3300049581 | Bacteria | 1864 |
| 1335 | Ga0501047_0653749 | 3300049581 | Bacteria | 871 |
| 1336 | Ga0501047_1227583 | 3300049581 | Bacteria | 563 |
| 1337 | Ga0501048_0000208 | 3300049582 | Bacteria | 38576 |
| 1338 | Ga0501048_0000611 | 3300049582 | Bacteria | 25411 |
| 1339 | Ga0501048_0326634 | 3300049582 | Bacteria | 1093 |
| 1340 | Ga0501067_0200869 | 3300049583 | Bacteria | 1110 |
| 1341 | Ga0501067_0293683 | 3300049583 | Bacteria | 905 |
| 1342 | Ga0501067_0729157 | 3300049583 | Bacteria | 557 |
| 1343 | Ga0501068_0066237 | 3300049584 | Bacteria | 2200 |
| 1344 | Ga0501068_0216071 | 3300049584 | Bacteria | 1218 |
| 1345 | Ga0501069_0085582 | 3300049585 | Bacteria | 1779 |
| 1346 | Ga0501069_0111832 | 3300049585 | Bacteria | 1556 |
| 1347 | Ga0501069_0351033 | 3300049585 | Bacteria | 869 |
| 1348 | Ga0501069_0560716 | 3300049585 | Bacteria | 684 |
| 1349 | Ga0501070_0003598 | 3300049586 | Bacteria | 13404 |
| 1350 | Ga0501070_0038542 | 3300049586 | Bacteria | 3987 |
| 1351 | Ga0501070_0082761 | 3300049586 | Bacteria | 2656 |
| 1352 | Ga0501070_0259504 | 3300049586 | Bacteria | 1420 |
| 1353 | Ga0501070_0537171 | 3300049586 | Bacteria | 937 |
| 1354 | Ga0501070_0615630 | 3300049586 | Bacteria | 865 |
| 1355 | Ga0501070_0755595 | 3300049586 | Bacteria | 766 |
| 1356 | Ga0501071_0001455 | 3300049587 | Bacteria | 13716 |
| 1357 | Ga0501071_0003307 | 3300049587 | Bacteria | 10072 |
| 1358 | Ga0501071_0022572 | 3300049587 | Bacteria | 4388 |
| 1359 | Ga0501071_0245959 | 3300049587 | Bacteria | 1349 |
| 1360 | Ga0501072_0000452 | 3300049588 | Bacteria | 29576 |
| 1361 | Ga0501072_0607383 | 3300049588 | Bacteria | 862 |
| 1362 | Ga0501073_0148755 | 3300049589 | Bacteria | 1623 |
| 1363 | Ga0501073_0269320 | 3300049589 | Bacteria | 1175 |
| 1364 | Ga0501073_0428564 | 3300049589 | Bacteria | 914 |
| 1365 | Ga0501074_0006540 | 3300049590 | Bacteria | 8419 |
| 1366 | Ga0501074_0010495 | 3300049590 | Bacteria | 6723 |
| 1367 | Ga0501074_0156894 | 3300049590 | Bacteria | 1625 |
| 1368 | Ga0501074_0501964 | 3300049590 | Bacteria | 859 |
| 1369 | Ga0501075_0002435 | 3300049591 | Bacteria | 12394 |
| 1370 | Ga0501075_0025620 | 3300049591 | Bacteria | 4333 |
| 1371 | Ga0501075_0206031 | 3300049591 | Bacteria | 1500 |
| 1372 | Ga0501076_0000061 | 3300049592 | Bacteria | 53989 |
| 1373 | Ga0501076_0363209 | 3300049592 | Bacteria | 1189 |
| 1374 | Ga0501077_0000349 | 3300049593 | Bacteria | 27264 |
| 1375 | Ga0501077_0285411 | 3300049593 | Bacteria | 1051 |
| 1376 | Ga0501217_094455 | 3300049661 | Bacteria | 843 |
| 1377 | Ga0501222_074394 | 3300049662 | Bacteria | 533 |
| 1378 | Ga0501243_099432 | 3300049675 | Bacteria | 586 |
| 1379 | Ga0501250_016109 | 3300049680 | Bacteria | 926 |
| 1380 | Ga0501079_0000185 | 3300049741 | Bacteria | 35586 |
| 1381 | Ga0501079_0004729 | 3300049741 | Bacteria | 10082 |
| 1382 | Ga0501079_0167023 | 3300049741 | Bacteria | 1716 |
| 1383 | Ga0501080_0035150 | 3300049742 | Bacteria | 4678 |
| 1384 | Ga0501080_0050424 | 3300049742 | Bacteria | 3874 |
| 1385 | Ga0501080_0091102 | 3300049742 | Bacteria | 2832 |
| 1386 | Ga0501080_0922097 | 3300049742 | Bacteria | 760 |
| 1387 | Ga0501080_1263783 | 3300049742 | Bacteria | 633 |
| 1388 | Ga0501080_1757283 | 3300049742 | Bacteria | 522 |
| 1389 | Ga0501081_0000808 | 3300049743 | Bacteria | 18487 |
| 1390 | Ga0501081_0014905 | 3300049743 | Bacteria | 5127 |
| 1391 | Ga0501083_0072299 | 3300049744 | Bacteria | 2293 |
| 1392 | Ga0501083_0081237 | 3300049744 | Bacteria | 2149 |
| 1393 | Ga0501035_0005880 | 3300049822 | Bacteria | 11554 |
| 1394 | Ga0501035_0030498 | 3300049822 | Bacteria | 4914 |
| 1395 | Ga0501035_0057970 | 3300049822 | Bacteria | 3452 |
| 1396 | Ga0501035_0059274 | 3300049822 | Bacteria | 3409 |
| 1397 | Ga0501035_0082543 | 3300049822 | Bacteria | 2836 |
| 1398 | Ga0501035_0629839 | 3300049822 | Bacteria | 871 |
| 1399 | Ga0501035_0677754 | 3300049822 | Bacteria | 833 |
| 1400 | Ga0501035_0813446 | 3300049822 | Bacteria | 746 |
| 1401 | Ga0501044_0004269 | 3300049823 | Bacteria | 16039 |
| 1402 | Ga0501044_0016800 | 3300049823 | Bacteria | 7854 |
| 1403 | Ga0501044_0053274 | 3300049823 | Bacteria | 4163 |
| 1404 | Ga0501044_0130851 | 3300049823 | Bacteria | 2503 |
| 1405 | Ga0501044_0313001 | 3300049823 | Bacteria | 1496 |
| 1406 | Ga0501044_0794045 | 3300049823 | Bacteria | 826 |
| 1407 | Ga0501044_1328849 | 3300049823 | Bacteria | 585 |
| 1408 | Ga0501045_0000044 | 3300049824 | Bacteria | 54187 |
| 1409 | Ga0501045_0000099 | 3300049824 | Bacteria | 42877 |
| 1410 | Ga0501045_0003799 | 3300049824 | Bacteria | 10386 |
| 1411 | Ga0501045_0416961 | 3300049824 | Bacteria | 999 |
| 1412 | nmdc:mga03n38_642101_c1 | 3300050490 | Bacteria | 608 |
| 1413 | nmdc:mga06z11_6901_c1 | 3300050494 | Bacteria | 4648 |
| 1414 | nmdc:mga04h51_7603_c1 | 3300050495 | Bacteria | 2867 |
| 1415 | nmdc:mga07m45_412112_c1 | 3300050496 | Bacteria | 784 |
| 1416 | nmdc:mga05p37_1978877_c1 | 3300050507 | Bacteria | 552 |
| 1417 | nmdc:mga05p37_2500_c1 | 3300050507 | Bacteria | 21375 |
| 1418 | nmdc:mga05p37_296234_c1 | 3300050507 | Bacteria | 1924 |
| 1419 | nmdc:mga05p37_476371_c1 | 3300050507 | Bacteria | 1439 |
| 1420 | nmdc:mga09592_29416_c1 | 3300050508 | Bacteria | 4570 |
| 1421 | nmdc:mga09592_297686_c1 | 3300050508 | Bacteria | 1399 |
| 1422 | nmdc:mga09592_621605_c1 | 3300050508 | Bacteria | 924 |
| 1423 | nmdc:mga0qj67_11266_c1 | 3300050509 | Bacteria | 6698 |
| 1424 | nmdc:mga0qj67_1196375_c1 | 3300050509 | Bacteria | 591 |
| 1425 | nmdc:mga06r32_39821_c1 | 3300050510 | Bacteria | 4461 |
| 1426 | nmdc:mga08y16_1109_c1 | 3300050511 | Bacteria | 26540 |
| 1427 | nmdc:mga0n895_2244304_c1 | 3300050512 | Bacteria | 501 |
| 1428 | nmdc:mga0n895_336722_c1 | 3300050512 | Bacteria | 1529 |
| 1429 | nmdc:mga0n895_557889_c1 | 3300050512 | Bacteria | 1151 |
| 1430 | nmdc:mga0rr50_6991_c1 | 3300050513 | Bacteria | 6924 |
| 1431 | nmdc:mga08x19_43194_c1 | 3300050514 | Bacteria | 2876 |
| 1432 | nmdc:mga08x19_927160_c1 | 3300050514 | Bacteria | 619 |
| 1433 | nmdc:mga0a205_18720_c2 | 3300050515 | Bacteria | 3115 |
| 1434 | nmdc:mga0a205_1920_c1 | 3300050515 | Bacteria | 18059 |
| 1435 | nmdc:mga0a205_472147_c1 | 3300050515 | Bacteria | 1113 |
| 1436 | Ga0495601_0054938 | 3300053077 | Bacteria | 2520 |
| 1437 | Ga0495601_0315218 | 3300053077 | Bacteria | 1018 |
| 1438 | Ga0495601_0507899 | 3300053077 | Bacteria | 777 |
| 1439 | Ga0495612_0024870 | 3300053078 | Bacteria | 2404 |
| 1440 | Ga0495612_0052359 | 3300053078 | Bacteria | 1679 |
| 1441 | Ga0495612_0106079 | 3300053078 | Bacteria | 1199 |
| 1442 | Ga0495655_0183927 | 3300053083 | Bacteria | 675 |
| 1443 | Ga0495655_0242719 | 3300053083 | Bacteria | 603 |
| 1444 | Ga0495595_0004357 | 3300053084 | Bacteria | 5697 |
| 1445 | Ga0495595_0317009 | 3300053084 | Bacteria | 785 |
| 1446 | Ga0495619_0080196 | 3300053085 | Bacteria | 2196 |
| 1447 | Ga0495619_0081314 | 3300053085 | Bacteria | 2181 |
| 1448 | Ga0500578_0061920 | 3300053086 | Bacteria | 2388 |
| 1449 | Ga0500578_0073961 | 3300053086 | Bacteria | 2171 |
| 1450 | Ga0500644_0087099 | 3300053088 | Bacteria | 1161 |
| 1451 | Ga0500646_0172845 | 3300053090 | Bacteria | 728 |
| 1452 | Ga0500583_0177827 | 3300053092 | Bacteria | 1060 |
| 1453 | Ga0500566_0029128 | 3300053094 | Bacteria | 3226 |
| 1454 | Ga0500640_001975 | 3300053095 | Bacteria | 6582 |
| 1455 | Ga0500660_133674 | 3300053100 | Bacteria | 1002 |
| 1456 | Ga0500553_121642 | 3300053101 | Bacteria | 1074 |
| 1457 | Ga0500560_043872 | 3300053107 | Bacteria | 1412 |
| 1458 | Ga0500560_239485 | 3300053107 | Bacteria | 570 |
| 1459 | Ga0500569_005079 | 3300053109 | Bacteria | 2809 |
| 1460 | Ga0500572_088195 | 3300053111 | Bacteria | 980 |
| 1461 | Ga0500580_239330 | 3300053113 | Bacteria | 551 |
| 1462 | Ga0500582_185900 | 3300053114 | Bacteria | 705 |
| 1463 | Ga0500614_010286 | 3300053123 | Bacteria | 2007 |
| 1464 | Ga0500621_206050 | 3300053126 | Bacteria | 692 |
| 1465 | Ga0500628_001049 | 3300053129 | Bacteria | 4827 |
| 1466 | Ga0500652_001997 | 3300053131 | Bacteria | 6143 |
| 1467 | Ga0500658_0004724 | 3300053134 | Bacteria | 5074 |
| 1468 | Ga0500559_0029534 | 3300053136 | Bacteria | 2348 |
| 1469 | Ga0500559_0304142 | 3300053136 | Bacteria | 749 |
| 1470 | Ga0500561_0000420 | 3300053137 | Bacteria | 6976 |
| 1471 | Ga0500573_0025239 | 3300053140 | Bacteria | 3417 |
| 1472 | Ga0500573_0508023 | 3300053140 | Bacteria | 543 |
| 1473 | Ga0500577_0268877 | 3300053142 | Bacteria | 742 |
| 1474 | Ga0500579_036618 | 3300053143 | Bacteria | 3114 |
| 1475 | Ga0500586_260713 | 3300053145 | Bacteria | 539 |
| 1476 | Ga0500588_0176562 | 3300053146 | Bacteria | 784 |
| 1477 | Ga0500600_0047044 | 3300053149 | Bacteria | 2461 |
| 1478 | Ga0500600_0231398 | 3300053149 | Bacteria | 844 |
| 1479 | Ga0500603_178475 | 3300053150 | Bacteria | 667 |
| 1480 | Ga0500606_139456 | 3300053152 | Bacteria | 796 |
| 1481 | Ga0500616_0029739 | 3300053153 | Bacteria | 3004 |
| 1482 | Ga0500627_0221498 | 3300053158 | Bacteria | 844 |
| 1483 | Ga0500633_0000496 | 3300053160 | Bacteria | 6294 |
| 1484 | Ga0500634_0000253 | 3300053161 | Bacteria | 17110 |
| 1485 | Ga0500634_0187598 | 3300053161 | Bacteria | 923 |
| 1486 | Ga0500656_000060 | 3300053732 | Bacteria | 6255 |
| 1487 | Ga0500587_002698 | 3300053739 | Bacteria | 2514 |
| 1488 | Ga0501084_0002725 | 3300054114 | Bacteria | 14245 |
| 1489 | Ga0501084_0007261 | 3300054114 | Bacteria | 9133 |
| 1490 | Ga0501084_0190792 | 3300054114 | Bacteria | 1729 |
| 1491 | Ga0501084_0903292 | 3300054114 | Bacteria | 743 |
| 1492 | Ga0590071_003818 | 3300059421 | Bacteria | 3701 |
| 1493 | Ga0590074_013428 | 3300059423 | Bacteria | 1383 |
| 1494 | Ga0590074_021961 | 3300059423 | Bacteria | 1102 |
| 1495 | Ga0590075_018110 | 3300059424 | Bacteria | 1740 |
| 1496 | Ga0590077_000958 | 3300059426 | Bacteria | 7357 |
| 1497 | Ga0590077_073095 | 3300059426 | Bacteria | 784 |
| 1498 | Ga0587073_0298714 | 3300059492 | Bacteria | 523 |
| 1499 | Ga0587082_162506 | 3300059504 | Bacteria | 536 |
| 1500 | Ga0587072_186239 | 3300059643 | Bacteria | 521 |
| 1501 | Ga0501082_0003253 | 3300060353 | Bacteria | 14176 |
| 1502 | Ga0501082_0041255 | 3300060353 | Bacteria | 3979 |
| 1503 | Ga0501082_0385269 | 3300060353 | Bacteria | 1223 |
| 1504 | Ga0466962_0000765 | 3300061719 | Bacteria | 14422 |
| 1505 | Ga0466962_0027782 | 3300061719 | Bacteria | 2712 |
| 1506 | Ga0466962_0077974 | 3300061719 | Bacteria | 1584 |
| 1507 | Ga0530510_0000204 | 3300061734 | Bacteria | 36725 |
| 1508 | Ga0530510_0036828 | 3300061734 | Bacteria | 3525 |
| 1509 | Ga0530510_0817184 | 3300061734 | Bacteria | 711 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005445 | Ga0070708_100236745 | Ga0070708_1002367452 | 59 |
| 2 | 3300012492 | Ga0157335_1026195 | Ga0157335_10261952 | 60 |
| 3 | 3300005327 | Ga0070658_10002606 | Ga0070658_100026062 | 68 |
| 4 | 3300044684 | Ga0466966_0088433 | Ga0466966_0088433_1389_1625 | 68 |
| 5 | 3300044693 | Ga0466961_0059572 | Ga0466961_0059572_712_948 | 68 |
| 6 | 3300044765 | Ga0466970_0773766 | Ga0466970_0773766_135_371 | 68 |
| 7 | 3300044842 | Ga0466957_0871388 | Ga0466957_0871388_20_256 | 68 |
| 8 | 3300045049 | Ga0466959_1067356 | Ga0466959_1067356_173_409 | 68 |
| 9 | 3300053111 | Ga0500572_088195 | Ga0500572_088195_272_514 | 68 |
| 10 | 3300053136 | Ga0500559_0029534 | Ga0500559_0029534_1133_1375 | 68 |
| 11 | iso_pu_bacteria | 2738543005 | 2739203231 | 68 |
| 12 | iso_pu_bacteria | 2928142448 | 2928142545 | 68 |
| 13 | 3300025935 | Ga0207709_10907226 | Ga0207709_109072261 | 69 |
| 14 | 3300049580 | Ga0501046_0138238 | Ga0501046_0138238_363_581 | 70 |
| 15 | 3300049568 | Ga0501031_0898503 | Ga0501031_0898503_241_456 | 71 |
| 16 | 3300049569 | Ga0501032_0722735 | Ga0501032_0722735_18_236 | 71 |
| 17 | 3300049742 | Ga0501080_1757283 | Ga0501080_1757283_287_502 | 71 |
| 18 | 3300041509 | Ga0451843_1399856 | Ga0451843_1399856_293_511 | 72 |
| 19 | iso_pu_bacteria | 2547132111 | 2547410434 | 73 |
| 20 | iso_pu_bacteria | 2582581312 | 2585297487 | 73 |
| 21 | iso_pu_bacteria | 2582581313 | 2585307691 | 73 |
| 22 | iso_pu_bacteria | 2582581314 | 2585316697 | 73 |
| 23 | iso_pu_bacteria | 2616644814 | 2616699965 | 73 |
| 24 | iso_pu_bacteria | 2616644941 | 2616903816 | 73 |
| 25 | iso_pu_bacteria | 2643221587 | 2643945597 | 73 |
| 26 | iso_pu_bacteria | 2643221670 | 2644387103 | 73 |
| 27 | iso_pu_bacteria | 2643221677 | 2644434863 | 73 |
| 28 | iso_pu_bacteria | 2643221678 | 2644437820 | 73 |
| 29 | iso_pu_bacteria | 2643221714 | 2644629794 | 73 |
| 30 | iso_pu_bacteria | 2675903060 | 2676488933 | 73 |
| 31 | iso_pu_bacteria | 2767802112 | 2768647055 | 73 |
| 32 | iso_pu_bacteria | 2784132148 | 2784590588 | 73 |
| 33 | iso_pu_bacteria | 2784746768 | 2785371760 | 73 |
| 34 | iso_pu_bacteria | 2786546132 | 2786672865 | 73 |
| 35 | iso_pu_bacteria | 2791355406 | 2793984781 | 73 |
| 36 | iso_pu_bacteria | 2808606359 | 2808844213 | 73 |
| 37 | iso_pu_bacteria | 2808606375 | 2808913832 | 73 |
| 38 | iso_pu_bacteria | 2808606448 | 2809234280 | 73 |
| 39 | iso_pu_bacteria | 2808606982 | 2811844175 | 73 |
| 40 | iso_pu_bacteria | 2818991472 | 2819740511 | 73 |
| 41 | iso_pu_bacteria | 2862178590 | 2862181733 | 73 |
| 42 | iso_pu_bacteria | 2862281513 | 2862284393 | 73 |
| 43 | iso_pu_bacteria | 2862382967 | 2862391807 | 73 |
| 44 | iso_pu_bacteria | 2862507626 | 2862508986 | 73 |
| 45 | iso_pu_bacteria | 2862705112 | 2862706131 | 73 |
| 46 | iso_pu_bacteria | 2863404153 | 2863408836 | 73 |
| 47 | iso_pu_bacteria | 2866552031 | 2866552724 | 73 |
| 48 | iso_pu_bacteria | 2867346516 | 2867350855 | 73 |
| 49 | iso_pu_bacteria | 2867369537 | 2867374029 | 73 |
| 50 | iso_pu_bacteria | 2867428634 | 2867430389 | 73 |
| 51 | iso_pu_bacteria | 2867475112 | 2867475709 | 73 |
| 52 | iso_pu_bacteria | 2877676314 | 2877678838 | 73 |
| 53 | iso_pu_bacteria | 2895427314 | 2895429286 | 73 |
| 54 | iso_pu_bacteria | 2912715099 | 2912717386 | 73 |
| 55 | iso_pu_bacteria | 2912723979 | 2912729965 | 73 |
| 56 | iso_pu_bacteria | 2918501144 | 2918506712 | 73 |
| 57 | iso_pu_bacteria | 2919468124 | 2919472442 | 73 |
| 58 | iso_pu_bacteria | 2946072368 | 2946077931 | 73 |
| 59 | iso_pu_bacteria | 2947224130 | 2947226734 | 73 |
| 60 | iso_pu_bacteria | 2954002825 | 2954005748 | 73 |
| 61 | iso_pu_bacteria | 2954380949 | 2954383800 | 73 |
| 62 | iso_pu_bacteria | 2954673503 | 2954679169 | 73 |
| 63 | iso_pu_bacteria | 2954682443 | 2954684983 | 73 |
| 64 | iso_pu_bacteria | 2954691527 | 2954694598 | 73 |
| 65 | iso_pu_bacteria | 2954701450 | 2954709802 | 73 |
| 66 | iso_pu_bacteria | 2954711539 | 2954714099 | 73 |
| 67 | iso_pu_bacteria | 2954721474 | 2954724052 | 73 |
| 68 | iso_pu_bacteria | 2954731030 | 2954737788 | 73 |
| 69 | iso_pu_bacteria | 2954740390 | 2954742950 | 73 |
| 70 | iso_pu_bacteria | 2954749733 | 2954756623 | 73 |
| 71 | iso_pu_bacteria | 2954759201 | 2954761908 | 73 |
| 72 | iso_pu_bacteria | 2990088156 | 2990093987 | 73 |
| 73 | iso_pu_bacteria | 2997451912 | 2997453062 | 73 |
| 74 | iso_pu_bacteria | 2997600082 | 2997603964 | 73 |
| 75 | iso_pu_bacteria | 3006321560 | 3006324809 | 73 |
| 76 | iso_pu_bacteria | 3006393351 | 3006397144 | 73 |
| 77 | iso_pu_bacteria | 3006425503 | 3006426570 | 73 |
| 78 | iso_pu_bacteria | 3006493962 | 3006494736 | 73 |
| 79 | iso_pu_bacteria | 8008485437 | 8008487188 | 73 |
| 80 | iso_pu_bacteria | 8008558824 | 8008563003 | 73 |
| 81 | iso_pu_bacteria | 8008574985 | 8008576955 | 73 |
| 82 | iso_pu_bacteria | 8023623736 | 8023624800 | 73 |
| 83 | iso_pu_bacteria | 8025478263 | 8025481132 | 73 |
| 84 | iso_pu_bacteria | 8025524527 | 8025526379 | 73 |
| 85 | iso_pu_bacteria | 8025530807 | 8025532617 | 73 |
| 86 | iso_pu_bacteria | 8033684223 | 8033686773 | 73 |
| 87 | iso_pu_bacteria | 8047893842 | 8047895867 | 73 |
| 88 | iso_pu_bacteria | 8048127548 | 8048129132 | 73 |
| 89 | iso_pu_bacteria | 8048356638 | 8048363067 | 73 |
| 90 | iso_pu_bacteria | 8048369669 | 8048372891 | 73 |
| 91 | iso_pu_bacteria | 8048379754 | 8048381825 | 73 |
| 92 | iso_pu_bacteria | 8054160619 | 8054165326 | 73 |
| 93 | iso_pu_bacteria | 8054472261 | 8054473305 | 73 |
| 94 | iso_pu_bacteria | 8055066027 | 8055073095 | 73 |
| 95 | iso_pu_bacteria | 8056447290 | 8056450045 | 73 |
| 96 | iso_pu_bacteria | 8056667051 | 8056671157 | 73 |
| 97 | iso_pu_bacteria | 8056829672 | 8056831524 | 73 |
| 98 | iso_pu_bacteria | 2515154155 | 2515853614 | 74 |
| 99 | iso_pu_bacteria | 2837268691 | 2837272885 | 74 |
| 100 | iso_pu_bacteria | 2868088558 | 2868093893 | 74 |
| 101 | 3300005328 | Ga0070676_11167441 | Ga0070676_111674412 | 76 |
| 102 | 3300005334 | Ga0068869_100047601 | Ga0068869_1000476014 | 76 |
| 103 | 3300005338 | Ga0068868_100230523 | Ga0068868_1002305232 | 76 |
| 104 | 3300005341 | Ga0070691_10209610 | Ga0070691_102096102 | 76 |
| 105 | 3300005343 | Ga0070687_100589783 | Ga0070687_1005897832 | 76 |
| 106 | 3300005345 | Ga0070692_10179902 | Ga0070692_101799021 | 76 |
| 107 | 3300005347 | Ga0070668_101237749 | Ga0070668_1012377491 | 76 |
| 108 | 3300005354 | Ga0070675_100521069 | Ga0070675_1005210692 | 76 |
| 109 | 3300005355 | Ga0070671_100460874 | Ga0070671_1004608742 | 76 |
| 110 | 3300005366 | Ga0070659_102088356 | Ga0070659_1020883562 | 76 |
| 111 | 3300005441 | Ga0070700_100014074 | Ga0070700_1000140743 | 76 |
| 112 | 3300005455 | Ga0070663_100679015 | Ga0070663_1006790152 | 76 |
| 113 | 3300005457 | Ga0070662_100281198 | Ga0070662_1002811982 | 76 |
| 114 | 3300005535 | Ga0070684_100706452 | Ga0070684_1007064521 | 76 |
| 115 | 3300005545 | Ga0070695_100375328 | Ga0070695_1003753282 | 76 |
| 116 | 3300005546 | Ga0070696_100090898 | Ga0070696_1000908984 | 76 |
| 117 | 3300005547 | Ga0070693_100308034 | Ga0070693_1003080342 | 76 |
| 118 | 3300005547 | Ga0070693_100665321 | Ga0070693_1006653212 | 76 |
| 119 | 3300005577 | Ga0068857_101599873 | Ga0068857_1015998731 | 76 |
| 120 | 3300005578 | Ga0068854_100501014 | Ga0068854_1005010142 | 76 |
| 121 | 3300017792 | Ga0163161_10559656 | Ga0163161_105596562 | 76 |
| 122 | 3300025901 | Ga0207688_10333190 | Ga0207688_103331902 | 76 |
| 123 | 3300025907 | Ga0207645_10143196 | Ga0207645_101431963 | 76 |
| 124 | 3300025927 | Ga0207687_10651963 | Ga0207687_106519632 | 76 |
| 125 | 3300025932 | Ga0207690_10652843 | Ga0207690_106528432 | 76 |
| 126 | 3300025933 | Ga0207706_10374031 | Ga0207706_103740313 | 76 |
| 127 | 3300025942 | Ga0207689_10099790 | Ga0207689_100997902 | 76 |
| 128 | 3300026023 | Ga0207677_11107215 | Ga0207677_111072151 | 76 |
| 129 | 3300026075 | Ga0207708_10002817 | Ga0207708_100028174 | 76 |
| 130 | 3300026118 | Ga0207675_100321669 | Ga0207675_1003216693 | 76 |
| 131 | 3300027695 | Ga0209966_1114722 | Ga0209966_11147221 | 76 |
| 132 | 3300001976 | JGI24752J21851_1038130 | JGI24752J21851_10381301 | 77 |
| 133 | 3300001977 | JGI24746J21847_1070487 | JGI24746J21847_10704871 | 77 |
| 134 | 3300001990 | JGI24737J22298_10003653 | JGI24737J22298_100036532 | 77 |
| 135 | 3300001990 | JGI24737J22298_10063356 | JGI24737J22298_100633562 | 77 |
| 136 | 3300002067 | JGI24735J21928_10021020 | JGI24735J21928_100210203 | 77 |
| 137 | 3300002075 | JGI24738J21930_10055472 | JGI24738J21930_100554722 | 77 |
| 138 | 3300002077 | JGI24744J21845_10079380 | JGI24744J21845_100793802 | 77 |
| 139 | 3300002459 | JGI24751J29686_10027934 | JGI24751J29686_100279342 | 77 |
| 140 | 3300003316 | rootH1_10041734 | rootH1_100417343 | 77 |
| 141 | 3300003320 | rootH2_10067360 | rootH2_100673602 | 77 |
| 142 | 3300003322 | rootL2_10041928 | rootL2_100419282 | 77 |
| 143 | 3300003322 | rootL2_10063672 | rootL2_100636723 | 77 |
| 144 | 3300003323 | rootH1_10009634 | rootH1_100096342 | 77 |
| 145 | 3300003323 | rootH1_10030202 | rootH1_100302022 | 77 |
| 146 | 3300003323 | rootH1_10030203 | rootH1_100302033 | 77 |
| 147 | 3300003373 | JGI25407J50210_10045851 | JGI25407J50210_100458512 | 77 |
| 148 | 3300003559 | Ga0007427J51700_123488 | Ga0007427J51700_1234881 | 77 |
| 149 | 3300004799 | Ga0058863_11889194 | Ga0058863_118891941 | 77 |
| 150 | 3300005327 | Ga0070658_10017488 | Ga0070658_100174884 | 77 |
| 151 | 3300005327 | Ga0070658_10211772 | Ga0070658_102117723 | 77 |
| 152 | 3300005327 | Ga0070658_10290895 | Ga0070658_102908952 | 77 |
| 153 | 3300005328 | Ga0070676_10194093 | Ga0070676_101940932 | 77 |
| 154 | 3300005329 | Ga0070683_100094876 | Ga0070683_1000948762 | 77 |
| 155 | 3300005329 | Ga0070683_100741609 | Ga0070683_1007416092 | 77 |
| 156 | 3300005329 | Ga0070683_100997461 | Ga0070683_1009974612 | 77 |
| 157 | 3300005329 | Ga0070683_101053993 | Ga0070683_1010539932 | 77 |
| 158 | 3300005329 | Ga0070683_102370549 | Ga0070683_1023705492 | 77 |
| 159 | 3300005330 | Ga0070690_100026467 | Ga0070690_1000264673 | 77 |
| 160 | 3300005330 | Ga0070690_100504626 | Ga0070690_1005046262 | 77 |
| 161 | 3300005330 | Ga0070690_100553406 | Ga0070690_1005534061 | 77 |
| 162 | 3300005331 | Ga0070670_100399061 | Ga0070670_1003990612 | 77 |
| 163 | 3300005334 | Ga0068869_100080194 | Ga0068869_1000801942 | 77 |
| 164 | 3300005334 | Ga0068869_100142285 | Ga0068869_1001422852 | 77 |
| 165 | 3300005334 | Ga0068869_101415583 | Ga0068869_1014155831 | 77 |
| 166 | 3300005335 | Ga0070666_10243862 | Ga0070666_102438622 | 77 |
| 167 | 3300005336 | Ga0070680_100010848 | Ga0070680_1000108483 | 77 |
| 168 | 3300005336 | Ga0070680_100081816 | Ga0070680_1000818161 | 77 |
| 169 | 3300005336 | Ga0070680_100504165 | Ga0070680_1005041651 | 77 |
| 170 | 3300005336 | Ga0070680_101238269 | Ga0070680_1012382691 | 77 |
| 171 | 3300005337 | Ga0070682_100016723 | Ga0070682_1000167233 | 77 |
| 172 | 3300005337 | Ga0070682_100295407 | Ga0070682_1002954072 | 77 |
| 173 | 3300005337 | Ga0070682_100333382 | Ga0070682_1003333822 | 77 |
| 174 | 3300005337 | Ga0070682_100356082 | Ga0070682_1003560821 | 77 |
| 175 | 3300005338 | Ga0068868_100008400 | Ga0068868_1000084002 | 77 |
| 176 | 3300005338 | Ga0068868_100286586 | Ga0068868_1002865862 | 77 |
| 177 | 3300005338 | Ga0068868_100511960 | Ga0068868_1005119602 | 77 |
| 178 | 3300005338 | Ga0068868_101236380 | Ga0068868_1012363802 | 77 |
| 179 | 3300005338 | Ga0068868_101418932 | Ga0068868_1014189322 | 77 |
| 180 | 3300005338 | Ga0068868_101927925 | Ga0068868_1019279251 | 77 |
| 181 | 3300005339 | Ga0070660_100020384 | Ga0070660_1000203844 | 77 |
| 182 | 3300005339 | Ga0070660_100297132 | Ga0070660_1002971322 | 77 |
| 183 | 3300005339 | Ga0070660_100638871 | Ga0070660_1006388711 | 77 |
| 184 | 3300005339 | Ga0070660_101448560 | Ga0070660_1014485602 | 77 |
| 185 | 3300005340 | Ga0070689_100135688 | Ga0070689_1001356883 | 77 |
| 186 | 3300005340 | Ga0070689_100264718 | Ga0070689_1002647183 | 77 |
| 187 | 3300005341 | Ga0070691_10119418 | Ga0070691_101194182 | 77 |
| 188 | 3300005341 | Ga0070691_10837424 | Ga0070691_108374242 | 77 |
| 189 | 3300005343 | Ga0070687_100045504 | Ga0070687_1000455042 | 77 |
| 190 | 3300005343 | Ga0070687_100263442 | Ga0070687_1002634422 | 77 |
| 191 | 3300005343 | Ga0070687_100863039 | Ga0070687_1008630392 | 77 |
| 192 | 3300005344 | Ga0070661_100317573 | Ga0070661_1003175731 | 77 |
| 193 | 3300005345 | Ga0070692_10090763 | Ga0070692_100907632 | 77 |
| 194 | 3300005345 | Ga0070692_10481120 | Ga0070692_104811201 | 77 |
| 195 | 3300005347 | Ga0070668_100507403 | Ga0070668_1005074032 | 77 |
| 196 | 3300005353 | Ga0070669_100113141 | Ga0070669_1001131413 | 77 |
| 197 | 3300005354 | Ga0070675_100004208 | Ga0070675_1000042086 | 77 |
| 198 | 3300005354 | Ga0070675_101290541 | Ga0070675_1012905412 | 77 |
| 199 | 3300005355 | Ga0070671_100001993 | Ga0070671_1000019933 | 77 |
| 200 | 3300005355 | Ga0070671_100597275 | Ga0070671_1005972752 | 77 |
| 201 | 3300005356 | Ga0070674_100356443 | Ga0070674_1003564431 | 77 |
| 202 | 3300005356 | Ga0070674_101189748 | Ga0070674_1011897482 | 77 |
| 203 | 3300005364 | Ga0070673_100004884 | Ga0070673_1000048845 | 77 |
| 204 | 3300005364 | Ga0070673_100581137 | Ga0070673_1005811371 | 77 |
| 205 | 3300005365 | Ga0070688_100112668 | Ga0070688_1001126682 | 77 |
| 206 | 3300005366 | Ga0070659_100002405 | Ga0070659_10000240516 | 77 |
| 207 | 3300005366 | Ga0070659_100020513 | Ga0070659_1000205135 | 77 |
| 208 | 3300005366 | Ga0070659_100275939 | Ga0070659_1002759392 | 77 |
| 209 | 3300005367 | Ga0070667_101137246 | Ga0070667_1011372462 | 77 |
| 210 | 3300005367 | Ga0070667_101195776 | Ga0070667_1011957762 | 77 |
| 211 | 3300005434 | Ga0070709_10014255 | Ga0070709_100142556 | 77 |
| 212 | 3300005434 | Ga0070709_11216682 | Ga0070709_112166821 | 77 |
| 213 | 3300005435 | Ga0070714_100009390 | Ga0070714_1000093902 | 77 |
| 214 | 3300005435 | Ga0070714_100016298 | Ga0070714_1000162983 | 77 |
| 215 | 3300005435 | Ga0070714_100019750 | Ga0070714_1000197502 | 77 |
| 216 | 3300005435 | Ga0070714_101612938 | Ga0070714_1016129382 | 77 |
| 217 | 3300005436 | Ga0070713_100006832 | Ga0070713_1000068329 | 77 |
| 218 | 3300005436 | Ga0070713_100143478 | Ga0070713_1001434782 | 77 |
| 219 | 3300005436 | Ga0070713_100375319 | Ga0070713_1003753193 | 77 |
| 220 | 3300005436 | Ga0070713_101042885 | Ga0070713_1010428852 | 77 |
| 221 | 3300005437 | Ga0070710_10113375 | Ga0070710_101133752 | 77 |
| 222 | 3300005437 | Ga0070710_10831655 | Ga0070710_108316551 | 77 |
| 223 | 3300005438 | Ga0070701_10130586 | Ga0070701_101305862 | 77 |
| 224 | 3300005438 | Ga0070701_10293836 | Ga0070701_102938362 | 77 |
| 225 | 3300005439 | Ga0070711_100001086 | Ga0070711_10000108612 | 77 |
| 226 | 3300005439 | Ga0070711_100201208 | Ga0070711_1002012082 | 77 |
| 227 | 3300005440 | Ga0070705_100097124 | Ga0070705_1000971242 | 77 |
| 228 | 3300005444 | Ga0070694_101919948 | Ga0070694_1019199481 | 77 |
| 229 | 3300005445 | Ga0070708_100006735 | Ga0070708_1000067352 | 77 |
| 230 | 3300005445 | Ga0070708_100098106 | Ga0070708_1000981063 | 77 |
| 231 | 3300005445 | Ga0070708_100133949 | Ga0070708_1001339491 | 77 |
| 232 | 3300005445 | Ga0070708_100272583 | Ga0070708_1002725832 | 77 |
| 233 | 3300005445 | Ga0070708_101302768 | Ga0070708_1013027682 | 77 |
| 234 | 3300005455 | Ga0070663_100082281 | Ga0070663_1000822813 | 77 |
| 235 | 3300005455 | Ga0070663_100756894 | Ga0070663_1007568942 | 77 |
| 236 | 3300005456 | Ga0070678_100001267 | Ga0070678_10000126715 | 77 |
| 237 | 3300005456 | Ga0070678_100626753 | Ga0070678_1006267532 | 77 |
| 238 | 3300005456 | Ga0070678_100975294 | Ga0070678_1009752941 | 77 |
| 239 | 3300005456 | Ga0070678_101950197 | Ga0070678_1019501971 | 77 |
| 240 | 3300005457 | Ga0070662_100007273 | Ga0070662_1000072733 | 77 |
| 241 | 3300005457 | Ga0070662_101328954 | Ga0070662_1013289541 | 77 |
| 242 | 3300005458 | Ga0070681_10000046 | Ga0070681_1000004674 | 77 |
| 243 | 3300005458 | Ga0070681_10002542 | Ga0070681_100025421 | 77 |
| 244 | 3300005458 | Ga0070681_10059510 | Ga0070681_100595103 | 77 |
| 245 | 3300005458 | Ga0070681_10798072 | Ga0070681_107980722 | 77 |
| 246 | 3300005458 | Ga0070681_10863061 | Ga0070681_108630612 | 77 |
| 247 | 3300005459 | Ga0068867_100011982 | Ga0068867_1000119824 | 77 |
| 248 | 3300005459 | Ga0068867_100083090 | Ga0068867_1000830902 | 77 |
| 249 | 3300005459 | Ga0068867_100795119 | Ga0068867_1007951192 | 77 |
| 250 | 3300005459 | Ga0068867_101692293 | Ga0068867_1016922932 | 77 |
| 251 | 3300005467 | Ga0070706_100003607 | Ga0070706_10000360713 | 77 |
| 252 | 3300005467 | Ga0070706_100003790 | Ga0070706_1000037907 | 77 |
| 253 | 3300005467 | Ga0070706_100010869 | Ga0070706_10001086911 | 77 |
| 254 | 3300005467 | Ga0070706_100050423 | Ga0070706_1000504235 | 77 |
| 255 | 3300005467 | Ga0070706_100254086 | Ga0070706_1002540862 | 77 |
| 256 | 3300005467 | Ga0070706_100277831 | Ga0070706_1002778313 | 77 |
| 257 | 3300005468 | Ga0070707_100003265 | Ga0070707_1000032652 | 77 |
| 258 | 3300005468 | Ga0070707_100005057 | Ga0070707_1000050573 | 77 |
| 259 | 3300005468 | Ga0070707_100008692 | Ga0070707_1000086926 | 77 |
| 260 | 3300005468 | Ga0070707_100084153 | Ga0070707_1000841533 | 77 |
| 261 | 3300005468 | Ga0070707_100463351 | Ga0070707_1004633513 | 77 |
| 262 | 3300005468 | Ga0070707_100540171 | Ga0070707_1005401712 | 77 |
| 263 | 3300005471 | Ga0070698_100001113 | Ga0070698_1000011136 | 77 |
| 264 | 3300005471 | Ga0070698_100028531 | Ga0070698_1000285315 | 77 |
| 265 | 3300005471 | Ga0070698_100031028 | Ga0070698_1000310284 | 77 |
| 266 | 3300005471 | Ga0070698_100060083 | Ga0070698_1000600832 | 77 |
| 267 | 3300005471 | Ga0070698_100522246 | Ga0070698_1005222461 | 77 |
| 268 | 3300005471 | Ga0070698_101312455 | Ga0070698_1013124552 | 77 |
| 269 | 3300005471 | Ga0070698_101435958 | Ga0070698_1014359582 | 77 |
| 270 | 3300005518 | Ga0070699_100145208 | Ga0070699_1001452083 | 77 |
| 271 | 3300005530 | Ga0070679_100001623 | Ga0070679_10000162311 | 77 |
| 272 | 3300005530 | Ga0070679_100007199 | Ga0070679_10000719914 | 77 |
| 273 | 3300005530 | Ga0070679_100025362 | Ga0070679_1000253626 | 77 |
| 274 | 3300005530 | Ga0070679_100067238 | Ga0070679_1000672386 | 77 |
| 275 | 3300005530 | Ga0070679_100069299 | Ga0070679_1000692993 | 77 |
| 276 | 3300005530 | Ga0070679_100411525 | Ga0070679_1004115251 | 77 |
| 277 | 3300005530 | Ga0070679_101109460 | Ga0070679_1011094602 | 77 |
| 278 | 3300005530 | Ga0070679_102148866 | Ga0070679_1021488661 | 77 |
| 279 | 3300005535 | Ga0070684_100003597 | Ga0070684_1000035975 | 77 |
| 280 | 3300005535 | Ga0070684_100232644 | Ga0070684_1002326443 | 77 |
| 281 | 3300005535 | Ga0070684_101741503 | Ga0070684_1017415031 | 77 |
| 282 | 3300005536 | Ga0070697_100024673 | Ga0070697_1000246732 | 77 |
| 283 | 3300005536 | Ga0070697_100044501 | Ga0070697_1000445012 | 77 |
| 284 | 3300005539 | Ga0068853_100029100 | Ga0068853_1000291007 | 77 |
| 285 | 3300005539 | Ga0068853_100291323 | Ga0068853_1002913232 | 77 |
| 286 | 3300005539 | Ga0068853_101725594 | Ga0068853_1017255941 | 77 |
| 287 | 3300005543 | Ga0070672_101928585 | Ga0070672_1019285852 | 77 |
| 288 | 3300005544 | Ga0070686_100100101 | Ga0070686_1001001012 | 77 |
| 289 | 3300005544 | Ga0070686_100288427 | Ga0070686_1002884272 | 77 |
| 290 | 3300005545 | Ga0070695_100091599 | Ga0070695_1000915993 | 77 |
| 291 | 3300005547 | Ga0070693_100795504 | Ga0070693_1007955042 | 77 |
| 292 | 3300005548 | Ga0070665_100021695 | Ga0070665_1000216956 | 77 |
| 293 | 3300005548 | Ga0070665_100436018 | Ga0070665_1004360183 | 77 |
| 294 | 3300005548 | Ga0070665_101111229 | Ga0070665_1011112291 | 77 |
| 295 | 3300005549 | Ga0070704_100032625 | Ga0070704_1000326253 | 77 |
| 296 | 3300005563 | Ga0068855_100333298 | Ga0068855_1003332981 | 77 |
| 297 | 3300005563 | Ga0068855_100731405 | Ga0068855_1007314053 | 77 |
| 298 | 3300005563 | Ga0068855_101175757 | Ga0068855_1011757572 | 77 |
| 299 | 3300005563 | Ga0068855_101484090 | Ga0068855_1014840901 | 77 |
| 300 | 3300005563 | Ga0068855_102140500 | Ga0068855_1021405002 | 77 |
| 301 | 3300005564 | Ga0070664_101305891 | Ga0070664_1013058912 | 77 |
| 302 | 3300005578 | Ga0068854_100042731 | Ga0068854_1000427313 | 77 |
| 303 | 3300005578 | Ga0068854_100589408 | Ga0068854_1005894081 | 77 |
| 304 | 3300005578 | Ga0068854_101917209 | Ga0068854_1019172092 | 77 |
| 305 | 3300005614 | Ga0068856_100005097 | Ga0068856_1000050978 | 77 |
| 306 | 3300005614 | Ga0068856_100057717 | Ga0068856_1000577174 | 77 |
| 307 | 3300005614 | Ga0068856_101808229 | Ga0068856_1018082292 | 77 |
| 308 | 3300005615 | Ga0070702_100004225 | Ga0070702_1000042253 | 77 |
| 309 | 3300005615 | Ga0070702_100080927 | Ga0070702_1000809272 | 77 |
| 310 | 3300005615 | Ga0070702_100313064 | Ga0070702_1003130642 | 77 |
| 311 | 3300005616 | Ga0068852_100656752 | Ga0068852_1006567522 | 77 |
| 312 | 3300005617 | Ga0068859_100103322 | Ga0068859_1001033224 | 77 |
| 313 | 3300005617 | Ga0068859_100743162 | Ga0068859_1007431621 | 77 |
| 314 | 3300005618 | Ga0068864_100150583 | Ga0068864_1001505832 | 77 |
| 315 | 3300005719 | Ga0068861_100856385 | Ga0068861_1008563851 | 77 |
| 316 | 3300005719 | Ga0068861_101805216 | Ga0068861_1018052162 | 77 |
| 317 | 3300005834 | Ga0068851_10004867 | Ga0068851_100048674 | 77 |
| 318 | 3300005840 | Ga0068870_10000527 | Ga0068870_100005275 | 77 |
| 319 | 3300005840 | Ga0068870_10383754 | Ga0068870_103837542 | 77 |
| 320 | 3300005841 | Ga0068863_100551384 | Ga0068863_1005513842 | 77 |
| 321 | 3300005843 | Ga0068860_100011881 | Ga0068860_1000118814 | 77 |
| 322 | 3300005843 | Ga0068860_100382222 | Ga0068860_1003822222 | 77 |
| 323 | 3300005844 | Ga0068862_101638029 | Ga0068862_1016380292 | 77 |
| 324 | 3300005937 | Ga0081455_10043358 | Ga0081455_100433582 | 77 |
| 325 | 3300005937 | Ga0081455_10117743 | Ga0081455_101177432 | 77 |
| 326 | 3300005937 | Ga0081455_10119826 | Ga0081455_101198262 | 77 |
| 327 | 3300005981 | Ga0081538_10002364 | Ga0081538_1000236412 | 77 |
| 328 | 3300005981 | Ga0081538_10005374 | Ga0081538_1000537412 | 77 |
| 329 | 3300005981 | Ga0081538_10007077 | Ga0081538_1000707711 | 77 |
| 330 | 3300005981 | Ga0081538_10081668 | Ga0081538_100816682 | 77 |
| 331 | 3300005983 | Ga0081540_1030633 | Ga0081540_10306332 | 77 |
| 332 | 3300005985 | Ga0081539_10003373 | Ga0081539_100033739 | 77 |
| 333 | 3300005985 | Ga0081539_10027511 | Ga0081539_100275115 | 77 |
| 334 | 3300005985 | Ga0081539_10108528 | Ga0081539_101085283 | 77 |
| 335 | 3300005985 | Ga0081539_10133968 | Ga0081539_101339682 | 77 |
| 336 | 3300005985 | Ga0081539_10285595 | Ga0081539_102855951 | 77 |
| 337 | 3300006028 | Ga0070717_10001330 | Ga0070717_100013302 | 77 |
| 338 | 3300006028 | Ga0070717_10127505 | Ga0070717_101275052 | 77 |
| 339 | 3300006028 | Ga0070717_10244269 | Ga0070717_102442692 | 77 |
| 340 | 3300006038 | Ga0075365_10116531 | Ga0075365_101165312 | 77 |
| 341 | 3300006042 | Ga0075368_10016793 | Ga0075368_100167932 | 77 |
| 342 | 3300006048 | Ga0075363_100004041 | Ga0075363_1000040412 | 77 |
| 343 | 3300006048 | Ga0075363_100049434 | Ga0075363_1000494343 | 77 |
| 344 | 3300006058 | Ga0075432_10006062 | Ga0075432_100060624 | 77 |
| 345 | 3300006163 | Ga0070715_10041515 | Ga0070715_100415151 | 77 |
| 346 | 3300006173 | Ga0070716_100030422 | Ga0070716_1000304221 | 77 |
| 347 | 3300006173 | Ga0070716_100193030 | Ga0070716_1001930302 | 77 |
| 348 | 3300006173 | Ga0070716_100598449 | Ga0070716_1005984492 | 77 |
| 349 | 3300006175 | Ga0070712_100011977 | Ga0070712_1000119772 | 77 |
| 350 | 3300006175 | Ga0070712_100187544 | Ga0070712_1001875442 | 77 |
| 351 | 3300006175 | Ga0070712_100400537 | Ga0070712_1004005372 | 77 |
| 352 | 3300006175 | Ga0070712_101759396 | Ga0070712_1017593962 | 77 |
| 353 | 3300006178 | Ga0075367_10133995 | Ga0075367_101339951 | 77 |
| 354 | 3300006186 | Ga0075369_10096581 | Ga0075369_100965812 | 77 |
| 355 | 3300006194 | Ga0075427_10054111 | Ga0075427_100541112 | 77 |
| 356 | 3300006237 | Ga0097621_101583515 | Ga0097621_1015835152 | 77 |
| 357 | 3300006353 | Ga0075370_10589045 | Ga0075370_105890452 | 77 |
| 358 | 3300006358 | Ga0068871_100564435 | Ga0068871_1005644352 | 77 |
| 359 | 3300006358 | Ga0068871_101251433 | Ga0068871_1012514332 | 77 |
| 360 | 3300006844 | Ga0075428_100269707 | Ga0075428_1002697072 | 77 |
| 361 | 3300006844 | Ga0075428_102123594 | Ga0075428_1021235942 | 77 |
| 362 | 3300006846 | Ga0075430_100120579 | Ga0075430_1001205792 | 77 |
| 363 | 3300006846 | Ga0075430_101445355 | Ga0075430_1014453552 | 77 |
| 364 | 3300006847 | Ga0075431_100251599 | Ga0075431_1002515991 | 77 |
| 365 | 3300006847 | Ga0075431_101037325 | Ga0075431_1010373252 | 77 |
| 366 | 3300006852 | Ga0075433_10117521 | Ga0075433_101175212 | 77 |
| 367 | 3300006852 | Ga0075433_10131394 | Ga0075433_101313943 | 77 |
| 368 | 3300006852 | Ga0075433_10225470 | Ga0075433_102254702 | 77 |
| 369 | 3300006852 | Ga0075433_11444570 | Ga0075433_114445701 | 77 |
| 370 | 3300006871 | Ga0075434_100087552 | Ga0075434_1000875524 | 77 |
| 371 | 3300006871 | Ga0075434_100613869 | Ga0075434_1006138692 | 77 |
| 372 | 3300006880 | Ga0075429_100035629 | Ga0075429_1000356295 | 77 |
| 373 | 3300006880 | Ga0075429_100796680 | Ga0075429_1007966802 | 77 |
| 374 | 3300006880 | Ga0075429_100901602 | Ga0075429_1009016022 | 77 |
| 375 | 3300006881 | Ga0068865_100015369 | Ga0068865_1000153697 | 77 |
| 376 | 3300006881 | Ga0068865_100792231 | Ga0068865_1007922312 | 77 |
| 377 | 3300006914 | Ga0075436_100006077 | Ga0075436_1000060779 | 77 |
| 378 | 3300006914 | Ga0075436_100309015 | Ga0075436_1003090152 | 77 |
| 379 | 3300006914 | Ga0075436_100572094 | Ga0075436_1005720943 | 77 |
| 380 | 3300006931 | Ga0097620_100103333 | Ga0097620_1001033334 | 77 |
| 381 | 3300006931 | Ga0097620_100743018 | Ga0097620_1007430181 | 77 |
| 382 | 3300007076 | Ga0075435_100022736 | Ga0075435_1000227364 | 77 |
| 383 | 3300009011 | Ga0105251_10009941 | Ga0105251_100099412 | 77 |
| 384 | 3300009011 | Ga0105251_10067454 | Ga0105251_100674542 | 77 |
| 385 | 3300009011 | Ga0105251_10375366 | Ga0105251_103753662 | 77 |
| 386 | 3300009036 | Ga0105244_10029526 | Ga0105244_100295263 | 77 |
| 387 | 3300009036 | Ga0105244_10506751 | Ga0105244_105067512 | 77 |
| 388 | 3300009092 | Ga0105250_10113357 | Ga0105250_101133572 | 77 |
| 389 | 3300009093 | Ga0105240_10032907 | Ga0105240_100329077 | 77 |
| 390 | 3300009093 | Ga0105240_10181039 | Ga0105240_101810392 | 77 |
| 391 | 3300009093 | Ga0105240_10319795 | Ga0105240_103197952 | 77 |
| 392 | 3300009093 | Ga0105240_11006790 | Ga0105240_110067902 | 77 |
| 393 | 3300009094 | Ga0111539_10017829 | Ga0111539_100178296 | 77 |
| 394 | 3300009094 | Ga0111539_10059096 | Ga0111539_100590966 | 77 |
| 395 | 3300009098 | Ga0105245_10017915 | Ga0105245_100179152 | 77 |
| 396 | 3300009098 | Ga0105245_10060270 | Ga0105245_100602703 | 77 |
| 397 | 3300009098 | Ga0105245_10179536 | Ga0105245_101795364 | 77 |
| 398 | 3300009098 | Ga0105245_10371275 | Ga0105245_103712751 | 77 |
| 399 | 3300009098 | Ga0105245_10488273 | Ga0105245_104882731 | 77 |
| 400 | 3300009098 | Ga0105245_10818897 | Ga0105245_108188972 | 77 |
| 401 | 3300009098 | Ga0105245_11197458 | Ga0105245_111974582 | 77 |
| 402 | 3300009098 | Ga0105245_11419024 | Ga0105245_114190241 | 77 |
| 403 | 3300009098 | Ga0105245_11457142 | Ga0105245_114571421 | 77 |
| 404 | 3300009098 | Ga0105245_12326789 | Ga0105245_123267892 | 77 |
| 405 | 3300009098 | Ga0105245_12886651 | Ga0105245_128866512 | 77 |
| 406 | 3300009098 | Ga0105245_13238202 | Ga0105245_132382022 | 77 |
| 407 | 3300009101 | Ga0105247_10027969 | Ga0105247_100279694 | 77 |
| 408 | 3300009147 | Ga0114129_10254651 | Ga0114129_102546513 | 77 |
| 409 | 3300009147 | Ga0114129_10919485 | Ga0114129_109194852 | 77 |
| 410 | 3300009148 | Ga0105243_10003463 | Ga0105243_100034635 | 77 |
| 411 | 3300009148 | Ga0105243_10090981 | Ga0105243_100909812 | 77 |
| 412 | 3300009148 | Ga0105243_10307892 | Ga0105243_103078923 | 77 |
| 413 | 3300009148 | Ga0105243_11422868 | Ga0105243_114228681 | 77 |
| 414 | 3300009148 | Ga0105243_12176516 | Ga0105243_121765162 | 77 |
| 415 | 3300009174 | Ga0105241_10030071 | Ga0105241_100300712 | 77 |
| 416 | 3300009174 | Ga0105241_11064862 | Ga0105241_110648621 | 77 |
| 417 | 3300009174 | Ga0105241_12327124 | Ga0105241_123271241 | 77 |
| 418 | 3300009174 | Ga0105241_12494513 | Ga0105241_124945131 | 77 |
| 419 | 3300009176 | Ga0105242_10002867 | Ga0105242_1000286711 | 77 |
| 420 | 3300009176 | Ga0105242_10008779 | Ga0105242_100087797 | 77 |
| 421 | 3300009176 | Ga0105242_10035559 | Ga0105242_100355595 | 77 |
| 422 | 3300009176 | Ga0105242_10195487 | Ga0105242_101954872 | 77 |
| 423 | 3300009176 | Ga0105242_10474130 | Ga0105242_104741302 | 77 |
| 424 | 3300009176 | Ga0105242_10510739 | Ga0105242_105107392 | 77 |
| 425 | 3300009176 | Ga0105242_10753568 | Ga0105242_107535682 | 77 |
| 426 | 3300009176 | Ga0105242_10833574 | Ga0105242_108335742 | 77 |
| 427 | 3300009176 | Ga0105242_11143954 | Ga0105242_111439541 | 77 |
| 428 | 3300009176 | Ga0105242_11424747 | Ga0105242_114247472 | 77 |
| 429 | 3300009177 | Ga0105248_10003481 | Ga0105248_1000348113 | 77 |
| 430 | 3300009177 | Ga0105248_10093019 | Ga0105248_100930194 | 77 |
| 431 | 3300009177 | Ga0105248_12085505 | Ga0105248_120855052 | 77 |
| 432 | 3300009545 | Ga0105237_10078772 | Ga0105237_100787724 | 77 |
| 433 | 3300009545 | Ga0105237_10631744 | Ga0105237_106317442 | 77 |
| 434 | 3300009545 | Ga0105237_10662312 | Ga0105237_106623122 | 77 |
| 435 | 3300009545 | Ga0105237_11697000 | Ga0105237_116970001 | 77 |
| 436 | 3300009551 | Ga0105238_10078051 | Ga0105238_100780512 | 77 |
| 437 | 3300009551 | Ga0105238_11024704 | Ga0105238_110247042 | 77 |
| 438 | 3300009551 | Ga0105238_12498524 | Ga0105238_124985241 | 77 |
| 439 | 3300009553 | Ga0105249_11188012 | Ga0105249_111880122 | 77 |
| 440 | 3300009553 | Ga0105249_12223255 | Ga0105249_122232552 | 77 |
| 441 | 3300009553 | Ga0105249_12338792 | Ga0105249_123387921 | 77 |
| 442 | 3300010375 | Ga0105239_10084743 | Ga0105239_100847434 | 77 |
| 443 | 3300010375 | Ga0105239_10373470 | Ga0105239_103734702 | 77 |
| 444 | 3300010375 | Ga0105239_10614933 | Ga0105239_106149332 | 77 |
| 445 | 3300010375 | Ga0105239_10641253 | Ga0105239_106412533 | 77 |
| 446 | 3300010375 | Ga0105239_10643461 | Ga0105239_106434612 | 77 |
| 447 | 3300010375 | Ga0105239_10728044 | Ga0105239_107280441 | 77 |
| 448 | 3300010375 | Ga0105239_11134548 | Ga0105239_111345483 | 77 |
| 449 | 3300010375 | Ga0105239_11586667 | Ga0105239_115866672 | 77 |
| 450 | 3300010375 | Ga0105239_13111694 | Ga0105239_131116942 | 77 |
| 451 | 3300011119 | Ga0105246_10000043 | Ga0105246_1000004334 | 77 |
| 452 | 3300011119 | Ga0105246_10031384 | Ga0105246_100313844 | 77 |
| 453 | 3300011119 | Ga0105246_10041465 | Ga0105246_100414654 | 77 |
| 454 | 3300011119 | Ga0105246_10466383 | Ga0105246_104663832 | 77 |
| 455 | 3300011119 | Ga0105246_11055673 | Ga0105246_110556731 | 77 |
| 456 | 3300012475 | Ga0157317_1017853 | Ga0157317_10178532 | 77 |
| 457 | 3300012497 | Ga0157319_1033671 | Ga0157319_10336711 | 77 |
| 458 | 3300012498 | Ga0157345_1031719 | Ga0157345_10317191 | 77 |
| 459 | 3300012503 | Ga0157313_1002065 | Ga0157313_10020653 | 77 |
| 460 | 3300012506 | Ga0157324_1008608 | Ga0157324_10086082 | 77 |
| 461 | 3300012512 | Ga0157327_1042893 | Ga0157327_10428932 | 77 |
| 462 | 3300013100 | Ga0157373_10053758 | Ga0157373_100537584 | 77 |
| 463 | 3300013100 | Ga0157373_10336419 | Ga0157373_103364192 | 77 |
| 464 | 3300013100 | Ga0157373_10565652 | Ga0157373_105656522 | 77 |
| 465 | 3300013100 | Ga0157373_10977254 | Ga0157373_109772542 | 77 |
| 466 | 3300013100 | Ga0157373_11356028 | Ga0157373_113560281 | 77 |
| 467 | 3300013102 | Ga0157371_10017120 | Ga0157371_100171206 | 77 |
| 468 | 3300013102 | Ga0157371_10080787 | Ga0157371_100807871 | 77 |
| 469 | 3300013102 | Ga0157371_10571147 | Ga0157371_105711472 | 77 |
| 470 | 3300013102 | Ga0157371_10842869 | Ga0157371_108428692 | 77 |
| 471 | 3300013102 | Ga0157371_10943151 | Ga0157371_109431511 | 77 |
| 472 | 3300013104 | Ga0157370_10067578 | Ga0157370_100675784 | 77 |
| 473 | 3300013104 | Ga0157370_10117335 | Ga0157370_101173352 | 77 |
| 474 | 3300013104 | Ga0157370_10420426 | Ga0157370_104204262 | 77 |
| 475 | 3300013104 | Ga0157370_10926837 | Ga0157370_109268371 | 77 |
| 476 | 3300013105 | Ga0157369_10000870 | Ga0157369_1000087020 | 77 |
| 477 | 3300013105 | Ga0157369_10054557 | Ga0157369_100545572 | 77 |
| 478 | 3300013105 | Ga0157369_10102442 | Ga0157369_101024422 | 77 |
| 479 | 3300013105 | Ga0157369_10227184 | Ga0157369_102271842 | 77 |
| 480 | 3300013105 | Ga0157369_10241307 | Ga0157369_102413072 | 77 |
| 481 | 3300013105 | Ga0157369_10973780 | Ga0157369_109737803 | 77 |
| 482 | 3300013105 | Ga0157369_11735141 | Ga0157369_117351411 | 77 |
| 483 | 3300013105 | Ga0157369_11823400 | Ga0157369_118234001 | 77 |
| 484 | 3300013105 | Ga0157369_12471059 | Ga0157369_124710591 | 77 |
| 485 | 3300013296 | Ga0157374_10017768 | Ga0157374_100177683 | 77 |
| 486 | 3300013296 | Ga0157374_10027093 | Ga0157374_100270932 | 77 |
| 487 | 3300013296 | Ga0157374_10093890 | Ga0157374_100938902 | 77 |
| 488 | 3300013296 | Ga0157374_10229907 | Ga0157374_102299072 | 77 |
| 489 | 3300013296 | Ga0157374_10599384 | Ga0157374_105993842 | 77 |
| 490 | 3300013296 | Ga0157374_11584229 | Ga0157374_115842291 | 77 |
| 491 | 3300013296 | Ga0157374_12416973 | Ga0157374_124169731 | 77 |
| 492 | 3300013297 | Ga0157378_11041478 | Ga0157378_110414782 | 77 |
| 493 | 3300013297 | Ga0157378_11186342 | Ga0157378_111863422 | 77 |
| 494 | 3300013297 | Ga0157378_12061621 | Ga0157378_120616212 | 77 |
| 495 | 3300013297 | Ga0157378_13112107 | Ga0157378_131121071 | 77 |
| 496 | 3300013306 | Ga0163162_10055426 | Ga0163162_100554263 | 77 |
| 497 | 3300013306 | Ga0163162_10332005 | Ga0163162_103320052 | 77 |
| 498 | 3300013306 | Ga0163162_11132157 | Ga0163162_111321572 | 77 |
| 499 | 3300013306 | Ga0163162_11541457 | Ga0163162_115414571 | 77 |
| 500 | 3300013307 | Ga0157372_10224670 | Ga0157372_102246704 | 77 |
| 501 | 3300013307 | Ga0157372_10346837 | Ga0157372_103468372 | 77 |
| 502 | 3300013307 | Ga0157372_10703483 | Ga0157372_107034832 | 77 |
| 503 | 3300013307 | Ga0157372_11411986 | Ga0157372_114119862 | 77 |
| 504 | 3300013307 | Ga0157372_13086784 | Ga0157372_130867842 | 77 |
| 505 | 3300013308 | Ga0157375_10015233 | Ga0157375_100152333 | 77 |
| 506 | 3300013308 | Ga0157375_11332668 | Ga0157375_113326682 | 77 |
| 507 | 3300013308 | Ga0157375_11986119 | Ga0157375_119861191 | 77 |
| 508 | 3300014325 | Ga0163163_10058272 | Ga0163163_100582725 | 77 |
| 509 | 3300014325 | Ga0163163_10616569 | Ga0163163_106165692 | 77 |
| 510 | 3300014325 | Ga0163163_10654633 | Ga0163163_106546332 | 77 |
| 511 | 3300014325 | Ga0163163_10712683 | Ga0163163_107126833 | 77 |
| 512 | 3300014326 | Ga0157380_10356865 | Ga0157380_103568652 | 77 |
| 513 | 3300014497 | Ga0182008_10000253 | Ga0182008_1000025344 | 77 |
| 514 | 3300014497 | Ga0182008_10225902 | Ga0182008_102259022 | 77 |
| 515 | 3300014745 | Ga0157377_10124756 | Ga0157377_101247561 | 77 |
| 516 | 3300014745 | Ga0157377_10166097 | Ga0157377_101660972 | 77 |
| 517 | 3300014745 | Ga0157377_10618015 | Ga0157377_106180151 | 77 |
| 518 | 3300014745 | Ga0157377_11273819 | Ga0157377_112738192 | 77 |
| 519 | 3300014968 | Ga0157379_10007721 | Ga0157379_1000772111 | 77 |
| 520 | 3300014968 | Ga0157379_10041025 | Ga0157379_100410254 | 77 |
| 521 | 3300014968 | Ga0157379_11734809 | Ga0157379_117348092 | 77 |
| 522 | 3300014969 | Ga0157376_10190203 | Ga0157376_101902032 | 77 |
| 523 | 3300014969 | Ga0157376_11333464 | Ga0157376_113334641 | 77 |
| 524 | 3300015262 | Ga0182007_10000295 | Ga0182007_100002952 | 77 |
| 525 | 3300015265 | Ga0182005_1015457 | Ga0182005_10154572 | 77 |
| 526 | 3300015688 | Ga0183367_1013 | Ga0183367_1013147 | 77 |
| 527 | 3300017792 | Ga0163161_10037148 | Ga0163161_100371483 | 77 |
| 528 | 3300017792 | Ga0163161_10378022 | Ga0163161_103780222 | 77 |
| 529 | 3300020069 | Ga0197907_11056749 | Ga0197907_110567492 | 77 |
| 530 | 3300020069 | Ga0197907_11151097 | Ga0197907_111510971 | 77 |
| 531 | 3300020069 | Ga0197907_11496031 | Ga0197907_114960311 | 77 |
| 532 | 3300020070 | Ga0206356_10780096 | Ga0206356_107800961 | 77 |
| 533 | 3300020077 | Ga0206351_10456640 | Ga0206351_104566401 | 77 |
| 534 | 3300020077 | Ga0206351_10506274 | Ga0206351_105062741 | 77 |
| 535 | 3300020078 | Ga0206352_10837226 | Ga0206352_108372262 | 77 |
| 536 | 3300020080 | Ga0206350_10519492 | Ga0206350_105194922 | 77 |
| 537 | 3300020081 | Ga0206354_10849213 | Ga0206354_108492134 | 77 |
| 538 | 3300020081 | Ga0206354_11155629 | Ga0206354_111556292 | 77 |
| 539 | 3300020081 | Ga0206354_11532524 | Ga0206354_115325241 | 77 |
| 540 | 3300020082 | Ga0206353_10486774 | Ga0206353_104867742 | 77 |
| 541 | 3300020082 | Ga0206353_10633777 | Ga0206353_106337772 | 77 |
| 542 | 3300020082 | Ga0206353_11701529 | Ga0206353_117015291 | 77 |
| 543 | 3300020610 | Ga0154015_1302778 | Ga0154015_13027781 | 77 |
| 544 | 3300020610 | Ga0154015_1492505 | Ga0154015_14925052 | 77 |
| 545 | 3300021384 | Ga0213876_10006371 | Ga0213876_100063714 | 77 |
| 546 | 3300021388 | Ga0213875_10496586 | Ga0213875_104965861 | 77 |
| 547 | 3300022467 | Ga0224712_10283858 | Ga0224712_102838582 | 77 |
| 548 | 3300022467 | Ga0224712_10315480 | Ga0224712_103154801 | 77 |
| 549 | 3300022467 | Ga0224712_10492403 | Ga0224712_104924031 | 77 |
| 550 | 3300022467 | Ga0224712_10506072 | Ga0224712_105060721 | 77 |
| 551 | 3300022467 | Ga0224712_10644212 | Ga0224712_106442122 | 77 |
| 552 | 3300025302 | Ga0207426_1003865 | Ga0207426_10038658 | 77 |
| 553 | 3300025321 | Ga0207656_10012144 | Ga0207656_100121444 | 77 |
| 554 | 3300025321 | Ga0207656_10286373 | Ga0207656_102863732 | 77 |
| 555 | 3300025711 | Ga0207696_1129341 | Ga0207696_11293412 | 77 |
| 556 | 3300025898 | Ga0207692_10044802 | Ga0207692_100448022 | 77 |
| 557 | 3300025899 | Ga0207642_10028544 | Ga0207642_100285443 | 77 |
| 558 | 3300025900 | Ga0207710_10047867 | Ga0207710_100478671 | 77 |
| 559 | 3300025901 | Ga0207688_10012469 | Ga0207688_100124692 | 77 |
| 560 | 3300025901 | Ga0207688_10101487 | Ga0207688_101014872 | 77 |
| 561 | 3300025904 | Ga0207647_10037633 | Ga0207647_100376334 | 77 |
| 562 | 3300025904 | Ga0207647_10192034 | Ga0207647_101920342 | 77 |
| 563 | 3300025904 | Ga0207647_10425785 | Ga0207647_104257851 | 77 |
| 564 | 3300025905 | Ga0207685_10006249 | Ga0207685_100062493 | 77 |
| 565 | 3300025906 | Ga0207699_10029683 | Ga0207699_100296831 | 77 |
| 566 | 3300025906 | Ga0207699_10044698 | Ga0207699_100446982 | 77 |
| 567 | 3300025907 | Ga0207645_10026096 | Ga0207645_100260966 | 77 |
| 568 | 3300025908 | Ga0207643_10000255 | Ga0207643_1000025523 | 77 |
| 569 | 3300025908 | Ga0207643_10363098 | Ga0207643_103630982 | 77 |
| 570 | 3300025908 | Ga0207643_10890807 | Ga0207643_108908072 | 77 |
| 571 | 3300025909 | Ga0207705_10002517 | Ga0207705_1000251717 | 77 |
| 572 | 3300025909 | Ga0207705_10017293 | Ga0207705_100172935 | 77 |
| 573 | 3300025909 | Ga0207705_10189930 | Ga0207705_101899302 | 77 |
| 574 | 3300025909 | Ga0207705_10251660 | Ga0207705_102516602 | 77 |
| 575 | 3300025909 | Ga0207705_11118594 | Ga0207705_111185942 | 77 |
| 576 | 3300025910 | Ga0207684_10000844 | Ga0207684_1000084416 | 77 |
| 577 | 3300025910 | Ga0207684_10002346 | Ga0207684_1000234614 | 77 |
| 578 | 3300025910 | Ga0207684_10008439 | Ga0207684_100084393 | 77 |
| 579 | 3300025910 | Ga0207684_10053046 | Ga0207684_100530464 | 77 |
| 580 | 3300025910 | Ga0207684_10123941 | Ga0207684_101239412 | 77 |
| 581 | 3300025911 | Ga0207654_10185165 | Ga0207654_101851652 | 77 |
| 582 | 3300025912 | Ga0207707_10000737 | Ga0207707_1000073728 | 77 |
| 583 | 3300025912 | Ga0207707_10010925 | Ga0207707_100109252 | 77 |
| 584 | 3300025912 | Ga0207707_10315609 | Ga0207707_103156092 | 77 |
| 585 | 3300025912 | Ga0207707_10661816 | Ga0207707_106618162 | 77 |
| 586 | 3300025912 | Ga0207707_10953806 | Ga0207707_109538062 | 77 |
| 587 | 3300025912 | Ga0207707_11030224 | Ga0207707_110302242 | 77 |
| 588 | 3300025913 | Ga0207695_10034116 | Ga0207695_100341163 | 77 |
| 589 | 3300025913 | Ga0207695_10276393 | Ga0207695_102763933 | 77 |
| 590 | 3300025913 | Ga0207695_11256014 | Ga0207695_112560142 | 77 |
| 591 | 3300025914 | Ga0207671_10114753 | Ga0207671_101147532 | 77 |
| 592 | 3300025914 | Ga0207671_10142489 | Ga0207671_101424892 | 77 |
| 593 | 3300025914 | Ga0207671_10412602 | Ga0207671_104126022 | 77 |
| 594 | 3300025915 | Ga0207693_10019809 | Ga0207693_100198095 | 77 |
| 595 | 3300025915 | Ga0207693_10165584 | Ga0207693_101655842 | 77 |
| 596 | 3300025916 | Ga0207663_10021541 | Ga0207663_100215416 | 77 |
| 597 | 3300025916 | Ga0207663_10033418 | Ga0207663_100334183 | 77 |
| 598 | 3300025916 | Ga0207663_10224703 | Ga0207663_102247032 | 77 |
| 599 | 3300025917 | Ga0207660_10001218 | Ga0207660_100012187 | 77 |
| 600 | 3300025917 | Ga0207660_10041213 | Ga0207660_100412134 | 77 |
| 601 | 3300025917 | Ga0207660_10418974 | Ga0207660_104189742 | 77 |
| 602 | 3300025917 | Ga0207660_10818317 | Ga0207660_108183172 | 77 |
| 603 | 3300025917 | Ga0207660_11314426 | Ga0207660_113144261 | 77 |
| 604 | 3300025918 | Ga0207662_10067495 | Ga0207662_100674952 | 77 |
| 605 | 3300025918 | Ga0207662_10144665 | Ga0207662_101446653 | 77 |
| 606 | 3300025918 | Ga0207662_10272767 | Ga0207662_102727672 | 77 |
| 607 | 3300025919 | Ga0207657_10020354 | Ga0207657_100203543 | 77 |
| 608 | 3300025919 | Ga0207657_10046041 | Ga0207657_100460415 | 77 |
| 609 | 3300025919 | Ga0207657_10109524 | Ga0207657_101095242 | 77 |
| 610 | 3300025919 | Ga0207657_10309157 | Ga0207657_103091572 | 77 |
| 611 | 3300025919 | Ga0207657_10666670 | Ga0207657_106666702 | 77 |
| 612 | 3300025919 | Ga0207657_10997148 | Ga0207657_109971481 | 77 |
| 613 | 3300025920 | Ga0207649_10005364 | Ga0207649_100053642 | 77 |
| 614 | 3300025921 | Ga0207652_10000461 | Ga0207652_1000046132 | 77 |
| 615 | 3300025921 | Ga0207652_10028585 | Ga0207652_100285855 | 77 |
| 616 | 3300025921 | Ga0207652_10047136 | Ga0207652_100471363 | 77 |
| 617 | 3300025921 | Ga0207652_10235615 | Ga0207652_102356152 | 77 |
| 618 | 3300025921 | Ga0207652_10261428 | Ga0207652_102614282 | 77 |
| 619 | 3300025921 | Ga0207652_11109790 | Ga0207652_111097902 | 77 |
| 620 | 3300025921 | Ga0207652_11297042 | Ga0207652_112970422 | 77 |
| 621 | 3300025922 | Ga0207646_10000990 | Ga0207646_1000099019 | 77 |
| 622 | 3300025922 | Ga0207646_10009844 | Ga0207646_100098445 | 77 |
| 623 | 3300025922 | Ga0207646_10020576 | Ga0207646_100205767 | 77 |
| 624 | 3300025922 | Ga0207646_10110919 | Ga0207646_101109193 | 77 |
| 625 | 3300025922 | Ga0207646_10273879 | Ga0207646_102738793 | 77 |
| 626 | 3300025923 | Ga0207681_10140457 | Ga0207681_101404572 | 77 |
| 627 | 3300025924 | Ga0207694_10053554 | Ga0207694_100535544 | 77 |
| 628 | 3300025924 | Ga0207694_11790513 | Ga0207694_117905131 | 77 |
| 629 | 3300025925 | Ga0207650_10008935 | Ga0207650_100089358 | 77 |
| 630 | 3300025925 | Ga0207650_11036479 | Ga0207650_110364792 | 77 |
| 631 | 3300025925 | Ga0207650_11850837 | Ga0207650_118508371 | 77 |
| 632 | 3300025926 | Ga0207659_10076266 | Ga0207659_100762662 | 77 |
| 633 | 3300025926 | Ga0207659_10101779 | Ga0207659_101017793 | 77 |
| 634 | 3300025926 | Ga0207659_10272224 | Ga0207659_102722243 | 77 |
| 635 | 3300025927 | Ga0207687_10054509 | Ga0207687_100545093 | 77 |
| 636 | 3300025927 | Ga0207687_10082022 | Ga0207687_100820224 | 77 |
| 637 | 3300025927 | Ga0207687_10089960 | Ga0207687_100899602 | 77 |
| 638 | 3300025927 | Ga0207687_11178823 | Ga0207687_111788232 | 77 |
| 639 | 3300025927 | Ga0207687_11685403 | Ga0207687_116854032 | 77 |
| 640 | 3300025927 | Ga0207687_11881367 | Ga0207687_118813671 | 77 |
| 641 | 3300025928 | Ga0207700_10002007 | Ga0207700_100020072 | 77 |
| 642 | 3300025928 | Ga0207700_10012146 | Ga0207700_100121462 | 77 |
| 643 | 3300025928 | Ga0207700_10111827 | Ga0207700_101118271 | 77 |
| 644 | 3300025928 | Ga0207700_10280663 | Ga0207700_102806632 | 77 |
| 645 | 3300025928 | Ga0207700_10292892 | Ga0207700_102928922 | 77 |
| 646 | 3300025928 | Ga0207700_11980278 | Ga0207700_119802782 | 77 |
| 647 | 3300025929 | Ga0207664_10000722 | Ga0207664_1000072218 | 77 |
| 648 | 3300025929 | Ga0207664_10005405 | Ga0207664_100054052 | 77 |
| 649 | 3300025929 | Ga0207664_10087450 | Ga0207664_100874502 | 77 |
| 650 | 3300025929 | Ga0207664_10254777 | Ga0207664_102547773 | 77 |
| 651 | 3300025929 | Ga0207664_10316678 | Ga0207664_103166782 | 77 |
| 652 | 3300025929 | Ga0207664_11752017 | Ga0207664_117520172 | 77 |
| 653 | 3300025931 | Ga0207644_10010248 | Ga0207644_100102482 | 77 |
| 654 | 3300025931 | Ga0207644_10464129 | Ga0207644_104641292 | 77 |
| 655 | 3300025932 | Ga0207690_10000157 | Ga0207690_100001574 | 77 |
| 656 | 3300025932 | Ga0207690_10027235 | Ga0207690_100272352 | 77 |
| 657 | 3300025932 | Ga0207690_11312936 | Ga0207690_113129362 | 77 |
| 658 | 3300025933 | Ga0207706_10031749 | Ga0207706_100317494 | 77 |
| 659 | 3300025933 | Ga0207706_10179613 | Ga0207706_101796132 | 77 |
| 660 | 3300025933 | Ga0207706_10221032 | Ga0207706_102210322 | 77 |
| 661 | 3300025934 | Ga0207686_10097534 | Ga0207686_100975343 | 77 |
| 662 | 3300025934 | Ga0207686_10173656 | Ga0207686_101736561 | 77 |
| 663 | 3300025934 | Ga0207686_10201462 | Ga0207686_102014623 | 77 |
| 664 | 3300025934 | Ga0207686_10295432 | Ga0207686_102954322 | 77 |
| 665 | 3300025934 | Ga0207686_10693801 | Ga0207686_106938012 | 77 |
| 666 | 3300025935 | Ga0207709_10012443 | Ga0207709_100124439 | 77 |
| 667 | 3300025935 | Ga0207709_10024868 | Ga0207709_100248685 | 77 |
| 668 | 3300025935 | Ga0207709_11762192 | Ga0207709_117621922 | 77 |
| 669 | 3300025936 | Ga0207670_10075697 | Ga0207670_100756974 | 77 |
| 670 | 3300025936 | Ga0207670_11059885 | Ga0207670_110598852 | 77 |
| 671 | 3300025937 | Ga0207669_10115037 | Ga0207669_101150372 | 77 |
| 672 | 3300025937 | Ga0207669_11267313 | Ga0207669_112673131 | 77 |
| 673 | 3300025937 | Ga0207669_11442598 | Ga0207669_114425981 | 77 |
| 674 | 3300025937 | Ga0207669_11540877 | Ga0207669_115408772 | 77 |
| 675 | 3300025938 | Ga0207704_10027324 | Ga0207704_100273243 | 77 |
| 676 | 3300025938 | Ga0207704_10364624 | Ga0207704_103646241 | 77 |
| 677 | 3300025938 | Ga0207704_10656248 | Ga0207704_106562482 | 77 |
| 678 | 3300025938 | Ga0207704_11448080 | Ga0207704_114480801 | 77 |
| 679 | 3300025939 | Ga0207665_10036641 | Ga0207665_100366413 | 77 |
| 680 | 3300025939 | Ga0207665_10673246 | Ga0207665_106732461 | 77 |
| 681 | 3300025939 | Ga0207665_11249280 | Ga0207665_112492801 | 77 |
| 682 | 3300025940 | Ga0207691_10085403 | Ga0207691_100854032 | 77 |
| 683 | 3300025940 | Ga0207691_11418964 | Ga0207691_114189642 | 77 |
| 684 | 3300025941 | Ga0207711_10076181 | Ga0207711_100761815 | 77 |
| 685 | 3300025941 | Ga0207711_10127941 | Ga0207711_101279413 | 77 |
| 686 | 3300025942 | Ga0207689_10001805 | Ga0207689_1000180510 | 77 |
| 687 | 3300025942 | Ga0207689_10098506 | Ga0207689_100985062 | 77 |
| 688 | 3300025942 | Ga0207689_10152879 | Ga0207689_101528793 | 77 |
| 689 | 3300025942 | Ga0207689_10332318 | Ga0207689_103323182 | 77 |
| 690 | 3300025942 | Ga0207689_10916969 | Ga0207689_109169692 | 77 |
| 691 | 3300025944 | Ga0207661_10573680 | Ga0207661_105736803 | 77 |
| 692 | 3300025944 | Ga0207661_10749136 | Ga0207661_107491363 | 77 |
| 693 | 3300025944 | Ga0207661_11047948 | Ga0207661_110479482 | 77 |
| 694 | 3300025944 | Ga0207661_11464208 | Ga0207661_114642081 | 77 |
| 695 | 3300025945 | Ga0207679_10007228 | Ga0207679_100072288 | 77 |
| 696 | 3300025945 | Ga0207679_10334475 | Ga0207679_103344752 | 77 |
| 697 | 3300025949 | Ga0207667_10415696 | Ga0207667_104156962 | 77 |
| 698 | 3300025949 | Ga0207667_11105460 | Ga0207667_111054602 | 77 |
| 699 | 3300025949 | Ga0207667_12155100 | Ga0207667_121551001 | 77 |
| 700 | 3300025960 | Ga0207651_10461626 | Ga0207651_104616261 | 77 |
| 701 | 3300025961 | Ga0207712_10289015 | Ga0207712_102890153 | 77 |
| 702 | 3300025961 | Ga0207712_10536035 | Ga0207712_105360351 | 77 |
| 703 | 3300025961 | Ga0207712_11629043 | Ga0207712_116290432 | 77 |
| 704 | 3300025972 | Ga0207668_10544345 | Ga0207668_105443452 | 77 |
| 705 | 3300025972 | Ga0207668_10753516 | Ga0207668_107535162 | 77 |
| 706 | 3300025981 | Ga0207640_10139129 | Ga0207640_101391292 | 77 |
| 707 | 3300025981 | Ga0207640_10377000 | Ga0207640_103770002 | 77 |
| 708 | 3300025981 | Ga0207640_10670966 | Ga0207640_106709662 | 77 |
| 709 | 3300025986 | Ga0207658_11275082 | Ga0207658_112750822 | 77 |
| 710 | 3300026023 | Ga0207677_10112573 | Ga0207677_101125731 | 77 |
| 711 | 3300026023 | Ga0207677_10173635 | Ga0207677_101736353 | 77 |
| 712 | 3300026023 | Ga0207677_10374139 | Ga0207677_103741392 | 77 |
| 713 | 3300026023 | Ga0207677_12198084 | Ga0207677_121980841 | 77 |
| 714 | 3300026035 | Ga0207703_10216285 | Ga0207703_102162853 | 77 |
| 715 | 3300026041 | Ga0207639_10141052 | Ga0207639_101410522 | 77 |
| 716 | 3300026041 | Ga0207639_10202575 | Ga0207639_102025752 | 77 |
| 717 | 3300026041 | Ga0207639_11057010 | Ga0207639_110570102 | 77 |
| 718 | 3300026067 | Ga0207678_10000346 | Ga0207678_1000034619 | 77 |
| 719 | 3300026067 | Ga0207678_10026744 | Ga0207678_100267445 | 77 |
| 720 | 3300026067 | Ga0207678_10811878 | Ga0207678_108118782 | 77 |
| 721 | 3300026067 | Ga0207678_11545765 | Ga0207678_115457652 | 77 |
| 722 | 3300026075 | Ga0207708_10062705 | Ga0207708_100627053 | 77 |
| 723 | 3300026075 | Ga0207708_10884848 | Ga0207708_108848481 | 77 |
| 724 | 3300026078 | Ga0207702_10000631 | Ga0207702_1000063117 | 77 |
| 725 | 3300026078 | Ga0207702_10027378 | Ga0207702_100273783 | 77 |
| 726 | 3300026078 | Ga0207702_10062252 | Ga0207702_100622523 | 77 |
| 727 | 3300026078 | Ga0207702_11313692 | Ga0207702_113136922 | 77 |
| 728 | 3300026078 | Ga0207702_11773658 | Ga0207702_117736582 | 77 |
| 729 | 3300026078 | Ga0207702_12228336 | Ga0207702_122283361 | 77 |
| 730 | 3300026078 | Ga0207702_12315784 | Ga0207702_123157841 | 77 |
| 731 | 3300026088 | Ga0207641_10070634 | Ga0207641_100706342 | 77 |
| 732 | 3300026088 | Ga0207641_11456503 | Ga0207641_114565031 | 77 |
| 733 | 3300026089 | Ga0207648_10003949 | Ga0207648_1000394920 | 77 |
| 734 | 3300026089 | Ga0207648_10007069 | Ga0207648_1000706912 | 77 |
| 735 | 3300026095 | Ga0207676_10001535 | Ga0207676_1000153513 | 77 |
| 736 | 3300026095 | Ga0207676_10087045 | Ga0207676_100870453 | 77 |
| 737 | 3300026116 | Ga0207674_10050592 | Ga0207674_100505926 | 77 |
| 738 | 3300026116 | Ga0207674_11237809 | Ga0207674_112378091 | 77 |
| 739 | 3300026116 | Ga0207674_11698784 | Ga0207674_116987842 | 77 |
| 740 | 3300026118 | Ga0207675_100025855 | Ga0207675_1000258554 | 77 |
| 741 | 3300026121 | Ga0207683_10000342 | Ga0207683_100003423 | 77 |
| 742 | 3300026121 | Ga0207683_10045766 | Ga0207683_100457662 | 77 |
| 743 | 3300026121 | Ga0207683_10858280 | Ga0207683_108582802 | 77 |
| 744 | 3300026142 | Ga0207698_10031800 | Ga0207698_100318001 | 77 |
| 745 | 3300027312 | Ga0209371_1042187 | Ga0209371_10421872 | 77 |
| 746 | 3300027312 | Ga0209371_1054914 | Ga0209371_10549142 | 77 |
| 747 | 3300027866 | Ga0209813_10008344 | Ga0209813_100083442 | 77 |
| 748 | 3300027907 | Ga0207428_10001881 | Ga0207428_1000188117 | 77 |
| 749 | 3300027907 | Ga0207428_10035741 | Ga0207428_100357413 | 77 |
| 750 | 3300028379 | Ga0268266_10006950 | Ga0268266_100069509 | 77 |
| 751 | 3300028379 | Ga0268266_10062053 | Ga0268266_100620532 | 77 |
| 752 | 3300028379 | Ga0268266_10518359 | Ga0268266_105183591 | 77 |
| 753 | 3300028379 | Ga0268266_11227628 | Ga0268266_112276282 | 77 |
| 754 | 3300028379 | Ga0268266_11633878 | Ga0268266_116338782 | 77 |
| 755 | 3300028380 | Ga0268265_10694174 | Ga0268265_106941741 | 77 |
| 756 | 3300028381 | Ga0268264_10403094 | Ga0268264_104030942 | 77 |
| 757 | 3300028381 | Ga0268264_10625715 | Ga0268264_106257152 | 77 |
| 758 | 3300028786 | Ga0307517_10000616 | Ga0307517_1000061643 | 77 |
| 759 | 3300028786 | Ga0307517_10064449 | Ga0307517_100644494 | 77 |
| 760 | 3300028794 | Ga0307515_10000785 | Ga0307515_1000078543 | 77 |
| 761 | 3300028794 | Ga0307515_10079858 | Ga0307515_100798584 | 77 |
| 762 | 3300030500 | Ga0268256_1039230 | Ga0268256_10392302 | 77 |
| 763 | 3300030500 | Ga0268256_1083396 | Ga0268256_10833962 | 77 |
| 764 | 3300030521 | Ga0307511_10001704 | Ga0307511_1000170415 | 77 |
| 765 | 3300030521 | Ga0307511_10070638 | Ga0307511_100706381 | 77 |
| 766 | 3300030521 | Ga0307511_10103443 | Ga0307511_101034432 | 77 |
| 767 | 3300030521 | Ga0307511_10142563 | Ga0307511_101425633 | 77 |
| 768 | 3300030521 | Ga0307511_10145519 | Ga0307511_101455192 | 77 |
| 769 | 3300030522 | Ga0307512_10005071 | Ga0307512_100050714 | 77 |
| 770 | 3300030522 | Ga0307512_10362610 | Ga0307512_103626102 | 77 |
| 771 | 3300030734 | Ga0316179_1085721 | Ga0316179_10857212 | 77 |
| 772 | 3300031090 | Ga0265760_10132617 | Ga0265760_101326172 | 77 |
| 773 | 3300031456 | Ga0307513_10779502 | Ga0307513_107795022 | 77 |
| 774 | 3300031507 | Ga0307509_10116525 | Ga0307509_101165252 | 77 |
| 775 | 3300031507 | Ga0307509_10120432 | Ga0307509_101204324 | 77 |
| 776 | 3300031507 | Ga0307509_10250321 | Ga0307509_102503212 | 77 |
| 777 | 3300031548 | Ga0307408_100160846 | Ga0307408_1001608461 | 77 |
| 778 | 3300031548 | Ga0307408_100194616 | Ga0307408_1001946161 | 77 |
| 779 | 3300031548 | Ga0307408_100805547 | Ga0307408_1008055472 | 77 |
| 780 | 3300031616 | Ga0307508_10009811 | Ga0307508_100098116 | 77 |
| 781 | 3300031616 | Ga0307508_10042968 | Ga0307508_100429685 | 77 |
| 782 | 3300031616 | Ga0307508_10048153 | Ga0307508_100481531 | 77 |
| 783 | 3300031616 | Ga0307508_10071032 | Ga0307508_100710324 | 77 |
| 784 | 3300031616 | Ga0307508_10102457 | Ga0307508_101024573 | 77 |
| 785 | 3300031616 | Ga0307508_10192267 | Ga0307508_101922671 | 77 |
| 786 | 3300031616 | Ga0307508_10923375 | Ga0307508_109233751 | 77 |
| 787 | 3300031649 | Ga0307514_10017611 | Ga0307514_100176113 | 77 |
| 788 | 3300031727 | Ga0316576_10033659 | Ga0316576_100336593 | 77 |
| 789 | 3300031728 | Ga0316578_10403236 | Ga0316578_104032362 | 77 |
| 790 | 3300031730 | Ga0307516_10006885 | Ga0307516_100068855 | 77 |
| 791 | 3300031730 | Ga0307516_10033062 | Ga0307516_100330625 | 77 |
| 792 | 3300031731 | Ga0307405_10004991 | Ga0307405_100049917 | 77 |
| 793 | 3300031731 | Ga0307405_10012545 | Ga0307405_100125452 | 77 |
| 794 | 3300031731 | Ga0307405_10152741 | Ga0307405_101527413 | 77 |
| 795 | 3300031731 | Ga0307405_11136572 | Ga0307405_111365721 | 77 |
| 796 | 3300031731 | Ga0307405_11371576 | Ga0307405_113715761 | 77 |
| 797 | 3300031824 | Ga0307413_10010340 | Ga0307413_100103403 | 77 |
| 798 | 3300031824 | Ga0307413_10033503 | Ga0307413_100335033 | 77 |
| 799 | 3300031824 | Ga0307413_10052232 | Ga0307413_100522323 | 77 |
| 800 | 3300031824 | Ga0307413_10118605 | Ga0307413_101186053 | 77 |
| 801 | 3300031824 | Ga0307413_10241777 | Ga0307413_102417772 | 77 |
| 802 | 3300031824 | Ga0307413_10297416 | Ga0307413_102974162 | 77 |
| 803 | 3300031824 | Ga0307413_10376821 | Ga0307413_103768212 | 77 |
| 804 | 3300031852 | Ga0307410_10043621 | Ga0307410_100436213 | 77 |
| 805 | 3300031852 | Ga0307410_10044978 | Ga0307410_100449783 | 77 |
| 806 | 3300031852 | Ga0307410_10123949 | Ga0307410_101239493 | 77 |
| 807 | 3300031852 | Ga0307410_10176213 | Ga0307410_101762132 | 77 |
| 808 | 3300031852 | Ga0307410_10186697 | Ga0307410_101866972 | 77 |
| 809 | 3300031852 | Ga0307410_11023848 | Ga0307410_110238482 | 77 |
| 810 | 3300031852 | Ga0307410_11392283 | Ga0307410_113922832 | 77 |
| 811 | 3300031901 | Ga0307406_10009972 | Ga0307406_100099725 | 77 |
| 812 | 3300031901 | Ga0307406_10056284 | Ga0307406_100562842 | 77 |
| 813 | 3300031901 | Ga0307406_10060010 | Ga0307406_100600102 | 77 |
| 814 | 3300031901 | Ga0307406_10341765 | Ga0307406_103417651 | 77 |
| 815 | 3300031903 | Ga0307407_10031727 | Ga0307407_100317273 | 77 |
| 816 | 3300031903 | Ga0307407_10032507 | Ga0307407_100325072 | 77 |
| 817 | 3300031903 | Ga0307407_10064675 | Ga0307407_100646751 | 77 |
| 818 | 3300031903 | Ga0307407_10273585 | Ga0307407_102735852 | 77 |
| 819 | 3300031903 | Ga0307407_10277977 | Ga0307407_102779771 | 77 |
| 820 | 3300031903 | Ga0307407_10892285 | Ga0307407_108922852 | 77 |
| 821 | 3300031911 | Ga0307412_10032183 | Ga0307412_100321833 | 77 |
| 822 | 3300031911 | Ga0307412_10390952 | Ga0307412_103909522 | 77 |
| 823 | 3300031911 | Ga0307412_10523528 | Ga0307412_105235282 | 77 |
| 824 | 3300031911 | Ga0307412_10731183 | Ga0307412_107311832 | 77 |
| 825 | 3300031911 | Ga0307412_11503781 | Ga0307412_115037811 | 77 |
| 826 | 3300031995 | Ga0307409_100031324 | Ga0307409_1000313241 | 77 |
| 827 | 3300031995 | Ga0307409_100051919 | Ga0307409_1000519192 | 77 |
| 828 | 3300031995 | Ga0307409_100057907 | Ga0307409_1000579073 | 77 |
| 829 | 3300031995 | Ga0307409_100179771 | Ga0307409_1001797712 | 77 |
| 830 | 3300031995 | Ga0307409_100599435 | Ga0307409_1005994352 | 77 |
| 831 | 3300031995 | Ga0307409_100930347 | Ga0307409_1009303472 | 77 |
| 832 | 3300032002 | Ga0307416_100002858 | Ga0307416_1000028583 | 77 |
| 833 | 3300032002 | Ga0307416_100062131 | Ga0307416_1000621313 | 77 |
| 834 | 3300032002 | Ga0307416_100259855 | Ga0307416_1002598552 | 77 |
| 835 | 3300032002 | Ga0307416_100456040 | Ga0307416_1004560402 | 77 |
| 836 | 3300032002 | Ga0307416_100987867 | Ga0307416_1009878672 | 77 |
| 837 | 3300032004 | Ga0307414_10061425 | Ga0307414_100614253 | 77 |
| 838 | 3300032004 | Ga0307414_10660101 | Ga0307414_106601012 | 77 |
| 839 | 3300032004 | Ga0307414_10760414 | Ga0307414_107604142 | 77 |
| 840 | 3300032005 | Ga0307411_10138399 | Ga0307411_101383992 | 77 |
| 841 | 3300032005 | Ga0307411_10149189 | Ga0307411_101491892 | 77 |
| 842 | 3300032005 | Ga0307411_10253669 | Ga0307411_102536692 | 77 |
| 843 | 3300032126 | Ga0307415_100001231 | Ga0307415_1000012315 | 77 |
| 844 | 3300032126 | Ga0307415_100046044 | Ga0307415_1000460442 | 77 |
| 845 | 3300032126 | Ga0307415_100061596 | Ga0307415_1000615961 | 77 |
| 846 | 3300032126 | Ga0307415_100087992 | Ga0307415_1000879921 | 77 |
| 847 | 3300032126 | Ga0307415_100159352 | Ga0307415_1001593523 | 77 |
| 848 | 3300032126 | Ga0307415_100173443 | Ga0307415_1001734432 | 77 |
| 849 | 3300032126 | Ga0307415_101590273 | Ga0307415_1015902732 | 77 |
| 850 | 3300032126 | Ga0307415_102008890 | Ga0307415_1020088901 | 77 |
| 851 | 3300032126 | Ga0307415_102388879 | Ga0307415_1023888792 | 77 |
| 852 | 3300033179 | Ga0307507_10000004 | Ga0307507_10000004138 | 77 |
| 853 | 3300033179 | Ga0307507_10019522 | Ga0307507_100195228 | 77 |
| 854 | 3300033179 | Ga0307507_10048643 | Ga0307507_100486435 | 77 |
| 855 | 3300033179 | Ga0307507_10265614 | Ga0307507_102656141 | 77 |
| 856 | 3300033180 | Ga0307510_10178454 | Ga0307510_101784541 | 77 |
| 857 | 3300033180 | Ga0307510_10616655 | Ga0307510_106166551 | 77 |
| 858 | 3300033541 | Ga0316596_1238806 | Ga0316596_12388061 | 77 |
| 859 | 3300035083 | Ga0373926_0103561 | Ga0373926_0103561_54_287 | 77 |
| 860 | 3300035084 | Ga0373928_0242519 | Ga0373928_0242519_256_489 | 77 |
| 861 | 3300035086 | Ga0373934_0081727 | Ga0373934_0081727_1018_1251 | 77 |
| 862 | 3300035089 | Ga0373944_0186231 | Ga0373944_0186231_426_659 | 77 |
| 863 | 3300035111 | Ga0373923_0232371 | Ga0373923_0232371_403_636 | 77 |
| 864 | 3300035113 | Ga0373936_0002652 | Ga0373936_0002652_4172_4405 | 77 |
| 865 | 3300035116 | Ga0373945_0032972 | Ga0373945_0032972_910_1143 | 77 |
| 866 | 3300035117 | Ga0373953_0039958 | Ga0373953_0039958_1098_1331 | 77 |
| 867 | 3300035118 | Ga0373954_0109839 | Ga0373954_0109839_531_764 | 77 |
| 868 | 3300035119 | Ga0373956_0009853 | Ga0373956_0009853_403_636 | 77 |
| 869 | 3300035120 | Ga0373957_0004739 | Ga0373957_0004739_3527_3760 | 77 |
| 870 | 3300035170 | Ga0373943_0086429 | Ga0373943_0086429_1344_1577 | 77 |
| 871 | 3300035170 | Ga0373943_0105489 | Ga0373943_0105489_1004_1237 | 77 |
| 872 | 3300035170 | Ga0373943_0275242 | Ga0373943_0275242_684_917 | 77 |
| 873 | 3300035170 | Ga0373943_0926660 | Ga0373943_0926660_85_321 | 77 |
| 874 | 3300035171 | Ga0373946_0055434 | Ga0373946_0055434_1116_1349 | 77 |
| 875 | 3300035171 | Ga0373946_0562780 | Ga0373946_0562780_90_323 | 77 |
| 876 | 3300035172 | Ga0373955_0618701 | Ga0373955_0618701_403_636 | 77 |
| 877 | 3300035398 | Ga0316574_0006775 | Ga0316574_0006775_3571_3804 | 77 |
| 878 | 3300035398 | Ga0316574_0024958 | Ga0316574_0024958_2963_3196 | 77 |
| 879 | 3300035410 | Ga0373924_0046395 | Ga0373924_0046395_1509_1742 | 77 |
| 880 | 3300035691 | Ga0373931_0211674 | Ga0373931_0211674_107_340 | 77 |
| 881 | 3300035692 | Ga0373935_0032879 | Ga0373935_0032879_2820_3053 | 77 |
| 882 | 3300035692 | Ga0373935_0629943 | Ga0373935_0629943_491_724 | 77 |
| 883 | 3300035692 | Ga0373935_1002202 | Ga0373935_1002202_100_333 | 77 |
| 884 | 3300035692 | Ga0373935_1486592 | Ga0373935_1486592_28_264 | 77 |
| 885 | 3300035695 | Ga0373927_0140364 | Ga0373927_0140364_865_1104 | 77 |
| 886 | 3300035724 | Ga0373933_0048564 | Ga0373933_0048564_816_1049 | 77 |
| 887 | 3300035725 | Ga0373947_0045323 | Ga0373947_0045323_356_589 | 77 |
| 888 | 3300035725 | Ga0373947_0740988 | Ga0373947_0740988_93_326 | 77 |
| 889 | 3300035725 | Ga0373947_0771829 | Ga0373947_0771829_396_629 | 77 |
| 890 | 3300035725 | Ga0373947_0970465 | Ga0373947_0970465_206_511 | 77 |
| 891 | 3300036401 | Ga0373937_0219523 | Ga0373937_0219523_48_281 | 77 |
| 892 | 3300037068 | Ga0373925_0073378 | Ga0373925_0073378_2131_2364 | 77 |
| 893 | 3300037068 | Ga0373925_0192091 | Ga0373925_0192091_665_898 | 77 |
| 894 | 3300037068 | Ga0373925_0647254 | Ga0373925_0647254_277_510 | 77 |
| 895 | 3300037312 | Ga0395899_0043872 | Ga0395899_0043872_2047_2283 | 77 |
| 896 | 3300037312 | Ga0395899_0063189 | Ga0395899_0063189_2233_2466 | 77 |
| 897 | 3300037312 | Ga0395899_0559152 | Ga0395899_0559152_393_626 | 77 |
| 898 | 3300037418 | Ga0395900_0049812 | Ga0395900_0049812_1462_1695 | 77 |
| 899 | 3300037418 | Ga0395900_0254888 | Ga0395900_0254888_429_668 | 77 |
| 900 | 3300037418 | Ga0395900_0400701 | Ga0395900_0400701_599_832 | 77 |
| 901 | 3300037418 | Ga0395900_0738160 | Ga0395900_0738160_59_298 | 77 |
| 902 | 3300037418 | Ga0395900_1515235 | Ga0395900_1515235_222_458 | 77 |
| 903 | 3300037466 | Ga0395898_0004957 | Ga0395898_0004957_867_1100 | 77 |
| 904 | 3300037466 | Ga0395898_0020289 | Ga0395898_0020289_4451_4684 | 77 |
| 905 | 3300037466 | Ga0395898_0204323 | Ga0395898_0204323_1384_1623 | 77 |
| 906 | 3300037466 | Ga0395898_0423014 | Ga0395898_0423014_938_1171 | 77 |
| 907 | 3300037471 | Ga0395905_0140072 | Ga0395905_0140072_294_527 | 77 |
| 908 | 3300037471 | Ga0395905_0912000 | Ga0395905_0912000_135_374 | 77 |
| 909 | 3300037853 | Ga0436364_0211036 | Ga0436364_0211036_320_568 | 77 |
| 910 | 3300037853 | Ga0436364_1387664 | Ga0436364_1387664_2365_2598 | 77 |
| 911 | 3300037853 | Ga0436364_1513228 | Ga0436364_1513228_846_1100 | 77 |
| 912 | 3300038443 | Ga0395901_0025589 | Ga0395901_0025589_5643_5876 | 77 |
| 913 | 3300038443 | Ga0395901_0028245 | Ga0395901_0028245_5364_5603 | 77 |
| 914 | 3300038443 | Ga0395901_0142136 | Ga0395901_0142136_1775_2014 | 77 |
| 915 | 3300038443 | Ga0395901_0220165 | Ga0395901_0220165_1607_1840 | 77 |
| 916 | 3300038443 | Ga0395901_1218419 | Ga0395901_1218419_28_261 | 77 |
| 917 | 3300039437 | Ga0436365_1800393 | Ga0436365_1800393_2185_2433 | 77 |
| 918 | 3300039450 | Ga0436363_1600108 | Ga0436363_1600108_398_631 | 77 |
| 919 | 3300041410 | Ga0439461_0108410 | Ga0439461_0108410_35_268 | 77 |
| 920 | 3300041451 | Ga0451791_0732074 | Ga0451791_0732074_56_289 | 77 |
| 921 | 3300041452 | Ga0451793_0443263 | Ga0451793_0443263_31_264 | 77 |
| 922 | 3300041453 | Ga0451797_0046928 | Ga0451797_0046928_70_303 | 77 |
| 923 | 3300041453 | Ga0451797_0063387 | Ga0451797_0063387_58_291 | 77 |
| 924 | 3300041456 | Ga0451795_0944170 | Ga0451795_0944170_476_709 | 77 |
| 925 | 3300041463 | Ga0451804_0709125 | Ga0451804_0709125_142_375 | 77 |
| 926 | 3300041486 | Ga0451807_2146582 | Ga0451807_2146582_758_991 | 77 |
| 927 | 3300041491 | Ga0451833_0363118 | Ga0451833_0363118_271_504 | 77 |
| 928 | 3300041498 | Ga0451841_1156208 | Ga0451841_1156208_411_644 | 77 |
| 929 | 3300041507 | Ga0451851_0539892 | Ga0451851_0539892_451_684 | 77 |
| 930 | 3300041512 | Ga0451853_0201250 | Ga0451853_0201250_751_984 | 77 |
| 931 | 3300041512 | Ga0451853_2009892 | Ga0451853_2009892_326_559 | 77 |
| 932 | 3300041999 | Ga0439433_0090839 | Ga0439433_0090839_306_539 | 77 |
| 933 | 3300042002 | Ga0439442_034627 | Ga0439442_034627_79_312 | 77 |
| 934 | 3300042003 | Ga0439443_068009 | Ga0439443_068009_368_607 | 77 |
| 935 | 3300042005 | Ga0439448_0000543 | Ga0439448_0000543_8272_8511 | 77 |
| 936 | 3300042005 | Ga0439448_0001808 | Ga0439448_0001808_26_259 | 77 |
| 937 | 3300042005 | Ga0439448_0001912 | Ga0439448_0001912_4868_5101 | 77 |
| 938 | 3300042005 | Ga0439448_0053491 | Ga0439448_0053491_34_267 | 77 |
| 939 | 3300042006 | Ga0439432_096512 | Ga0439432_096512_366_599 | 77 |
| 940 | 3300042007 | Ga0439449_0002001 | Ga0439449_0002001_48_281 | 77 |
| 941 | 3300042007 | Ga0439449_0092550 | Ga0439449_0092550_48_281 | 77 |
| 942 | 3300042008 | Ga0439450_001186 | Ga0439450_001186_623_862 | 77 |
| 943 | 3300042008 | Ga0439450_003903 | Ga0439450_003903_714_953 | 77 |
| 944 | 3300042009 | Ga0439451_007224 | Ga0439451_007224_1762_2001 | 77 |
| 945 | 3300042009 | Ga0439451_010546 | Ga0439451_010546_69_308 | 77 |
| 946 | 3300042011 | Ga0439454_010919 | Ga0439454_010919_92_331 | 77 |
| 947 | 3300042011 | Ga0439454_071041 | Ga0439454_071041_40_279 | 77 |
| 948 | 3300042012 | Ga0439455_0000702 | Ga0439455_0000702_4051_4284 | 77 |
| 949 | 3300042012 | Ga0439455_0035109 | Ga0439455_0035109_899_1138 | 77 |
| 950 | 3300042013 | Ga0439456_043433 | Ga0439456_043433_330_569 | 77 |
| 951 | 3300042014 | Ga0439457_016546 | Ga0439457_016546_71_304 | 77 |
| 952 | 3300042016 | Ga0439463_000211 | Ga0439463_000211_5943_6182 | 77 |
| 953 | 3300042016 | Ga0439463_007150 | Ga0439463_007150_2144_2383 | 77 |
| 954 | 3300042016 | Ga0439463_094634 | Ga0439463_094634_394_627 | 77 |
| 955 | 3300042116 | Ga0450912_002482 | Ga0450912_002482_115_348 | 77 |
| 956 | 3300042118 | Ga0450914_003043 | Ga0450914_003043_95_328 | 77 |
| 957 | 3300042119 | Ga0450915_002074 | Ga0450915_002074_763_996 | 77 |
| 958 | 3300042124 | Ga0450922_018805 | Ga0450922_018805_293_532 | 77 |
| 959 | 3300042125 | Ga0450923_092472 | Ga0450923_092472_390_629 | 77 |
| 960 | 3300042131 | Ga0450894_000582 | Ga0450894_000582_1391_1624 | 77 |
| 961 | 3300042132 | Ga0450895_010376 | Ga0450895_010376_451_684 | 77 |
| 962 | 3300042133 | Ga0450896_006854 | Ga0450896_006854_425_658 | 77 |
| 963 | 3300042134 | Ga0450898_002954 | Ga0450898_002954_1332_1565 | 77 |
| 964 | 3300042136 | Ga0450900_000637 | Ga0450900_000637_2017_2256 | 77 |
| 965 | 3300042136 | Ga0450900_004755 | Ga0450900_004755_538_771 | 77 |
| 966 | 3300042136 | Ga0450900_023785 | Ga0450900_023785_606_839 | 77 |
| 967 | 3300042137 | Ga0450902_007496 | Ga0450902_007496_1119_1352 | 77 |
| 968 | 3300042138 | Ga0450903_000222 | Ga0450903_000222_4740_4973 | 77 |
| 969 | 3300042138 | Ga0450903_004285 | Ga0450903_004285_2112_2345 | 77 |
| 970 | 3300042145 | Ga0450906_001179 | Ga0450906_001179_1909_2142 | 77 |
| 971 | 3300042147 | Ga0450910_084117 | Ga0450910_084117_181_420 | 77 |
| 972 | 3300042156 | Ga0439446_0086653 | Ga0439446_0086653_524_760 | 77 |
| 973 | 3300042157 | Ga0439458_0002925 | Ga0439458_0002925_1394_1627 | 77 |
| 974 | 3300042157 | Ga0439458_0020266 | Ga0439458_0020266_853_1092 | 77 |
| 975 | 3300042184 | Ga0450908_001963 | Ga0450908_001963_1961_2194 | 77 |
| 976 | 3300042436 | Ga0439435_0002840 | Ga0439435_0002840_1301_1540 | 77 |
| 977 | 3300042436 | Ga0439435_0118145 | Ga0439435_0118145_502_741 | 77 |
| 978 | 3300042437 | Ga0439444_0003239 | Ga0439444_0003239_691_930 | 77 |
| 979 | 3300042437 | Ga0439444_0014537 | Ga0439444_0014537_881_1120 | 77 |
| 980 | 3300042437 | Ga0439444_0169981 | Ga0439444_0169981_248_481 | 77 |
| 981 | 3300042438 | Ga0439459_0004527 | Ga0439459_0004527_635_868 | 77 |
| 982 | 3300042438 | Ga0439459_0077429 | Ga0439459_0077429_89_328 | 77 |
| 983 | 3300042439 | Ga0439464_0000089 | Ga0439464_0000089_3345_3584 | 77 |
| 984 | 3300042439 | Ga0439464_0237172 | Ga0439464_0237172_336_575 | 77 |
| 985 | 3300042530 | Ga0450916_019008 | Ga0450916_019008_622_861 | 77 |
| 986 | 3300042532 | Ga0450893_0019003 | Ga0450893_0019003_628_867 | 77 |
| 987 | 3300042533 | Ga0450901_032004 | Ga0450901_032004_47_280 | 77 |
| 988 | 3300042993 | Ga0439440_0000033 | Ga0439440_0000033_10043_10282 | 77 |
| 989 | 3300042993 | Ga0439440_0024212 | Ga0439440_0024212_1060_1299 | 77 |
| 990 | 3300044656 | Ga0466969_0000873 | Ga0466969_0000873_14606_14857 | 77 |
| 991 | 3300044656 | Ga0466969_0008468 | Ga0466969_0008468_598_831 | 77 |
| 992 | 3300044656 | Ga0466969_0139742 | Ga0466969_0139742_342_578 | 77 |
| 993 | 3300044656 | Ga0466969_0264710 | Ga0466969_0264710_238_474 | 77 |
| 994 | 3300044656 | Ga0466969_0610860 | Ga0466969_0610860_229_465 | 77 |
| 995 | 3300044658 | Ga0466972_0003355 | Ga0466972_0003355_7641_7874 | 77 |
| 996 | 3300044658 | Ga0466972_0105820 | Ga0466972_0105820_62_295 | 77 |
| 997 | 3300044683 | Ga0466965_0000614 | Ga0466965_0000614_12605_12838 | 77 |
| 998 | 3300044683 | Ga0466965_0128809 | Ga0466965_0128809_1046_1279 | 77 |
| 999 | 3300044683 | Ga0466965_0285966 | Ga0466965_0285966_55_288 | 77 |
| 1000 | 3300044684 | Ga0466966_0007105 | Ga0466966_0007105_4801_5034 | 77 |
| 1001 | 3300044684 | Ga0466966_0058977 | Ga0466966_0058977_713_949 | 77 |
| 1002 | 3300044684 | Ga0466966_0060711 | Ga0466966_0060711_1435_1686 | 77 |
| 1003 | 3300044684 | Ga0466966_0313783 | Ga0466966_0313783_366_602 | 77 |
| 1004 | 3300044684 | Ga0466966_0410879 | Ga0466966_0410879_242_478 | 77 |
| 1005 | 3300044684 | Ga0466966_0776219 | Ga0466966_0776219_317_553 | 77 |
| 1006 | 3300044684 | Ga0466966_0900509 | Ga0466966_0900509_213_449 | 77 |
| 1007 | 3300044693 | Ga0466961_0001921 | Ga0466961_0001921_953_1186 | 77 |
| 1008 | 3300044693 | Ga0466961_0009405 | Ga0466961_0009405_112_348 | 77 |
| 1009 | 3300044693 | Ga0466961_0023817 | Ga0466961_0023817_3459_3710 | 77 |
| 1010 | 3300044693 | Ga0466961_0026189 | Ga0466961_0026189_3337_3573 | 77 |
| 1011 | 3300044693 | Ga0466961_0072197 | Ga0466961_0072197_1503_1739 | 77 |
| 1012 | 3300044693 | Ga0466961_0155752 | Ga0466961_0155752_527_763 | 77 |
| 1013 | 3300044693 | Ga0466961_0208213 | Ga0466961_0208213_58_294 | 77 |
| 1014 | 3300044693 | Ga0466961_0575026 | Ga0466961_0575026_312_548 | 77 |
| 1015 | 3300044694 | Ga0466963_0004618 | Ga0466963_0004618_4530_4763 | 77 |
| 1016 | 3300044694 | Ga0466963_0021337 | Ga0466963_0021337_18_254 | 77 |
| 1017 | 3300044694 | Ga0466963_0056243 | Ga0466963_0056243_1384_1620 | 77 |
| 1018 | 3300044694 | Ga0466963_0282237 | Ga0466963_0282237_492_728 | 77 |
| 1019 | 3300044694 | Ga0466963_0284409 | Ga0466963_0284409_353_589 | 77 |
| 1020 | 3300044694 | Ga0466963_0288668 | Ga0466963_0288668_770_1006 | 77 |
| 1021 | 3300044694 | Ga0466963_0302482 | Ga0466963_0302482_112_363 | 77 |
| 1022 | 3300044694 | Ga0466963_0535370 | Ga0466963_0535370_274_510 | 77 |
| 1023 | 3300044694 | Ga0466963_0549153 | Ga0466963_0549153_274_510 | 77 |
| 1024 | 3300044694 | Ga0466963_0831908 | Ga0466963_0831908_131_382 | 77 |
| 1025 | 3300044706 | Ga0466964_0032966 | Ga0466964_0032966_39_272 | 77 |
| 1026 | 3300044706 | Ga0466964_0061865 | Ga0466964_0061865_991_1227 | 77 |
| 1027 | 3300044706 | Ga0466964_0230905 | Ga0466964_0230905_156_392 | 77 |
| 1028 | 3300044706 | Ga0466964_0354057 | Ga0466964_0354057_33_269 | 77 |
| 1029 | 3300044706 | Ga0466964_0391946 | Ga0466964_0391946_137_370 | 77 |
| 1030 | 3300044706 | Ga0466964_0408856 | Ga0466964_0408856_49_285 | 77 |
| 1031 | 3300044719 | Ga0466971_0000629 | Ga0466971_0000629_12611_12862 | 77 |
| 1032 | 3300044719 | Ga0466971_0016721 | Ga0466971_0016721_507_743 | 77 |
| 1033 | 3300044719 | Ga0466971_0098445 | Ga0466971_0098445_271_507 | 77 |
| 1034 | 3300044719 | Ga0466971_0116813 | Ga0466971_0116813_528_761 | 77 |
| 1035 | 3300044719 | Ga0466971_0145427 | Ga0466971_0145427_610_846 | 77 |
| 1036 | 3300044719 | Ga0466971_0179353 | Ga0466971_0179353_617_853 | 77 |
| 1037 | 3300044719 | Ga0466971_0415339 | Ga0466971_0415339_249_485 | 77 |
| 1038 | 3300044719 | Ga0466971_0645134 | Ga0466971_0645134_184_420 | 77 |
| 1039 | 3300044735 | Ga0466968_0136969 | Ga0466968_0136969_724_957 | 77 |
| 1040 | 3300044765 | Ga0466970_0001377 | Ga0466970_0001377_2305_2538 | 77 |
| 1041 | 3300044765 | Ga0466970_0030083 | Ga0466970_0030083_914_1150 | 77 |
| 1042 | 3300044765 | Ga0466970_0209856 | Ga0466970_0209856_391_627 | 77 |
| 1043 | 3300044765 | Ga0466970_0222763 | Ga0466970_0222763_615_848 | 77 |
| 1044 | 3300044765 | Ga0466970_0280012 | Ga0466970_0280012_679_915 | 77 |
| 1045 | 3300044765 | Ga0466970_0367753 | Ga0466970_0367753_62_295 | 77 |
| 1046 | 3300044842 | Ga0466957_0006278 | Ga0466957_0006278_4573_4809 | 77 |
| 1047 | 3300044842 | Ga0466957_0010382 | Ga0466957_0010382_699_932 | 77 |
| 1048 | 3300044842 | Ga0466957_0366712 | Ga0466957_0366712_43_279 | 77 |
| 1049 | 3300044842 | Ga0466957_0462526 | Ga0466957_0462526_189_425 | 77 |
| 1050 | 3300044842 | Ga0466957_0616643 | Ga0466957_0616643_493_729 | 77 |
| 1051 | 3300044842 | Ga0466957_0792033 | Ga0466957_0792033_254_505 | 77 |
| 1052 | 3300044842 | Ga0466957_1331580 | Ga0466957_1331580_50_286 | 77 |
| 1053 | 3300044842 | Ga0466957_1384974 | Ga0466957_1384974_53_286 | 77 |
| 1054 | 3300044901 | Ga0466960_0109978 | Ga0466960_0109978_101_334 | 77 |
| 1055 | 3300044901 | Ga0466960_0517916 | Ga0466960_0517916_406_639 | 77 |
| 1056 | 3300044901 | Ga0466960_0607372 | Ga0466960_0607372_205_438 | 77 |
| 1057 | 3300045049 | Ga0466959_0000365 | Ga0466959_0000365_2515_2748 | 77 |
| 1058 | 3300045049 | Ga0466959_0000617 | Ga0466959_0000617_1243_1494 | 77 |
| 1059 | 3300045049 | Ga0466959_0036475 | Ga0466959_0036475_377_613 | 77 |
| 1060 | 3300045049 | Ga0466959_0796026 | Ga0466959_0796026_50_286 | 77 |
| 1061 | 3300045836 | Ga0466958_0000185 | Ga0466958_0000185_10678_10911 | 77 |
| 1062 | 3300045836 | Ga0466958_0013097 | Ga0466958_0013097_3686_3922 | 77 |
| 1063 | 3300045836 | Ga0466958_0015443 | Ga0466958_0015443_1031_1267 | 77 |
| 1064 | 3300045836 | Ga0466958_0034058 | Ga0466958_0034058_2188_2424 | 77 |
| 1065 | 3300045836 | Ga0466958_0050301 | Ga0466958_0050301_84_335 | 77 |
| 1066 | 3300045836 | Ga0466958_0177273 | Ga0466958_0177273_920_1156 | 77 |
| 1067 | 3300045836 | Ga0466958_0434593 | Ga0466958_0434593_79_315 | 77 |
| 1068 | 3300045836 | Ga0466958_0434798 | Ga0466958_0434798_140_376 | 77 |
| 1069 | 3300045836 | Ga0466958_0612196 | Ga0466958_0612196_51_287 | 77 |
| 1070 | 3300045836 | Ga0466958_0882127 | Ga0466958_0882127_259_492 | 77 |
| 1071 | 3300045836 | Ga0466958_0887339 | Ga0466958_0887339_296_532 | 77 |
| 1072 | 3300045976 | Ga0466967_0012726 | Ga0466967_0012726_2118_2360 | 77 |
| 1073 | 3300045976 | Ga0466967_0024439 | Ga0466967_0024439_953_1189 | 77 |
| 1074 | 3300045976 | Ga0466967_0042374 | Ga0466967_0042374_146_379 | 77 |
| 1075 | 3300045976 | Ga0466967_0162097 | Ga0466967_0162097_1627_1863 | 77 |
| 1076 | 3300045976 | Ga0466967_0186708 | Ga0466967_0186708_1063_1299 | 77 |
| 1077 | 3300045976 | Ga0466967_0191205 | Ga0466967_0191205_690_923 | 77 |
| 1078 | 3300045976 | Ga0466967_0200361 | Ga0466967_0200361_626_862 | 77 |
| 1079 | 3300045976 | Ga0466967_0252272 | Ga0466967_0252272_360_596 | 77 |
| 1080 | 3300045976 | Ga0466967_0494070 | Ga0466967_0494070_700_936 | 77 |
| 1081 | 3300045976 | Ga0466967_0657819 | Ga0466967_0657819_200_436 | 77 |
| 1082 | 3300045976 | Ga0466967_1004103 | Ga0466967_1004103_234_467 | 77 |
| 1083 | 3300045976 | Ga0466967_1137537 | Ga0466967_1137537_160_396 | 77 |
| 1084 | 3300045976 | Ga0466967_1879981 | Ga0466967_1879981_35_271 | 77 |
| 1085 | 3300046452 | Ga0495617_113804 | Ga0495617_113804_383_637 | 77 |
| 1086 | 3300046454 | Ga0495592_0003261 | Ga0495592_0003261_7045_7278 | 77 |
| 1087 | 3300046454 | Ga0495592_0020580 | Ga0495592_0020580_54_287 | 77 |
| 1088 | 3300046454 | Ga0495592_0022586 | Ga0495592_0022586_1296_1529 | 77 |
| 1089 | 3300046455 | Ga0495603_0004326 | Ga0495603_0004326_3986_4219 | 77 |
| 1090 | 3300046455 | Ga0495603_0006636 | Ga0495603_0006636_4431_4664 | 77 |
| 1091 | 3300046455 | Ga0495603_0035572 | Ga0495603_0035572_2167_2400 | 77 |
| 1092 | 3300046455 | Ga0495603_0306303 | Ga0495603_0306303_422_655 | 77 |
| 1093 | 3300046455 | Ga0495603_0593524 | Ga0495603_0593524_325_558 | 77 |
| 1094 | 3300046459 | Ga0495629_0000710 | Ga0495629_0000710_5349_5582 | 77 |
| 1095 | 3300046459 | Ga0495629_0008081 | Ga0495629_0008081_4419_4652 | 77 |
| 1096 | 3300046459 | Ga0495629_0009932 | Ga0495629_0009932_4453_4686 | 77 |
| 1097 | 3300046459 | Ga0495629_0034307 | Ga0495629_0034307_2168_2401 | 77 |
| 1098 | 3300046459 | Ga0495629_0045243 | Ga0495629_0045243_1973_2206 | 77 |
| 1099 | 3300046460 | Ga0495638_0019718 | Ga0495638_0019718_813_1046 | 77 |
| 1100 | 3300046461 | Ga0495641_0033691 | Ga0495641_0033691_1914_2147 | 77 |
| 1101 | 3300046461 | Ga0495641_0253296 | Ga0495641_0253296_489_722 | 77 |
| 1102 | 3300046461 | Ga0495641_0487062 | Ga0495641_0487062_115_348 | 77 |
| 1103 | 3300046462 | Ga0495651_0001993 | Ga0495651_0001993_13512_13763 | 77 |
| 1104 | 3300046462 | Ga0495651_0002231 | Ga0495651_0002231_14537_14770 | 77 |
| 1105 | 3300046462 | Ga0495651_0005685 | Ga0495651_0005685_1033_1266 | 77 |
| 1106 | 3300046462 | Ga0495651_0031302 | Ga0495651_0031302_1552_1785 | 77 |
| 1107 | 3300046463 | Ga0495653_0020146 | Ga0495653_0020146_4771_5004 | 77 |
| 1108 | 3300046472 | Ga0495580_0368845 | Ga0495580_0368845_687_920 | 77 |
| 1109 | 3300046473 | Ga0495582_0105708 | Ga0495582_0105708_50_283 | 77 |
| 1110 | 3300046475 | Ga0495639_0008151 | Ga0495639_0008151_3589_3822 | 77 |
| 1111 | 3300046475 | Ga0495639_0027525 | Ga0495639_0027525_61_294 | 77 |
| 1112 | 3300046475 | Ga0495639_0054394 | Ga0495639_0054394_229_462 | 77 |
| 1113 | 3300046476 | Ga0495662_0031072 | Ga0495662_0031072_1673_1906 | 77 |
| 1114 | 3300046476 | Ga0495662_0080214 | Ga0495662_0080214_1249_1482 | 77 |
| 1115 | 3300046476 | Ga0495662_0083229 | Ga0495662_0083229_57_290 | 77 |
| 1116 | 3300046476 | Ga0495662_0084294 | Ga0495662_0084294_354_587 | 77 |
| 1117 | 3300046477 | Ga0495664_0000321 | Ga0495664_0000321_4756_4989 | 77 |
| 1118 | 3300046477 | Ga0495664_0088739 | Ga0495664_0088739_1296_1529 | 77 |
| 1119 | 3300046477 | Ga0495664_0095726 | Ga0495664_0095726_260_511 | 77 |
| 1120 | 3300046477 | Ga0495664_0098595 | Ga0495664_0098595_1156_1392 | 77 |
| 1121 | 3300046477 | Ga0495664_0314144 | Ga0495664_0314144_267_500 | 77 |
| 1122 | 3300046477 | Ga0495664_0395118 | Ga0495664_0395118_68_301 | 77 |
| 1123 | 3300046491 | Ga0495584_0136123 | Ga0495584_0136123_461_715 | 77 |
| 1124 | 3300046492 | Ga0495585_0017733 | Ga0495585_0017733_658_891 | 77 |
| 1125 | 3300046492 | Ga0495585_0033369 | Ga0495585_0033369_905_1138 | 77 |
| 1126 | 3300046492 | Ga0495585_0111064 | Ga0495585_0111064_790_1044 | 77 |
| 1127 | 3300046499 | Ga0495594_0039331 | Ga0495594_0039331_929_1162 | 77 |
| 1128 | 3300046499 | Ga0495594_0145721 | Ga0495594_0145721_68_301 | 77 |
| 1129 | 3300046499 | Ga0495594_0150653 | Ga0495594_0150653_552_785 | 77 |
| 1130 | 3300046499 | Ga0495594_0802764 | Ga0495594_0802764_194_427 | 77 |
| 1131 | 3300046500 | Ga0495596_0082647 | Ga0495596_0082647_659_892 | 77 |
| 1132 | 3300046501 | Ga0495607_0206477 | Ga0495607_0206477_382_615 | 77 |
| 1133 | 3300046506 | Ga0495583_0099426 | Ga0495583_0099426_79_312 | 77 |
| 1134 | 3300046511 | Ga0495608_0006672 | Ga0495608_0006672_3588_3821 | 77 |
| 1135 | 3300046513 | Ga0495616_0077806 | Ga0495616_0077806_387_620 | 77 |
| 1136 | 3300046514 | Ga0495618_0010799 | Ga0495618_0010799_3384_3617 | 77 |
| 1137 | 3300046514 | Ga0495618_0080528 | Ga0495618_0080528_1568_1819 | 77 |
| 1138 | 3300046514 | Ga0495618_0103068 | Ga0495618_0103068_1296_1529 | 77 |
| 1139 | 3300046514 | Ga0495618_0220040 | Ga0495618_0220040_120_353 | 77 |
| 1140 | 3300046516 | Ga0495628_0039915 | Ga0495628_0039915_2056_2289 | 77 |
| 1141 | 3300046516 | Ga0495628_0165401 | Ga0495628_0165401_1094_1327 | 77 |
| 1142 | 3300046516 | Ga0495628_0238241 | Ga0495628_0238241_22_255 | 77 |
| 1143 | 3300046517 | Ga0495630_0016999 | Ga0495630_0016999_1809_2042 | 77 |
| 1144 | 3300046517 | Ga0495630_0084225 | Ga0495630_0084225_403_636 | 77 |
| 1145 | 3300046517 | Ga0495630_0216871 | Ga0495630_0216871_16_249 | 77 |
| 1146 | 3300046517 | Ga0495630_0636853 | Ga0495630_0636853_431_664 | 77 |
| 1147 | 3300046517 | Ga0495630_0676156 | Ga0495630_0676156_24_257 | 77 |
| 1148 | 3300046517 | Ga0495630_0713047 | Ga0495630_0713047_302_535 | 77 |
| 1149 | 3300046519 | Ga0495632_0020483 | Ga0495632_0020483_1141_1374 | 77 |
| 1150 | 3300046522 | Ga0495643_0001559 | Ga0495643_0001559_1630_1863 | 77 |
| 1151 | 3300046523 | Ga0495644_0063076 | Ga0495644_0063076_382_615 | 77 |
| 1152 | 3300046523 | Ga0495644_0083621 | Ga0495644_0083621_500_754 | 77 |
| 1153 | 3300046525 | Ga0495663_0056690 | Ga0495663_0056690_523_777 | 77 |
| 1154 | 3300046526 | Ga0495666_0084330 | Ga0495666_0084330_693_926 | 77 |
| 1155 | 3300046528 | Ga0495642_0223776 | Ga0495642_0223776_495_749 | 77 |
| 1156 | 3300046528 | Ga0495642_0511575 | Ga0495642_0511575_224_457 | 77 |
| 1157 | 3300046529 | Ga0495652_0017484 | Ga0495652_0017484_4019_4270 | 77 |
| 1158 | 3300046529 | Ga0495652_0025898 | Ga0495652_0025898_1856_2089 | 77 |
| 1159 | 3300046529 | Ga0495652_0034744 | Ga0495652_0034744_403_636 | 77 |
| 1160 | 3300046529 | Ga0495652_0352308 | Ga0495652_0352308_45_278 | 77 |
| 1161 | 3300046529 | Ga0495652_0377922 | Ga0495652_0377922_30_263 | 77 |
| 1162 | 3300046529 | Ga0495652_1033179 | Ga0495652_1033179_288_524 | 77 |
| 1163 | 3300046531 | Ga0495665_0008441 | Ga0495665_0008441_5246_5479 | 77 |
| 1164 | 3300046531 | Ga0495665_0010940 | Ga0495665_0010940_1018_1251 | 77 |
| 1165 | 3300046531 | Ga0495665_0017919 | Ga0495665_0017919_1076_1309 | 77 |
| 1166 | 3300046531 | Ga0495665_0211559 | Ga0495665_0211559_102_335 | 77 |
| 1167 | 3300046531 | Ga0495665_0339482 | Ga0495665_0339482_11_244 | 77 |
| 1168 | 3300046533 | Ga0495640_0096099 | Ga0495640_0096099_558_791 | 77 |
| 1169 | 3300046533 | Ga0495640_0109840 | Ga0495640_0109840_504_737 | 77 |
| 1170 | 3300046533 | Ga0495640_0121285 | Ga0495640_0121285_1296_1529 | 77 |
| 1171 | 3300046533 | Ga0495640_0815792 | Ga0495640_0815792_14_247 | 77 |
| 1172 | 3300046535 | Ga0495586_0003363 | Ga0495586_0003363_3654_3887 | 77 |
| 1173 | 3300046535 | Ga0495586_0126535 | Ga0495586_0126535_424_657 | 77 |
| 1174 | 3300046535 | Ga0495586_0379976 | Ga0495586_0379976_135_368 | 77 |
| 1175 | 3300046535 | Ga0495586_0430274 | Ga0495586_0430274_280_531 | 77 |
| 1176 | 3300046535 | Ga0495586_0677679 | Ga0495586_0677679_311_544 | 77 |
| 1177 | 3300046536 | Ga0495587_0002686 | Ga0495587_0002686_10681_10914 | 77 |
| 1178 | 3300046536 | Ga0495587_0007528 | Ga0495587_0007528_3655_3888 | 77 |
| 1179 | 3300046536 | Ga0495587_0066958 | Ga0495587_0066958_1290_1541 | 77 |
| 1180 | 3300046537 | Ga0495598_0044534 | Ga0495598_0044534_332_586 | 77 |
| 1181 | 3300046543 | Ga0495645_0020552 | Ga0495645_0020552_235_468 | 77 |
| 1182 | 3300046543 | Ga0495645_0153683 | Ga0495645_0153683_526_777 | 77 |
| 1183 | 3300046557 | Ga0495622_0085722 | Ga0495622_0085722_934_1167 | 77 |
| 1184 | 3300046557 | Ga0495622_0108014 | Ga0495622_0108014_11_244 | 77 |
| 1185 | 3300046557 | Ga0495622_0141533 | Ga0495622_0141533_413_646 | 77 |
| 1186 | 3300046558 | Ga0495633_0212677 | Ga0495633_0212677_375_608 | 77 |
| 1187 | 3300046558 | Ga0495633_0562945 | Ga0495633_0562945_39_272 | 77 |
| 1188 | 3300046559 | Ga0495667_0023497 | Ga0495667_0023497_3105_3338 | 77 |
| 1189 | 3300046615 | Ga0495656_0006417 | Ga0495656_0006417_1711_1965 | 77 |
| 1190 | 3300046615 | Ga0495656_0015188 | Ga0495656_0015188_2423_2656 | 77 |
| 1191 | 3300046615 | Ga0495656_0523719 | Ga0495656_0523719_106_339 | 77 |
| 1192 | 3300046616 | Ga0495668_0274835 | Ga0495668_0274835_86_319 | 77 |
| 1193 | 3300046642 | Ga0495634_0001805 | Ga0495634_0001805_10939_11172 | 77 |
| 1194 | 3300046642 | Ga0495634_0024244 | Ga0495634_0024244_2453_2686 | 77 |
| 1195 | 3300046642 | Ga0495634_0536005 | Ga0495634_0536005_403_636 | 77 |
| 1196 | 3300046648 | Ga0495611_0051654 | Ga0495611_0051654_17_250 | 77 |
| 1197 | 3300046648 | Ga0495611_0162654 | Ga0495611_0162654_493_747 | 77 |
| 1198 | 3300046648 | Ga0495611_0231408 | Ga0495611_0231408_552_785 | 77 |
| 1199 | 3300046660 | Ga0495625_0002573 | Ga0495625_0002573_19003_19236 | 77 |
| 1200 | 3300046663 | Ga0495635_0002591 | Ga0495635_0002591_11487_11720 | 77 |
| 1201 | 3300046663 | Ga0495635_0006046 | Ga0495635_0006046_1127_1378 | 77 |
| 1202 | 3300046663 | Ga0495635_0052660 | Ga0495635_0052660_2209_2442 | 77 |
| 1203 | 3300046663 | Ga0495635_0398335 | Ga0495635_0398335_601_837 | 77 |
| 1204 | 3300046663 | Ga0495635_0853723 | Ga0495635_0853723_108_341 | 77 |
| 1205 | 3300046664 | Ga0495659_0142221 | Ga0495659_0142221_193_447 | 77 |
| 1206 | 3300046665 | Ga0495661_0164531 | Ga0495661_0164531_852_1085 | 77 |
| 1207 | 3300046665 | Ga0495661_0622543 | Ga0495661_0622543_12_245 | 77 |
| 1208 | 3300046674 | Ga0495588_0000642 | Ga0495588_0000642_15327_15560 | 77 |
| 1209 | 3300046674 | Ga0495588_0002751 | Ga0495588_0002751_7279_7512 | 77 |
| 1210 | 3300046674 | Ga0495588_0142205 | Ga0495588_0142205_89_322 | 77 |
| 1211 | 3300046675 | Ga0495657_0003132 | Ga0495657_0003132_13418_13651 | 77 |
| 1212 | 3300046675 | Ga0495657_0038819 | Ga0495657_0038819_417_650 | 77 |
| 1213 | 3300046675 | Ga0495657_0191587 | Ga0495657_0191587_54_287 | 77 |
| 1214 | 3300046678 | Ga0495599_0072878 | Ga0495599_0072878_1508_1741 | 77 |
| 1215 | 3300046678 | Ga0495599_0263261 | Ga0495599_0263261_636_869 | 77 |
| 1216 | 3300046679 | Ga0495623_0013318 | Ga0495623_0013318_798_1049 | 77 |
| 1217 | 3300046679 | Ga0495623_0026406 | Ga0495623_0026406_3138_3371 | 77 |
| 1218 | 3300046679 | Ga0495623_0278068 | Ga0495623_0278068_583_816 | 77 |
| 1219 | 3300046680 | Ga0495646_0000324 | Ga0495646_0000324_10702_10935 | 77 |
| 1220 | 3300046680 | Ga0495646_0015431 | Ga0495646_0015431_2810_3061 | 77 |
| 1221 | 3300046680 | Ga0495646_0095738 | Ga0495646_0095738_531_764 | 77 |
| 1222 | 3300046681 | Ga0495647_0129790 | Ga0495647_0129790_148_381 | 77 |
| 1223 | 3300046683 | Ga0495658_0008765 | Ga0495658_0008765_4576_4809 | 77 |
| 1224 | 3300046683 | Ga0495658_0051207 | Ga0495658_0051207_283_516 | 77 |
| 1225 | 3300046683 | Ga0495658_0279756 | Ga0495658_0279756_120_353 | 77 |
| 1226 | 3300046683 | Ga0495658_0374186 | Ga0495658_0374186_106_339 | 77 |
| 1227 | 3300046684 | Ga0495669_0222810 | Ga0495669_0222810_619_873 | 77 |
| 1228 | 3300046689 | Ga0495613_0000764 | Ga0495613_0000764_14186_14419 | 77 |
| 1229 | 3300046689 | Ga0495613_0006537 | Ga0495613_0006537_4766_4999 | 77 |
| 1230 | 3300046689 | Ga0495613_0010964 | Ga0495613_0010964_992_1225 | 77 |
| 1231 | 3300046689 | Ga0495613_0015577 | Ga0495613_0015577_3140_3373 | 77 |
| 1232 | 3300046689 | Ga0495613_0404236 | Ga0495613_0404236_355_588 | 77 |
| 1233 | 3300046689 | Ga0495613_0716355 | Ga0495613_0716355_31_264 | 77 |
| 1234 | 3300046689 | Ga0495613_1035109 | Ga0495613_1035109_173_424 | 77 |
| 1235 | 3300046690 | Ga0495624_0026063 | Ga0495624_0026063_1621_1854 | 77 |
| 1236 | 3300046690 | Ga0495624_0058275 | Ga0495624_0058275_597_830 | 77 |
| 1237 | 3300046690 | Ga0495624_0355367 | Ga0495624_0355367_351_584 | 77 |
| 1238 | 3300046691 | Ga0495670_0013814 | Ga0495670_0013814_3395_3628 | 77 |
| 1239 | 3300046691 | Ga0495670_0019327 | Ga0495670_0019327_535_768 | 77 |
| 1240 | 3300046691 | Ga0495670_0051167 | Ga0495670_0051167_396_650 | 77 |
| 1241 | 3300046691 | Ga0495670_0077290 | Ga0495670_0077290_1307_1540 | 77 |
| 1242 | 3300046692 | Ga0495671_0036258 | Ga0495671_0036258_2241_2474 | 77 |
| 1243 | 3300046692 | Ga0495671_0070031 | Ga0495671_0070031_79_312 | 77 |
| 1244 | 3300046794 | Ga0495589_0116420 | Ga0495589_0116420_780_1034 | 77 |
| 1245 | 3300046794 | Ga0495589_0282406 | Ga0495589_0282406_372_605 | 77 |
| 1246 | 3300046794 | Ga0495589_0313285 | Ga0495589_0313285_93_326 | 77 |
| 1247 | 3300046809 | Ga0495600_0004577 | Ga0495600_0004577_4622_4855 | 77 |
| 1248 | 3300046809 | Ga0495600_0013881 | Ga0495600_0013881_3329_3562 | 77 |
| 1249 | 3300046809 | Ga0495600_0017958 | Ga0495600_0017958_1690_1941 | 77 |
| 1250 | 3300046809 | Ga0495600_0031433 | Ga0495600_0031433_2854_3087 | 77 |
| 1251 | 3300046810 | Ga0495660_0054464 | Ga0495660_0054464_321_554 | 77 |
| 1252 | 3300047315 | Ga0495581_0000238 | Ga0495581_0000238_20986_21219 | 77 |
| 1253 | 3300047315 | Ga0495581_0003747 | Ga0495581_0003747_54_287 | 77 |
| 1254 | 3300047315 | Ga0495581_0019051 | Ga0495581_0019051_2591_2824 | 77 |
| 1255 | 3300047315 | Ga0495581_0049246 | Ga0495581_0049246_1499_1732 | 77 |
| 1256 | 3300047315 | Ga0495581_0050619 | Ga0495581_0050619_2049_2282 | 77 |
| 1257 | 3300047315 | Ga0495581_0064715 | Ga0495581_0064715_540_773 | 77 |
| 1258 | 3300047317 | Ga0495604_0002587 | Ga0495604_0002587_45_278 | 77 |
| 1259 | 3300047317 | Ga0495604_0014277 | Ga0495604_0014277_3214_3447 | 77 |
| 1260 | 3300047317 | Ga0495604_0015750 | Ga0495604_0015750_4143_4376 | 77 |
| 1261 | 3300047317 | Ga0495604_0124864 | Ga0495604_0124864_531_764 | 77 |
| 1262 | 3300047318 | Ga0495636_0001805 | Ga0495636_0001805_3302_3535 | 77 |
| 1263 | 3300047318 | Ga0495636_0020472 | Ga0495636_0020472_532_786 | 77 |
| 1264 | 3300047318 | Ga0495636_0054268 | Ga0495636_0054268_744_977 | 77 |
| 1265 | 3300047318 | Ga0495636_0123511 | Ga0495636_0123511_809_1120 | 77 |
| 1266 | 3300047319 | Ga0495674_0046634 | Ga0495674_0046634_2663_2896 | 77 |
| 1267 | 3300047319 | Ga0495674_0125423 | Ga0495674_0125423_389_622 | 77 |
| 1268 | 3300047319 | Ga0495674_0174904 | Ga0495674_0174904_48_281 | 77 |
| 1269 | 3300047319 | Ga0495674_1241798 | Ga0495674_1241798_171_404 | 77 |
| 1270 | 3300047321 | Ga0495676_0001601 | Ga0495676_0001601_908_1141 | 77 |
| 1271 | 3300047321 | Ga0495676_0016702 | Ga0495676_0016702_2251_2484 | 77 |
| 1272 | 3300047321 | Ga0495676_0025794 | Ga0495676_0025794_528_761 | 77 |
| 1273 | 3300047321 | Ga0495676_0049046 | Ga0495676_0049046_2512_2745 | 77 |
| 1274 | 3300047321 | Ga0495676_0230854 | Ga0495676_0230854_36_269 | 77 |
| 1275 | 3300047321 | Ga0495676_0589931 | Ga0495676_0589931_278_511 | 77 |
| 1276 | 3300047321 | Ga0495676_0694091 | Ga0495676_0694091_30_263 | 77 |
| 1277 | 3300047321 | Ga0495676_0777352 | Ga0495676_0777352_98_331 | 77 |
| 1278 | 3300047321 | Ga0495676_0922942 | Ga0495676_0922942_311_544 | 77 |
| 1279 | 3300047322 | Ga0495680_0013650 | Ga0495680_0013650_3588_3821 | 77 |
| 1280 | 3300047322 | Ga0495680_0227853 | Ga0495680_0227853_56_289 | 77 |
| 1281 | 3300047443 | Ga0495687_001481 | Ga0495687_001481_1969_2202 | 77 |
| 1282 | 3300047444 | Ga0495675_0003598 | Ga0495675_0003598_2948_3181 | 77 |
| 1283 | 3300047444 | Ga0495675_0225808 | Ga0495675_0225808_492_725 | 77 |
| 1284 | 3300047445 | Ga0495677_0090778 | Ga0495677_0090778_25_258 | 77 |
| 1285 | 3300047447 | Ga0495685_000247 | Ga0495685_000247_1732_1965 | 77 |
| 1286 | 3300047447 | Ga0495685_133299 | Ga0495685_133299_131_364 | 77 |
| 1287 | 3300047447 | Ga0495685_215545 | Ga0495685_215545_15_248 | 77 |
| 1288 | 3300047470 | Ga0495681_0000245 | Ga0495681_0000245_39176_39409 | 77 |
| 1289 | 3300047470 | Ga0495681_0002253 | Ga0495681_0002253_281_514 | 77 |
| 1290 | 3300047471 | Ga0495684_0029888 | Ga0495684_0029888_1002_1235 | 77 |
| 1291 | 3300047472 | Ga0495686_0016970 | Ga0495686_0016970_3173_3406 | 77 |
| 1292 | 3300047472 | Ga0495686_0145358 | Ga0495686_0145358_1128_1361 | 77 |
| 1293 | 3300047673 | Ga0495593_0000138 | Ga0495593_0000138_27708_27941 | 77 |
| 1294 | 3300047673 | Ga0495593_0027904 | Ga0495593_0027904_1423_1656 | 77 |
| 1295 | 3300047673 | Ga0495593_0419964 | Ga0495593_0419964_114_347 | 77 |
| 1296 | 3300048088 | Ga0495602_0025051 | Ga0495602_0025051_4873_5106 | 77 |
| 1297 | 3300048088 | Ga0495602_0106055 | Ga0495602_0106055_1018_1251 | 77 |
| 1298 | 3300048088 | Ga0495602_0280340 | Ga0495602_0280340_333_584 | 77 |
| 1299 | 3300048088 | Ga0495602_0425073 | Ga0495602_0425073_484_717 | 77 |
| 1300 | 3300048089 | Ga0495614_0003797 | Ga0495614_0003797_6358_6591 | 77 |
| 1301 | 3300048089 | Ga0495614_0007036 | Ga0495614_0007036_826_1059 | 77 |
| 1302 | 3300048089 | Ga0495614_0115694 | Ga0495614_0115694_893_1126 | 77 |
| 1303 | 3300048091 | Ga0495626_0254129 | Ga0495626_0254129_86_319 | 77 |
| 1304 | 3300048903 | Ga0496100_0075470 | Ga0496100_0075470_1062_1295 | 77 |
| 1305 | 3300048903 | Ga0496100_0099232 | Ga0496100_0099232_1662_1895 | 77 |
| 1306 | 3300048904 | Ga0496101_0045807 | Ga0496101_0045807_2769_3002 | 77 |
| 1307 | 3300048904 | Ga0496101_0755843 | Ga0496101_0755843_384_617 | 77 |
| 1308 | 3300048904 | Ga0496101_0969990 | Ga0496101_0969990_98_331 | 77 |
| 1309 | 3300048905 | Ga0496102_0005011 | Ga0496102_0005011_825_1058 | 77 |
| 1310 | 3300048905 | Ga0496102_0010869 | Ga0496102_0010869_2606_2839 | 77 |
| 1311 | 3300048905 | Ga0496102_0035508 | Ga0496102_0035508_549_782 | 77 |
| 1312 | 3300048906 | Ga0496103_0027147 | Ga0496103_0027147_1553_1786 | 77 |
| 1313 | 3300048906 | Ga0496103_0113802 | Ga0496103_0113802_970_1203 | 77 |
| 1314 | 3300048906 | Ga0496103_0137800 | Ga0496103_0137800_116_364 | 77 |
| 1315 | 3300048906 | Ga0496103_1059738 | Ga0496103_1059738_109_345 | 77 |
| 1316 | 3300048907 | Ga0496104_0008259 | Ga0496104_0008259_1023_1256 | 77 |
| 1317 | 3300048907 | Ga0496104_0751688 | Ga0496104_0751688_535_771 | 77 |
| 1318 | 3300048907 | Ga0496104_1126017 | Ga0496104_1126017_278_511 | 77 |
| 1319 | 3300048908 | Ga0496105_0060824 | Ga0496105_0060824_2186_2419 | 77 |
| 1320 | 3300048908 | Ga0496105_0353605 | Ga0496105_0353605_258_491 | 77 |
| 1321 | 3300048908 | Ga0496105_0520553 | Ga0496105_0520553_269_505 | 77 |
| 1322 | 3300048908 | Ga0496105_0527843 | Ga0496105_0527843_291_524 | 77 |
| 1323 | 3300048909 | Ga0496106_0047288 | Ga0496106_0047288_768_1001 | 77 |
| 1324 | 3300048909 | Ga0496106_0063796 | Ga0496106_0063796_1523_1756 | 77 |
| 1325 | 3300048909 | Ga0496106_0118244 | Ga0496106_0118244_759_992 | 77 |
| 1326 | 3300048910 | Ga0496107_0002569 | Ga0496107_0002569_11334_11567 | 77 |
| 1327 | 3300048910 | Ga0496107_0060942 | Ga0496107_0060942_1842_2075 | 77 |
| 1328 | 3300048911 | Ga0496108_0058515 | Ga0496108_0058515_2595_2828 | 77 |
| 1329 | 3300048911 | Ga0496108_0085285 | Ga0496108_0085285_2427_2660 | 77 |
| 1330 | 3300048911 | Ga0496108_0188911 | Ga0496108_0188911_356_589 | 77 |
| 1331 | 3300048912 | Ga0496109_0127666 | Ga0496109_0127666_1481_1714 | 77 |
| 1332 | 3300048912 | Ga0496109_0544574 | Ga0496109_0544574_579_812 | 77 |
| 1333 | 3300048912 | Ga0496109_0716823 | Ga0496109_0716823_632_868 | 77 |
| 1334 | 3300048912 | Ga0496109_0764108 | Ga0496109_0764108_225_458 | 77 |
| 1335 | 3300048912 | Ga0496109_1056385 | Ga0496109_1056385_430_666 | 77 |
| 1336 | 3300048912 | Ga0496109_1462390 | Ga0496109_1462390_237_470 | 77 |
| 1337 | 3300048913 | Ga0496110_0027642 | Ga0496110_0027642_3998_4231 | 77 |
| 1338 | 3300048913 | Ga0496110_0038230 | Ga0496110_0038230_2596_2829 | 77 |
| 1339 | 3300048913 | Ga0496110_0174858 | Ga0496110_0174858_479_712 | 77 |
| 1340 | 3300048913 | Ga0496110_1864313 | Ga0496110_1864313_201_440 | 77 |
| 1341 | 3300048914 | Ga0496111_0035067 | Ga0496111_0035067_2487_2720 | 77 |
| 1342 | 3300048914 | Ga0496111_0741937 | Ga0496111_0741937_328_564 | 77 |
| 1343 | 3300048915 | Ga0496112_0113328 | Ga0496112_0113328_760_993 | 77 |
| 1344 | 3300048915 | Ga0496112_0404333 | Ga0496112_0404333_174_407 | 77 |
| 1345 | 3300048915 | Ga0496112_0832628 | Ga0496112_0832628_592_828 | 77 |
| 1346 | 3300048916 | Ga0496113_0040177 | Ga0496113_0040177_2427_2660 | 77 |
| 1347 | 3300048916 | Ga0496113_0088139 | Ga0496113_0088139_582_815 | 77 |
| 1348 | 3300048916 | Ga0496113_0720869 | Ga0496113_0720869_124_357 | 77 |
| 1349 | 3300048917 | Ga0496114_0038329 | Ga0496114_0038329_83_316 | 77 |
| 1350 | 3300048917 | Ga0496114_0107652 | Ga0496114_0107652_381_617 | 77 |
| 1351 | 3300048917 | Ga0496114_1802307 | Ga0496114_1802307_172_405 | 77 |
| 1352 | 3300048918 | Ga0496115_0400190 | Ga0496115_0400190_307_540 | 77 |
| 1353 | 3300048922 | Ga0496119_0234972 | Ga0496119_0234972_487_720 | 77 |
| 1354 | 3300048929 | Ga0496126_0684430 | Ga0496126_0684430_285_518 | 77 |
| 1355 | 3300049534 | Ga0501318_081340 | Ga0501318_081340_55_288 | 77 |
| 1356 | 3300049568 | Ga0501031_0001780 | Ga0501031_0001780_4570_4806 | 77 |
| 1357 | 3300049568 | Ga0501031_0017177 | Ga0501031_0017177_174_407 | 77 |
| 1358 | 3300049568 | Ga0501031_0029479 | Ga0501031_0029479_335_568 | 77 |
| 1359 | 3300049568 | Ga0501031_0061817 | Ga0501031_0061817_2103_2342 | 77 |
| 1360 | 3300049568 | Ga0501031_0936363 | Ga0501031_0936363_220_456 | 77 |
| 1361 | 3300049569 | Ga0501032_0028713 | Ga0501032_0028713_3051_3290 | 77 |
| 1362 | 3300049569 | Ga0501032_0123909 | Ga0501032_0123909_1265_1504 | 77 |
| 1363 | 3300049569 | Ga0501032_0552085 | Ga0501032_0552085_458_691 | 77 |
| 1364 | 3300049570 | Ga0501033_0006059 | Ga0501033_0006059_2117_2350 | 77 |
| 1365 | 3300049570 | Ga0501033_0021304 | Ga0501033_0021304_1476_1709 | 77 |
| 1366 | 3300049570 | Ga0501033_0037724 | Ga0501033_0037724_2287_2523 | 77 |
| 1367 | 3300049570 | Ga0501033_0072646 | Ga0501033_0072646_1918_2151 | 77 |
| 1368 | 3300049570 | Ga0501033_0192030 | Ga0501033_0192030_732_971 | 77 |
| 1369 | 3300049570 | Ga0501033_1007595 | Ga0501033_1007595_33_266 | 77 |
| 1370 | 3300049570 | Ga0501033_1019594 | Ga0501033_1019594_17_250 | 77 |
| 1371 | 3300049571 | Ga0501034_0000924 | Ga0501034_0000924_38880_39116 | 77 |
| 1372 | 3300049571 | Ga0501034_0002789 | Ga0501034_0002789_10266_10499 | 77 |
| 1373 | 3300049571 | Ga0501034_0022110 | Ga0501034_0022110_5840_6076 | 77 |
| 1374 | 3300049571 | Ga0501034_0171104 | Ga0501034_0171104_821_1054 | 77 |
| 1375 | 3300049571 | Ga0501034_0172536 | Ga0501034_0172536_395_631 | 77 |
| 1376 | 3300049571 | Ga0501034_0495594 | Ga0501034_0495594_848_1084 | 77 |
| 1377 | 3300049572 | Ga0501036_0000311 | Ga0501036_0000311_5940_6179 | 77 |
| 1378 | 3300049572 | Ga0501036_0035488 | Ga0501036_0035488_2094_2327 | 77 |
| 1379 | 3300049572 | Ga0501036_0056446 | Ga0501036_0056446_597_830 | 77 |
| 1380 | 3300049572 | Ga0501036_0060193 | Ga0501036_0060193_1078_1314 | 77 |
| 1381 | 3300049572 | Ga0501036_0322210 | Ga0501036_0322210_507_746 | 77 |
| 1382 | 3300049572 | Ga0501036_0392960 | Ga0501036_0392960_255_488 | 77 |
| 1383 | 3300049572 | Ga0501036_1090149 | Ga0501036_1090149_174_407 | 77 |
| 1384 | 3300049573 | Ga0501037_0056238 | Ga0501037_0056238_1885_2121 | 77 |
| 1385 | 3300049573 | Ga0501037_0096108 | Ga0501037_0096108_1598_1831 | 77 |
| 1386 | 3300049573 | Ga0501037_0111730 | Ga0501037_0111730_442_675 | 77 |
| 1387 | 3300049573 | Ga0501037_0180209 | Ga0501037_0180209_555_794 | 77 |
| 1388 | 3300049574 | Ga0501038_0000729 | Ga0501038_0000729_24375_24611 | 77 |
| 1389 | 3300049574 | Ga0501038_0001008 | Ga0501038_0001008_2482_2721 | 77 |
| 1390 | 3300049574 | Ga0501038_0001438 | Ga0501038_0001438_21250_21483 | 77 |
| 1391 | 3300049574 | Ga0501038_0003450 | Ga0501038_0003450_13213_13446 | 77 |
| 1392 | 3300049574 | Ga0501038_0022056 | Ga0501038_0022056_1235_1474 | 77 |
| 1393 | 3300049574 | Ga0501038_0183858 | Ga0501038_0183858_592_825 | 77 |
| 1394 | 3300049575 | Ga0501039_0001818 | Ga0501039_0001818_9178_9417 | 77 |
| 1395 | 3300049575 | Ga0501039_0012672 | Ga0501039_0012672_6127_6360 | 77 |
| 1396 | 3300049575 | Ga0501039_0395712 | Ga0501039_0395712_466_705 | 77 |
| 1397 | 3300049575 | Ga0501039_0493035 | Ga0501039_0493035_336_572 | 77 |
| 1398 | 3300049576 | Ga0501040_0000601 | Ga0501040_0000601_2811_3050 | 77 |
| 1399 | 3300049576 | Ga0501040_0030966 | Ga0501040_0030966_584_823 | 77 |
| 1400 | 3300049576 | Ga0501040_0357376 | Ga0501040_0357376_559_792 | 77 |
| 1401 | 3300049577 | Ga0501041_0000058 | Ga0501041_0000058_12231_12464 | 77 |
| 1402 | 3300049577 | Ga0501041_0017390 | Ga0501041_0017390_898_1137 | 77 |
| 1403 | 3300049578 | Ga0501042_0000028 | Ga0501042_0000028_41075_41308 | 77 |
| 1404 | 3300049578 | Ga0501042_0001191 | Ga0501042_0001191_3594_3833 | 77 |
| 1405 | 3300049578 | Ga0501042_0163184 | Ga0501042_0163184_1192_1431 | 77 |
| 1406 | 3300049578 | Ga0501042_0164637 | Ga0501042_0164637_921_1154 | 77 |
| 1407 | 3300049579 | Ga0501043_0006711 | Ga0501043_0006711_8897_9130 | 77 |
| 1408 | 3300049579 | Ga0501043_0047630 | Ga0501043_0047630_145_381 | 77 |
| 1409 | 3300049579 | Ga0501043_0248654 | Ga0501043_0248654_617_856 | 77 |
| 1410 | 3300049579 | Ga0501043_0374102 | Ga0501043_0374102_57_290 | 77 |
| 1411 | 3300049580 | Ga0501046_0000269 | Ga0501046_0000269_15245_15478 | 77 |
| 1412 | 3300049580 | Ga0501046_0002221 | Ga0501046_0002221_11682_11921 | 77 |
| 1413 | 3300049580 | Ga0501046_0332087 | Ga0501046_0332087_466_702 | 77 |
| 1414 | 3300049580 | Ga0501046_0948634 | Ga0501046_0948634_290_523 | 77 |
| 1415 | 3300049581 | Ga0501047_0000029 | Ga0501047_0000029_48737_48970 | 77 |
| 1416 | 3300049581 | Ga0501047_0051999 | Ga0501047_0051999_2165_2401 | 77 |
| 1417 | 3300049581 | Ga0501047_0100758 | Ga0501047_0100758_2306_2545 | 77 |
| 1418 | 3300049581 | Ga0501047_0124606 | Ga0501047_0124606_333_566 | 77 |
| 1419 | 3300049581 | Ga0501047_0199083 | Ga0501047_0199083_89_322 | 77 |
| 1420 | 3300049581 | Ga0501047_0653749 | Ga0501047_0653749_187_420 | 77 |
| 1421 | 3300049581 | Ga0501047_1227583 | Ga0501047_1227583_266_499 | 77 |
| 1422 | 3300049582 | Ga0501048_0000208 | Ga0501048_0000208_10241_10474 | 77 |
| 1423 | 3300049582 | Ga0501048_0000611 | Ga0501048_0000611_9413_9649 | 77 |
| 1424 | 3300049582 | Ga0501048_0326634 | Ga0501048_0326634_55_288 | 77 |
| 1425 | 3300049583 | Ga0501067_0200869 | Ga0501067_0200869_101_334 | 77 |
| 1426 | 3300049583 | Ga0501067_0293683 | Ga0501067_0293683_183_416 | 77 |
| 1427 | 3300049583 | Ga0501067_0729157 | Ga0501067_0729157_167_400 | 77 |
| 1428 | 3300049584 | Ga0501068_0066237 | Ga0501068_0066237_1608_1841 | 77 |
| 1429 | 3300049584 | Ga0501068_0216071 | Ga0501068_0216071_467_700 | 77 |
| 1430 | 3300049585 | Ga0501069_0085582 | Ga0501069_0085582_203_436 | 77 |
| 1431 | 3300049585 | Ga0501069_0111832 | Ga0501069_0111832_265_498 | 77 |
| 1432 | 3300049585 | Ga0501069_0351033 | Ga0501069_0351033_332_565 | 77 |
| 1433 | 3300049585 | Ga0501069_0560716 | Ga0501069_0560716_404_637 | 77 |
| 1434 | 3300049586 | Ga0501070_0003598 | Ga0501070_0003598_1872_2105 | 77 |
| 1435 | 3300049586 | Ga0501070_0038542 | Ga0501070_0038542_1268_1504 | 77 |
| 1436 | 3300049586 | Ga0501070_0082761 | Ga0501070_0082761_617_853 | 77 |
| 1437 | 3300049586 | Ga0501070_0259504 | Ga0501070_0259504_1165_1401 | 77 |
| 1438 | 3300049586 | Ga0501070_0537171 | Ga0501070_0537171_95_328 | 77 |
| 1439 | 3300049586 | Ga0501070_0615630 | Ga0501070_0615630_575_811 | 77 |
| 1440 | 3300049586 | Ga0501070_0755595 | Ga0501070_0755595_423_656 | 77 |
| 1441 | 3300049587 | Ga0501071_0001455 | Ga0501071_0001455_6224_6463 | 77 |
| 1442 | 3300049587 | Ga0501071_0003307 | Ga0501071_0003307_1444_1677 | 77 |
| 1443 | 3300049587 | Ga0501071_0022572 | Ga0501071_0022572_3629_3868 | 77 |
| 1444 | 3300049587 | Ga0501071_0245959 | Ga0501071_0245959_1072_1305 | 77 |
| 1445 | 3300049588 | Ga0501072_0000452 | Ga0501072_0000452_6088_6321 | 77 |
| 1446 | 3300049588 | Ga0501072_0607383 | Ga0501072_0607383_321_560 | 77 |
| 1447 | 3300049589 | Ga0501073_0148755 | Ga0501073_0148755_453_689 | 77 |
| 1448 | 3300049589 | Ga0501073_0269320 | Ga0501073_0269320_741_974 | 77 |
| 1449 | 3300049589 | Ga0501073_0428564 | Ga0501073_0428564_121_354 | 77 |
| 1450 | 3300049590 | Ga0501074_0006540 | Ga0501074_0006540_5656_5889 | 77 |
| 1451 | 3300049590 | Ga0501074_0010495 | Ga0501074_0010495_1948_2187 | 77 |
| 1452 | 3300049590 | Ga0501074_0156894 | Ga0501074_0156894_240_476 | 77 |
| 1453 | 3300049590 | Ga0501074_0501964 | Ga0501074_0501964_325_564 | 77 |
| 1454 | 3300049591 | Ga0501075_0002435 | Ga0501075_0002435_3509_3742 | 77 |
| 1455 | 3300049591 | Ga0501075_0025620 | Ga0501075_0025620_1231_1470 | 77 |
| 1456 | 3300049591 | Ga0501075_0206031 | Ga0501075_0206031_1210_1443 | 77 |
| 1457 | 3300049592 | Ga0501076_0000061 | Ga0501076_0000061_26214_26453 | 77 |
| 1458 | 3300049592 | Ga0501076_0363209 | Ga0501076_0363209_678_911 | 77 |
| 1459 | 3300049593 | Ga0501077_0000349 | Ga0501077_0000349_23973_24212 | 77 |
| 1460 | 3300049593 | Ga0501077_0285411 | Ga0501077_0285411_106_345 | 77 |
| 1461 | 3300049661 | Ga0501217_094455 | Ga0501217_094455_156_389 | 77 |
| 1462 | 3300049662 | Ga0501222_074394 | Ga0501222_074394_209_442 | 77 |
| 1463 | 3300049675 | Ga0501243_099432 | Ga0501243_099432_300_533 | 77 |
| 1464 | 3300049680 | Ga0501250_016109 | Ga0501250_016109_348_581 | 77 |
| 1465 | 3300049741 | Ga0501079_0000185 | Ga0501079_0000185_20081_20314 | 77 |
| 1466 | 3300049741 | Ga0501079_0004729 | Ga0501079_0004729_495_731 | 77 |
| 1467 | 3300049741 | Ga0501079_0167023 | Ga0501079_0167023_273_512 | 77 |
| 1468 | 3300049742 | Ga0501080_0035150 | Ga0501080_0035150_1399_1638 | 77 |
| 1469 | 3300049742 | Ga0501080_0050424 | Ga0501080_0050424_1419_1652 | 77 |
| 1470 | 3300049742 | Ga0501080_0091102 | Ga0501080_0091102_2566_2799 | 77 |
| 1471 | 3300049742 | Ga0501080_0922097 | Ga0501080_0922097_478_714 | 77 |
| 1472 | 3300049742 | Ga0501080_1263783 | Ga0501080_1263783_254_487 | 77 |
| 1473 | 3300049743 | Ga0501081_0000808 | Ga0501081_0000808_3032_3271 | 77 |
| 1474 | 3300049743 | Ga0501081_0014905 | Ga0501081_0014905_1205_1444 | 77 |
| 1475 | 3300049744 | Ga0501083_0072299 | Ga0501083_0072299_1155_1394 | 77 |
| 1476 | 3300049744 | Ga0501083_0081237 | Ga0501083_0081237_1717_1956 | 77 |
| 1477 | 3300049822 | Ga0501035_0005880 | Ga0501035_0005880_7008_7241 | 77 |
| 1478 | 3300049822 | Ga0501035_0030498 | Ga0501035_0030498_2332_2568 | 77 |
| 1479 | 3300049822 | Ga0501035_0057970 | Ga0501035_0057970_1941_2174 | 77 |
| 1480 | 3300049822 | Ga0501035_0059274 | Ga0501035_0059274_499_738 | 77 |
| 1481 | 3300049822 | Ga0501035_0082543 | Ga0501035_0082543_750_983 | 77 |
| 1482 | 3300049822 | Ga0501035_0629839 | Ga0501035_0629839_354_587 | 77 |
| 1483 | 3300049822 | Ga0501035_0677754 | Ga0501035_0677754_535_768 | 77 |
| 1484 | 3300049822 | Ga0501035_0813446 | Ga0501035_0813446_93_329 | 77 |
| 1485 | 3300049823 | Ga0501044_0004269 | Ga0501044_0004269_8812_9045 | 77 |
| 1486 | 3300049823 | Ga0501044_0016800 | Ga0501044_0016800_5468_5701 | 77 |
| 1487 | 3300049823 | Ga0501044_0053274 | Ga0501044_0053274_1646_1882 | 77 |
| 1488 | 3300049823 | Ga0501044_0130851 | Ga0501044_0130851_1845_2078 | 77 |
| 1489 | 3300049823 | Ga0501044_0313001 | Ga0501044_0313001_1156_1389 | 77 |
| 1490 | 3300049823 | Ga0501044_0794045 | Ga0501044_0794045_247_480 | 77 |
| 1491 | 3300049823 | Ga0501044_1328849 | Ga0501044_1328849_113_346 | 77 |
| 1492 | 3300049824 | Ga0501045_0000044 | Ga0501045_0000044_44163_44396 | 77 |
| 1493 | 3300049824 | Ga0501045_0000099 | Ga0501045_0000099_30374_30613 | 77 |
| 1494 | 3300049824 | Ga0501045_0003799 | Ga0501045_0003799_10061_10300 | 77 |
| 1495 | 3300049824 | Ga0501045_0416961 | Ga0501045_0416961_34_267 | 77 |
| 1496 | 3300050490 | nmdc:mga03n38_642101_c1 | nmdc:mga03n38_642101_c1_340_573 | 77 |
| 1497 | 3300050494 | nmdc:mga06z11_6901_c1 | nmdc:mga06z11_6901_c1_3179_3412 | 77 |
| 1498 | 3300050495 | nmdc:mga04h51_7603_c1 | nmdc:mga04h51_7603_c1_380_613 | 77 |
| 1499 | 3300050496 | nmdc:mga07m45_412112_c1 | nmdc:mga07m45_412112_c1_339_572 | 77 |
| 1500 | 3300050507 | nmdc:mga05p37_1978877_c1 | nmdc:mga05p37_1978877_c1_235_474 | 77 |
| 1501 | 3300050507 | nmdc:mga05p37_2500_c1 | nmdc:mga05p37_2500_c1_14999_15238 | 77 |
| 1502 | 3300050507 | nmdc:mga05p37_296234_c1 | nmdc:mga05p37_296234_c1_177_410 | 77 |
| 1503 | 3300050507 | nmdc:mga05p37_476371_c1 | nmdc:mga05p37_476371_c1_514_753 | 77 |
| 1504 | 3300050508 | nmdc:mga09592_29416_c1 | nmdc:mga09592_29416_c1_3941_4180 | 77 |
| 1505 | 3300050508 | nmdc:mga09592_297686_c1 | nmdc:mga09592_297686_c1_154_387 | 77 |
| 1506 | 3300050508 | nmdc:mga09592_621605_c1 | nmdc:mga09592_621605_c1_285_524 | 77 |
| 1507 | 3300050509 | nmdc:mga0qj67_11266_c1 | nmdc:mga0qj67_11266_c1_372_611 | 77 |
| 1508 | 3300050509 | nmdc:mga0qj67_1196375_c1 | nmdc:mga0qj67_1196375_c1_167_403 | 77 |
| 1509 | 3300050510 | nmdc:mga06r32_39821_c1 | nmdc:mga06r32_39821_c1_3568_3807 | 77 |
| 1510 | 3300050511 | nmdc:mga08y16_1109_c1 | nmdc:mga08y16_1109_c1_2455_2694 | 77 |
| 1511 | 3300050512 | nmdc:mga0n895_2244304_c1 | nmdc:mga0n895_2244304_c1_64_300 | 77 |
| 1512 | 3300050512 | nmdc:mga0n895_336722_c1 | nmdc:mga0n895_336722_c1_274_507 | 77 |
| 1513 | 3300050512 | nmdc:mga0n895_557889_c1 | nmdc:mga0n895_557889_c1_23_256 | 77 |
| 1514 | 3300050513 | nmdc:mga0rr50_6991_c1 | nmdc:mga0rr50_6991_c1_795_1028 | 77 |
| 1515 | 3300050514 | nmdc:mga08x19_43194_c1 | nmdc:mga08x19_43194_c1_941_1174 | 77 |
| 1516 | 3300050514 | nmdc:mga08x19_927160_c1 | nmdc:mga08x19_927160_c1_244_531 | 77 |
| 1517 | 3300050515 | nmdc:mga0a205_18720_c2 | nmdc:mga0a205_18720_c2_2693_2932 | 77 |
| 1518 | 3300050515 | nmdc:mga0a205_1920_c1 | nmdc:mga0a205_1920_c1_15967_16200 | 77 |
| 1519 | 3300050515 | nmdc:mga0a205_472147_c1 | nmdc:mga0a205_472147_c1_14_247 | 77 |
| 1520 | 3300053077 | Ga0495601_0054938 | Ga0495601_0054938_1592_1843 | 77 |
| 1521 | 3300053077 | Ga0495601_0315218 | Ga0495601_0315218_530_763 | 77 |
| 1522 | 3300053077 | Ga0495601_0507899 | Ga0495601_0507899_53_286 | 77 |
| 1523 | 3300053078 | Ga0495612_0024870 | Ga0495612_0024870_2009_2242 | 77 |
| 1524 | 3300053078 | Ga0495612_0052359 | Ga0495612_0052359_84_317 | 77 |
| 1525 | 3300053078 | Ga0495612_0106079 | Ga0495612_0106079_267_518 | 77 |
| 1526 | 3300053083 | Ga0495655_0183927 | Ga0495655_0183927_144_377 | 77 |
| 1527 | 3300053083 | Ga0495655_0242719 | Ga0495655_0242719_86_319 | 77 |
| 1528 | 3300053084 | Ga0495595_0004357 | Ga0495595_0004357_4682_4915 | 77 |
| 1529 | 3300053084 | Ga0495595_0317009 | Ga0495595_0317009_532_768 | 77 |
| 1530 | 3300053085 | Ga0495619_0080196 | Ga0495619_0080196_1319_1552 | 77 |
| 1531 | 3300053085 | Ga0495619_0081314 | Ga0495619_0081314_1253_1504 | 77 |
| 1532 | 3300053086 | Ga0500578_0061920 | Ga0500578_0061920_1226_1459 | 77 |
| 1533 | 3300053086 | Ga0500578_0073961 | Ga0500578_0073961_498_731 | 77 |
| 1534 | 3300053088 | Ga0500644_0087099 | Ga0500644_0087099_794_1027 | 77 |
| 1535 | 3300053090 | Ga0500646_0172845 | Ga0500646_0172845_208_441 | 77 |
| 1536 | 3300053092 | Ga0500583_0177827 | Ga0500583_0177827_227_460 | 77 |
| 1537 | 3300053094 | Ga0500566_0029128 | Ga0500566_0029128_211_444 | 77 |
| 1538 | 3300053095 | Ga0500640_001975 | Ga0500640_001975_1445_1678 | 77 |
| 1539 | 3300053100 | Ga0500660_133674 | Ga0500660_133674_281_514 | 77 |
| 1540 | 3300053101 | Ga0500553_121642 | Ga0500553_121642_749_982 | 77 |
| 1541 | 3300053107 | Ga0500560_043872 | Ga0500560_043872_87_320 | 77 |
| 1542 | 3300053107 | Ga0500560_239485 | Ga0500560_239485_219_452 | 77 |
| 1543 | 3300053109 | Ga0500569_005079 | Ga0500569_005079_151_384 | 77 |
| 1544 | 3300053113 | Ga0500580_239330 | Ga0500580_239330_36_269 | 77 |
| 1545 | 3300053114 | Ga0500582_185900 | Ga0500582_185900_115_348 | 77 |
| 1546 | 3300053123 | Ga0500614_010286 | Ga0500614_010286_1171_1404 | 77 |
| 1547 | 3300053126 | Ga0500621_206050 | Ga0500621_206050_163_396 | 77 |
| 1548 | 3300053129 | Ga0500628_001049 | Ga0500628_001049_3330_3563 | 77 |
| 1549 | 3300053131 | Ga0500652_001997 | Ga0500652_001997_4112_4345 | 77 |
| 1550 | 3300053134 | Ga0500658_0004724 | Ga0500658_0004724_4025_4258 | 77 |
| 1551 | 3300053136 | Ga0500559_0304142 | Ga0500559_0304142_430_663 | 77 |
| 1552 | 3300053137 | Ga0500561_0000420 | Ga0500561_0000420_2775_3008 | 77 |
| 1553 | 3300053140 | Ga0500573_0025239 | Ga0500573_0025239_227_460 | 77 |
| 1554 | 3300053140 | Ga0500573_0508023 | Ga0500573_0508023_266_499 | 77 |
| 1555 | 3300053142 | Ga0500577_0268877 | Ga0500577_0268877_225_458 | 77 |
| 1556 | 3300053143 | Ga0500579_036618 | Ga0500579_036618_1042_1275 | 77 |
| 1557 | 3300053145 | Ga0500586_260713 | Ga0500586_260713_193_426 | 77 |
| 1558 | 3300053146 | Ga0500588_0176562 | Ga0500588_0176562_439_672 | 77 |
| 1559 | 3300053149 | Ga0500600_0047044 | Ga0500600_0047044_1353_1586 | 77 |
| 1560 | 3300053149 | Ga0500600_0231398 | Ga0500600_0231398_201_434 | 77 |
| 1561 | 3300053150 | Ga0500603_178475 | Ga0500603_178475_300_533 | 77 |
| 1562 | 3300053152 | Ga0500606_139456 | Ga0500606_139456_193_426 | 77 |
| 1563 | 3300053153 | Ga0500616_0029739 | Ga0500616_0029739_1842_2075 | 77 |
| 1564 | 3300053158 | Ga0500627_0221498 | Ga0500627_0221498_222_455 | 77 |
| 1565 | 3300053160 | Ga0500633_0000496 | Ga0500633_0000496_2878_3111 | 77 |
| 1566 | 3300053161 | Ga0500634_0000253 | Ga0500634_0000253_1586_1819 | 77 |
| 1567 | 3300053161 | Ga0500634_0187598 | Ga0500634_0187598_360_593 | 77 |
| 1568 | 3300053732 | Ga0500656_000060 | Ga0500656_000060_249_482 | 77 |
| 1569 | 3300053739 | Ga0500587_002698 | Ga0500587_002698_1353_1586 | 77 |
| 1570 | 3300054114 | Ga0501084_0002725 | Ga0501084_0002725_12862_13101 | 77 |
| 1571 | 3300054114 | Ga0501084_0007261 | Ga0501084_0007261_8839_9072 | 77 |
| 1572 | 3300054114 | Ga0501084_0190792 | Ga0501084_0190792_531_764 | 77 |
| 1573 | 3300054114 | Ga0501084_0903292 | Ga0501084_0903292_96_329 | 77 |
| 1574 | 3300059421 | Ga0590071_003818 | Ga0590071_003818_1283_1516 | 77 |
| 1575 | 3300059423 | Ga0590074_013428 | Ga0590074_013428_271_504 | 77 |
| 1576 | 3300059423 | Ga0590074_021961 | Ga0590074_021961_505_744 | 77 |
| 1577 | 3300059424 | Ga0590075_018110 | Ga0590075_018110_1330_1563 | 77 |
| 1578 | 3300059426 | Ga0590077_000958 | Ga0590077_000958_6660_6893 | 77 |
| 1579 | 3300059426 | Ga0590077_073095 | Ga0590077_073095_478_717 | 77 |
| 1580 | 3300059492 | Ga0587073_0298714 | Ga0587073_0298714_159_392 | 77 |
| 1581 | 3300059504 | Ga0587082_162506 | Ga0587082_162506_132_365 | 77 |
| 1582 | 3300059643 | Ga0587072_186239 | Ga0587072_186239_130_363 | 77 |
| 1583 | 3300060353 | Ga0501082_0003253 | Ga0501082_0003253_5194_5427 | 77 |
| 1584 | 3300060353 | Ga0501082_0041255 | Ga0501082_0041255_1652_1891 | 77 |
| 1585 | 3300060353 | Ga0501082_0385269 | Ga0501082_0385269_199_438 | 77 |
| 1586 | 3300061719 | Ga0466962_0000765 | Ga0466962_0000765_12910_13161 | 77 |
| 1587 | 3300061719 | Ga0466962_0027782 | Ga0466962_0027782_109_342 | 77 |
| 1588 | 3300061719 | Ga0466962_0077974 | Ga0466962_0077974_1042_1278 | 77 |
| 1589 | 3300061734 | Ga0530510_0000204 | Ga0530510_0000204_25760_25999 | 77 |
| 1590 | 3300061734 | Ga0530510_0036828 | Ga0530510_0036828_206_439 | 77 |
| 1591 | 3300061734 | Ga0530510_0817184 | Ga0530510_0817184_453_692 | 77 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zbc-assembly1.cif.gz_C-2 | crystal structure of sts042, a stand-alone ram module protein, from hyperthermophilic archaeon sulfolobus tokodaii strain7. | 0.9017 | 3 | 75 |
| 2djw-assembly1.cif.gz_F | crystal structure of ttha0845 from thermus thermophilus hb8 | 0.8893 | 1 | 77 |
| 2e1a-assembly1.cif.gz_B | crystal structure of ffrp-dm1 | 0.8817 | 1 | 75 |
| 2djw-assembly1.cif.gz_F | crystal structure of ttha0845 from thermus thermophilus hb8 | 0.8786 | 1 | 77 |
| 2efo-assembly1.cif.gz_A | crystal structure of tyr77 to ala of st1022 from sulfolobus tokodaii 7 | 0.878 | 2 | 77 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2djwE01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain | 0.8937 | 1 | 74 | 3.30.70.920 |
| 2zbcB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain | 0.8935 | 3 | 71 | 3.30.70.920 |
| 2djwE01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain | 0.8826 | 1 | 74 | 3.30.70.920 |
| 2z4pD01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain | 0.8791 | 1 | 74 | 3.30.70.920 |
| 2jsxA01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain | 0.8773 | 3 | 72 | 3.30.70.920 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I4CSG5-F1-model_v4 | AsnC family protein | 0.9747 | 2 | 77 |
|
| AF-A0A1H5RBS8-F1-model_v4 | AsnC family protein | 0.9745 | 2 | 77 |
|
| AF-A0A0L0KXZ7-F1-model_v4 | deleted | 0.974 | 1 | 77 |
|
| AF-A0A6F7VTE0-F1-model_v4 | deleted | 0.9739 | 1 | 77 |
|
| AF-H0B7P4-F1-model_v4 | Transcription regulator AsnC/Lrp ligand binding domain-containing protein | 0.9734 | 2 | 77 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar