F494935

General Info

Members Datasets Scaffolds Average Seq Length
1591 647 1509 77

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_101302768|Ga0070708_1013027682
Length 85
Sequence MAAKSGSAVVNAYILIQTEVGKAAAVAKSAAQIKGVLSAEDVTGPYDVIVRAEAKNVDDLGKLVVARIQGVEGITRTLTCPVVHL

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
3 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
7 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
8 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
9 2643221670 Streptomyces sp. Root431 Isolate Unclassified
10 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
11 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
12 2643221714 Streptomyces sp. Root264 Isolate Unclassified
13 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
14 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
15 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
16 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
17 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
18 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
19 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
20 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
21 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
22 2808606448 Streptomyces sp. 193411 Isolate Unclassified
23 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
24 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
25 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
26 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
27 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
28 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
29 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
30 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
31 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
32 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
33 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
34 2867369537 Streptomyces sp. Z26 Isolate Unclassified
35 2867428634 Streptomyces sp. RP5T Isolate Unclassified
36 2867475112 Streptomyces sp. TM32 Isolate Unclassified
37 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
38 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
39 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
40 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
41 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
42 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
43 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
44 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
45 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
46 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
47 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
48 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
49 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
50 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
51 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
52 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
53 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
54 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
55 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
56 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
57 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
58 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
59 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
60 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
61 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
62 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
63 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
64 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
65 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
66 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
67 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
68 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
69 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
70 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
71 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
72 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
73 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
74 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
75 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
76 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
77 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
79 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
81 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
82 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
83 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
84 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
85 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
86 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
87 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
88 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
89 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
90 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
91 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
92 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
93 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
94 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
95 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
96 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
97 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
98 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
99 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
100 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
101 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
102 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
103 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
104 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
105 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
106 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
107 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
108 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
109 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
110 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
111 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
112 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
113 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
114 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
115 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
116 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
117 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
118 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
119 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
120 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
121 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
122 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
123 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
124 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
125 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
126 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
127 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
128 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
129 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
130 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
131 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
132 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
133 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
134 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
135 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
136 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
137 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
138 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
139 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
140 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
141 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
142 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
143 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
144 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
145 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
146 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
147 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
148 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
149 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
150 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
151 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
152 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
153 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
154 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
155 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
156 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
157 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
158 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
159 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
160 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
161 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
162 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
163 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
164 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
165 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
166 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
167 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
168 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
169 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
170 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
171 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
172 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
173 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
174 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
175 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
176 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
177 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
178 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
179 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
180 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
181 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
182 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
183 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
184 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
185 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
186 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
187 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
188 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
189 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
190 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
191 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
192 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
193 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
194 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
195 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
196 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
197 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
198 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
199 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
200 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
201 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
202 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
203 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
204 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
205 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
206 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
207 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
208 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
209 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
210 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
211 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
212 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
213 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
214 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
215 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
216 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
217 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
218 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
219 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
220 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
221 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
222 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
223 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
224 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
225 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
226 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
227 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
228 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
230 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
231 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
232 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
233 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
299 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
300 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
301 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
302 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
306 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
307 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
308 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
309 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
310 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
311 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
313 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
314 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
315 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
316 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
317 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
318 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
319 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
320 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
321 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
322 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
323 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
324 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
325 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
326 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
327 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
328 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
329 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
330 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
331 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
332 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
333 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
335 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
336 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
337 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
338 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
339 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
340 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
341 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
342 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
343 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
344 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
345 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
346 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
347 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
348 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
349 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
350 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
351 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
352 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
353 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
354 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
355 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
356 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
357 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
358 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
359 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
360 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
361 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
362 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
363 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
364 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
365 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
366 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
367 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
368 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
369 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
370 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
371 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
372 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
373 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
374 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
375 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
376 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
377 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
378 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
379 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
380 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
381 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
382 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
383 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
384 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
385 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
386 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
387 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
388 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
389 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
390 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
391 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
392 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
393 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
394 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
395 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
396 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
397 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
398 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
399 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
400 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
401 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
402 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
403 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
404 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
405 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
406 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
407 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
408 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
409 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
410 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
411 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
412 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
413 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
414 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
415 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
416 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
417 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
418 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
419 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
420 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
421 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
422 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
423 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
424 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
425 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
426 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
427 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
428 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
429 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
430 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
431 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
432 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
433 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
434 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
435 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
436 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
437 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
438 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
439 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
440 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
441 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
442 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
443 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
444 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
445 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
446 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
447 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
448 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
449 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
450 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
451 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
452 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
453 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
454 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
455 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
456 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
457 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
458 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
459 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
460 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
461 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
462 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
463 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
464 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
465 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
466 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
467 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
468 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
469 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
470 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
471 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
472 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
473 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
474 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
475 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
476 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
477 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
478 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
479 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
480 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
481 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
482 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
483 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
484 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
485 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
486 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
487 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
488 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
489 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
490 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
491 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
492 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
493 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
494 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
495 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
496 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
497 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
498 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
499 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
500 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
501 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
502 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
503 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
504 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
505 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
506 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
507 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
508 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
509 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
510 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
511 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
512 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
513 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
514 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
515 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
516 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
517 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
518 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
519 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
520 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
521 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
522 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
523 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
524 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
525 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
526 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
527 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
528 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
530 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
531 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
532 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
533 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
534 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
535 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
536 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
537 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
538 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
539 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
540 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
541 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
542 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
543 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
544 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
545 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
546 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
547 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
548 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
549 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
550 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
551 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
552 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
553 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
554 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
555 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
556 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
557 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
558 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
559 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
560 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
561 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
562 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
563 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
564 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
565 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
566 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
567 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
568 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
569 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
570 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
571 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
572 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
573 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
574 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
575 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
576 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
577 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
578 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
579 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
580 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
581 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
582 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
583 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
584 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
585 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
586 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
587 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
588 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
589 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
590 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
591 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
592 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
593 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
594 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
595 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
596 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
597 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
598 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
599 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
600 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
601 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
602 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
603 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
604 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
605 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
606 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
607 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
608 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
609 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
610 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
611 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
612 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
613 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
614 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
615 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
616 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
617 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
618 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
619 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
620 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
621 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
622 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
623 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
624 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
625 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
626 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
627 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
628 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
629 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
630 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
631 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
632 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
633 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
634 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
635 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
636 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
637 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
638 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
639 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
640 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
641 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
642 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
643 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
644 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
645 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
646 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
647 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.9
Metatranscriptomes 1.82
Isolates 5.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.33
Nodule 0.13
Rhizoplane 3.58
Rhizosphere 87.37
Stem 0
Stem Tuber 0
Unclassified 5.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1038130 3300001976 Bacteria 641
2 JGI24746J21847_1070487 3300001977 Bacteria 508
3 JGI24737J22298_10003653 3300001990 Bacteria 5419
4 JGI24737J22298_10063356 3300001990 Bacteria 1110
5 JGI24735J21928_10021020 3300002067 Bacteria 1995
6 JGI24738J21930_10055472 3300002075 Bacteria 810
7 JGI24744J21845_10079380 3300002077 Bacteria 600
8 JGI24751J29686_10027934 3300002459 Bacteria 1172
9 rootH1_10041734 3300003316 Bacteria 4023
10 rootH1_10041734 3300003323 Bacteria 3489
11 rootH2_10067360 3300003320 Bacteria 1763
12 rootL2_10041928 3300003322 Bacteria 1698
13 rootL2_10063672 3300003322 Bacteria 1560
14 rootH1_10009634 3300003323 Bacteria 3564
15 rootH1_10030202 3300003323 Bacteria 1809
16 rootH1_10030203 3300003316 Bacteria 5567
17 rootH1_10030203 3300003323 Bacteria 1477
18 JGI25407J50210_10045851 3300003373 Bacteria 1114
19 Ga0007427J51700_123488 3300003559 Bacteria 734
20 Ga0058863_11889194 3300004799 Bacteria 601
21 Ga0070658_10002606 3300005327 Bacteria 15025
22 Ga0070658_10017488 3300005327 Bacteria 5736
23 Ga0070658_10211772 3300005327 Bacteria 1637
24 Ga0070658_10290895 3300005327 Bacteria 1392
25 Ga0070676_10194093 3300005328 Bacteria 1327
26 Ga0070676_11167441 3300005328 Bacteria 584
27 Ga0070683_100094876 3300005329 Bacteria 2804
28 Ga0070683_100741609 3300005329 Bacteria 941
29 Ga0070683_100997461 3300005329 Bacteria 804
30 Ga0070683_101053993 3300005329 Bacteria 781
31 Ga0070683_102370549 3300005329 Bacteria 509
32 Ga0070690_100026467 3300005330 Bacteria 3578
33 Ga0070690_100504626 3300005330 Bacteria 905
34 Ga0070690_100553406 3300005330 Bacteria 868
35 Ga0070670_100399061 3300005331 Bacteria 1214
36 Ga0068869_100047601 3300005334 Bacteria 3097
37 Ga0068869_100080194 3300005334 Bacteria 2434
38 Ga0068869_100142285 3300005334 Bacteria 1853
39 Ga0068869_101415583 3300005334 Bacteria 616
40 Ga0070666_10243862 3300005335 Bacteria 1271
41 Ga0070680_100010848 3300005336 Bacteria 7037
42 Ga0070680_100081816 3300005336 Bacteria 2664
43 Ga0070680_100504165 3300005336 Bacteria 1036
44 Ga0070680_101238269 3300005336 Bacteria 646
45 Ga0070682_100016723 3300005337 Bacteria 4269
46 Ga0070682_100295407 3300005337 Bacteria 1186
47 Ga0070682_100333382 3300005337 Bacteria 1125
48 Ga0070682_100356082 3300005337 Bacteria 1093
49 Ga0068868_100008400 3300005338 Bacteria 7391
50 Ga0068868_100230523 3300005338 Bacteria 1553
51 Ga0068868_100286586 3300005338 Bacteria 1395
52 Ga0068868_100511960 3300005338 Bacteria 1052
53 Ga0068868_101236380 3300005338 Bacteria 692
54 Ga0068868_101418932 3300005338 Bacteria 648
55 Ga0068868_101927925 3300005338 Bacteria 560
56 Ga0070660_100020384 3300005339 Bacteria 4873
57 Ga0070660_100297132 3300005339 Bacteria 1323
58 Ga0070660_100638871 3300005339 Bacteria 891
59 Ga0070660_101448560 3300005339 Bacteria 584
60 Ga0070689_100135688 3300005340 Bacteria 1976
61 Ga0070689_100264718 3300005340 Bacteria 1422
62 Ga0070691_10119418 3300005341 Bacteria 1326
63 Ga0070691_10209610 3300005341 Bacteria 1028
64 Ga0070691_10837424 3300005341 Bacteria 563
65 Ga0070687_100045504 3300005343 Bacteria 2242
66 Ga0070687_100263442 3300005343 Bacteria 1077
67 Ga0070687_100589783 3300005343 Bacteria 762
68 Ga0070687_100863039 3300005343 Bacteria 646
69 Ga0070661_100317573 3300005344 Bacteria 1216
70 Ga0070692_10090763 3300005345 Bacteria 1660
71 Ga0070692_10179902 3300005345 Bacteria 1225
72 Ga0070692_10481120 3300005345 Bacteria 801
73 Ga0070668_100507403 3300005347 Bacteria 1045
74 Ga0070668_101237749 3300005347 Bacteria 677
75 Ga0070669_100113141 3300005353 Bacteria 2062
76 Ga0070675_100004208 3300005354 Bacteria 10936
77 Ga0070675_100521069 3300005354 Bacteria 1073
78 Ga0070675_101290541 3300005354 Bacteria 673
79 Ga0070671_100001993 3300005355 Bacteria 15683
80 Ga0070671_100460874 3300005355 Bacteria 1091
81 Ga0070671_100597275 3300005355 Bacteria 954
82 Ga0070674_100356443 3300005356 Bacteria 1183
83 Ga0070674_101189748 3300005356 Bacteria 676
84 Ga0070673_100004884 3300005364 Bacteria 8534
85 Ga0070673_100581137 3300005364 Bacteria 1020
86 Ga0070688_100112668 3300005365 Bacteria 1812
87 Ga0070659_100002405 3300005366 Bacteria 13298
88 Ga0070659_100020513 3300005366 Bacteria 5022
89 Ga0070659_100275939 3300005366 Bacteria 1398
90 Ga0070659_102088356 3300005366 Bacteria 509
91 Ga0070667_101137246 3300005367 Bacteria 730
92 Ga0070667_101195776 3300005367 Bacteria 711
93 Ga0070709_10014255 3300005434 Bacteria 4494
94 Ga0070709_11216682 3300005434 Bacteria 606
95 Ga0070714_100009390 3300005435 Bacteria 7687
96 Ga0070714_100016298 3300005435 Bacteria 5996
97 Ga0070714_100019750 3300005435 Bacteria 5495
98 Ga0070714_101612938 3300005435 Bacteria 634
99 Ga0070713_100006832 3300005436 Bacteria 7950
100 Ga0070713_100143478 3300005436 Bacteria 2117
101 Ga0070713_100375319 3300005436 Bacteria 1324
102 Ga0070713_101042885 3300005436 Bacteria 789
103 Ga0070710_10113375 3300005437 Bacteria 1631
104 Ga0070710_10831655 3300005437 Bacteria 662
105 Ga0070701_10130586 3300005438 Bacteria 1427
106 Ga0070701_10293836 3300005438 Bacteria 996
107 Ga0070711_100001086 3300005439 Bacteria 14531
108 Ga0070711_100201208 3300005439 Bacteria 1537
109 Ga0070705_100097124 3300005440 Bacteria 1851
110 Ga0070700_100014074 3300005441 Bacteria 4511
111 Ga0070694_101919948 3300005444 Bacteria 506
112 Ga0070708_100006735 3300005445 Bacteria 9153
113 Ga0070708_100098106 3300005445 Bacteria 2679
114 Ga0070708_100133949 3300005445 Bacteria 2294
115 Ga0070708_100236745 3300005445 Bacteria 1714
116 Ga0070708_100272583 3300005445 Bacteria 1592
117 Ga0070708_101302768 3300005445 Bacteria 679
118 Ga0070663_100082281 3300005455 Bacteria 2368
119 Ga0070663_100679015 3300005455 Bacteria 874
120 Ga0070663_100756894 3300005455 Bacteria 830
121 Ga0070678_100001267 3300005456 Bacteria 13414
122 Ga0070678_100626753 3300005456 Bacteria 962
123 Ga0070678_100975294 3300005456 Bacteria 778
124 Ga0070678_101950197 3300005456 Bacteria 555
125 Ga0070662_100007273 3300005457 Bacteria 7174
126 Ga0070662_100281198 3300005457 Bacteria 1347
127 Ga0070662_101328954 3300005457 Bacteria 619
128 Ga0070681_10000046 3300005458 Bacteria 84043
129 Ga0070681_10002542 3300005458 Bacteria 16737
130 Ga0070681_10059510 3300005458 Bacteria 3800
131 Ga0070681_10798072 3300005458 Bacteria 861
132 Ga0070681_10863061 3300005458 Bacteria 823
133 Ga0068867_100011982 3300005459 Bacteria 6126
134 Ga0068867_100083090 3300005459 Bacteria 2417
135 Ga0068867_100795119 3300005459 Bacteria 843
136 Ga0068867_101692293 3300005459 Bacteria 593
137 Ga0070706_100003607 3300005467 Bacteria 15167
138 Ga0070706_100003790 3300005467 Bacteria 14762
139 Ga0070706_100010869 3300005467 Bacteria 8449
140 Ga0070706_100050423 3300005467 Bacteria 3841
141 Ga0070706_100254086 3300005467 Bacteria 1641
142 Ga0070706_100277831 3300005467 Bacteria 1563
143 Ga0070707_100003265 3300005468 Bacteria 15362
144 Ga0070707_100005057 3300005468 Bacteria 12361
145 Ga0070707_100008692 3300005468 Bacteria 9417
146 Ga0070707_100084153 3300005468 Bacteria 3073
147 Ga0070707_100463351 3300005468 Bacteria 1228
148 Ga0070707_100540171 3300005468 Bacteria 1128
149 Ga0070698_100001113 3300005471 Bacteria 29670
150 Ga0070698_100028531 3300005471 Bacteria 5796
151 Ga0070698_100031028 3300005471 Bacteria 5542
152 Ga0070698_100060083 3300005471 Bacteria 3836
153 Ga0070698_100522246 3300005471 Bacteria 1126
154 Ga0070698_101312455 3300005471 Bacteria 674
155 Ga0070698_101435958 3300005471 Bacteria 641
156 Ga0070699_100145208 3300005518 Bacteria 2096
157 Ga0070679_100001623 3300005530 Bacteria 20251
158 Ga0070679_100007199 3300005530 Bacteria 10389
159 Ga0070679_100025362 3300005530 Bacteria 5817
160 Ga0070679_100067238 3300005530 Bacteria 3574
161 Ga0070679_100069299 3300005530 Bacteria 3518
162 Ga0070679_100411525 3300005530 Bacteria 1298
163 Ga0070679_101109460 3300005530 Bacteria 736
164 Ga0070679_102148866 3300005530 Bacteria 508
165 Ga0070684_100003597 3300005535 Bacteria 11666
166 Ga0070684_100232644 3300005535 Bacteria 1683
167 Ga0070684_100706452 3300005535 Bacteria 940
168 Ga0070684_101741503 3300005535 Bacteria 588
169 Ga0070697_100024673 3300005536 Bacteria 4789
170 Ga0070697_100044501 3300005536 Bacteria 3596
171 Ga0068853_100029100 3300005539 Bacteria 4653
172 Ga0068853_100291323 3300005539 Bacteria 1507
173 Ga0068853_101725594 3300005539 Bacteria 607
174 Ga0070672_101928585 3300005543 Bacteria 532
175 Ga0070686_100100101 3300005544 Bacteria 1956
176 Ga0070686_100288427 3300005544 Bacteria 1213
177 Ga0070695_100091599 3300005545 Bacteria 2031
178 Ga0070695_100375328 3300005545 Bacteria 1072
179 Ga0070696_100090898 3300005546 Bacteria 2173
180 Ga0070693_100308034 3300005547 Bacteria 1070
181 Ga0070693_100665321 3300005547 Bacteria 759
182 Ga0070693_100795504 3300005547 Bacteria 700
183 Ga0070665_100021695 3300005548 Bacteria 6458
184 Ga0070665_100436018 3300005548 Bacteria 1319
185 Ga0070665_101111229 3300005548 Bacteria 802
186 Ga0070704_100032625 3300005549 Bacteria 3514
187 Ga0068855_100333298 3300005563 Bacteria 1675
188 Ga0068855_100731405 3300005563 Bacteria 1057
189 Ga0068855_101175757 3300005563 Bacteria 799
190 Ga0068855_101484090 3300005563 Bacteria 697
191 Ga0068855_102140500 3300005563 Bacteria 563
192 Ga0070664_101305891 3300005564 Bacteria 685
193 Ga0068857_101599873 3300005577 Bacteria 636
194 Ga0068854_100042731 3300005578 Bacteria 3209
195 Ga0068854_100501014 3300005578 Bacteria 1023
196 Ga0068854_100589408 3300005578 Bacteria 948
197 Ga0068854_101917209 3300005578 Bacteria 545
198 Ga0068856_100005097 3300005614 Bacteria 12983
199 Ga0068856_100057717 3300005614 Bacteria 3832
200 Ga0068856_101808229 3300005614 Bacteria 623
201 Ga0070702_100004225 3300005615 Bacteria 6537
202 Ga0070702_100080927 3300005615 Bacteria 1945
203 Ga0070702_100313064 3300005615 Bacteria 1091
204 Ga0068852_100656752 3300005616 Bacteria 1056
205 Ga0068859_100103322 3300005617 Bacteria 2907
206 Ga0068859_100743162 3300005617 Bacteria 1070
207 Ga0068864_100150583 3300005618 Bacteria 2107
208 Ga0068861_100856385 3300005719 Bacteria 857
209 Ga0068861_101805216 3300005719 Bacteria 607
210 Ga0068851_10004867 3300005834 Bacteria 6078
211 Ga0068870_10000527 3300005840 Bacteria 14400
212 Ga0068870_10383754 3300005840 Bacteria 910
213 Ga0068863_100551384 3300005841 Bacteria 1138
214 Ga0068860_100011881 3300005843 Bacteria 8584
215 Ga0068860_100382222 3300005843 Bacteria 1390
216 Ga0068862_101638029 3300005844 Bacteria 651
217 Ga0081455_10043358 3300005937 Bacteria 3936
218 Ga0081455_10117743 3300005937 Bacteria 2099
219 Ga0081455_10119826 3300005937 Bacteria 2075
220 Ga0081538_10002364 3300005981 Bacteria 18542
221 Ga0081538_10005374 3300005981 Bacteria 11513
222 Ga0081538_10007077 3300005981 Bacteria 9748
223 Ga0081538_10081668 3300005981 Bacteria 1718
224 Ga0081540_1030633 3300005983 Bacteria 2976
225 Ga0081539_10003373 3300005985 Bacteria 19777
226 Ga0081539_10027511 3300005985 Bacteria 3599
227 Ga0081539_10108528 3300005985 Bacteria 1402
228 Ga0081539_10133968 3300005985 Bacteria 1213
229 Ga0081539_10285595 3300005985 Bacteria 716
230 Ga0070717_10001330 3300006028 Bacteria 16956
231 Ga0070717_10127505 3300006028 Bacteria 2186
232 Ga0070717_10244269 3300006028 Bacteria 1584
233 Ga0075365_10116531 3300006038 Bacteria 1840
234 Ga0075368_10016793 3300006042 Bacteria 2731
235 Ga0075363_100004041 3300006048 Bacteria 6348
236 Ga0075363_100049434 3300006048 Bacteria 2239
237 Ga0075432_10006062 3300006058 Bacteria 4114
238 Ga0070715_10041515 3300006163 Bacteria 1928
239 Ga0070716_100030422 3300006173 Bacteria 2928
240 Ga0070716_100193030 3300006173 Bacteria 1347
241 Ga0070716_100598449 3300006173 Bacteria 829
242 Ga0070712_100011977 3300006175 Bacteria 5513
243 Ga0070712_100187544 3300006175 Bacteria 1616
244 Ga0070712_100400537 3300006175 Bacteria 1133
245 Ga0070712_101759396 3300006175 Bacteria 543
246 Ga0075367_10133995 3300006178 Bacteria 1532
247 Ga0075369_10096581 3300006186 Bacteria 1323
248 Ga0075427_10054111 3300006194 Bacteria 695
249 Ga0097621_101583515 3300006237 Bacteria 623
250 Ga0075370_10589045 3300006353 Bacteria 673
251 Ga0068871_100564435 3300006358 Bacteria 1032
252 Ga0068871_101251433 3300006358 Bacteria 697
253 Ga0075428_100269707 3300006844 Bacteria 1831
254 Ga0075428_102123594 3300006844 Bacteria 581
255 Ga0075430_100120579 3300006846 Bacteria 2186
256 Ga0075430_101445355 3300006846 Bacteria 565
257 Ga0075431_100251599 3300006847 Bacteria 1795
258 Ga0075431_101037325 3300006847 Bacteria 786
259 Ga0075433_10117521 3300006852 Bacteria 2360
260 Ga0075433_10131394 3300006852 Bacteria 2224
261 Ga0075433_10225470 3300006852 Bacteria 1664
262 Ga0075433_11444570 3300006852 Bacteria 594
263 Ga0075434_100087552 3300006871 Bacteria 3115
264 Ga0075434_100613869 3300006871 Bacteria 1106
265 Ga0075429_100035629 3300006880 Bacteria 4328
266 Ga0075429_100796680 3300006880 Bacteria 827
267 Ga0075429_100901602 3300006880 Bacteria 774
268 Ga0068865_100015369 3300006881 Bacteria 4881
269 Ga0068865_100792231 3300006881 Bacteria 817
270 Ga0075436_100006077 3300006914 Bacteria 8287
271 Ga0075436_100309015 3300006914 Bacteria 1134
272 Ga0075436_100572094 3300006914 Bacteria 831
273 Ga0097620_100103333 3300006931 Bacteria 2907
274 Ga0097620_100743018 3300006931 Bacteria 1070
275 Ga0075435_100022736 3300007076 Bacteria 4839
276 Ga0105251_10009941 3300009011 Bacteria 5568
277 Ga0105251_10067454 3300009011 Bacteria 1671
278 Ga0105251_10375366 3300009011 Bacteria 651
279 Ga0105244_10029526 3300009036 Bacteria 2929
280 Ga0105244_10506751 3300009036 Bacteria 556
281 Ga0105250_10113357 3300009092 Bacteria 1111
282 Ga0105240_10032907 3300009093 Bacteria 6705
283 Ga0105240_10181039 3300009093 Bacteria 2487
284 Ga0105240_10319795 3300009093 Bacteria 1769
285 Ga0105240_11006790 3300009093 Bacteria 891
286 Ga0111539_10017829 3300009094 Bacteria 8791
287 Ga0111539_10059096 3300009094 Bacteria 4548
288 Ga0105245_10017915 3300009098 Bacteria 6185
289 Ga0105245_10060270 3300009098 Bacteria 3418
290 Ga0105245_10179536 3300009098 Bacteria 2021
291 Ga0105245_10371275 3300009098 Bacteria 1422
292 Ga0105245_10488273 3300009098 Bacteria 1246
293 Ga0105245_10818897 3300009098 Bacteria 970
294 Ga0105245_11197458 3300009098 Bacteria 807
295 Ga0105245_11419024 3300009098 Bacteria 744
296 Ga0105245_11457142 3300009098 Bacteria 735
297 Ga0105245_12326789 3300009098 Bacteria 589
298 Ga0105245_12886651 3300009098 Bacteria 533
299 Ga0105245_13238202 3300009098 Bacteria 504
300 Ga0105247_10027969 3300009101 Bacteria 3411
301 Ga0114129_10254651 3300009147 Bacteria 2355
302 Ga0114129_10919485 3300009147 Bacteria 1107
303 Ga0105243_10003463 3300009148 Bacteria 12742
304 Ga0105243_10090981 3300009148 Bacteria 2512
305 Ga0105243_10307892 3300009148 Bacteria 1438
306 Ga0105243_11422868 3300009148 Bacteria 715
307 Ga0105243_12176516 3300009148 Bacteria 591
308 Ga0105241_10030071 3300009174 Bacteria 4057
309 Ga0105241_11064862 3300009174 Bacteria 760
310 Ga0105241_12327124 3300009174 Bacteria 534
311 Ga0105241_12494513 3300009174 Bacteria 518
312 Ga0105242_10002867 3300009176 Bacteria 13505
313 Ga0105242_10008779 3300009176 Bacteria 7754
314 Ga0105242_10035559 3300009176 Bacteria 3994
315 Ga0105242_10195487 3300009176 Bacteria 1793
316 Ga0105242_10474130 3300009176 Bacteria 1185
317 Ga0105242_10510739 3300009176 Bacteria 1145
318 Ga0105242_10753568 3300009176 Bacteria 959
319 Ga0105242_10833574 3300009176 Bacteria 916
320 Ga0105242_11143954 3300009176 Bacteria 795
321 Ga0105242_11424747 3300009176 Bacteria 721
322 Ga0105248_10003481 3300009177 Bacteria 17473
323 Ga0105248_10093019 3300009177 Bacteria 3395
324 Ga0105248_12085505 3300009177 Bacteria 645
325 Ga0105237_10078772 3300009545 Bacteria 3285
326 Ga0105237_10631744 3300009545 Bacteria 1078
327 Ga0105237_10662312 3300009545 Bacteria 1051
328 Ga0105237_11697000 3300009545 Bacteria 639
329 Ga0105238_10078051 3300009551 Bacteria 3302
330 Ga0105238_11024704 3300009551 Bacteria 847
331 Ga0105238_12498524 3300009551 Bacteria 553
332 Ga0105249_11188012 3300009553 Bacteria 834
333 Ga0105249_12223255 3300009553 Bacteria 621
334 Ga0105249_12338792 3300009553 Bacteria 607
335 Ga0105239_10084743 3300010375 Bacteria 3492
336 Ga0105239_10373470 3300010375 Bacteria 1612
337 Ga0105239_10614933 3300010375 Bacteria 1240
338 Ga0105239_10641253 3300010375 Bacteria 1213
339 Ga0105239_10643461 3300010375 Bacteria 1211
340 Ga0105239_10728044 3300010375 Bacteria 1135
341 Ga0105239_11134548 3300010375 Bacteria 900
342 Ga0105239_11586667 3300010375 Bacteria 757
343 Ga0105239_13111694 3300010375 Bacteria 540
344 Ga0105246_10000043 3300011119 Bacteria 47690
345 Ga0105246_10031384 3300011119 Bacteria 3516
346 Ga0105246_10041465 3300011119 Bacteria 3111
347 Ga0105246_10466383 3300011119 Bacteria 1065
348 Ga0105246_11055673 3300011119 Bacteria 739
349 Ga0157317_1017853 3300012475 Bacteria 609
350 Ga0157335_1026195 3300012492 Bacteria 586
351 Ga0157319_1033671 3300012497 Bacteria 567
352 Ga0157345_1031719 3300012498 Bacteria 596
353 Ga0157313_1002065 3300012503 Bacteria 1162
354 Ga0157324_1008608 3300012506 Bacteria 825
355 Ga0157327_1042893 3300012512 Bacteria 615
356 Ga0157373_10053758 3300013100 Bacteria 2863
357 Ga0157373_10336419 3300013100 Bacteria 1075
358 Ga0157373_10565652 3300013100 Bacteria 825
359 Ga0157373_10977254 3300013100 Bacteria 631
360 Ga0157373_11356028 3300013100 Bacteria 540
361 Ga0157371_10017120 3300013102 Bacteria 5392
362 Ga0157371_10080787 3300013102 Bacteria 2302
363 Ga0157371_10571147 3300013102 Bacteria 839
364 Ga0157371_10842869 3300013102 Bacteria 693
365 Ga0157371_10943151 3300013102 Bacteria 656
366 Ga0157370_10067578 3300013104 Bacteria 3378
367 Ga0157370_10117335 3300013104 Bacteria 2486
368 Ga0157370_10420426 3300013104 Bacteria 1230
369 Ga0157370_10926837 3300013104 Bacteria 790
370 Ga0157369_10000870 3300013105 Bacteria 38542
371 Ga0157369_10054557 3300013105 Bacteria 4316
372 Ga0157369_10102442 3300013105 Bacteria 3051
373 Ga0157369_10227184 3300013105 Bacteria 1952
374 Ga0157369_10241307 3300013105 Bacteria 1888
375 Ga0157369_10973780 3300013105 Bacteria 869
376 Ga0157369_11735141 3300013105 Bacteria 634
377 Ga0157369_11823400 3300013105 Bacteria 618
378 Ga0157369_12471059 3300013105 Bacteria 526
379 Ga0157374_10017768 3300013296 Bacteria 6267
380 Ga0157374_10027093 3300013296 Bacteria 5165
381 Ga0157374_10093890 3300013296 Bacteria 2865
382 Ga0157374_10229907 3300013296 Bacteria 1821
383 Ga0157374_10599384 3300013296 Bacteria 1112
384 Ga0157374_11584229 3300013296 Bacteria 679
385 Ga0157374_12416973 3300013296 Bacteria 553
386 Ga0157378_11041478 3300013297 Bacteria 854
387 Ga0157378_11186342 3300013297 Bacteria 802
388 Ga0157378_12061621 3300013297 Bacteria 621
389 Ga0157378_13112107 3300013297 Bacteria 515
390 Ga0163162_10055426 3300013306 Bacteria 3991
391 Ga0163162_10332005 3300013306 Bacteria 1653
392 Ga0163162_11132157 3300013306 Bacteria 887
393 Ga0163162_11541457 3300013306 Bacteria 757
394 Ga0157372_10224670 3300013307 Bacteria 2177
395 Ga0157372_10346837 3300013307 Bacteria 1730
396 Ga0157372_10703483 3300013307 Bacteria 1176
397 Ga0157372_11411986 3300013307 Bacteria 802
398 Ga0157372_13086784 3300013307 Bacteria 532
399 Ga0157375_10015233 3300013308 Bacteria 6880
400 Ga0157375_11332668 3300013308 Bacteria 844
401 Ga0157375_11986119 3300013308 Bacteria 691
402 Ga0163163_10058272 3300014325 Bacteria 3819
403 Ga0163163_10616569 3300014325 Bacteria 1148
404 Ga0163163_10654633 3300014325 Bacteria 1114
405 Ga0163163_10712683 3300014325 Bacteria 1067
406 Ga0157380_10356865 3300014326 Bacteria 1370
407 Ga0182008_10000253 3300014497 Bacteria 41589
408 Ga0182008_10225902 3300014497 Bacteria 959
409 Ga0157377_10124756 3300014745 Bacteria 1565
410 Ga0157377_10166097 3300014745 Bacteria 1376
411 Ga0157377_10618015 3300014745 Bacteria 775
412 Ga0157377_11273819 3300014745 Bacteria 573
413 Ga0157379_10007721 3300014968 Bacteria 9312
414 Ga0157379_10041025 3300014968 Bacteria 4131
415 Ga0157379_11734809 3300014968 Bacteria 612
416 Ga0157376_10190203 3300014969 Bacteria 1882
417 Ga0157376_11333464 3300014969 Bacteria 748
418 Ga0182007_10000295 3300015262 Bacteria 32455
419 Ga0182005_1015457 3300015265 Bacteria 2128
420 Ga0183367_1013 3300015688 Bacteria 334176
421 Ga0163161_10037148 3300017792 Bacteria 3491
422 Ga0163161_10378022 3300017792 Bacteria 1131
423 Ga0163161_10559656 3300017792 Bacteria 938
424 Ga0197907_11056749 3300020069 Bacteria 863
425 Ga0197907_11151097 3300020069 Bacteria 550
426 Ga0197907_11496031 3300020069 Bacteria 1027
427 Ga0206356_10780096 3300020070 Bacteria 768
428 Ga0206351_10456640 3300020077 Bacteria 591
429 Ga0206351_10506274 3300020077 Bacteria 748
430 Ga0206352_10837226 3300020078 Bacteria 507
431 Ga0206350_10519492 3300020080 Bacteria 817
432 Ga0206354_10849213 3300020081 Bacteria 3978
433 Ga0206354_11155629 3300020081 Bacteria 593
434 Ga0206354_11532524 3300020081 Bacteria 860
435 Ga0206353_10486774 3300020082 Bacteria 3880
436 Ga0206353_10633777 3300020082 Bacteria 2049
437 Ga0206353_11701529 3300020082 Bacteria 571
438 Ga0154015_1302778 3300020610 Bacteria 501
439 Ga0154015_1492505 3300020610 Bacteria 505
440 Ga0213876_10006371 3300021384 Bacteria 6433
441 Ga0213875_10496586 3300021388 Bacteria 586
442 Ga0224712_10283858 3300022467 Bacteria 771
443 Ga0224712_10315480 3300022467 Bacteria 734
444 Ga0224712_10492403 3300022467 Bacteria 592
445 Ga0224712_10506072 3300022467 Bacteria 584
446 Ga0224712_10644212 3300022467 Bacteria 519
447 Ga0207426_1003865 3300025302 Bacteria 7721
448 Ga0207656_10012144 3300025321 Bacteria 3269
449 Ga0207656_10286373 3300025321 Bacteria 813
450 Ga0207696_1129341 3300025711 Bacteria 679
451 Ga0207692_10044802 3300025898 Bacteria 2209
452 Ga0207642_10028544 3300025899 Bacteria 2299
453 Ga0207710_10047867 3300025900 Bacteria 1912
454 Ga0207688_10012469 3300025901 Bacteria 4626
455 Ga0207688_10101487 3300025901 Bacteria 1662
456 Ga0207688_10333190 3300025901 Bacteria 933
457 Ga0207647_10037633 3300025904 Bacteria 3066
458 Ga0207647_10192034 3300025904 Bacteria 1183
459 Ga0207647_10425785 3300025904 Bacteria 746
460 Ga0207685_10006249 3300025905 Bacteria 3227
461 Ga0207699_10029683 3300025906 Bacteria 3051
462 Ga0207699_10044698 3300025906 Bacteria 2579
463 Ga0207645_10026096 3300025907 Bacteria 3777
464 Ga0207645_10143196 3300025907 Bacteria 1558
465 Ga0207643_10000255 3300025908 Bacteria 37233
466 Ga0207643_10363098 3300025908 Bacteria 910
467 Ga0207643_10890807 3300025908 Bacteria 577
468 Ga0207705_10002517 3300025909 Bacteria 14126
469 Ga0207705_10017293 3300025909 Bacteria 5163
470 Ga0207705_10189930 3300025909 Bacteria 1553
471 Ga0207705_10251660 3300025909 Bacteria 1347
472 Ga0207705_11118594 3300025909 Bacteria 606
473 Ga0207684_10000844 3300025910 Bacteria 35321
474 Ga0207684_10002346 3300025910 Bacteria 19173
475 Ga0207684_10008439 3300025910 Bacteria 9165
476 Ga0207684_10053046 3300025910 Bacteria 3442
477 Ga0207684_10123941 3300025910 Bacteria 2216
478 Ga0207654_10185165 3300025911 Bacteria 1361
479 Ga0207707_10000737 3300025912 Bacteria 32379
480 Ga0207707_10010925 3300025912 Bacteria 7896
481 Ga0207707_10315609 3300025912 Bacteria 1350
482 Ga0207707_10661816 3300025912 Bacteria 879
483 Ga0207707_10953806 3300025912 Bacteria 706
484 Ga0207707_11030224 3300025912 Bacteria 674
485 Ga0207695_10034116 3300025913 Bacteria 5539
486 Ga0207695_10276393 3300025913 Bacteria 1574
487 Ga0207695_11256014 3300025913 Bacteria 621
488 Ga0207671_10114753 3300025914 Bacteria 2053
489 Ga0207671_10142489 3300025914 Bacteria 1847
490 Ga0207671_10412602 3300025914 Bacteria 1074
491 Ga0207693_10019809 3300025915 Bacteria 5349
492 Ga0207693_10165584 3300025915 Bacteria 1740
493 Ga0207663_10021541 3300025916 Bacteria 3671
494 Ga0207663_10033418 3300025916 Bacteria 3064
495 Ga0207663_10224703 3300025916 Bacteria 1368
496 Ga0207660_10001218 3300025917 Bacteria 17215
497 Ga0207660_10041213 3300025917 Bacteria 3235
498 Ga0207660_10418974 3300025917 Bacteria 1080
499 Ga0207660_10818317 3300025917 Bacteria 760
500 Ga0207660_11314426 3300025917 Bacteria 587
501 Ga0207662_10067495 3300025918 Bacteria 2157
502 Ga0207662_10144665 3300025918 Bacteria 1508
503 Ga0207662_10272767 3300025918 Bacteria 1117
504 Ga0207657_10020354 3300025919 Bacteria 6272
505 Ga0207657_10046041 3300025919 Bacteria 3822
506 Ga0207657_10109524 3300025919 Bacteria 2282
507 Ga0207657_10309157 3300025919 Bacteria 1251
508 Ga0207657_10666670 3300025919 Bacteria 809
509 Ga0207657_10997148 3300025919 Bacteria 643
510 Ga0207649_10005364 3300025920 Bacteria 6940
511 Ga0207652_10000461 3300025921 Bacteria 41921
512 Ga0207652_10028585 3300025921 Bacteria 4653
513 Ga0207652_10047136 3300025921 Bacteria 3681
514 Ga0207652_10235615 3300025921 Bacteria 1650
515 Ga0207652_10261428 3300025921 Bacteria 1561
516 Ga0207652_11109790 3300025921 Bacteria 691
517 Ga0207652_11297042 3300025921 Bacteria 631
518 Ga0207646_10000990 3300025922 Bacteria 36476
519 Ga0207646_10009844 3300025922 Bacteria 9409
520 Ga0207646_10020576 3300025922 Bacteria 6113
521 Ga0207646_10110919 3300025922 Bacteria 2461
522 Ga0207646_10273879 3300025922 Bacteria 1526
523 Ga0207681_10140457 3300025923 Bacteria 1798
524 Ga0207694_10053554 3300025924 Bacteria 3129
525 Ga0207694_11790513 3300025924 Bacteria 516
526 Ga0207650_10008935 3300025925 Bacteria 6847
527 Ga0207650_11036479 3300025925 Bacteria 698
528 Ga0207650_11850837 3300025925 Bacteria 510
529 Ga0207659_10076266 3300025926 Bacteria 2463
530 Ga0207659_10101779 3300025926 Bacteria 2167
531 Ga0207659_10272224 3300025926 Bacteria 1381
532 Ga0207687_10054509 3300025927 Bacteria 2798
533 Ga0207687_10082022 3300025927 Bacteria 2332
534 Ga0207687_10089960 3300025927 Bacteria 2236
535 Ga0207687_10651963 3300025927 Bacteria 891
536 Ga0207687_11178823 3300025927 Bacteria 658
537 Ga0207687_11685403 3300025927 Bacteria 543
538 Ga0207687_11881367 3300025927 Bacteria 512
539 Ga0207700_10002007 3300025928 Bacteria 11610
540 Ga0207700_10012146 3300025928 Bacteria 5539
541 Ga0207700_10111827 3300025928 Bacteria 2199
542 Ga0207700_10280663 3300025928 Bacteria 1433
543 Ga0207700_10292892 3300025928 Bacteria 1403
544 Ga0207700_11980278 3300025928 Bacteria 509
545 Ga0207664_10000722 3300025929 Bacteria 22530
546 Ga0207664_10005405 3300025929 Bacteria 8722
547 Ga0207664_10087450 3300025929 Bacteria 2548
548 Ga0207664_10254777 3300025929 Bacteria 1533
549 Ga0207664_10316678 3300025929 Bacteria 1376
550 Ga0207664_11752017 3300025929 Bacteria 543
551 Ga0207644_10010248 3300025931 Bacteria 6176
552 Ga0207644_10464129 3300025931 Bacteria 1041
553 Ga0207690_10000157 3300025932 Bacteria 53457
554 Ga0207690_10027235 3300025932 Bacteria 3611
555 Ga0207690_10652843 3300025932 Bacteria 862
556 Ga0207690_11312936 3300025932 Bacteria 605
557 Ga0207706_10031749 3300025933 Bacteria 4703
558 Ga0207706_10179613 3300025933 Bacteria 1859
559 Ga0207706_10221032 3300025933 Bacteria 1658
560 Ga0207706_10374031 3300025933 Bacteria 1237
561 Ga0207686_10097534 3300025934 Bacteria 1955
562 Ga0207686_10173656 3300025934 Bacteria 1522
563 Ga0207686_10201462 3300025934 Bacteria 1426
564 Ga0207686_10295432 3300025934 Bacteria 1201
565 Ga0207686_10693801 3300025934 Bacteria 809
566 Ga0207709_10012443 3300025935 Bacteria 4687
567 Ga0207709_10024868 3300025935 Bacteria 3425
568 Ga0207709_10907226 3300025935 Bacteria 716
569 Ga0207709_11762192 3300025935 Bacteria 515
570 Ga0207670_10075697 3300025936 Bacteria 2340
571 Ga0207670_11059885 3300025936 Bacteria 683
572 Ga0207669_10115037 3300025937 Bacteria 1812
573 Ga0207669_11267313 3300025937 Bacteria 626
574 Ga0207669_11442598 3300025937 Bacteria 586
575 Ga0207669_11540877 3300025937 Bacteria 567
576 Ga0207704_10027324 3300025938 Bacteria 3146
577 Ga0207704_10364624 3300025938 Bacteria 1129
578 Ga0207704_10656248 3300025938 Bacteria 865
579 Ga0207704_11448080 3300025938 Bacteria 589
580 Ga0207665_10036641 3300025939 Bacteria 3263
581 Ga0207665_10673246 3300025939 Bacteria 812
582 Ga0207665_11249280 3300025939 Bacteria 592
583 Ga0207691_10085403 3300025940 Bacteria 2832
584 Ga0207691_11418964 3300025940 Bacteria 570
585 Ga0207711_10076181 3300025941 Bacteria 2921
586 Ga0207711_10127941 3300025941 Bacteria 2274
587 Ga0207689_10001805 3300025942 Bacteria 20198
588 Ga0207689_10098506 3300025942 Bacteria 2402
589 Ga0207689_10099790 3300025942 Bacteria 2386
590 Ga0207689_10152879 3300025942 Bacteria 1902
591 Ga0207689_10332318 3300025942 Bacteria 1262
592 Ga0207689_10916969 3300025942 Bacteria 739
593 Ga0207661_10573680 3300025944 Bacteria 1035
594 Ga0207661_10749136 3300025944 Bacteria 899
595 Ga0207661_11047948 3300025944 Bacteria 751
596 Ga0207661_11464208 3300025944 Bacteria 626
597 Ga0207679_10007228 3300025945 Bacteria 7037
598 Ga0207679_10334475 3300025945 Bacteria 1315
599 Ga0207667_10415696 3300025949 Bacteria 1369
600 Ga0207667_11105460 3300025949 Bacteria 776
601 Ga0207667_12155100 3300025949 Bacteria 515
602 Ga0207651_10461626 3300025960 Bacteria 1091
603 Ga0207712_10289015 3300025961 Bacteria 1341
604 Ga0207712_10536035 3300025961 Bacteria 1005
605 Ga0207712_11629043 3300025961 Bacteria 578
606 Ga0207668_10544345 3300025972 Bacteria 1005
607 Ga0207668_10753516 3300025972 Bacteria 859
608 Ga0207640_10139129 3300025981 Bacteria 1767
609 Ga0207640_10377000 3300025981 Bacteria 1148
610 Ga0207640_10670966 3300025981 Bacteria 885
611 Ga0207658_11275082 3300025986 Bacteria 672
612 Ga0207677_10112573 3300026023 Bacteria 2030
613 Ga0207677_10173635 3300026023 Bacteria 1688
614 Ga0207677_10374139 3300026023 Bacteria 1200
615 Ga0207677_11107215 3300026023 Bacteria 722
616 Ga0207677_12198084 3300026023 Bacteria 513
617 Ga0207703_10216285 3300026035 Bacteria 1711
618 Ga0207639_10141052 3300026041 Bacteria 2008
619 Ga0207639_10202575 3300026041 Bacteria 1703
620 Ga0207639_11057010 3300026041 Bacteria 761
621 Ga0207678_10000346 3300026067 Bacteria 41986
622 Ga0207678_10026744 3300026067 Bacteria 5033
623 Ga0207678_10811878 3300026067 Bacteria 826
624 Ga0207678_11545765 3300026067 Bacteria 585
625 Ga0207708_10002817 3300026075 Bacteria 12776
626 Ga0207708_10062705 3300026075 Bacteria 2840
627 Ga0207708_10884848 3300026075 Bacteria 772
628 Ga0207702_10000631 3300026078 Bacteria 38615
629 Ga0207702_10027378 3300026078 Bacteria 4734
630 Ga0207702_10062252 3300026078 Bacteria 3186
631 Ga0207702_11313692 3300026078 Bacteria 717
632 Ga0207702_11773658 3300026078 Bacteria 609
633 Ga0207702_12228336 3300026078 Bacteria 536
634 Ga0207702_12315784 3300026078 Bacteria 525
635 Ga0207641_10070634 3300026088 Bacteria 3000
636 Ga0207641_11456503 3300026088 Bacteria 686
637 Ga0207648_10003949 3300026089 Bacteria 15426
638 Ga0207648_10007069 3300026089 Bacteria 11079
639 Ga0207676_10001535 3300026095 Bacteria 17033
640 Ga0207676_10087045 3300026095 Bacteria 2554
641 Ga0207674_10050592 3300026116 Bacteria 4244
642 Ga0207674_11237809 3300026116 Bacteria 716
643 Ga0207674_11698784 3300026116 Bacteria 599
644 Ga0207675_100025855 3300026118 Bacteria 5461
645 Ga0207675_100321669 3300026118 Bacteria 1510
646 Ga0207683_10000342 3300026121 Bacteria 42329
647 Ga0207683_10045766 3300026121 Bacteria 3827
648 Ga0207683_10858280 3300026121 Bacteria 843
649 Ga0207698_10031800 3300026142 Bacteria 3814
650 Ga0209371_1042187 3300027312 Bacteria 919
651 Ga0209371_1054914 3300027312 Bacteria 751
652 Ga0209966_1114722 3300027695 Bacteria 615
653 Ga0209813_10008344 3300027866 Bacteria 2613
654 Ga0207428_10001881 3300027907 Bacteria 21371
655 Ga0207428_10035741 3300027907 Bacteria 4058
656 Ga0268266_10006950 3300028379 Bacteria 10287
657 Ga0268266_10062053 3300028379 Bacteria 3225
658 Ga0268266_10518359 3300028379 Bacteria 1140
659 Ga0268266_11227628 3300028379 Bacteria 725
660 Ga0268266_11633878 3300028379 Bacteria 620
661 Ga0268265_10694174 3300028380 Bacteria 983
662 Ga0268264_10403094 3300028381 Bacteria 1315
663 Ga0268264_10625715 3300028381 Bacteria 1063
664 Ga0307517_10000616 3300028786 Bacteria 60799
665 Ga0307517_10064449 3300028786 Bacteria 3407
666 Ga0307515_10000785 3300028794 Bacteria 73213
667 Ga0307515_10079858 3300028794 Bacteria 4277
668 Ga0268256_1039230 3300030500 Bacteria 1071
669 Ga0268256_1083396 3300030500 Bacteria 594
670 Ga0307511_10001704 3300030521 Bacteria 23130
671 Ga0307511_10070638 3300030521 Bacteria 2555
672 Ga0307511_10103443 3300030521 Bacteria 1855
673 Ga0307511_10142563 3300030521 Bacteria 1402
674 Ga0307511_10145519 3300030521 Bacteria 1378
675 Ga0307512_10005071 3300030522 Bacteria 13997
676 Ga0307512_10362610 3300030522 Bacteria 631
677 Ga0316179_1085721 3300030734 Bacteria 663
678 Ga0265760_10132617 3300031090 Bacteria 807
679 Ga0307513_10779502 3300031456 Bacteria 662
680 Ga0307509_10116525 3300031507 Bacteria 2661
681 Ga0307509_10120432 3300031507 Bacteria 2603
682 Ga0307509_10250321 3300031507 Bacteria 1556
683 Ga0307408_100160846 3300031548 Bacteria 1783
684 Ga0307408_100194616 3300031548 Bacteria 1636
685 Ga0307408_100805547 3300031548 Bacteria 853
686 Ga0307508_10009811 3300031616 Bacteria 8773
687 Ga0307508_10042968 3300031616 Bacteria 4051
688 Ga0307508_10048153 3300031616 Bacteria 3798
689 Ga0307508_10071032 3300031616 Bacteria 3054
690 Ga0307508_10102457 3300031616 Bacteria 2458
691 Ga0307508_10192267 3300031616 Bacteria 1642
692 Ga0307508_10923375 3300031616 Bacteria 501
693 Ga0307514_10017611 3300031649 Bacteria 5872
694 Ga0316576_10033659 3300031727 Bacteria 3649
695 Ga0316578_10403236 3300031728 Bacteria 810
696 Ga0307516_10006885 3300031730 Bacteria 13238
697 Ga0307516_10033062 3300031730 Bacteria 5207
698 Ga0307405_10004991 3300031731 Bacteria 6343
699 Ga0307405_10012545 3300031731 Bacteria 4492
700 Ga0307405_10152741 3300031731 Bacteria 1625
701 Ga0307405_11136572 3300031731 Bacteria 673
702 Ga0307405_11371576 3300031731 Bacteria 617
703 Ga0307413_10010340 3300031824 Bacteria 4520
704 Ga0307413_10033503 3300031824 Bacteria 2926
705 Ga0307413_10052232 3300031824 Bacteria 2467
706 Ga0307413_10118605 3300031824 Bacteria 1787
707 Ga0307413_10241777 3300031824 Bacteria 1333
708 Ga0307413_10297416 3300031824 Bacteria 1222
709 Ga0307413_10376821 3300031824 Bacteria 1104
710 Ga0307410_10043621 3300031852 Bacteria 2973
711 Ga0307410_10044978 3300031852 Bacteria 2936
712 Ga0307410_10123949 3300031852 Bacteria 1888
713 Ga0307410_10176213 3300031852 Bacteria 1615
714 Ga0307410_10186697 3300031852 Bacteria 1574
715 Ga0307410_11023848 3300031852 Bacteria 713
716 Ga0307410_11392283 3300031852 Bacteria 615
717 Ga0307406_10009972 3300031901 Bacteria 5343
718 Ga0307406_10056284 3300031901 Bacteria 2517
719 Ga0307406_10060010 3300031901 Bacteria 2451
720 Ga0307406_10341765 3300031901 Bacteria 1166
721 Ga0307407_10031727 3300031903 Bacteria 2865
722 Ga0307407_10032507 3300031903 Bacteria 2837
723 Ga0307407_10064675 3300031903 Bacteria 2150
724 Ga0307407_10273585 3300031903 Bacteria 1167
725 Ga0307407_10277977 3300031903 Bacteria 1158
726 Ga0307407_10892285 3300031903 Bacteria 682
727 Ga0307412_10032183 3300031911 Bacteria 3320
728 Ga0307412_10390952 3300031911 Bacteria 1129
729 Ga0307412_10523528 3300031911 Bacteria 991
730 Ga0307412_10731183 3300031911 Bacteria 852
731 Ga0307412_11503781 3300031911 Bacteria 612
732 Ga0307409_100031324 3300031995 Bacteria 3836
733 Ga0307409_100051919 3300031995 Bacteria 3140
734 Ga0307409_100057907 3300031995 Bacteria 3006
735 Ga0307409_100179771 3300031995 Bacteria 1871
736 Ga0307409_100599435 3300031995 Bacteria 1088
737 Ga0307409_100930347 3300031995 Bacteria 884
738 Ga0307416_100002858 3300032002 Bacteria 10049
739 Ga0307416_100062131 3300032002 Bacteria 3052
740 Ga0307416_100259855 3300032002 Bacteria 1696
741 Ga0307416_100456040 3300032002 Bacteria 1332
742 Ga0307416_100987867 3300032002 Bacteria 944
743 Ga0307414_10061425 3300032004 Bacteria 2662
744 Ga0307414_10660101 3300032004 Bacteria 943
745 Ga0307414_10760414 3300032004 Bacteria 881
746 Ga0307411_10138399 3300032005 Bacteria 1791
747 Ga0307411_10149189 3300032005 Bacteria 1735
748 Ga0307411_10253669 3300032005 Bacteria 1385
749 Ga0307415_100001231 3300032126 Bacteria 11998
750 Ga0307415_100046044 3300032126 Bacteria 2928
751 Ga0307415_100061596 3300032126 Bacteria 2598
752 Ga0307415_100087992 3300032126 Bacteria 2240
753 Ga0307415_100159352 3300032126 Bacteria 1747
754 Ga0307415_100173443 3300032126 Bacteria 1684
755 Ga0307415_101590273 3300032126 Bacteria 628
756 Ga0307415_102008890 3300032126 Bacteria 563
757 Ga0307415_102388879 3300032126 Bacteria 519
758 Ga0307507_10000004 3300033179 Bacteria 289641
759 Ga0307507_10019522 3300033179 Bacteria 7630
760 Ga0307507_10048643 3300033179 Bacteria 4121
761 Ga0307507_10265614 3300033179 Bacteria 1090
762 Ga0307510_10178454 3300033180 Bacteria 1690
763 Ga0307510_10616655 3300033180 Bacteria 538
764 Ga0316596_1238806 3300033541 Bacteria 511
765 Ga0373926_0103561 3300035083 Bacteria 1066
766 Ga0373928_0242519 3300035084 Bacteria 534
767 Ga0373934_0081727 3300035086 Bacteria 1298
768 Ga0373944_0186231 3300035089 Bacteria 746
769 Ga0373923_0232371 3300035111 Bacteria 859
770 Ga0373936_0002652 3300035113 Bacteria 6692
771 Ga0373945_0032972 3300035116 Bacteria 1838
772 Ga0373953_0039958 3300035117 Bacteria 1861
773 Ga0373954_0109839 3300035118 Bacteria 1333
774 Ga0373956_0009853 3300035119 Bacteria 3892
775 Ga0373957_0004739 3300035120 Bacteria 4162
776 Ga0373943_0086429 3300035170 Bacteria 1617
777 Ga0373943_0105489 3300035170 Bacteria 1479
778 Ga0373943_0275242 3300035170 Bacteria 950
779 Ga0373943_0926660 3300035170 Bacteria 521
780 Ga0373946_0055434 3300035171 Bacteria 1671
781 Ga0373946_0562780 3300035171 Bacteria 589
782 Ga0373955_0618701 3300035172 Bacteria 663
783 Ga0316574_0006775 3300035398 Bacteria 6226
784 Ga0316574_0024958 3300035398 Bacteria 3583
785 Ga0373924_0046395 3300035410 Bacteria 1789
786 Ga0373931_0211674 3300035691 Bacteria 1163
787 Ga0373935_0032879 3300035692 Bacteria 3225
788 Ga0373935_0629943 3300035692 Bacteria 786
789 Ga0373935_1002202 3300035692 Bacteria 620
790 Ga0373935_1486592 3300035692 Bacteria 507
791 Ga0373927_0140364 3300035695 Bacteria 1580
792 Ga0373933_0048564 3300035724 Bacteria 2527
793 Ga0373947_0045323 3300035725 Bacteria 2631
794 Ga0373947_0740988 3300035725 Bacteria 670
795 Ga0373947_0771829 3300035725 Bacteria 656
796 Ga0373947_0970465 3300035725 Bacteria 580
797 Ga0373937_0219523 3300036401 Bacteria 1789
798 Ga0373925_0073378 3300037068 Bacteria 2590
799 Ga0373925_0192091 3300037068 Bacteria 1620
800 Ga0373925_0647254 3300037068 Bacteria 871
801 Ga0395899_0043872 3300037312 Bacteria 3333
802 Ga0395899_0063189 3300037312 Bacteria 2724
803 Ga0395899_0559152 3300037312 Bacteria 734
804 Ga0395900_0049812 3300037418 Bacteria 4316
805 Ga0395900_0254888 3300037418 Bacteria 1754
806 Ga0395900_0400701 3300037418 Bacteria 1336
807 Ga0395900_0738160 3300037418 Bacteria 916
808 Ga0395900_1515235 3300037418 Bacteria 583
809 Ga0395898_0004957 3300037466 Bacteria 14451
810 Ga0395898_0020289 3300037466 Bacteria 6750
811 Ga0395898_0204323 3300037466 Bacteria 1885
812 Ga0395898_0423014 3300037466 Bacteria 1269
813 Ga0395905_0140072 3300037471 Bacteria 2276
814 Ga0395905_0912000 3300037471 Bacteria 782
815 Ga0436364_0211036 3300037853 Bacteria 730
816 Ga0436364_1387664 3300037853 Bacteria 4015
817 Ga0436364_1513228 3300037853 Bacteria 4039
818 Ga0395901_0025589 3300038443 Bacteria 6058
819 Ga0395901_0028245 3300038443 Bacteria 5771
820 Ga0395901_0142136 3300038443 Bacteria 2522
821 Ga0395901_0220165 3300038443 Bacteria 1984
822 Ga0395901_1218419 3300038443 Bacteria 718
823 Ga0436365_1800393 3300039437 Bacteria 8156
824 Ga0436363_1600108 3300039450 Bacteria 685
825 Ga0439461_0108410 3300041410 Bacteria 683
826 Ga0451791_0732074 3300041451 Bacteria 665
827 Ga0451793_0443263 3300041452 Bacteria 721
828 Ga0451797_0046928 3300041453 Bacteria 561
829 Ga0451797_0063387 3300041453 Bacteria 810
830 Ga0451795_0944170 3300041456 Bacteria 1218
831 Ga0451804_0709125 3300041463 Bacteria 506
832 Ga0451807_2146582 3300041486 Bacteria 1462
833 Ga0451833_0363118 3300041491 Bacteria 816
834 Ga0451841_1156208 3300041498 Bacteria 1382
835 Ga0451851_0539892 3300041507 Bacteria 997
836 Ga0451843_1399856 3300041509 Bacteria 609
837 Ga0451853_0201250 3300041512 Bacteria 3896
838 Ga0451853_2009892 3300041512 Bacteria 1260
839 Ga0439433_0090839 3300041999 Bacteria 751
840 Ga0439442_034627 3300042002 Bacteria 1056
841 Ga0439443_068009 3300042003 Bacteria 646
842 Ga0439448_0000543 3300042005 Bacteria 8788
843 Ga0439448_0001808 3300042005 Bacteria 5658
844 Ga0439448_0001912 3300042005 Bacteria 5542
845 Ga0439448_0053491 3300042005 Bacteria 1325
846 Ga0439432_096512 3300042006 Bacteria 886
847 Ga0439449_0002001 3300042007 Bacteria 8009
848 Ga0439449_0092550 3300042007 Bacteria 1116
849 Ga0439450_001186 3300042008 Bacteria 3743
850 Ga0439450_003903 3300042008 Bacteria 2505
851 Ga0439451_007224 3300042009 Bacteria 2268
852 Ga0439451_010546 3300042009 Bacteria 1862
853 Ga0439454_010919 3300042011 Bacteria 1204
854 Ga0439454_071041 3300042011 Bacteria 618
855 Ga0439455_0000702 3300042012 Bacteria 4953
856 Ga0439455_0035109 3300042012 Bacteria 1264
857 Ga0439456_043433 3300042013 Bacteria 977
858 Ga0439457_016546 3300042014 Bacteria 1643
859 Ga0439463_000211 3300042016 Bacteria 15803
860 Ga0439463_007150 3300042016 Bacteria 2755
861 Ga0439463_094634 3300042016 Bacteria 769
862 Ga0450912_002482 3300042116 Bacteria 1244
863 Ga0450914_003043 3300042118 Bacteria 1258
864 Ga0450915_002074 3300042119 Bacteria 1012
865 Ga0450922_018805 3300042124 Bacteria 703
866 Ga0450923_092472 3300042125 Bacteria 691
867 Ga0450894_000582 3300042131 Bacteria 6155
868 Ga0450895_010376 3300042132 Bacteria 795
869 Ga0450896_006854 3300042133 Bacteria 1566
870 Ga0450898_002954 3300042134 Bacteria 2401
871 Ga0450900_000637 3300042136 Bacteria 2924
872 Ga0450900_004755 3300042136 Bacteria 1575
873 Ga0450900_023785 3300042136 Bacteria 866
874 Ga0450902_007496 3300042137 Bacteria 1690
875 Ga0450903_000222 3300042138 Bacteria 12668
876 Ga0450903_004285 3300042138 Bacteria 2442
877 Ga0450906_001179 3300042145 Bacteria 5782
878 Ga0450910_084117 3300042147 Bacteria 558
879 Ga0439446_0086653 3300042156 Bacteria 976
880 Ga0439458_0002925 3300042157 Bacteria 4102
881 Ga0439458_0020266 3300042157 Bacteria 1535
882 Ga0450908_001963 3300042184 Bacteria 4032
883 Ga0439435_0002840 3300042436 Bacteria 3510
884 Ga0439435_0118145 3300042436 Bacteria 828
885 Ga0439444_0003239 3300042437 Bacteria 2290
886 Ga0439444_0014537 3300042437 Bacteria 1317
887 Ga0439444_0169981 3300042437 Bacteria 536
888 Ga0439459_0004527 3300042438 Bacteria 2240
889 Ga0439459_0077429 3300042438 Bacteria 779
890 Ga0439464_0000089 3300042439 Bacteria 13293
891 Ga0439464_0237172 3300042439 Bacteria 587
892 Ga0450916_019008 3300042530 Bacteria 929
893 Ga0450893_0019003 3300042532 Bacteria 1174
894 Ga0450901_032004 3300042533 Bacteria 582
895 Ga0439440_0000033 3300042993 Bacteria 17433
896 Ga0439440_0024212 3300042993 Bacteria 1390
897 Ga0466969_0000873 3300044656 Bacteria 16345
898 Ga0466969_0008468 3300044656 Bacteria 5456
899 Ga0466969_0139742 3300044656 Bacteria 1120
900 Ga0466969_0264710 3300044656 Bacteria 779
901 Ga0466969_0610860 3300044656 Bacteria 501
902 Ga0466972_0003355 3300044658 Bacteria 7935
903 Ga0466972_0105820 3300044658 Bacteria 1330
904 Ga0466965_0000614 3300044683 Bacteria 13014
905 Ga0466965_0128809 3300044683 Bacteria 1311
906 Ga0466965_0285966 3300044683 Bacteria 892
907 Ga0466966_0007105 3300044684 Bacteria 7420
908 Ga0466966_0058977 3300044684 Bacteria 2425
909 Ga0466966_0060711 3300044684 Bacteria 2386
910 Ga0466966_0088433 3300044684 Bacteria 1925
911 Ga0466966_0313783 3300044684 Bacteria 942
912 Ga0466966_0410879 3300044684 Bacteria 813
913 Ga0466966_0776219 3300044684 Bacteria 578
914 Ga0466966_0900509 3300044684 Bacteria 533
915 Ga0466961_0001921 3300044693 Bacteria 12946
916 Ga0466961_0009405 3300044693 Bacteria 6225
917 Ga0466961_0023817 3300044693 Bacteria 3939
918 Ga0466961_0026189 3300044693 Bacteria 3751
919 Ga0466961_0059572 3300044693 Bacteria 2428
920 Ga0466961_0072197 3300044693 Bacteria 2189
921 Ga0466961_0155752 3300044693 Bacteria 1425
922 Ga0466961_0208213 3300044693 Bacteria 1208
923 Ga0466961_0575026 3300044693 Bacteria 678
924 Ga0466963_0004618 3300044694 Bacteria 8027
925 Ga0466963_0021337 3300044694 Bacteria 4084
926 Ga0466963_0056243 3300044694 Bacteria 2618
927 Ga0466963_0282237 3300044694 Bacteria 1167
928 Ga0466963_0284409 3300044694 Bacteria 1162
929 Ga0466963_0288668 3300044694 Bacteria 1153
930 Ga0466963_0302482 3300044694 Bacteria 1125
931 Ga0466963_0535370 3300044694 Bacteria 827
932 Ga0466963_0549153 3300044694 Bacteria 816
933 Ga0466963_0831908 3300044694 Bacteria 651
934 Ga0466964_0032966 3300044706 Bacteria 2061
935 Ga0466964_0061865 3300044706 Bacteria 1560
936 Ga0466964_0230905 3300044706 Bacteria 903
937 Ga0466964_0354057 3300044706 Bacteria 755
938 Ga0466964_0391946 3300044706 Bacteria 723
939 Ga0466964_0408856 3300044706 Bacteria 711
940 Ga0466971_0000629 3300044719 Bacteria 14080
941 Ga0466971_0016721 3300044719 Bacteria 3240
942 Ga0466971_0098445 3300044719 Bacteria 1343
943 Ga0466971_0116813 3300044719 Bacteria 1233
944 Ga0466971_0145427 3300044719 Bacteria 1105
945 Ga0466971_0179353 3300044719 Bacteria 995
946 Ga0466971_0415339 3300044719 Bacteria 657
947 Ga0466971_0645134 3300044719 Bacteria 530
948 Ga0466968_0136969 3300044735 Bacteria 1117
949 Ga0466970_0001377 3300044765 Bacteria 11706
950 Ga0466970_0030083 3300044765 Bacteria 2863
951 Ga0466970_0209856 3300044765 Bacteria 1085
952 Ga0466970_0222763 3300044765 Bacteria 1053
953 Ga0466970_0280012 3300044765 Bacteria 938
954 Ga0466970_0367753 3300044765 Bacteria 817
955 Ga0466970_0773766 3300044765 Bacteria 561
956 Ga0466957_0006278 3300044842 Bacteria 6705
957 Ga0466957_0010382 3300044842 Bacteria 5343
958 Ga0466957_0366712 3300044842 Bacteria 980
959 Ga0466957_0462526 3300044842 Bacteria 875
960 Ga0466957_0616643 3300044842 Bacteria 761
961 Ga0466957_0792033 3300044842 Bacteria 673
962 Ga0466957_0871388 3300044842 Bacteria 642
963 Ga0466957_1331580 3300044842 Bacteria 522
964 Ga0466957_1384974 3300044842 Bacteria 512
965 Ga0466960_0109978 3300044901 Bacteria 1430
966 Ga0466960_0517916 3300044901 Bacteria 700
967 Ga0466960_0607372 3300044901 Bacteria 650
968 Ga0466959_0000365 3300045049 Bacteria 26771
969 Ga0466959_0000617 3300045049 Bacteria 20706
970 Ga0466959_0036475 3300045049 Bacteria 3633
971 Ga0466959_0796026 3300045049 Bacteria 632
972 Ga0466959_1067356 3300045049 Bacteria 537
973 Ga0466958_0000185 3300045836 Bacteria 22546
974 Ga0466958_0013097 3300045836 Bacteria 4713
975 Ga0466958_0015443 3300045836 Bacteria 4375
976 Ga0466958_0034058 3300045836 Bacteria 3037
977 Ga0466958_0050301 3300045836 Bacteria 2523
978 Ga0466958_0177273 3300045836 Bacteria 1352
979 Ga0466958_0434593 3300045836 Bacteria 849
980 Ga0466958_0434798 3300045836 Bacteria 849
981 Ga0466958_0612196 3300045836 Bacteria 708
982 Ga0466958_0882127 3300045836 Bacteria 583
983 Ga0466958_0887339 3300045836 Bacteria 582
984 Ga0466967_0012726 3300045976 Bacteria 6458
985 Ga0466967_0024439 3300045976 Bacteria 4968
986 Ga0466967_0042374 3300045976 Bacteria 3933
987 Ga0466967_0162097 3300045976 Bacteria 2100
988 Ga0466967_0186708 3300045976 Bacteria 1958
989 Ga0466967_0191205 3300045976 Bacteria 1934
990 Ga0466967_0200361 3300045976 Bacteria 1890
991 Ga0466967_0252272 3300045976 Bacteria 1686
992 Ga0466967_0494070 3300045976 Bacteria 1200
993 Ga0466967_0657819 3300045976 Bacteria 1036
994 Ga0466967_1004103 3300045976 Bacteria 831
995 Ga0466967_1137537 3300045976 Bacteria 778
996 Ga0466967_1879981 3300045976 Bacteria 595
997 Ga0495617_113804 3300046452 Bacteria 874
998 Ga0495592_0003261 3300046454 Bacteria 11634
999 Ga0495592_0020580 3300046454 Bacteria 5021
1000 Ga0495592_0022586 3300046454 Bacteria 4785
1001 Ga0495603_0004326 3300046455 Bacteria 8470
1002 Ga0495603_0006636 3300046455 Bacteria 6942
1003 Ga0495603_0035572 3300046455 Bacteria 2991
1004 Ga0495603_0306303 3300046455 Bacteria 912
1005 Ga0495603_0593524 3300046455 Bacteria 634
1006 Ga0495629_0000710 3300046459 Bacteria 26980
1007 Ga0495629_0008081 3300046459 Bacteria 7744
1008 Ga0495629_0009932 3300046459 Bacteria 6946
1009 Ga0495629_0034307 3300046459 Bacteria 3587
1010 Ga0495629_0045243 3300046459 Bacteria 3088
1011 Ga0495638_0019718 3300046460 Bacteria 4459
1012 Ga0495641_0033691 3300046461 Bacteria 2429
1013 Ga0495641_0253296 3300046461 Bacteria 792
1014 Ga0495641_0487062 3300046461 Bacteria 562
1015 Ga0495651_0001993 3300046462 Bacteria 15807
1016 Ga0495651_0002231 3300046462 Bacteria 14956
1017 Ga0495651_0005685 3300046462 Bacteria 9503
1018 Ga0495651_0031302 3300046462 Bacteria 4149
1019 Ga0495653_0020146 3300046463 Bacteria 5406
1020 Ga0495580_0368845 3300046472 Bacteria 971
1021 Ga0495582_0105708 3300046473 Bacteria 1578
1022 Ga0495639_0008151 3300046475 Bacteria 4499
1023 Ga0495639_0027525 3300046475 Bacteria 2517
1024 Ga0495639_0054394 3300046475 Bacteria 1825
1025 Ga0495662_0031072 3300046476 Bacteria 2579
1026 Ga0495662_0080214 3300046476 Bacteria 1587
1027 Ga0495662_0083229 3300046476 Bacteria 1557
1028 Ga0495662_0084294 3300046476 Bacteria 1547
1029 Ga0495664_0000321 3300046477 Bacteria 23117
1030 Ga0495664_0088739 3300046477 Bacteria 1858
1031 Ga0495664_0095726 3300046477 Bacteria 1787
1032 Ga0495664_0098595 3300046477 Bacteria 1760
1033 Ga0495664_0314144 3300046477 Bacteria 945
1034 Ga0495664_0395118 3300046477 Bacteria 830
1035 Ga0495584_0136123 3300046491 Bacteria 1247
1036 Ga0495585_0017733 3300046492 Bacteria 4111
1037 Ga0495585_0033369 3300046492 Bacteria 2914
1038 Ga0495585_0111064 3300046492 Bacteria 1458
1039 Ga0495594_0039331 3300046499 Bacteria 2586
1040 Ga0495594_0145721 3300046499 Bacteria 1343
1041 Ga0495594_0150653 3300046499 Bacteria 1320
1042 Ga0495594_0802764 3300046499 Bacteria 530
1043 Ga0495596_0082647 3300046500 Bacteria 1247
1044 Ga0495607_0206477 3300046501 Bacteria 969
1045 Ga0495583_0099426 3300046506 Bacteria 1243
1046 Ga0495608_0006672 3300046511 Bacteria 8185
1047 Ga0495616_0077806 3300046513 Bacteria 1592
1048 Ga0495618_0010799 3300046514 Bacteria 5531
1049 Ga0495618_0080528 3300046514 Bacteria 2078
1050 Ga0495618_0103068 3300046514 Bacteria 1826
1051 Ga0495618_0220040 3300046514 Bacteria 1198
1052 Ga0495628_0039915 3300046516 Bacteria 3753
1053 Ga0495628_0165401 3300046516 Bacteria 1679
1054 Ga0495628_0238241 3300046516 Bacteria 1361
1055 Ga0495630_0016999 3300046517 Bacteria 5324
1056 Ga0495630_0084225 3300046517 Bacteria 2400
1057 Ga0495630_0216871 3300046517 Bacteria 1461
1058 Ga0495630_0636853 3300046517 Bacteria 817
1059 Ga0495630_0676156 3300046517 Bacteria 790
1060 Ga0495630_0713047 3300046517 Bacteria 767
1061 Ga0495632_0020483 3300046519 Bacteria 3580
1062 Ga0495643_0001559 3300046522 Bacteria 20433
1063 Ga0495644_0063076 3300046523 Bacteria 1393
1064 Ga0495644_0083621 3300046523 Bacteria 1203
1065 Ga0495663_0056690 3300046525 Bacteria 1224
1066 Ga0495666_0084330 3300046526 Bacteria 1501
1067 Ga0495642_0223776 3300046528 Bacteria 822
1068 Ga0495642_0511575 3300046528 Bacteria 532
1069 Ga0495652_0017484 3300046529 Bacteria 6398
1070 Ga0495652_0025898 3300046529 Bacteria 5182
1071 Ga0495652_0034744 3300046529 Bacteria 4392
1072 Ga0495652_0352308 3300046529 Bacteria 1054
1073 Ga0495652_0377922 3300046529 Bacteria 1008
1074 Ga0495652_1033179 3300046529 Bacteria 536
1075 Ga0495665_0008441 3300046531 Bacteria 5587
1076 Ga0495665_0010940 3300046531 Bacteria 4909
1077 Ga0495665_0017919 3300046531 Bacteria 3806
1078 Ga0495665_0211559 3300046531 Bacteria 1004
1079 Ga0495665_0339482 3300046531 Bacteria 766
1080 Ga0495640_0096099 3300046533 Bacteria 1949
1081 Ga0495640_0109840 3300046533 Bacteria 1803
1082 Ga0495640_0121285 3300046533 Bacteria 1699
1083 Ga0495640_0815792 3300046533 Bacteria 555
1084 Ga0495586_0003363 3300046535 Bacteria 8577
1085 Ga0495586_0126535 3300046535 Bacteria 1429
1086 Ga0495586_0379976 3300046535 Bacteria 812
1087 Ga0495586_0430274 3300046535 Bacteria 760
1088 Ga0495586_0677679 3300046535 Bacteria 595
1089 Ga0495587_0002686 3300046536 Bacteria 11874
1090 Ga0495587_0007528 3300046536 Bacteria 7052
1091 Ga0495587_0066958 3300046536 Bacteria 2094
1092 Ga0495598_0044534 3300046537 Bacteria 1311
1093 Ga0495645_0020552 3300046543 Bacteria 4766
1094 Ga0495645_0153683 3300046543 Bacteria 1596
1095 Ga0495622_0085722 3300046557 Bacteria 1449
1096 Ga0495622_0108014 3300046557 Bacteria 1274
1097 Ga0495622_0141533 3300046557 Bacteria 1092
1098 Ga0495633_0212677 3300046558 Bacteria 886
1099 Ga0495633_0562945 3300046558 Bacteria 513
1100 Ga0495667_0023497 3300046559 Bacteria 4153
1101 Ga0495656_0006417 3300046615 Bacteria 4126
1102 Ga0495656_0015188 3300046615 Bacteria 2903
1103 Ga0495656_0523719 3300046615 Bacteria 630
1104 Ga0495668_0274835 3300046616 Bacteria 923
1105 Ga0495634_0001805 3300046642 Bacteria 18484
1106 Ga0495634_0024244 3300046642 Bacteria 4259
1107 Ga0495634_0536005 3300046642 Bacteria 683
1108 Ga0495611_0051654 3300046648 Bacteria 1853
1109 Ga0495611_0162654 3300046648 Bacteria 1043
1110 Ga0495611_0231408 3300046648 Bacteria 859
1111 Ga0495625_0002573 3300046660 Bacteria 19482
1112 Ga0495635_0002591 3300046663 Bacteria 12376
1113 Ga0495635_0006046 3300046663 Bacteria 8443
1114 Ga0495635_0052660 3300046663 Bacteria 2803
1115 Ga0495635_0398335 3300046663 Bacteria 915
1116 Ga0495635_0853723 3300046663 Bacteria 585
1117 Ga0495659_0142221 3300046664 Bacteria 958
1118 Ga0495661_0164531 3300046665 Bacteria 1188
1119 Ga0495661_0622543 3300046665 Bacteria 506
1120 Ga0495588_0000642 3300046674 Bacteria 16256
1121 Ga0495588_0002751 3300046674 Bacteria 7549
1122 Ga0495588_0142205 3300046674 Bacteria 1267
1123 Ga0495657_0003132 3300046675 Bacteria 13662
1124 Ga0495657_0038819 3300046675 Bacteria 3274
1125 Ga0495657_0191587 3300046675 Bacteria 1249
1126 Ga0495599_0072878 3300046678 Bacteria 2143
1127 Ga0495599_0263261 3300046678 Bacteria 1047
1128 Ga0495623_0013318 3300046679 Bacteria 5334
1129 Ga0495623_0026406 3300046679 Bacteria 3738
1130 Ga0495623_0278068 3300046679 Bacteria 932
1131 Ga0495646_0000324 3300046680 Bacteria 24548
1132 Ga0495646_0015431 3300046680 Bacteria 4849
1133 Ga0495646_0095738 3300046680 Bacteria 1707
1134 Ga0495647_0129790 3300046681 Bacteria 1067
1135 Ga0495658_0008765 3300046683 Bacteria 5024
1136 Ga0495658_0051207 3300046683 Bacteria 2338
1137 Ga0495658_0279756 3300046683 Bacteria 1053
1138 Ga0495658_0374186 3300046683 Bacteria 906
1139 Ga0495669_0222810 3300046684 Bacteria 904
1140 Ga0495613_0000764 3300046689 Bacteria 25140
1141 Ga0495613_0006537 3300046689 Bacteria 8713
1142 Ga0495613_0010964 3300046689 Bacteria 6728
1143 Ga0495613_0015577 3300046689 Bacteria 5655
1144 Ga0495613_0404236 3300046689 Bacteria 931
1145 Ga0495613_0716355 3300046689 Bacteria 658
1146 Ga0495613_1035109 3300046689 Bacteria 526
1147 Ga0495624_0026063 3300046690 Bacteria 3833
1148 Ga0495624_0058275 3300046690 Bacteria 2426
1149 Ga0495624_0355367 3300046690 Bacteria 881
1150 Ga0495670_0013814 3300046691 Bacteria 3970
1151 Ga0495670_0019327 3300046691 Bacteria 3356
1152 Ga0495670_0051167 3300046691 Bacteria 2067
1153 Ga0495670_0077290 3300046691 Bacteria 1692
1154 Ga0495671_0036258 3300046692 Bacteria 2499
1155 Ga0495671_0070031 3300046692 Bacteria 1723
1156 Ga0495589_0116420 3300046794 Bacteria 1288
1157 Ga0495589_0282406 3300046794 Bacteria 772
1158 Ga0495589_0313285 3300046794 Bacteria 726
1159 Ga0495600_0004577 3300046809 Bacteria 8294
1160 Ga0495600_0013881 3300046809 Bacteria 5073
1161 Ga0495600_0017958 3300046809 Bacteria 4503
1162 Ga0495600_0031433 3300046809 Bacteria 3439
1163 Ga0495660_0054464 3300046810 Bacteria 2167
1164 Ga0495581_0000238 3300047315 Bacteria 26091
1165 Ga0495581_0003747 3300047315 Bacteria 8754
1166 Ga0495581_0019051 3300047315 Bacteria 3983
1167 Ga0495581_0049246 3300047315 Bacteria 2433
1168 Ga0495581_0050619 3300047315 Bacteria 2399
1169 Ga0495581_0064715 3300047315 Bacteria 2113
1170 Ga0495604_0002587 3300047317 Bacteria 14490
1171 Ga0495604_0014277 3300047317 Bacteria 6333
1172 Ga0495604_0015750 3300047317 Bacteria 6034
1173 Ga0495604_0124864 3300047317 Bacteria 1857
1174 Ga0495636_0001805 3300047318 Bacteria 8178
1175 Ga0495636_0020472 3300047318 Bacteria 2666
1176 Ga0495636_0054268 3300047318 Bacteria 1684
1177 Ga0495636_0123511 3300047318 Bacteria 1147
1178 Ga0495674_0046634 3300047319 Bacteria 3846
1179 Ga0495674_0125423 3300047319 Bacteria 2167
1180 Ga0495674_0174904 3300047319 Bacteria 1789
1181 Ga0495674_1241798 3300047319 Bacteria 561
1182 Ga0495676_0001601 3300047321 Bacteria 19648
1183 Ga0495676_0016702 3300047321 Bacteria 6500
1184 Ga0495676_0025794 3300047321 Bacteria 5069
1185 Ga0495676_0049046 3300047321 Bacteria 3399
1186 Ga0495676_0230854 3300047321 Bacteria 1271
1187 Ga0495676_0589931 3300047321 Bacteria 724
1188 Ga0495676_0694091 3300047321 Bacteria 659
1189 Ga0495676_0777352 3300047321 Bacteria 617
1190 Ga0495676_0922942 3300047321 Bacteria 559
1191 Ga0495680_0013650 3300047322 Bacteria 7077
1192 Ga0495680_0227853 3300047322 Bacteria 1328
1193 Ga0495687_001481 3300047443 Bacteria 21470
1194 Ga0495675_0003598 3300047444 Bacteria 9346
1195 Ga0495675_0225808 3300047444 Bacteria 1131
1196 Ga0495677_0090778 3300047445 Bacteria 1151
1197 Ga0495685_000247 3300047447 Bacteria 18692
1198 Ga0495685_133299 3300047447 Bacteria 812
1199 Ga0495685_215545 3300047447 Bacteria 613
1200 Ga0495681_0000245 3300047470 Bacteria 45204
1201 Ga0495681_0002253 3300047470 Bacteria 13865
1202 Ga0495684_0029888 3300047471 Bacteria 4182
1203 Ga0495686_0016970 3300047472 Bacteria 4918
1204 Ga0495686_0145358 3300047472 Bacteria 1396
1205 Ga0495593_0000138 3300047673 Bacteria 35243
1206 Ga0495593_0027904 3300047673 Bacteria 3103
1207 Ga0495593_0419964 3300047673 Bacteria 669
1208 Ga0495602_0025051 3300048088 Bacteria 5781
1209 Ga0495602_0106055 3300048088 Bacteria 2294
1210 Ga0495602_0280340 3300048088 Bacteria 1228
1211 Ga0495602_0425073 3300048088 Bacteria 943
1212 Ga0495614_0003797 3300048089 Bacteria 6791
1213 Ga0495614_0007036 3300048089 Bacteria 5024
1214 Ga0495614_0115694 3300048089 Bacteria 1179
1215 Ga0495626_0254129 3300048091 Bacteria 704
1216 Ga0496100_0075470 3300048903 Bacteria 2261
1217 Ga0496100_0099232 3300048903 Bacteria 2003
1218 Ga0496101_0045807 3300048904 Bacteria 3134
1219 Ga0496101_0755843 3300048904 Bacteria 767
1220 Ga0496101_0969990 3300048904 Bacteria 669
1221 Ga0496102_0005011 3300048905 Bacteria 11218
1222 Ga0496102_0010869 3300048905 Bacteria 7837
1223 Ga0496102_0035508 3300048905 Bacteria 4487
1224 Ga0496103_0027147 3300048906 Bacteria 3467
1225 Ga0496103_0113802 3300048906 Bacteria 1720
1226 Ga0496103_0137800 3300048906 Bacteria 1560
1227 Ga0496103_1059738 3300048906 Bacteria 503
1228 Ga0496104_0008259 3300048907 Bacteria 9243
1229 Ga0496104_0751688 3300048907 Bacteria 882
1230 Ga0496104_1126017 3300048907 Bacteria 688
1231 Ga0496105_0060824 3300048908 Bacteria 3117
1232 Ga0496105_0353605 3300048908 Bacteria 1173
1233 Ga0496105_0520553 3300048908 Bacteria 932
1234 Ga0496105_0527843 3300048908 Bacteria 924
1235 Ga0496106_0047288 3300048909 Bacteria 3237
1236 Ga0496106_0063796 3300048909 Bacteria 2801
1237 Ga0496106_0118244 3300048909 Bacteria 2069
1238 Ga0496107_0002569 3300048910 Bacteria 11842
1239 Ga0496107_0060942 3300048910 Bacteria 2731
1240 Ga0496108_0058515 3300048911 Bacteria 3239
1241 Ga0496108_0085285 3300048911 Bacteria 2680
1242 Ga0496108_0188911 3300048911 Bacteria 1785
1243 Ga0496109_0127666 3300048912 Bacteria 2371
1244 Ga0496109_0544574 3300048912 Bacteria 1095
1245 Ga0496109_0716823 3300048912 Bacteria 938
1246 Ga0496109_0764108 3300048912 Bacteria 904
1247 Ga0496109_1056385 3300048912 Bacteria 749
1248 Ga0496109_1462390 3300048912 Bacteria 618
1249 Ga0496110_0027642 3300048913 Bacteria 4863
1250 Ga0496110_0038230 3300048913 Bacteria 4174
1251 Ga0496110_0174858 3300048913 Bacteria 1949
1252 Ga0496110_1864313 3300048913 Bacteria 511
1253 Ga0496111_0035067 3300048914 Bacteria 3584
1254 Ga0496111_0741937 3300048914 Bacteria 713
1255 Ga0496112_0113328 3300048915 Bacteria 2682
1256 Ga0496112_0404333 3300048915 Bacteria 1305
1257 Ga0496112_0832628 3300048915 Bacteria 847
1258 Ga0496113_0040177 3300048916 Bacteria 3446
1259 Ga0496113_0088139 3300048916 Bacteria 2387
1260 Ga0496113_0720869 3300048916 Bacteria 795
1261 Ga0496114_0038329 3300048917 Bacteria 3965
1262 Ga0496114_0107652 3300048917 Bacteria 2386
1263 Ga0496114_1802307 3300048917 Bacteria 500
1264 Ga0496115_0400190 3300048918 Bacteria 1114
1265 Ga0496119_0234972 3300048922 Bacteria 931
1266 Ga0496126_0684430 3300048929 Bacteria 799
1267 Ga0501318_081340 3300049534 Bacteria 525
1268 Ga0501031_0001780 3300049568 Bacteria 13515
1269 Ga0501031_0017177 3300049568 Bacteria 4701
1270 Ga0501031_0029479 3300049568 Bacteria 3579
1271 Ga0501031_0061817 3300049568 Bacteria 2440
1272 Ga0501031_0898503 3300049568 Bacteria 567
1273 Ga0501031_0936363 3300049568 Bacteria 554
1274 Ga0501032_0028713 3300049569 Bacteria 3821
1275 Ga0501032_0123909 3300049569 Bacteria 1708
1276 Ga0501032_0552085 3300049569 Bacteria 734
1277 Ga0501032_0722735 3300049569 Bacteria 631
1278 Ga0501033_0006059 3300049570 Bacteria 9482
1279 Ga0501033_0021304 3300049570 Bacteria 4889
1280 Ga0501033_0037724 3300049570 Bacteria 3616
1281 Ga0501033_0072646 3300049570 Bacteria 2526
1282 Ga0501033_0192030 3300049570 Bacteria 1461
1283 Ga0501033_1007595 3300049570 Bacteria 556
1284 Ga0501033_1019594 3300049570 Bacteria 553
1285 Ga0501034_0000924 3300049571 Bacteria 42892
1286 Ga0501034_0002789 3300049571 Bacteria 20464
1287 Ga0501034_0022110 3300049571 Bacteria 6478
1288 Ga0501034_0171104 3300049571 Bacteria 2139
1289 Ga0501034_0172536 3300049571 Bacteria 2129
1290 Ga0501034_0495594 3300049571 Bacteria 1136
1291 Ga0501036_0000311 3300049572 Bacteria 33892
1292 Ga0501036_0035488 3300049572 Bacteria 4219
1293 Ga0501036_0056446 3300049572 Bacteria 3328
1294 Ga0501036_0060193 3300049572 Bacteria 3217
1295 Ga0501036_0322210 3300049572 Bacteria 1291
1296 Ga0501036_0392960 3300049572 Bacteria 1157
1297 Ga0501036_1090149 3300049572 Bacteria 652
1298 Ga0501037_0056238 3300049573 Bacteria 2874
1299 Ga0501037_0096108 3300049573 Bacteria 2141
1300 Ga0501037_0111730 3300049573 Bacteria 1968
1301 Ga0501037_0180209 3300049573 Bacteria 1499
1302 Ga0501038_0000729 3300049574 Bacteria 29347
1303 Ga0501038_0001008 3300049574 Bacteria 25385
1304 Ga0501038_0001438 3300049574 Bacteria 21853
1305 Ga0501038_0003450 3300049574 Bacteria 14741
1306 Ga0501038_0022056 3300049574 Bacteria 5711
1307 Ga0501038_0183858 3300049574 Bacteria 1685
1308 Ga0501039_0001818 3300049575 Bacteria 15776
1309 Ga0501039_0012672 3300049575 Bacteria 6443
1310 Ga0501039_0395712 3300049575 Bacteria 1085
1311 Ga0501039_0493035 3300049575 Bacteria 962
1312 Ga0501040_0000601 3300049576 Bacteria 21952
1313 Ga0501040_0030966 3300049576 Bacteria 3615
1314 Ga0501040_0357376 3300049576 Bacteria 1047
1315 Ga0501041_0000058 3300049577 Bacteria 40571
1316 Ga0501041_0017390 3300049577 Bacteria 4279
1317 Ga0501042_0000028 3300049578 Bacteria 47448
1318 Ga0501042_0001191 3300049578 Bacteria 15071
1319 Ga0501042_0163184 3300049578 Bacteria 1607
1320 Ga0501042_0164637 3300049578 Bacteria 1600
1321 Ga0501043_0006711 3300049579 Bacteria 9191
1322 Ga0501043_0047630 3300049579 Bacteria 3370
1323 Ga0501043_0248654 3300049579 Bacteria 1370
1324 Ga0501043_0374102 3300049579 Bacteria 1079
1325 Ga0501046_0000269 3300049580 Bacteria 52979
1326 Ga0501046_0002221 3300049580 Bacteria 18318
1327 Ga0501046_0138238 3300049580 Bacteria 1845
1328 Ga0501046_0332087 3300049580 Bacteria 1106
1329 Ga0501046_0948634 3300049580 Bacteria 599
1330 Ga0501047_0000029 3300049581 Bacteria 218396
1331 Ga0501047_0051999 3300049581 Bacteria 3959
1332 Ga0501047_0100758 3300049581 Bacteria 2768
1333 Ga0501047_0124606 3300049581 Bacteria 2457
1334 Ga0501047_0199083 3300049581 Bacteria 1864
1335 Ga0501047_0653749 3300049581 Bacteria 871
1336 Ga0501047_1227583 3300049581 Bacteria 563
1337 Ga0501048_0000208 3300049582 Bacteria 38576
1338 Ga0501048_0000611 3300049582 Bacteria 25411
1339 Ga0501048_0326634 3300049582 Bacteria 1093
1340 Ga0501067_0200869 3300049583 Bacteria 1110
1341 Ga0501067_0293683 3300049583 Bacteria 905
1342 Ga0501067_0729157 3300049583 Bacteria 557
1343 Ga0501068_0066237 3300049584 Bacteria 2200
1344 Ga0501068_0216071 3300049584 Bacteria 1218
1345 Ga0501069_0085582 3300049585 Bacteria 1779
1346 Ga0501069_0111832 3300049585 Bacteria 1556
1347 Ga0501069_0351033 3300049585 Bacteria 869
1348 Ga0501069_0560716 3300049585 Bacteria 684
1349 Ga0501070_0003598 3300049586 Bacteria 13404
1350 Ga0501070_0038542 3300049586 Bacteria 3987
1351 Ga0501070_0082761 3300049586 Bacteria 2656
1352 Ga0501070_0259504 3300049586 Bacteria 1420
1353 Ga0501070_0537171 3300049586 Bacteria 937
1354 Ga0501070_0615630 3300049586 Bacteria 865
1355 Ga0501070_0755595 3300049586 Bacteria 766
1356 Ga0501071_0001455 3300049587 Bacteria 13716
1357 Ga0501071_0003307 3300049587 Bacteria 10072
1358 Ga0501071_0022572 3300049587 Bacteria 4388
1359 Ga0501071_0245959 3300049587 Bacteria 1349
1360 Ga0501072_0000452 3300049588 Bacteria 29576
1361 Ga0501072_0607383 3300049588 Bacteria 862
1362 Ga0501073_0148755 3300049589 Bacteria 1623
1363 Ga0501073_0269320 3300049589 Bacteria 1175
1364 Ga0501073_0428564 3300049589 Bacteria 914
1365 Ga0501074_0006540 3300049590 Bacteria 8419
1366 Ga0501074_0010495 3300049590 Bacteria 6723
1367 Ga0501074_0156894 3300049590 Bacteria 1625
1368 Ga0501074_0501964 3300049590 Bacteria 859
1369 Ga0501075_0002435 3300049591 Bacteria 12394
1370 Ga0501075_0025620 3300049591 Bacteria 4333
1371 Ga0501075_0206031 3300049591 Bacteria 1500
1372 Ga0501076_0000061 3300049592 Bacteria 53989
1373 Ga0501076_0363209 3300049592 Bacteria 1189
1374 Ga0501077_0000349 3300049593 Bacteria 27264
1375 Ga0501077_0285411 3300049593 Bacteria 1051
1376 Ga0501217_094455 3300049661 Bacteria 843
1377 Ga0501222_074394 3300049662 Bacteria 533
1378 Ga0501243_099432 3300049675 Bacteria 586
1379 Ga0501250_016109 3300049680 Bacteria 926
1380 Ga0501079_0000185 3300049741 Bacteria 35586
1381 Ga0501079_0004729 3300049741 Bacteria 10082
1382 Ga0501079_0167023 3300049741 Bacteria 1716
1383 Ga0501080_0035150 3300049742 Bacteria 4678
1384 Ga0501080_0050424 3300049742 Bacteria 3874
1385 Ga0501080_0091102 3300049742 Bacteria 2832
1386 Ga0501080_0922097 3300049742 Bacteria 760
1387 Ga0501080_1263783 3300049742 Bacteria 633
1388 Ga0501080_1757283 3300049742 Bacteria 522
1389 Ga0501081_0000808 3300049743 Bacteria 18487
1390 Ga0501081_0014905 3300049743 Bacteria 5127
1391 Ga0501083_0072299 3300049744 Bacteria 2293
1392 Ga0501083_0081237 3300049744 Bacteria 2149
1393 Ga0501035_0005880 3300049822 Bacteria 11554
1394 Ga0501035_0030498 3300049822 Bacteria 4914
1395 Ga0501035_0057970 3300049822 Bacteria 3452
1396 Ga0501035_0059274 3300049822 Bacteria 3409
1397 Ga0501035_0082543 3300049822 Bacteria 2836
1398 Ga0501035_0629839 3300049822 Bacteria 871
1399 Ga0501035_0677754 3300049822 Bacteria 833
1400 Ga0501035_0813446 3300049822 Bacteria 746
1401 Ga0501044_0004269 3300049823 Bacteria 16039
1402 Ga0501044_0016800 3300049823 Bacteria 7854
1403 Ga0501044_0053274 3300049823 Bacteria 4163
1404 Ga0501044_0130851 3300049823 Bacteria 2503
1405 Ga0501044_0313001 3300049823 Bacteria 1496
1406 Ga0501044_0794045 3300049823 Bacteria 826
1407 Ga0501044_1328849 3300049823 Bacteria 585
1408 Ga0501045_0000044 3300049824 Bacteria 54187
1409 Ga0501045_0000099 3300049824 Bacteria 42877
1410 Ga0501045_0003799 3300049824 Bacteria 10386
1411 Ga0501045_0416961 3300049824 Bacteria 999
1412 nmdc:mga03n38_642101_c1 3300050490 Bacteria 608
1413 nmdc:mga06z11_6901_c1 3300050494 Bacteria 4648
1414 nmdc:mga04h51_7603_c1 3300050495 Bacteria 2867
1415 nmdc:mga07m45_412112_c1 3300050496 Bacteria 784
1416 nmdc:mga05p37_1978877_c1 3300050507 Bacteria 552
1417 nmdc:mga05p37_2500_c1 3300050507 Bacteria 21375
1418 nmdc:mga05p37_296234_c1 3300050507 Bacteria 1924
1419 nmdc:mga05p37_476371_c1 3300050507 Bacteria 1439
1420 nmdc:mga09592_29416_c1 3300050508 Bacteria 4570
1421 nmdc:mga09592_297686_c1 3300050508 Bacteria 1399
1422 nmdc:mga09592_621605_c1 3300050508 Bacteria 924
1423 nmdc:mga0qj67_11266_c1 3300050509 Bacteria 6698
1424 nmdc:mga0qj67_1196375_c1 3300050509 Bacteria 591
1425 nmdc:mga06r32_39821_c1 3300050510 Bacteria 4461
1426 nmdc:mga08y16_1109_c1 3300050511 Bacteria 26540
1427 nmdc:mga0n895_2244304_c1 3300050512 Bacteria 501
1428 nmdc:mga0n895_336722_c1 3300050512 Bacteria 1529
1429 nmdc:mga0n895_557889_c1 3300050512 Bacteria 1151
1430 nmdc:mga0rr50_6991_c1 3300050513 Bacteria 6924
1431 nmdc:mga08x19_43194_c1 3300050514 Bacteria 2876
1432 nmdc:mga08x19_927160_c1 3300050514 Bacteria 619
1433 nmdc:mga0a205_18720_c2 3300050515 Bacteria 3115
1434 nmdc:mga0a205_1920_c1 3300050515 Bacteria 18059
1435 nmdc:mga0a205_472147_c1 3300050515 Bacteria 1113
1436 Ga0495601_0054938 3300053077 Bacteria 2520
1437 Ga0495601_0315218 3300053077 Bacteria 1018
1438 Ga0495601_0507899 3300053077 Bacteria 777
1439 Ga0495612_0024870 3300053078 Bacteria 2404
1440 Ga0495612_0052359 3300053078 Bacteria 1679
1441 Ga0495612_0106079 3300053078 Bacteria 1199
1442 Ga0495655_0183927 3300053083 Bacteria 675
1443 Ga0495655_0242719 3300053083 Bacteria 603
1444 Ga0495595_0004357 3300053084 Bacteria 5697
1445 Ga0495595_0317009 3300053084 Bacteria 785
1446 Ga0495619_0080196 3300053085 Bacteria 2196
1447 Ga0495619_0081314 3300053085 Bacteria 2181
1448 Ga0500578_0061920 3300053086 Bacteria 2388
1449 Ga0500578_0073961 3300053086 Bacteria 2171
1450 Ga0500644_0087099 3300053088 Bacteria 1161
1451 Ga0500646_0172845 3300053090 Bacteria 728
1452 Ga0500583_0177827 3300053092 Bacteria 1060
1453 Ga0500566_0029128 3300053094 Bacteria 3226
1454 Ga0500640_001975 3300053095 Bacteria 6582
1455 Ga0500660_133674 3300053100 Bacteria 1002
1456 Ga0500553_121642 3300053101 Bacteria 1074
1457 Ga0500560_043872 3300053107 Bacteria 1412
1458 Ga0500560_239485 3300053107 Bacteria 570
1459 Ga0500569_005079 3300053109 Bacteria 2809
1460 Ga0500572_088195 3300053111 Bacteria 980
1461 Ga0500580_239330 3300053113 Bacteria 551
1462 Ga0500582_185900 3300053114 Bacteria 705
1463 Ga0500614_010286 3300053123 Bacteria 2007
1464 Ga0500621_206050 3300053126 Bacteria 692
1465 Ga0500628_001049 3300053129 Bacteria 4827
1466 Ga0500652_001997 3300053131 Bacteria 6143
1467 Ga0500658_0004724 3300053134 Bacteria 5074
1468 Ga0500559_0029534 3300053136 Bacteria 2348
1469 Ga0500559_0304142 3300053136 Bacteria 749
1470 Ga0500561_0000420 3300053137 Bacteria 6976
1471 Ga0500573_0025239 3300053140 Bacteria 3417
1472 Ga0500573_0508023 3300053140 Bacteria 543
1473 Ga0500577_0268877 3300053142 Bacteria 742
1474 Ga0500579_036618 3300053143 Bacteria 3114
1475 Ga0500586_260713 3300053145 Bacteria 539
1476 Ga0500588_0176562 3300053146 Bacteria 784
1477 Ga0500600_0047044 3300053149 Bacteria 2461
1478 Ga0500600_0231398 3300053149 Bacteria 844
1479 Ga0500603_178475 3300053150 Bacteria 667
1480 Ga0500606_139456 3300053152 Bacteria 796
1481 Ga0500616_0029739 3300053153 Bacteria 3004
1482 Ga0500627_0221498 3300053158 Bacteria 844
1483 Ga0500633_0000496 3300053160 Bacteria 6294
1484 Ga0500634_0000253 3300053161 Bacteria 17110
1485 Ga0500634_0187598 3300053161 Bacteria 923
1486 Ga0500656_000060 3300053732 Bacteria 6255
1487 Ga0500587_002698 3300053739 Bacteria 2514
1488 Ga0501084_0002725 3300054114 Bacteria 14245
1489 Ga0501084_0007261 3300054114 Bacteria 9133
1490 Ga0501084_0190792 3300054114 Bacteria 1729
1491 Ga0501084_0903292 3300054114 Bacteria 743
1492 Ga0590071_003818 3300059421 Bacteria 3701
1493 Ga0590074_013428 3300059423 Bacteria 1383
1494 Ga0590074_021961 3300059423 Bacteria 1102
1495 Ga0590075_018110 3300059424 Bacteria 1740
1496 Ga0590077_000958 3300059426 Bacteria 7357
1497 Ga0590077_073095 3300059426 Bacteria 784
1498 Ga0587073_0298714 3300059492 Bacteria 523
1499 Ga0587082_162506 3300059504 Bacteria 536
1500 Ga0587072_186239 3300059643 Bacteria 521
1501 Ga0501082_0003253 3300060353 Bacteria 14176
1502 Ga0501082_0041255 3300060353 Bacteria 3979
1503 Ga0501082_0385269 3300060353 Bacteria 1223
1504 Ga0466962_0000765 3300061719 Bacteria 14422
1505 Ga0466962_0027782 3300061719 Bacteria 2712
1506 Ga0466962_0077974 3300061719 Bacteria 1584
1507 Ga0530510_0000204 3300061734 Bacteria 36725
1508 Ga0530510_0036828 3300061734 Bacteria 3525
1509 Ga0530510_0817184 3300061734 Bacteria 711

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100236745 Ga0070708_1002367452 59
2 3300012492 Ga0157335_1026195 Ga0157335_10261952 60
3 3300005327 Ga0070658_10002606 Ga0070658_100026062 68
4 3300044684 Ga0466966_0088433 Ga0466966_0088433_1389_1625 68
5 3300044693 Ga0466961_0059572 Ga0466961_0059572_712_948 68
6 3300044765 Ga0466970_0773766 Ga0466970_0773766_135_371 68
7 3300044842 Ga0466957_0871388 Ga0466957_0871388_20_256 68
8 3300045049 Ga0466959_1067356 Ga0466959_1067356_173_409 68
9 3300053111 Ga0500572_088195 Ga0500572_088195_272_514 68
10 3300053136 Ga0500559_0029534 Ga0500559_0029534_1133_1375 68
11 iso_pu_bacteria 2738543005 2739203231 68
12 iso_pu_bacteria 2928142448 2928142545 68
13 3300025935 Ga0207709_10907226 Ga0207709_109072261 69
14 3300049580 Ga0501046_0138238 Ga0501046_0138238_363_581 70
15 3300049568 Ga0501031_0898503 Ga0501031_0898503_241_456 71
16 3300049569 Ga0501032_0722735 Ga0501032_0722735_18_236 71
17 3300049742 Ga0501080_1757283 Ga0501080_1757283_287_502 71
18 3300041509 Ga0451843_1399856 Ga0451843_1399856_293_511 72
19 iso_pu_bacteria 2547132111 2547410434 73
20 iso_pu_bacteria 2582581312 2585297487 73
21 iso_pu_bacteria 2582581313 2585307691 73
22 iso_pu_bacteria 2582581314 2585316697 73
23 iso_pu_bacteria 2616644814 2616699965 73
24 iso_pu_bacteria 2616644941 2616903816 73
25 iso_pu_bacteria 2643221587 2643945597 73
26 iso_pu_bacteria 2643221670 2644387103 73
27 iso_pu_bacteria 2643221677 2644434863 73
28 iso_pu_bacteria 2643221678 2644437820 73
29 iso_pu_bacteria 2643221714 2644629794 73
30 iso_pu_bacteria 2675903060 2676488933 73
31 iso_pu_bacteria 2767802112 2768647055 73
32 iso_pu_bacteria 2784132148 2784590588 73
33 iso_pu_bacteria 2784746768 2785371760 73
34 iso_pu_bacteria 2786546132 2786672865 73
35 iso_pu_bacteria 2791355406 2793984781 73
36 iso_pu_bacteria 2808606359 2808844213 73
37 iso_pu_bacteria 2808606375 2808913832 73
38 iso_pu_bacteria 2808606448 2809234280 73
39 iso_pu_bacteria 2808606982 2811844175 73
40 iso_pu_bacteria 2818991472 2819740511 73
41 iso_pu_bacteria 2862178590 2862181733 73
42 iso_pu_bacteria 2862281513 2862284393 73
43 iso_pu_bacteria 2862382967 2862391807 73
44 iso_pu_bacteria 2862507626 2862508986 73
45 iso_pu_bacteria 2862705112 2862706131 73
46 iso_pu_bacteria 2863404153 2863408836 73
47 iso_pu_bacteria 2866552031 2866552724 73
48 iso_pu_bacteria 2867346516 2867350855 73
49 iso_pu_bacteria 2867369537 2867374029 73
50 iso_pu_bacteria 2867428634 2867430389 73
51 iso_pu_bacteria 2867475112 2867475709 73
52 iso_pu_bacteria 2877676314 2877678838 73
53 iso_pu_bacteria 2895427314 2895429286 73
54 iso_pu_bacteria 2912715099 2912717386 73
55 iso_pu_bacteria 2912723979 2912729965 73
56 iso_pu_bacteria 2918501144 2918506712 73
57 iso_pu_bacteria 2919468124 2919472442 73
58 iso_pu_bacteria 2946072368 2946077931 73
59 iso_pu_bacteria 2947224130 2947226734 73
60 iso_pu_bacteria 2954002825 2954005748 73
61 iso_pu_bacteria 2954380949 2954383800 73
62 iso_pu_bacteria 2954673503 2954679169 73
63 iso_pu_bacteria 2954682443 2954684983 73
64 iso_pu_bacteria 2954691527 2954694598 73
65 iso_pu_bacteria 2954701450 2954709802 73
66 iso_pu_bacteria 2954711539 2954714099 73
67 iso_pu_bacteria 2954721474 2954724052 73
68 iso_pu_bacteria 2954731030 2954737788 73
69 iso_pu_bacteria 2954740390 2954742950 73
70 iso_pu_bacteria 2954749733 2954756623 73
71 iso_pu_bacteria 2954759201 2954761908 73
72 iso_pu_bacteria 2990088156 2990093987 73
73 iso_pu_bacteria 2997451912 2997453062 73
74 iso_pu_bacteria 2997600082 2997603964 73
75 iso_pu_bacteria 3006321560 3006324809 73
76 iso_pu_bacteria 3006393351 3006397144 73
77 iso_pu_bacteria 3006425503 3006426570 73
78 iso_pu_bacteria 3006493962 3006494736 73
79 iso_pu_bacteria 8008485437 8008487188 73
80 iso_pu_bacteria 8008558824 8008563003 73
81 iso_pu_bacteria 8008574985 8008576955 73
82 iso_pu_bacteria 8023623736 8023624800 73
83 iso_pu_bacteria 8025478263 8025481132 73
84 iso_pu_bacteria 8025524527 8025526379 73
85 iso_pu_bacteria 8025530807 8025532617 73
86 iso_pu_bacteria 8033684223 8033686773 73
87 iso_pu_bacteria 8047893842 8047895867 73
88 iso_pu_bacteria 8048127548 8048129132 73
89 iso_pu_bacteria 8048356638 8048363067 73
90 iso_pu_bacteria 8048369669 8048372891 73
91 iso_pu_bacteria 8048379754 8048381825 73
92 iso_pu_bacteria 8054160619 8054165326 73
93 iso_pu_bacteria 8054472261 8054473305 73
94 iso_pu_bacteria 8055066027 8055073095 73
95 iso_pu_bacteria 8056447290 8056450045 73
96 iso_pu_bacteria 8056667051 8056671157 73
97 iso_pu_bacteria 8056829672 8056831524 73
98 iso_pu_bacteria 2515154155 2515853614 74
99 iso_pu_bacteria 2837268691 2837272885 74
100 iso_pu_bacteria 2868088558 2868093893 74
101 3300005328 Ga0070676_11167441 Ga0070676_111674412 76
102 3300005334 Ga0068869_100047601 Ga0068869_1000476014 76
103 3300005338 Ga0068868_100230523 Ga0068868_1002305232 76
104 3300005341 Ga0070691_10209610 Ga0070691_102096102 76
105 3300005343 Ga0070687_100589783 Ga0070687_1005897832 76
106 3300005345 Ga0070692_10179902 Ga0070692_101799021 76
107 3300005347 Ga0070668_101237749 Ga0070668_1012377491 76
108 3300005354 Ga0070675_100521069 Ga0070675_1005210692 76
109 3300005355 Ga0070671_100460874 Ga0070671_1004608742 76
110 3300005366 Ga0070659_102088356 Ga0070659_1020883562 76
111 3300005441 Ga0070700_100014074 Ga0070700_1000140743 76
112 3300005455 Ga0070663_100679015 Ga0070663_1006790152 76
113 3300005457 Ga0070662_100281198 Ga0070662_1002811982 76
114 3300005535 Ga0070684_100706452 Ga0070684_1007064521 76
115 3300005545 Ga0070695_100375328 Ga0070695_1003753282 76
116 3300005546 Ga0070696_100090898 Ga0070696_1000908984 76
117 3300005547 Ga0070693_100308034 Ga0070693_1003080342 76
118 3300005547 Ga0070693_100665321 Ga0070693_1006653212 76
119 3300005577 Ga0068857_101599873 Ga0068857_1015998731 76
120 3300005578 Ga0068854_100501014 Ga0068854_1005010142 76
121 3300017792 Ga0163161_10559656 Ga0163161_105596562 76
122 3300025901 Ga0207688_10333190 Ga0207688_103331902 76
123 3300025907 Ga0207645_10143196 Ga0207645_101431963 76
124 3300025927 Ga0207687_10651963 Ga0207687_106519632 76
125 3300025932 Ga0207690_10652843 Ga0207690_106528432 76
126 3300025933 Ga0207706_10374031 Ga0207706_103740313 76
127 3300025942 Ga0207689_10099790 Ga0207689_100997902 76
128 3300026023 Ga0207677_11107215 Ga0207677_111072151 76
129 3300026075 Ga0207708_10002817 Ga0207708_100028174 76
130 3300026118 Ga0207675_100321669 Ga0207675_1003216693 76
131 3300027695 Ga0209966_1114722 Ga0209966_11147221 76
132 3300001976 JGI24752J21851_1038130 JGI24752J21851_10381301 77
133 3300001977 JGI24746J21847_1070487 JGI24746J21847_10704871 77
134 3300001990 JGI24737J22298_10003653 JGI24737J22298_100036532 77
135 3300001990 JGI24737J22298_10063356 JGI24737J22298_100633562 77
136 3300002067 JGI24735J21928_10021020 JGI24735J21928_100210203 77
137 3300002075 JGI24738J21930_10055472 JGI24738J21930_100554722 77
138 3300002077 JGI24744J21845_10079380 JGI24744J21845_100793802 77
139 3300002459 JGI24751J29686_10027934 JGI24751J29686_100279342 77
140 3300003316 rootH1_10041734 rootH1_100417343 77
141 3300003320 rootH2_10067360 rootH2_100673602 77
142 3300003322 rootL2_10041928 rootL2_100419282 77
143 3300003322 rootL2_10063672 rootL2_100636723 77
144 3300003323 rootH1_10009634 rootH1_100096342 77
145 3300003323 rootH1_10030202 rootH1_100302022 77
146 3300003323 rootH1_10030203 rootH1_100302033 77
147 3300003373 JGI25407J50210_10045851 JGI25407J50210_100458512 77
148 3300003559 Ga0007427J51700_123488 Ga0007427J51700_1234881 77
149 3300004799 Ga0058863_11889194 Ga0058863_118891941 77
150 3300005327 Ga0070658_10017488 Ga0070658_100174884 77
151 3300005327 Ga0070658_10211772 Ga0070658_102117723 77
152 3300005327 Ga0070658_10290895 Ga0070658_102908952 77
153 3300005328 Ga0070676_10194093 Ga0070676_101940932 77
154 3300005329 Ga0070683_100094876 Ga0070683_1000948762 77
155 3300005329 Ga0070683_100741609 Ga0070683_1007416092 77
156 3300005329 Ga0070683_100997461 Ga0070683_1009974612 77
157 3300005329 Ga0070683_101053993 Ga0070683_1010539932 77
158 3300005329 Ga0070683_102370549 Ga0070683_1023705492 77
159 3300005330 Ga0070690_100026467 Ga0070690_1000264673 77
160 3300005330 Ga0070690_100504626 Ga0070690_1005046262 77
161 3300005330 Ga0070690_100553406 Ga0070690_1005534061 77
162 3300005331 Ga0070670_100399061 Ga0070670_1003990612 77
163 3300005334 Ga0068869_100080194 Ga0068869_1000801942 77
164 3300005334 Ga0068869_100142285 Ga0068869_1001422852 77
165 3300005334 Ga0068869_101415583 Ga0068869_1014155831 77
166 3300005335 Ga0070666_10243862 Ga0070666_102438622 77
167 3300005336 Ga0070680_100010848 Ga0070680_1000108483 77
168 3300005336 Ga0070680_100081816 Ga0070680_1000818161 77
169 3300005336 Ga0070680_100504165 Ga0070680_1005041651 77
170 3300005336 Ga0070680_101238269 Ga0070680_1012382691 77
171 3300005337 Ga0070682_100016723 Ga0070682_1000167233 77
172 3300005337 Ga0070682_100295407 Ga0070682_1002954072 77
173 3300005337 Ga0070682_100333382 Ga0070682_1003333822 77
174 3300005337 Ga0070682_100356082 Ga0070682_1003560821 77
175 3300005338 Ga0068868_100008400 Ga0068868_1000084002 77
176 3300005338 Ga0068868_100286586 Ga0068868_1002865862 77
177 3300005338 Ga0068868_100511960 Ga0068868_1005119602 77
178 3300005338 Ga0068868_101236380 Ga0068868_1012363802 77
179 3300005338 Ga0068868_101418932 Ga0068868_1014189322 77
180 3300005338 Ga0068868_101927925 Ga0068868_1019279251 77
181 3300005339 Ga0070660_100020384 Ga0070660_1000203844 77
182 3300005339 Ga0070660_100297132 Ga0070660_1002971322 77
183 3300005339 Ga0070660_100638871 Ga0070660_1006388711 77
184 3300005339 Ga0070660_101448560 Ga0070660_1014485602 77
185 3300005340 Ga0070689_100135688 Ga0070689_1001356883 77
186 3300005340 Ga0070689_100264718 Ga0070689_1002647183 77
187 3300005341 Ga0070691_10119418 Ga0070691_101194182 77
188 3300005341 Ga0070691_10837424 Ga0070691_108374242 77
189 3300005343 Ga0070687_100045504 Ga0070687_1000455042 77
190 3300005343 Ga0070687_100263442 Ga0070687_1002634422 77
191 3300005343 Ga0070687_100863039 Ga0070687_1008630392 77
192 3300005344 Ga0070661_100317573 Ga0070661_1003175731 77
193 3300005345 Ga0070692_10090763 Ga0070692_100907632 77
194 3300005345 Ga0070692_10481120 Ga0070692_104811201 77
195 3300005347 Ga0070668_100507403 Ga0070668_1005074032 77
196 3300005353 Ga0070669_100113141 Ga0070669_1001131413 77
197 3300005354 Ga0070675_100004208 Ga0070675_1000042086 77
198 3300005354 Ga0070675_101290541 Ga0070675_1012905412 77
199 3300005355 Ga0070671_100001993 Ga0070671_1000019933 77
200 3300005355 Ga0070671_100597275 Ga0070671_1005972752 77
201 3300005356 Ga0070674_100356443 Ga0070674_1003564431 77
202 3300005356 Ga0070674_101189748 Ga0070674_1011897482 77
203 3300005364 Ga0070673_100004884 Ga0070673_1000048845 77
204 3300005364 Ga0070673_100581137 Ga0070673_1005811371 77
205 3300005365 Ga0070688_100112668 Ga0070688_1001126682 77
206 3300005366 Ga0070659_100002405 Ga0070659_10000240516 77
207 3300005366 Ga0070659_100020513 Ga0070659_1000205135 77
208 3300005366 Ga0070659_100275939 Ga0070659_1002759392 77
209 3300005367 Ga0070667_101137246 Ga0070667_1011372462 77
210 3300005367 Ga0070667_101195776 Ga0070667_1011957762 77
211 3300005434 Ga0070709_10014255 Ga0070709_100142556 77
212 3300005434 Ga0070709_11216682 Ga0070709_112166821 77
213 3300005435 Ga0070714_100009390 Ga0070714_1000093902 77
214 3300005435 Ga0070714_100016298 Ga0070714_1000162983 77
215 3300005435 Ga0070714_100019750 Ga0070714_1000197502 77
216 3300005435 Ga0070714_101612938 Ga0070714_1016129382 77
217 3300005436 Ga0070713_100006832 Ga0070713_1000068329 77
218 3300005436 Ga0070713_100143478 Ga0070713_1001434782 77
219 3300005436 Ga0070713_100375319 Ga0070713_1003753193 77
220 3300005436 Ga0070713_101042885 Ga0070713_1010428852 77
221 3300005437 Ga0070710_10113375 Ga0070710_101133752 77
222 3300005437 Ga0070710_10831655 Ga0070710_108316551 77
223 3300005438 Ga0070701_10130586 Ga0070701_101305862 77
224 3300005438 Ga0070701_10293836 Ga0070701_102938362 77
225 3300005439 Ga0070711_100001086 Ga0070711_10000108612 77
226 3300005439 Ga0070711_100201208 Ga0070711_1002012082 77
227 3300005440 Ga0070705_100097124 Ga0070705_1000971242 77
228 3300005444 Ga0070694_101919948 Ga0070694_1019199481 77
229 3300005445 Ga0070708_100006735 Ga0070708_1000067352 77
230 3300005445 Ga0070708_100098106 Ga0070708_1000981063 77
231 3300005445 Ga0070708_100133949 Ga0070708_1001339491 77
232 3300005445 Ga0070708_100272583 Ga0070708_1002725832 77
233 3300005445 Ga0070708_101302768 Ga0070708_1013027682 77
234 3300005455 Ga0070663_100082281 Ga0070663_1000822813 77
235 3300005455 Ga0070663_100756894 Ga0070663_1007568942 77
236 3300005456 Ga0070678_100001267 Ga0070678_10000126715 77
237 3300005456 Ga0070678_100626753 Ga0070678_1006267532 77
238 3300005456 Ga0070678_100975294 Ga0070678_1009752941 77
239 3300005456 Ga0070678_101950197 Ga0070678_1019501971 77
240 3300005457 Ga0070662_100007273 Ga0070662_1000072733 77
241 3300005457 Ga0070662_101328954 Ga0070662_1013289541 77
242 3300005458 Ga0070681_10000046 Ga0070681_1000004674 77
243 3300005458 Ga0070681_10002542 Ga0070681_100025421 77
244 3300005458 Ga0070681_10059510 Ga0070681_100595103 77
245 3300005458 Ga0070681_10798072 Ga0070681_107980722 77
246 3300005458 Ga0070681_10863061 Ga0070681_108630612 77
247 3300005459 Ga0068867_100011982 Ga0068867_1000119824 77
248 3300005459 Ga0068867_100083090 Ga0068867_1000830902 77
249 3300005459 Ga0068867_100795119 Ga0068867_1007951192 77
250 3300005459 Ga0068867_101692293 Ga0068867_1016922932 77
251 3300005467 Ga0070706_100003607 Ga0070706_10000360713 77
252 3300005467 Ga0070706_100003790 Ga0070706_1000037907 77
253 3300005467 Ga0070706_100010869 Ga0070706_10001086911 77
254 3300005467 Ga0070706_100050423 Ga0070706_1000504235 77
255 3300005467 Ga0070706_100254086 Ga0070706_1002540862 77
256 3300005467 Ga0070706_100277831 Ga0070706_1002778313 77
257 3300005468 Ga0070707_100003265 Ga0070707_1000032652 77
258 3300005468 Ga0070707_100005057 Ga0070707_1000050573 77
259 3300005468 Ga0070707_100008692 Ga0070707_1000086926 77
260 3300005468 Ga0070707_100084153 Ga0070707_1000841533 77
261 3300005468 Ga0070707_100463351 Ga0070707_1004633513 77
262 3300005468 Ga0070707_100540171 Ga0070707_1005401712 77
263 3300005471 Ga0070698_100001113 Ga0070698_1000011136 77
264 3300005471 Ga0070698_100028531 Ga0070698_1000285315 77
265 3300005471 Ga0070698_100031028 Ga0070698_1000310284 77
266 3300005471 Ga0070698_100060083 Ga0070698_1000600832 77
267 3300005471 Ga0070698_100522246 Ga0070698_1005222461 77
268 3300005471 Ga0070698_101312455 Ga0070698_1013124552 77
269 3300005471 Ga0070698_101435958 Ga0070698_1014359582 77
270 3300005518 Ga0070699_100145208 Ga0070699_1001452083 77
271 3300005530 Ga0070679_100001623 Ga0070679_10000162311 77
272 3300005530 Ga0070679_100007199 Ga0070679_10000719914 77
273 3300005530 Ga0070679_100025362 Ga0070679_1000253626 77
274 3300005530 Ga0070679_100067238 Ga0070679_1000672386 77
275 3300005530 Ga0070679_100069299 Ga0070679_1000692993 77
276 3300005530 Ga0070679_100411525 Ga0070679_1004115251 77
277 3300005530 Ga0070679_101109460 Ga0070679_1011094602 77
278 3300005530 Ga0070679_102148866 Ga0070679_1021488661 77
279 3300005535 Ga0070684_100003597 Ga0070684_1000035975 77
280 3300005535 Ga0070684_100232644 Ga0070684_1002326443 77
281 3300005535 Ga0070684_101741503 Ga0070684_1017415031 77
282 3300005536 Ga0070697_100024673 Ga0070697_1000246732 77
283 3300005536 Ga0070697_100044501 Ga0070697_1000445012 77
284 3300005539 Ga0068853_100029100 Ga0068853_1000291007 77
285 3300005539 Ga0068853_100291323 Ga0068853_1002913232 77
286 3300005539 Ga0068853_101725594 Ga0068853_1017255941 77
287 3300005543 Ga0070672_101928585 Ga0070672_1019285852 77
288 3300005544 Ga0070686_100100101 Ga0070686_1001001012 77
289 3300005544 Ga0070686_100288427 Ga0070686_1002884272 77
290 3300005545 Ga0070695_100091599 Ga0070695_1000915993 77
291 3300005547 Ga0070693_100795504 Ga0070693_1007955042 77
292 3300005548 Ga0070665_100021695 Ga0070665_1000216956 77
293 3300005548 Ga0070665_100436018 Ga0070665_1004360183 77
294 3300005548 Ga0070665_101111229 Ga0070665_1011112291 77
295 3300005549 Ga0070704_100032625 Ga0070704_1000326253 77
296 3300005563 Ga0068855_100333298 Ga0068855_1003332981 77
297 3300005563 Ga0068855_100731405 Ga0068855_1007314053 77
298 3300005563 Ga0068855_101175757 Ga0068855_1011757572 77
299 3300005563 Ga0068855_101484090 Ga0068855_1014840901 77
300 3300005563 Ga0068855_102140500 Ga0068855_1021405002 77
301 3300005564 Ga0070664_101305891 Ga0070664_1013058912 77
302 3300005578 Ga0068854_100042731 Ga0068854_1000427313 77
303 3300005578 Ga0068854_100589408 Ga0068854_1005894081 77
304 3300005578 Ga0068854_101917209 Ga0068854_1019172092 77
305 3300005614 Ga0068856_100005097 Ga0068856_1000050978 77
306 3300005614 Ga0068856_100057717 Ga0068856_1000577174 77
307 3300005614 Ga0068856_101808229 Ga0068856_1018082292 77
308 3300005615 Ga0070702_100004225 Ga0070702_1000042253 77
309 3300005615 Ga0070702_100080927 Ga0070702_1000809272 77
310 3300005615 Ga0070702_100313064 Ga0070702_1003130642 77
311 3300005616 Ga0068852_100656752 Ga0068852_1006567522 77
312 3300005617 Ga0068859_100103322 Ga0068859_1001033224 77
313 3300005617 Ga0068859_100743162 Ga0068859_1007431621 77
314 3300005618 Ga0068864_100150583 Ga0068864_1001505832 77
315 3300005719 Ga0068861_100856385 Ga0068861_1008563851 77
316 3300005719 Ga0068861_101805216 Ga0068861_1018052162 77
317 3300005834 Ga0068851_10004867 Ga0068851_100048674 77
318 3300005840 Ga0068870_10000527 Ga0068870_100005275 77
319 3300005840 Ga0068870_10383754 Ga0068870_103837542 77
320 3300005841 Ga0068863_100551384 Ga0068863_1005513842 77
321 3300005843 Ga0068860_100011881 Ga0068860_1000118814 77
322 3300005843 Ga0068860_100382222 Ga0068860_1003822222 77
323 3300005844 Ga0068862_101638029 Ga0068862_1016380292 77
324 3300005937 Ga0081455_10043358 Ga0081455_100433582 77
325 3300005937 Ga0081455_10117743 Ga0081455_101177432 77
326 3300005937 Ga0081455_10119826 Ga0081455_101198262 77
327 3300005981 Ga0081538_10002364 Ga0081538_1000236412 77
328 3300005981 Ga0081538_10005374 Ga0081538_1000537412 77
329 3300005981 Ga0081538_10007077 Ga0081538_1000707711 77
330 3300005981 Ga0081538_10081668 Ga0081538_100816682 77
331 3300005983 Ga0081540_1030633 Ga0081540_10306332 77
332 3300005985 Ga0081539_10003373 Ga0081539_100033739 77
333 3300005985 Ga0081539_10027511 Ga0081539_100275115 77
334 3300005985 Ga0081539_10108528 Ga0081539_101085283 77
335 3300005985 Ga0081539_10133968 Ga0081539_101339682 77
336 3300005985 Ga0081539_10285595 Ga0081539_102855951 77
337 3300006028 Ga0070717_10001330 Ga0070717_100013302 77
338 3300006028 Ga0070717_10127505 Ga0070717_101275052 77
339 3300006028 Ga0070717_10244269 Ga0070717_102442692 77
340 3300006038 Ga0075365_10116531 Ga0075365_101165312 77
341 3300006042 Ga0075368_10016793 Ga0075368_100167932 77
342 3300006048 Ga0075363_100004041 Ga0075363_1000040412 77
343 3300006048 Ga0075363_100049434 Ga0075363_1000494343 77
344 3300006058 Ga0075432_10006062 Ga0075432_100060624 77
345 3300006163 Ga0070715_10041515 Ga0070715_100415151 77
346 3300006173 Ga0070716_100030422 Ga0070716_1000304221 77
347 3300006173 Ga0070716_100193030 Ga0070716_1001930302 77
348 3300006173 Ga0070716_100598449 Ga0070716_1005984492 77
349 3300006175 Ga0070712_100011977 Ga0070712_1000119772 77
350 3300006175 Ga0070712_100187544 Ga0070712_1001875442 77
351 3300006175 Ga0070712_100400537 Ga0070712_1004005372 77
352 3300006175 Ga0070712_101759396 Ga0070712_1017593962 77
353 3300006178 Ga0075367_10133995 Ga0075367_101339951 77
354 3300006186 Ga0075369_10096581 Ga0075369_100965812 77
355 3300006194 Ga0075427_10054111 Ga0075427_100541112 77
356 3300006237 Ga0097621_101583515 Ga0097621_1015835152 77
357 3300006353 Ga0075370_10589045 Ga0075370_105890452 77
358 3300006358 Ga0068871_100564435 Ga0068871_1005644352 77
359 3300006358 Ga0068871_101251433 Ga0068871_1012514332 77
360 3300006844 Ga0075428_100269707 Ga0075428_1002697072 77
361 3300006844 Ga0075428_102123594 Ga0075428_1021235942 77
362 3300006846 Ga0075430_100120579 Ga0075430_1001205792 77
363 3300006846 Ga0075430_101445355 Ga0075430_1014453552 77
364 3300006847 Ga0075431_100251599 Ga0075431_1002515991 77
365 3300006847 Ga0075431_101037325 Ga0075431_1010373252 77
366 3300006852 Ga0075433_10117521 Ga0075433_101175212 77
367 3300006852 Ga0075433_10131394 Ga0075433_101313943 77
368 3300006852 Ga0075433_10225470 Ga0075433_102254702 77
369 3300006852 Ga0075433_11444570 Ga0075433_114445701 77
370 3300006871 Ga0075434_100087552 Ga0075434_1000875524 77
371 3300006871 Ga0075434_100613869 Ga0075434_1006138692 77
372 3300006880 Ga0075429_100035629 Ga0075429_1000356295 77
373 3300006880 Ga0075429_100796680 Ga0075429_1007966802 77
374 3300006880 Ga0075429_100901602 Ga0075429_1009016022 77
375 3300006881 Ga0068865_100015369 Ga0068865_1000153697 77
376 3300006881 Ga0068865_100792231 Ga0068865_1007922312 77
377 3300006914 Ga0075436_100006077 Ga0075436_1000060779 77
378 3300006914 Ga0075436_100309015 Ga0075436_1003090152 77
379 3300006914 Ga0075436_100572094 Ga0075436_1005720943 77
380 3300006931 Ga0097620_100103333 Ga0097620_1001033334 77
381 3300006931 Ga0097620_100743018 Ga0097620_1007430181 77
382 3300007076 Ga0075435_100022736 Ga0075435_1000227364 77
383 3300009011 Ga0105251_10009941 Ga0105251_100099412 77
384 3300009011 Ga0105251_10067454 Ga0105251_100674542 77
385 3300009011 Ga0105251_10375366 Ga0105251_103753662 77
386 3300009036 Ga0105244_10029526 Ga0105244_100295263 77
387 3300009036 Ga0105244_10506751 Ga0105244_105067512 77
388 3300009092 Ga0105250_10113357 Ga0105250_101133572 77
389 3300009093 Ga0105240_10032907 Ga0105240_100329077 77
390 3300009093 Ga0105240_10181039 Ga0105240_101810392 77
391 3300009093 Ga0105240_10319795 Ga0105240_103197952 77
392 3300009093 Ga0105240_11006790 Ga0105240_110067902 77
393 3300009094 Ga0111539_10017829 Ga0111539_100178296 77
394 3300009094 Ga0111539_10059096 Ga0111539_100590966 77
395 3300009098 Ga0105245_10017915 Ga0105245_100179152 77
396 3300009098 Ga0105245_10060270 Ga0105245_100602703 77
397 3300009098 Ga0105245_10179536 Ga0105245_101795364 77
398 3300009098 Ga0105245_10371275 Ga0105245_103712751 77
399 3300009098 Ga0105245_10488273 Ga0105245_104882731 77
400 3300009098 Ga0105245_10818897 Ga0105245_108188972 77
401 3300009098 Ga0105245_11197458 Ga0105245_111974582 77
402 3300009098 Ga0105245_11419024 Ga0105245_114190241 77
403 3300009098 Ga0105245_11457142 Ga0105245_114571421 77
404 3300009098 Ga0105245_12326789 Ga0105245_123267892 77
405 3300009098 Ga0105245_12886651 Ga0105245_128866512 77
406 3300009098 Ga0105245_13238202 Ga0105245_132382022 77
407 3300009101 Ga0105247_10027969 Ga0105247_100279694 77
408 3300009147 Ga0114129_10254651 Ga0114129_102546513 77
409 3300009147 Ga0114129_10919485 Ga0114129_109194852 77
410 3300009148 Ga0105243_10003463 Ga0105243_100034635 77
411 3300009148 Ga0105243_10090981 Ga0105243_100909812 77
412 3300009148 Ga0105243_10307892 Ga0105243_103078923 77
413 3300009148 Ga0105243_11422868 Ga0105243_114228681 77
414 3300009148 Ga0105243_12176516 Ga0105243_121765162 77
415 3300009174 Ga0105241_10030071 Ga0105241_100300712 77
416 3300009174 Ga0105241_11064862 Ga0105241_110648621 77
417 3300009174 Ga0105241_12327124 Ga0105241_123271241 77
418 3300009174 Ga0105241_12494513 Ga0105241_124945131 77
419 3300009176 Ga0105242_10002867 Ga0105242_1000286711 77
420 3300009176 Ga0105242_10008779 Ga0105242_100087797 77
421 3300009176 Ga0105242_10035559 Ga0105242_100355595 77
422 3300009176 Ga0105242_10195487 Ga0105242_101954872 77
423 3300009176 Ga0105242_10474130 Ga0105242_104741302 77
424 3300009176 Ga0105242_10510739 Ga0105242_105107392 77
425 3300009176 Ga0105242_10753568 Ga0105242_107535682 77
426 3300009176 Ga0105242_10833574 Ga0105242_108335742 77
427 3300009176 Ga0105242_11143954 Ga0105242_111439541 77
428 3300009176 Ga0105242_11424747 Ga0105242_114247472 77
429 3300009177 Ga0105248_10003481 Ga0105248_1000348113 77
430 3300009177 Ga0105248_10093019 Ga0105248_100930194 77
431 3300009177 Ga0105248_12085505 Ga0105248_120855052 77
432 3300009545 Ga0105237_10078772 Ga0105237_100787724 77
433 3300009545 Ga0105237_10631744 Ga0105237_106317442 77
434 3300009545 Ga0105237_10662312 Ga0105237_106623122 77
435 3300009545 Ga0105237_11697000 Ga0105237_116970001 77
436 3300009551 Ga0105238_10078051 Ga0105238_100780512 77
437 3300009551 Ga0105238_11024704 Ga0105238_110247042 77
438 3300009551 Ga0105238_12498524 Ga0105238_124985241 77
439 3300009553 Ga0105249_11188012 Ga0105249_111880122 77
440 3300009553 Ga0105249_12223255 Ga0105249_122232552 77
441 3300009553 Ga0105249_12338792 Ga0105249_123387921 77
442 3300010375 Ga0105239_10084743 Ga0105239_100847434 77
443 3300010375 Ga0105239_10373470 Ga0105239_103734702 77
444 3300010375 Ga0105239_10614933 Ga0105239_106149332 77
445 3300010375 Ga0105239_10641253 Ga0105239_106412533 77
446 3300010375 Ga0105239_10643461 Ga0105239_106434612 77
447 3300010375 Ga0105239_10728044 Ga0105239_107280441 77
448 3300010375 Ga0105239_11134548 Ga0105239_111345483 77
449 3300010375 Ga0105239_11586667 Ga0105239_115866672 77
450 3300010375 Ga0105239_13111694 Ga0105239_131116942 77
451 3300011119 Ga0105246_10000043 Ga0105246_1000004334 77
452 3300011119 Ga0105246_10031384 Ga0105246_100313844 77
453 3300011119 Ga0105246_10041465 Ga0105246_100414654 77
454 3300011119 Ga0105246_10466383 Ga0105246_104663832 77
455 3300011119 Ga0105246_11055673 Ga0105246_110556731 77
456 3300012475 Ga0157317_1017853 Ga0157317_10178532 77
457 3300012497 Ga0157319_1033671 Ga0157319_10336711 77
458 3300012498 Ga0157345_1031719 Ga0157345_10317191 77
459 3300012503 Ga0157313_1002065 Ga0157313_10020653 77
460 3300012506 Ga0157324_1008608 Ga0157324_10086082 77
461 3300012512 Ga0157327_1042893 Ga0157327_10428932 77
462 3300013100 Ga0157373_10053758 Ga0157373_100537584 77
463 3300013100 Ga0157373_10336419 Ga0157373_103364192 77
464 3300013100 Ga0157373_10565652 Ga0157373_105656522 77
465 3300013100 Ga0157373_10977254 Ga0157373_109772542 77
466 3300013100 Ga0157373_11356028 Ga0157373_113560281 77
467 3300013102 Ga0157371_10017120 Ga0157371_100171206 77
468 3300013102 Ga0157371_10080787 Ga0157371_100807871 77
469 3300013102 Ga0157371_10571147 Ga0157371_105711472 77
470 3300013102 Ga0157371_10842869 Ga0157371_108428692 77
471 3300013102 Ga0157371_10943151 Ga0157371_109431511 77
472 3300013104 Ga0157370_10067578 Ga0157370_100675784 77
473 3300013104 Ga0157370_10117335 Ga0157370_101173352 77
474 3300013104 Ga0157370_10420426 Ga0157370_104204262 77
475 3300013104 Ga0157370_10926837 Ga0157370_109268371 77
476 3300013105 Ga0157369_10000870 Ga0157369_1000087020 77
477 3300013105 Ga0157369_10054557 Ga0157369_100545572 77
478 3300013105 Ga0157369_10102442 Ga0157369_101024422 77
479 3300013105 Ga0157369_10227184 Ga0157369_102271842 77
480 3300013105 Ga0157369_10241307 Ga0157369_102413072 77
481 3300013105 Ga0157369_10973780 Ga0157369_109737803 77
482 3300013105 Ga0157369_11735141 Ga0157369_117351411 77
483 3300013105 Ga0157369_11823400 Ga0157369_118234001 77
484 3300013105 Ga0157369_12471059 Ga0157369_124710591 77
485 3300013296 Ga0157374_10017768 Ga0157374_100177683 77
486 3300013296 Ga0157374_10027093 Ga0157374_100270932 77
487 3300013296 Ga0157374_10093890 Ga0157374_100938902 77
488 3300013296 Ga0157374_10229907 Ga0157374_102299072 77
489 3300013296 Ga0157374_10599384 Ga0157374_105993842 77
490 3300013296 Ga0157374_11584229 Ga0157374_115842291 77
491 3300013296 Ga0157374_12416973 Ga0157374_124169731 77
492 3300013297 Ga0157378_11041478 Ga0157378_110414782 77
493 3300013297 Ga0157378_11186342 Ga0157378_111863422 77
494 3300013297 Ga0157378_12061621 Ga0157378_120616212 77
495 3300013297 Ga0157378_13112107 Ga0157378_131121071 77
496 3300013306 Ga0163162_10055426 Ga0163162_100554263 77
497 3300013306 Ga0163162_10332005 Ga0163162_103320052 77
498 3300013306 Ga0163162_11132157 Ga0163162_111321572 77
499 3300013306 Ga0163162_11541457 Ga0163162_115414571 77
500 3300013307 Ga0157372_10224670 Ga0157372_102246704 77
501 3300013307 Ga0157372_10346837 Ga0157372_103468372 77
502 3300013307 Ga0157372_10703483 Ga0157372_107034832 77
503 3300013307 Ga0157372_11411986 Ga0157372_114119862 77
504 3300013307 Ga0157372_13086784 Ga0157372_130867842 77
505 3300013308 Ga0157375_10015233 Ga0157375_100152333 77
506 3300013308 Ga0157375_11332668 Ga0157375_113326682 77
507 3300013308 Ga0157375_11986119 Ga0157375_119861191 77
508 3300014325 Ga0163163_10058272 Ga0163163_100582725 77
509 3300014325 Ga0163163_10616569 Ga0163163_106165692 77
510 3300014325 Ga0163163_10654633 Ga0163163_106546332 77
511 3300014325 Ga0163163_10712683 Ga0163163_107126833 77
512 3300014326 Ga0157380_10356865 Ga0157380_103568652 77
513 3300014497 Ga0182008_10000253 Ga0182008_1000025344 77
514 3300014497 Ga0182008_10225902 Ga0182008_102259022 77
515 3300014745 Ga0157377_10124756 Ga0157377_101247561 77
516 3300014745 Ga0157377_10166097 Ga0157377_101660972 77
517 3300014745 Ga0157377_10618015 Ga0157377_106180151 77
518 3300014745 Ga0157377_11273819 Ga0157377_112738192 77
519 3300014968 Ga0157379_10007721 Ga0157379_1000772111 77
520 3300014968 Ga0157379_10041025 Ga0157379_100410254 77
521 3300014968 Ga0157379_11734809 Ga0157379_117348092 77
522 3300014969 Ga0157376_10190203 Ga0157376_101902032 77
523 3300014969 Ga0157376_11333464 Ga0157376_113334641 77
524 3300015262 Ga0182007_10000295 Ga0182007_100002952 77
525 3300015265 Ga0182005_1015457 Ga0182005_10154572 77
526 3300015688 Ga0183367_1013 Ga0183367_1013147 77
527 3300017792 Ga0163161_10037148 Ga0163161_100371483 77
528 3300017792 Ga0163161_10378022 Ga0163161_103780222 77
529 3300020069 Ga0197907_11056749 Ga0197907_110567492 77
530 3300020069 Ga0197907_11151097 Ga0197907_111510971 77
531 3300020069 Ga0197907_11496031 Ga0197907_114960311 77
532 3300020070 Ga0206356_10780096 Ga0206356_107800961 77
533 3300020077 Ga0206351_10456640 Ga0206351_104566401 77
534 3300020077 Ga0206351_10506274 Ga0206351_105062741 77
535 3300020078 Ga0206352_10837226 Ga0206352_108372262 77
536 3300020080 Ga0206350_10519492 Ga0206350_105194922 77
537 3300020081 Ga0206354_10849213 Ga0206354_108492134 77
538 3300020081 Ga0206354_11155629 Ga0206354_111556292 77
539 3300020081 Ga0206354_11532524 Ga0206354_115325241 77
540 3300020082 Ga0206353_10486774 Ga0206353_104867742 77
541 3300020082 Ga0206353_10633777 Ga0206353_106337772 77
542 3300020082 Ga0206353_11701529 Ga0206353_117015291 77
543 3300020610 Ga0154015_1302778 Ga0154015_13027781 77
544 3300020610 Ga0154015_1492505 Ga0154015_14925052 77
545 3300021384 Ga0213876_10006371 Ga0213876_100063714 77
546 3300021388 Ga0213875_10496586 Ga0213875_104965861 77
547 3300022467 Ga0224712_10283858 Ga0224712_102838582 77
548 3300022467 Ga0224712_10315480 Ga0224712_103154801 77
549 3300022467 Ga0224712_10492403 Ga0224712_104924031 77
550 3300022467 Ga0224712_10506072 Ga0224712_105060721 77
551 3300022467 Ga0224712_10644212 Ga0224712_106442122 77
552 3300025302 Ga0207426_1003865 Ga0207426_10038658 77
553 3300025321 Ga0207656_10012144 Ga0207656_100121444 77
554 3300025321 Ga0207656_10286373 Ga0207656_102863732 77
555 3300025711 Ga0207696_1129341 Ga0207696_11293412 77
556 3300025898 Ga0207692_10044802 Ga0207692_100448022 77
557 3300025899 Ga0207642_10028544 Ga0207642_100285443 77
558 3300025900 Ga0207710_10047867 Ga0207710_100478671 77
559 3300025901 Ga0207688_10012469 Ga0207688_100124692 77
560 3300025901 Ga0207688_10101487 Ga0207688_101014872 77
561 3300025904 Ga0207647_10037633 Ga0207647_100376334 77
562 3300025904 Ga0207647_10192034 Ga0207647_101920342 77
563 3300025904 Ga0207647_10425785 Ga0207647_104257851 77
564 3300025905 Ga0207685_10006249 Ga0207685_100062493 77
565 3300025906 Ga0207699_10029683 Ga0207699_100296831 77
566 3300025906 Ga0207699_10044698 Ga0207699_100446982 77
567 3300025907 Ga0207645_10026096 Ga0207645_100260966 77
568 3300025908 Ga0207643_10000255 Ga0207643_1000025523 77
569 3300025908 Ga0207643_10363098 Ga0207643_103630982 77
570 3300025908 Ga0207643_10890807 Ga0207643_108908072 77
571 3300025909 Ga0207705_10002517 Ga0207705_1000251717 77
572 3300025909 Ga0207705_10017293 Ga0207705_100172935 77
573 3300025909 Ga0207705_10189930 Ga0207705_101899302 77
574 3300025909 Ga0207705_10251660 Ga0207705_102516602 77
575 3300025909 Ga0207705_11118594 Ga0207705_111185942 77
576 3300025910 Ga0207684_10000844 Ga0207684_1000084416 77
577 3300025910 Ga0207684_10002346 Ga0207684_1000234614 77
578 3300025910 Ga0207684_10008439 Ga0207684_100084393 77
579 3300025910 Ga0207684_10053046 Ga0207684_100530464 77
580 3300025910 Ga0207684_10123941 Ga0207684_101239412 77
581 3300025911 Ga0207654_10185165 Ga0207654_101851652 77
582 3300025912 Ga0207707_10000737 Ga0207707_1000073728 77
583 3300025912 Ga0207707_10010925 Ga0207707_100109252 77
584 3300025912 Ga0207707_10315609 Ga0207707_103156092 77
585 3300025912 Ga0207707_10661816 Ga0207707_106618162 77
586 3300025912 Ga0207707_10953806 Ga0207707_109538062 77
587 3300025912 Ga0207707_11030224 Ga0207707_110302242 77
588 3300025913 Ga0207695_10034116 Ga0207695_100341163 77
589 3300025913 Ga0207695_10276393 Ga0207695_102763933 77
590 3300025913 Ga0207695_11256014 Ga0207695_112560142 77
591 3300025914 Ga0207671_10114753 Ga0207671_101147532 77
592 3300025914 Ga0207671_10142489 Ga0207671_101424892 77
593 3300025914 Ga0207671_10412602 Ga0207671_104126022 77
594 3300025915 Ga0207693_10019809 Ga0207693_100198095 77
595 3300025915 Ga0207693_10165584 Ga0207693_101655842 77
596 3300025916 Ga0207663_10021541 Ga0207663_100215416 77
597 3300025916 Ga0207663_10033418 Ga0207663_100334183 77
598 3300025916 Ga0207663_10224703 Ga0207663_102247032 77
599 3300025917 Ga0207660_10001218 Ga0207660_100012187 77
600 3300025917 Ga0207660_10041213 Ga0207660_100412134 77
601 3300025917 Ga0207660_10418974 Ga0207660_104189742 77
602 3300025917 Ga0207660_10818317 Ga0207660_108183172 77
603 3300025917 Ga0207660_11314426 Ga0207660_113144261 77
604 3300025918 Ga0207662_10067495 Ga0207662_100674952 77
605 3300025918 Ga0207662_10144665 Ga0207662_101446653 77
606 3300025918 Ga0207662_10272767 Ga0207662_102727672 77
607 3300025919 Ga0207657_10020354 Ga0207657_100203543 77
608 3300025919 Ga0207657_10046041 Ga0207657_100460415 77
609 3300025919 Ga0207657_10109524 Ga0207657_101095242 77
610 3300025919 Ga0207657_10309157 Ga0207657_103091572 77
611 3300025919 Ga0207657_10666670 Ga0207657_106666702 77
612 3300025919 Ga0207657_10997148 Ga0207657_109971481 77
613 3300025920 Ga0207649_10005364 Ga0207649_100053642 77
614 3300025921 Ga0207652_10000461 Ga0207652_1000046132 77
615 3300025921 Ga0207652_10028585 Ga0207652_100285855 77
616 3300025921 Ga0207652_10047136 Ga0207652_100471363 77
617 3300025921 Ga0207652_10235615 Ga0207652_102356152 77
618 3300025921 Ga0207652_10261428 Ga0207652_102614282 77
619 3300025921 Ga0207652_11109790 Ga0207652_111097902 77
620 3300025921 Ga0207652_11297042 Ga0207652_112970422 77
621 3300025922 Ga0207646_10000990 Ga0207646_1000099019 77
622 3300025922 Ga0207646_10009844 Ga0207646_100098445 77
623 3300025922 Ga0207646_10020576 Ga0207646_100205767 77
624 3300025922 Ga0207646_10110919 Ga0207646_101109193 77
625 3300025922 Ga0207646_10273879 Ga0207646_102738793 77
626 3300025923 Ga0207681_10140457 Ga0207681_101404572 77
627 3300025924 Ga0207694_10053554 Ga0207694_100535544 77
628 3300025924 Ga0207694_11790513 Ga0207694_117905131 77
629 3300025925 Ga0207650_10008935 Ga0207650_100089358 77
630 3300025925 Ga0207650_11036479 Ga0207650_110364792 77
631 3300025925 Ga0207650_11850837 Ga0207650_118508371 77
632 3300025926 Ga0207659_10076266 Ga0207659_100762662 77
633 3300025926 Ga0207659_10101779 Ga0207659_101017793 77
634 3300025926 Ga0207659_10272224 Ga0207659_102722243 77
635 3300025927 Ga0207687_10054509 Ga0207687_100545093 77
636 3300025927 Ga0207687_10082022 Ga0207687_100820224 77
637 3300025927 Ga0207687_10089960 Ga0207687_100899602 77
638 3300025927 Ga0207687_11178823 Ga0207687_111788232 77
639 3300025927 Ga0207687_11685403 Ga0207687_116854032 77
640 3300025927 Ga0207687_11881367 Ga0207687_118813671 77
641 3300025928 Ga0207700_10002007 Ga0207700_100020072 77
642 3300025928 Ga0207700_10012146 Ga0207700_100121462 77
643 3300025928 Ga0207700_10111827 Ga0207700_101118271 77
644 3300025928 Ga0207700_10280663 Ga0207700_102806632 77
645 3300025928 Ga0207700_10292892 Ga0207700_102928922 77
646 3300025928 Ga0207700_11980278 Ga0207700_119802782 77
647 3300025929 Ga0207664_10000722 Ga0207664_1000072218 77
648 3300025929 Ga0207664_10005405 Ga0207664_100054052 77
649 3300025929 Ga0207664_10087450 Ga0207664_100874502 77
650 3300025929 Ga0207664_10254777 Ga0207664_102547773 77
651 3300025929 Ga0207664_10316678 Ga0207664_103166782 77
652 3300025929 Ga0207664_11752017 Ga0207664_117520172 77
653 3300025931 Ga0207644_10010248 Ga0207644_100102482 77
654 3300025931 Ga0207644_10464129 Ga0207644_104641292 77
655 3300025932 Ga0207690_10000157 Ga0207690_100001574 77
656 3300025932 Ga0207690_10027235 Ga0207690_100272352 77
657 3300025932 Ga0207690_11312936 Ga0207690_113129362 77
658 3300025933 Ga0207706_10031749 Ga0207706_100317494 77
659 3300025933 Ga0207706_10179613 Ga0207706_101796132 77
660 3300025933 Ga0207706_10221032 Ga0207706_102210322 77
661 3300025934 Ga0207686_10097534 Ga0207686_100975343 77
662 3300025934 Ga0207686_10173656 Ga0207686_101736561 77
663 3300025934 Ga0207686_10201462 Ga0207686_102014623 77
664 3300025934 Ga0207686_10295432 Ga0207686_102954322 77
665 3300025934 Ga0207686_10693801 Ga0207686_106938012 77
666 3300025935 Ga0207709_10012443 Ga0207709_100124439 77
667 3300025935 Ga0207709_10024868 Ga0207709_100248685 77
668 3300025935 Ga0207709_11762192 Ga0207709_117621922 77
669 3300025936 Ga0207670_10075697 Ga0207670_100756974 77
670 3300025936 Ga0207670_11059885 Ga0207670_110598852 77
671 3300025937 Ga0207669_10115037 Ga0207669_101150372 77
672 3300025937 Ga0207669_11267313 Ga0207669_112673131 77
673 3300025937 Ga0207669_11442598 Ga0207669_114425981 77
674 3300025937 Ga0207669_11540877 Ga0207669_115408772 77
675 3300025938 Ga0207704_10027324 Ga0207704_100273243 77
676 3300025938 Ga0207704_10364624 Ga0207704_103646241 77
677 3300025938 Ga0207704_10656248 Ga0207704_106562482 77
678 3300025938 Ga0207704_11448080 Ga0207704_114480801 77
679 3300025939 Ga0207665_10036641 Ga0207665_100366413 77
680 3300025939 Ga0207665_10673246 Ga0207665_106732461 77
681 3300025939 Ga0207665_11249280 Ga0207665_112492801 77
682 3300025940 Ga0207691_10085403 Ga0207691_100854032 77
683 3300025940 Ga0207691_11418964 Ga0207691_114189642 77
684 3300025941 Ga0207711_10076181 Ga0207711_100761815 77
685 3300025941 Ga0207711_10127941 Ga0207711_101279413 77
686 3300025942 Ga0207689_10001805 Ga0207689_1000180510 77
687 3300025942 Ga0207689_10098506 Ga0207689_100985062 77
688 3300025942 Ga0207689_10152879 Ga0207689_101528793 77
689 3300025942 Ga0207689_10332318 Ga0207689_103323182 77
690 3300025942 Ga0207689_10916969 Ga0207689_109169692 77
691 3300025944 Ga0207661_10573680 Ga0207661_105736803 77
692 3300025944 Ga0207661_10749136 Ga0207661_107491363 77
693 3300025944 Ga0207661_11047948 Ga0207661_110479482 77
694 3300025944 Ga0207661_11464208 Ga0207661_114642081 77
695 3300025945 Ga0207679_10007228 Ga0207679_100072288 77
696 3300025945 Ga0207679_10334475 Ga0207679_103344752 77
697 3300025949 Ga0207667_10415696 Ga0207667_104156962 77
698 3300025949 Ga0207667_11105460 Ga0207667_111054602 77
699 3300025949 Ga0207667_12155100 Ga0207667_121551001 77
700 3300025960 Ga0207651_10461626 Ga0207651_104616261 77
701 3300025961 Ga0207712_10289015 Ga0207712_102890153 77
702 3300025961 Ga0207712_10536035 Ga0207712_105360351 77
703 3300025961 Ga0207712_11629043 Ga0207712_116290432 77
704 3300025972 Ga0207668_10544345 Ga0207668_105443452 77
705 3300025972 Ga0207668_10753516 Ga0207668_107535162 77
706 3300025981 Ga0207640_10139129 Ga0207640_101391292 77
707 3300025981 Ga0207640_10377000 Ga0207640_103770002 77
708 3300025981 Ga0207640_10670966 Ga0207640_106709662 77
709 3300025986 Ga0207658_11275082 Ga0207658_112750822 77
710 3300026023 Ga0207677_10112573 Ga0207677_101125731 77
711 3300026023 Ga0207677_10173635 Ga0207677_101736353 77
712 3300026023 Ga0207677_10374139 Ga0207677_103741392 77
713 3300026023 Ga0207677_12198084 Ga0207677_121980841 77
714 3300026035 Ga0207703_10216285 Ga0207703_102162853 77
715 3300026041 Ga0207639_10141052 Ga0207639_101410522 77
716 3300026041 Ga0207639_10202575 Ga0207639_102025752 77
717 3300026041 Ga0207639_11057010 Ga0207639_110570102 77
718 3300026067 Ga0207678_10000346 Ga0207678_1000034619 77
719 3300026067 Ga0207678_10026744 Ga0207678_100267445 77
720 3300026067 Ga0207678_10811878 Ga0207678_108118782 77
721 3300026067 Ga0207678_11545765 Ga0207678_115457652 77
722 3300026075 Ga0207708_10062705 Ga0207708_100627053 77
723 3300026075 Ga0207708_10884848 Ga0207708_108848481 77
724 3300026078 Ga0207702_10000631 Ga0207702_1000063117 77
725 3300026078 Ga0207702_10027378 Ga0207702_100273783 77
726 3300026078 Ga0207702_10062252 Ga0207702_100622523 77
727 3300026078 Ga0207702_11313692 Ga0207702_113136922 77
728 3300026078 Ga0207702_11773658 Ga0207702_117736582 77
729 3300026078 Ga0207702_12228336 Ga0207702_122283361 77
730 3300026078 Ga0207702_12315784 Ga0207702_123157841 77
731 3300026088 Ga0207641_10070634 Ga0207641_100706342 77
732 3300026088 Ga0207641_11456503 Ga0207641_114565031 77
733 3300026089 Ga0207648_10003949 Ga0207648_1000394920 77
734 3300026089 Ga0207648_10007069 Ga0207648_1000706912 77
735 3300026095 Ga0207676_10001535 Ga0207676_1000153513 77
736 3300026095 Ga0207676_10087045 Ga0207676_100870453 77
737 3300026116 Ga0207674_10050592 Ga0207674_100505926 77
738 3300026116 Ga0207674_11237809 Ga0207674_112378091 77
739 3300026116 Ga0207674_11698784 Ga0207674_116987842 77
740 3300026118 Ga0207675_100025855 Ga0207675_1000258554 77
741 3300026121 Ga0207683_10000342 Ga0207683_100003423 77
742 3300026121 Ga0207683_10045766 Ga0207683_100457662 77
743 3300026121 Ga0207683_10858280 Ga0207683_108582802 77
744 3300026142 Ga0207698_10031800 Ga0207698_100318001 77
745 3300027312 Ga0209371_1042187 Ga0209371_10421872 77
746 3300027312 Ga0209371_1054914 Ga0209371_10549142 77
747 3300027866 Ga0209813_10008344 Ga0209813_100083442 77
748 3300027907 Ga0207428_10001881 Ga0207428_1000188117 77
749 3300027907 Ga0207428_10035741 Ga0207428_100357413 77
750 3300028379 Ga0268266_10006950 Ga0268266_100069509 77
751 3300028379 Ga0268266_10062053 Ga0268266_100620532 77
752 3300028379 Ga0268266_10518359 Ga0268266_105183591 77
753 3300028379 Ga0268266_11227628 Ga0268266_112276282 77
754 3300028379 Ga0268266_11633878 Ga0268266_116338782 77
755 3300028380 Ga0268265_10694174 Ga0268265_106941741 77
756 3300028381 Ga0268264_10403094 Ga0268264_104030942 77
757 3300028381 Ga0268264_10625715 Ga0268264_106257152 77
758 3300028786 Ga0307517_10000616 Ga0307517_1000061643 77
759 3300028786 Ga0307517_10064449 Ga0307517_100644494 77
760 3300028794 Ga0307515_10000785 Ga0307515_1000078543 77
761 3300028794 Ga0307515_10079858 Ga0307515_100798584 77
762 3300030500 Ga0268256_1039230 Ga0268256_10392302 77
763 3300030500 Ga0268256_1083396 Ga0268256_10833962 77
764 3300030521 Ga0307511_10001704 Ga0307511_1000170415 77
765 3300030521 Ga0307511_10070638 Ga0307511_100706381 77
766 3300030521 Ga0307511_10103443 Ga0307511_101034432 77
767 3300030521 Ga0307511_10142563 Ga0307511_101425633 77
768 3300030521 Ga0307511_10145519 Ga0307511_101455192 77
769 3300030522 Ga0307512_10005071 Ga0307512_100050714 77
770 3300030522 Ga0307512_10362610 Ga0307512_103626102 77
771 3300030734 Ga0316179_1085721 Ga0316179_10857212 77
772 3300031090 Ga0265760_10132617 Ga0265760_101326172 77
773 3300031456 Ga0307513_10779502 Ga0307513_107795022 77
774 3300031507 Ga0307509_10116525 Ga0307509_101165252 77
775 3300031507 Ga0307509_10120432 Ga0307509_101204324 77
776 3300031507 Ga0307509_10250321 Ga0307509_102503212 77
777 3300031548 Ga0307408_100160846 Ga0307408_1001608461 77
778 3300031548 Ga0307408_100194616 Ga0307408_1001946161 77
779 3300031548 Ga0307408_100805547 Ga0307408_1008055472 77
780 3300031616 Ga0307508_10009811 Ga0307508_100098116 77
781 3300031616 Ga0307508_10042968 Ga0307508_100429685 77
782 3300031616 Ga0307508_10048153 Ga0307508_100481531 77
783 3300031616 Ga0307508_10071032 Ga0307508_100710324 77
784 3300031616 Ga0307508_10102457 Ga0307508_101024573 77
785 3300031616 Ga0307508_10192267 Ga0307508_101922671 77
786 3300031616 Ga0307508_10923375 Ga0307508_109233751 77
787 3300031649 Ga0307514_10017611 Ga0307514_100176113 77
788 3300031727 Ga0316576_10033659 Ga0316576_100336593 77
789 3300031728 Ga0316578_10403236 Ga0316578_104032362 77
790 3300031730 Ga0307516_10006885 Ga0307516_100068855 77
791 3300031730 Ga0307516_10033062 Ga0307516_100330625 77
792 3300031731 Ga0307405_10004991 Ga0307405_100049917 77
793 3300031731 Ga0307405_10012545 Ga0307405_100125452 77
794 3300031731 Ga0307405_10152741 Ga0307405_101527413 77
795 3300031731 Ga0307405_11136572 Ga0307405_111365721 77
796 3300031731 Ga0307405_11371576 Ga0307405_113715761 77
797 3300031824 Ga0307413_10010340 Ga0307413_100103403 77
798 3300031824 Ga0307413_10033503 Ga0307413_100335033 77
799 3300031824 Ga0307413_10052232 Ga0307413_100522323 77
800 3300031824 Ga0307413_10118605 Ga0307413_101186053 77
801 3300031824 Ga0307413_10241777 Ga0307413_102417772 77
802 3300031824 Ga0307413_10297416 Ga0307413_102974162 77
803 3300031824 Ga0307413_10376821 Ga0307413_103768212 77
804 3300031852 Ga0307410_10043621 Ga0307410_100436213 77
805 3300031852 Ga0307410_10044978 Ga0307410_100449783 77
806 3300031852 Ga0307410_10123949 Ga0307410_101239493 77
807 3300031852 Ga0307410_10176213 Ga0307410_101762132 77
808 3300031852 Ga0307410_10186697 Ga0307410_101866972 77
809 3300031852 Ga0307410_11023848 Ga0307410_110238482 77
810 3300031852 Ga0307410_11392283 Ga0307410_113922832 77
811 3300031901 Ga0307406_10009972 Ga0307406_100099725 77
812 3300031901 Ga0307406_10056284 Ga0307406_100562842 77
813 3300031901 Ga0307406_10060010 Ga0307406_100600102 77
814 3300031901 Ga0307406_10341765 Ga0307406_103417651 77
815 3300031903 Ga0307407_10031727 Ga0307407_100317273 77
816 3300031903 Ga0307407_10032507 Ga0307407_100325072 77
817 3300031903 Ga0307407_10064675 Ga0307407_100646751 77
818 3300031903 Ga0307407_10273585 Ga0307407_102735852 77
819 3300031903 Ga0307407_10277977 Ga0307407_102779771 77
820 3300031903 Ga0307407_10892285 Ga0307407_108922852 77
821 3300031911 Ga0307412_10032183 Ga0307412_100321833 77
822 3300031911 Ga0307412_10390952 Ga0307412_103909522 77
823 3300031911 Ga0307412_10523528 Ga0307412_105235282 77
824 3300031911 Ga0307412_10731183 Ga0307412_107311832 77
825 3300031911 Ga0307412_11503781 Ga0307412_115037811 77
826 3300031995 Ga0307409_100031324 Ga0307409_1000313241 77
827 3300031995 Ga0307409_100051919 Ga0307409_1000519192 77
828 3300031995 Ga0307409_100057907 Ga0307409_1000579073 77
829 3300031995 Ga0307409_100179771 Ga0307409_1001797712 77
830 3300031995 Ga0307409_100599435 Ga0307409_1005994352 77
831 3300031995 Ga0307409_100930347 Ga0307409_1009303472 77
832 3300032002 Ga0307416_100002858 Ga0307416_1000028583 77
833 3300032002 Ga0307416_100062131 Ga0307416_1000621313 77
834 3300032002 Ga0307416_100259855 Ga0307416_1002598552 77
835 3300032002 Ga0307416_100456040 Ga0307416_1004560402 77
836 3300032002 Ga0307416_100987867 Ga0307416_1009878672 77
837 3300032004 Ga0307414_10061425 Ga0307414_100614253 77
838 3300032004 Ga0307414_10660101 Ga0307414_106601012 77
839 3300032004 Ga0307414_10760414 Ga0307414_107604142 77
840 3300032005 Ga0307411_10138399 Ga0307411_101383992 77
841 3300032005 Ga0307411_10149189 Ga0307411_101491892 77
842 3300032005 Ga0307411_10253669 Ga0307411_102536692 77
843 3300032126 Ga0307415_100001231 Ga0307415_1000012315 77
844 3300032126 Ga0307415_100046044 Ga0307415_1000460442 77
845 3300032126 Ga0307415_100061596 Ga0307415_1000615961 77
846 3300032126 Ga0307415_100087992 Ga0307415_1000879921 77
847 3300032126 Ga0307415_100159352 Ga0307415_1001593523 77
848 3300032126 Ga0307415_100173443 Ga0307415_1001734432 77
849 3300032126 Ga0307415_101590273 Ga0307415_1015902732 77
850 3300032126 Ga0307415_102008890 Ga0307415_1020088901 77
851 3300032126 Ga0307415_102388879 Ga0307415_1023888792 77
852 3300033179 Ga0307507_10000004 Ga0307507_10000004138 77
853 3300033179 Ga0307507_10019522 Ga0307507_100195228 77
854 3300033179 Ga0307507_10048643 Ga0307507_100486435 77
855 3300033179 Ga0307507_10265614 Ga0307507_102656141 77
856 3300033180 Ga0307510_10178454 Ga0307510_101784541 77
857 3300033180 Ga0307510_10616655 Ga0307510_106166551 77
858 3300033541 Ga0316596_1238806 Ga0316596_12388061 77
859 3300035083 Ga0373926_0103561 Ga0373926_0103561_54_287 77
860 3300035084 Ga0373928_0242519 Ga0373928_0242519_256_489 77
861 3300035086 Ga0373934_0081727 Ga0373934_0081727_1018_1251 77
862 3300035089 Ga0373944_0186231 Ga0373944_0186231_426_659 77
863 3300035111 Ga0373923_0232371 Ga0373923_0232371_403_636 77
864 3300035113 Ga0373936_0002652 Ga0373936_0002652_4172_4405 77
865 3300035116 Ga0373945_0032972 Ga0373945_0032972_910_1143 77
866 3300035117 Ga0373953_0039958 Ga0373953_0039958_1098_1331 77
867 3300035118 Ga0373954_0109839 Ga0373954_0109839_531_764 77
868 3300035119 Ga0373956_0009853 Ga0373956_0009853_403_636 77
869 3300035120 Ga0373957_0004739 Ga0373957_0004739_3527_3760 77
870 3300035170 Ga0373943_0086429 Ga0373943_0086429_1344_1577 77
871 3300035170 Ga0373943_0105489 Ga0373943_0105489_1004_1237 77
872 3300035170 Ga0373943_0275242 Ga0373943_0275242_684_917 77
873 3300035170 Ga0373943_0926660 Ga0373943_0926660_85_321 77
874 3300035171 Ga0373946_0055434 Ga0373946_0055434_1116_1349 77
875 3300035171 Ga0373946_0562780 Ga0373946_0562780_90_323 77
876 3300035172 Ga0373955_0618701 Ga0373955_0618701_403_636 77
877 3300035398 Ga0316574_0006775 Ga0316574_0006775_3571_3804 77
878 3300035398 Ga0316574_0024958 Ga0316574_0024958_2963_3196 77
879 3300035410 Ga0373924_0046395 Ga0373924_0046395_1509_1742 77
880 3300035691 Ga0373931_0211674 Ga0373931_0211674_107_340 77
881 3300035692 Ga0373935_0032879 Ga0373935_0032879_2820_3053 77
882 3300035692 Ga0373935_0629943 Ga0373935_0629943_491_724 77
883 3300035692 Ga0373935_1002202 Ga0373935_1002202_100_333 77
884 3300035692 Ga0373935_1486592 Ga0373935_1486592_28_264 77
885 3300035695 Ga0373927_0140364 Ga0373927_0140364_865_1104 77
886 3300035724 Ga0373933_0048564 Ga0373933_0048564_816_1049 77
887 3300035725 Ga0373947_0045323 Ga0373947_0045323_356_589 77
888 3300035725 Ga0373947_0740988 Ga0373947_0740988_93_326 77
889 3300035725 Ga0373947_0771829 Ga0373947_0771829_396_629 77
890 3300035725 Ga0373947_0970465 Ga0373947_0970465_206_511 77
891 3300036401 Ga0373937_0219523 Ga0373937_0219523_48_281 77
892 3300037068 Ga0373925_0073378 Ga0373925_0073378_2131_2364 77
893 3300037068 Ga0373925_0192091 Ga0373925_0192091_665_898 77
894 3300037068 Ga0373925_0647254 Ga0373925_0647254_277_510 77
895 3300037312 Ga0395899_0043872 Ga0395899_0043872_2047_2283 77
896 3300037312 Ga0395899_0063189 Ga0395899_0063189_2233_2466 77
897 3300037312 Ga0395899_0559152 Ga0395899_0559152_393_626 77
898 3300037418 Ga0395900_0049812 Ga0395900_0049812_1462_1695 77
899 3300037418 Ga0395900_0254888 Ga0395900_0254888_429_668 77
900 3300037418 Ga0395900_0400701 Ga0395900_0400701_599_832 77
901 3300037418 Ga0395900_0738160 Ga0395900_0738160_59_298 77
902 3300037418 Ga0395900_1515235 Ga0395900_1515235_222_458 77
903 3300037466 Ga0395898_0004957 Ga0395898_0004957_867_1100 77
904 3300037466 Ga0395898_0020289 Ga0395898_0020289_4451_4684 77
905 3300037466 Ga0395898_0204323 Ga0395898_0204323_1384_1623 77
906 3300037466 Ga0395898_0423014 Ga0395898_0423014_938_1171 77
907 3300037471 Ga0395905_0140072 Ga0395905_0140072_294_527 77
908 3300037471 Ga0395905_0912000 Ga0395905_0912000_135_374 77
909 3300037853 Ga0436364_0211036 Ga0436364_0211036_320_568 77
910 3300037853 Ga0436364_1387664 Ga0436364_1387664_2365_2598 77
911 3300037853 Ga0436364_1513228 Ga0436364_1513228_846_1100 77
912 3300038443 Ga0395901_0025589 Ga0395901_0025589_5643_5876 77
913 3300038443 Ga0395901_0028245 Ga0395901_0028245_5364_5603 77
914 3300038443 Ga0395901_0142136 Ga0395901_0142136_1775_2014 77
915 3300038443 Ga0395901_0220165 Ga0395901_0220165_1607_1840 77
916 3300038443 Ga0395901_1218419 Ga0395901_1218419_28_261 77
917 3300039437 Ga0436365_1800393 Ga0436365_1800393_2185_2433 77
918 3300039450 Ga0436363_1600108 Ga0436363_1600108_398_631 77
919 3300041410 Ga0439461_0108410 Ga0439461_0108410_35_268 77
920 3300041451 Ga0451791_0732074 Ga0451791_0732074_56_289 77
921 3300041452 Ga0451793_0443263 Ga0451793_0443263_31_264 77
922 3300041453 Ga0451797_0046928 Ga0451797_0046928_70_303 77
923 3300041453 Ga0451797_0063387 Ga0451797_0063387_58_291 77
924 3300041456 Ga0451795_0944170 Ga0451795_0944170_476_709 77
925 3300041463 Ga0451804_0709125 Ga0451804_0709125_142_375 77
926 3300041486 Ga0451807_2146582 Ga0451807_2146582_758_991 77
927 3300041491 Ga0451833_0363118 Ga0451833_0363118_271_504 77
928 3300041498 Ga0451841_1156208 Ga0451841_1156208_411_644 77
929 3300041507 Ga0451851_0539892 Ga0451851_0539892_451_684 77
930 3300041512 Ga0451853_0201250 Ga0451853_0201250_751_984 77
931 3300041512 Ga0451853_2009892 Ga0451853_2009892_326_559 77
932 3300041999 Ga0439433_0090839 Ga0439433_0090839_306_539 77
933 3300042002 Ga0439442_034627 Ga0439442_034627_79_312 77
934 3300042003 Ga0439443_068009 Ga0439443_068009_368_607 77
935 3300042005 Ga0439448_0000543 Ga0439448_0000543_8272_8511 77
936 3300042005 Ga0439448_0001808 Ga0439448_0001808_26_259 77
937 3300042005 Ga0439448_0001912 Ga0439448_0001912_4868_5101 77
938 3300042005 Ga0439448_0053491 Ga0439448_0053491_34_267 77
939 3300042006 Ga0439432_096512 Ga0439432_096512_366_599 77
940 3300042007 Ga0439449_0002001 Ga0439449_0002001_48_281 77
941 3300042007 Ga0439449_0092550 Ga0439449_0092550_48_281 77
942 3300042008 Ga0439450_001186 Ga0439450_001186_623_862 77
943 3300042008 Ga0439450_003903 Ga0439450_003903_714_953 77
944 3300042009 Ga0439451_007224 Ga0439451_007224_1762_2001 77
945 3300042009 Ga0439451_010546 Ga0439451_010546_69_308 77
946 3300042011 Ga0439454_010919 Ga0439454_010919_92_331 77
947 3300042011 Ga0439454_071041 Ga0439454_071041_40_279 77
948 3300042012 Ga0439455_0000702 Ga0439455_0000702_4051_4284 77
949 3300042012 Ga0439455_0035109 Ga0439455_0035109_899_1138 77
950 3300042013 Ga0439456_043433 Ga0439456_043433_330_569 77
951 3300042014 Ga0439457_016546 Ga0439457_016546_71_304 77
952 3300042016 Ga0439463_000211 Ga0439463_000211_5943_6182 77
953 3300042016 Ga0439463_007150 Ga0439463_007150_2144_2383 77
954 3300042016 Ga0439463_094634 Ga0439463_094634_394_627 77
955 3300042116 Ga0450912_002482 Ga0450912_002482_115_348 77
956 3300042118 Ga0450914_003043 Ga0450914_003043_95_328 77
957 3300042119 Ga0450915_002074 Ga0450915_002074_763_996 77
958 3300042124 Ga0450922_018805 Ga0450922_018805_293_532 77
959 3300042125 Ga0450923_092472 Ga0450923_092472_390_629 77
960 3300042131 Ga0450894_000582 Ga0450894_000582_1391_1624 77
961 3300042132 Ga0450895_010376 Ga0450895_010376_451_684 77
962 3300042133 Ga0450896_006854 Ga0450896_006854_425_658 77
963 3300042134 Ga0450898_002954 Ga0450898_002954_1332_1565 77
964 3300042136 Ga0450900_000637 Ga0450900_000637_2017_2256 77
965 3300042136 Ga0450900_004755 Ga0450900_004755_538_771 77
966 3300042136 Ga0450900_023785 Ga0450900_023785_606_839 77
967 3300042137 Ga0450902_007496 Ga0450902_007496_1119_1352 77
968 3300042138 Ga0450903_000222 Ga0450903_000222_4740_4973 77
969 3300042138 Ga0450903_004285 Ga0450903_004285_2112_2345 77
970 3300042145 Ga0450906_001179 Ga0450906_001179_1909_2142 77
971 3300042147 Ga0450910_084117 Ga0450910_084117_181_420 77
972 3300042156 Ga0439446_0086653 Ga0439446_0086653_524_760 77
973 3300042157 Ga0439458_0002925 Ga0439458_0002925_1394_1627 77
974 3300042157 Ga0439458_0020266 Ga0439458_0020266_853_1092 77
975 3300042184 Ga0450908_001963 Ga0450908_001963_1961_2194 77
976 3300042436 Ga0439435_0002840 Ga0439435_0002840_1301_1540 77
977 3300042436 Ga0439435_0118145 Ga0439435_0118145_502_741 77
978 3300042437 Ga0439444_0003239 Ga0439444_0003239_691_930 77
979 3300042437 Ga0439444_0014537 Ga0439444_0014537_881_1120 77
980 3300042437 Ga0439444_0169981 Ga0439444_0169981_248_481 77
981 3300042438 Ga0439459_0004527 Ga0439459_0004527_635_868 77
982 3300042438 Ga0439459_0077429 Ga0439459_0077429_89_328 77
983 3300042439 Ga0439464_0000089 Ga0439464_0000089_3345_3584 77
984 3300042439 Ga0439464_0237172 Ga0439464_0237172_336_575 77
985 3300042530 Ga0450916_019008 Ga0450916_019008_622_861 77
986 3300042532 Ga0450893_0019003 Ga0450893_0019003_628_867 77
987 3300042533 Ga0450901_032004 Ga0450901_032004_47_280 77
988 3300042993 Ga0439440_0000033 Ga0439440_0000033_10043_10282 77
989 3300042993 Ga0439440_0024212 Ga0439440_0024212_1060_1299 77
990 3300044656 Ga0466969_0000873 Ga0466969_0000873_14606_14857 77
991 3300044656 Ga0466969_0008468 Ga0466969_0008468_598_831 77
992 3300044656 Ga0466969_0139742 Ga0466969_0139742_342_578 77
993 3300044656 Ga0466969_0264710 Ga0466969_0264710_238_474 77
994 3300044656 Ga0466969_0610860 Ga0466969_0610860_229_465 77
995 3300044658 Ga0466972_0003355 Ga0466972_0003355_7641_7874 77
996 3300044658 Ga0466972_0105820 Ga0466972_0105820_62_295 77
997 3300044683 Ga0466965_0000614 Ga0466965_0000614_12605_12838 77
998 3300044683 Ga0466965_0128809 Ga0466965_0128809_1046_1279 77
999 3300044683 Ga0466965_0285966 Ga0466965_0285966_55_288 77
1000 3300044684 Ga0466966_0007105 Ga0466966_0007105_4801_5034 77
1001 3300044684 Ga0466966_0058977 Ga0466966_0058977_713_949 77
1002 3300044684 Ga0466966_0060711 Ga0466966_0060711_1435_1686 77
1003 3300044684 Ga0466966_0313783 Ga0466966_0313783_366_602 77
1004 3300044684 Ga0466966_0410879 Ga0466966_0410879_242_478 77
1005 3300044684 Ga0466966_0776219 Ga0466966_0776219_317_553 77
1006 3300044684 Ga0466966_0900509 Ga0466966_0900509_213_449 77
1007 3300044693 Ga0466961_0001921 Ga0466961_0001921_953_1186 77
1008 3300044693 Ga0466961_0009405 Ga0466961_0009405_112_348 77
1009 3300044693 Ga0466961_0023817 Ga0466961_0023817_3459_3710 77
1010 3300044693 Ga0466961_0026189 Ga0466961_0026189_3337_3573 77
1011 3300044693 Ga0466961_0072197 Ga0466961_0072197_1503_1739 77
1012 3300044693 Ga0466961_0155752 Ga0466961_0155752_527_763 77
1013 3300044693 Ga0466961_0208213 Ga0466961_0208213_58_294 77
1014 3300044693 Ga0466961_0575026 Ga0466961_0575026_312_548 77
1015 3300044694 Ga0466963_0004618 Ga0466963_0004618_4530_4763 77
1016 3300044694 Ga0466963_0021337 Ga0466963_0021337_18_254 77
1017 3300044694 Ga0466963_0056243 Ga0466963_0056243_1384_1620 77
1018 3300044694 Ga0466963_0282237 Ga0466963_0282237_492_728 77
1019 3300044694 Ga0466963_0284409 Ga0466963_0284409_353_589 77
1020 3300044694 Ga0466963_0288668 Ga0466963_0288668_770_1006 77
1021 3300044694 Ga0466963_0302482 Ga0466963_0302482_112_363 77
1022 3300044694 Ga0466963_0535370 Ga0466963_0535370_274_510 77
1023 3300044694 Ga0466963_0549153 Ga0466963_0549153_274_510 77
1024 3300044694 Ga0466963_0831908 Ga0466963_0831908_131_382 77
1025 3300044706 Ga0466964_0032966 Ga0466964_0032966_39_272 77
1026 3300044706 Ga0466964_0061865 Ga0466964_0061865_991_1227 77
1027 3300044706 Ga0466964_0230905 Ga0466964_0230905_156_392 77
1028 3300044706 Ga0466964_0354057 Ga0466964_0354057_33_269 77
1029 3300044706 Ga0466964_0391946 Ga0466964_0391946_137_370 77
1030 3300044706 Ga0466964_0408856 Ga0466964_0408856_49_285 77
1031 3300044719 Ga0466971_0000629 Ga0466971_0000629_12611_12862 77
1032 3300044719 Ga0466971_0016721 Ga0466971_0016721_507_743 77
1033 3300044719 Ga0466971_0098445 Ga0466971_0098445_271_507 77
1034 3300044719 Ga0466971_0116813 Ga0466971_0116813_528_761 77
1035 3300044719 Ga0466971_0145427 Ga0466971_0145427_610_846 77
1036 3300044719 Ga0466971_0179353 Ga0466971_0179353_617_853 77
1037 3300044719 Ga0466971_0415339 Ga0466971_0415339_249_485 77
1038 3300044719 Ga0466971_0645134 Ga0466971_0645134_184_420 77
1039 3300044735 Ga0466968_0136969 Ga0466968_0136969_724_957 77
1040 3300044765 Ga0466970_0001377 Ga0466970_0001377_2305_2538 77
1041 3300044765 Ga0466970_0030083 Ga0466970_0030083_914_1150 77
1042 3300044765 Ga0466970_0209856 Ga0466970_0209856_391_627 77
1043 3300044765 Ga0466970_0222763 Ga0466970_0222763_615_848 77
1044 3300044765 Ga0466970_0280012 Ga0466970_0280012_679_915 77
1045 3300044765 Ga0466970_0367753 Ga0466970_0367753_62_295 77
1046 3300044842 Ga0466957_0006278 Ga0466957_0006278_4573_4809 77
1047 3300044842 Ga0466957_0010382 Ga0466957_0010382_699_932 77
1048 3300044842 Ga0466957_0366712 Ga0466957_0366712_43_279 77
1049 3300044842 Ga0466957_0462526 Ga0466957_0462526_189_425 77
1050 3300044842 Ga0466957_0616643 Ga0466957_0616643_493_729 77
1051 3300044842 Ga0466957_0792033 Ga0466957_0792033_254_505 77
1052 3300044842 Ga0466957_1331580 Ga0466957_1331580_50_286 77
1053 3300044842 Ga0466957_1384974 Ga0466957_1384974_53_286 77
1054 3300044901 Ga0466960_0109978 Ga0466960_0109978_101_334 77
1055 3300044901 Ga0466960_0517916 Ga0466960_0517916_406_639 77
1056 3300044901 Ga0466960_0607372 Ga0466960_0607372_205_438 77
1057 3300045049 Ga0466959_0000365 Ga0466959_0000365_2515_2748 77
1058 3300045049 Ga0466959_0000617 Ga0466959_0000617_1243_1494 77
1059 3300045049 Ga0466959_0036475 Ga0466959_0036475_377_613 77
1060 3300045049 Ga0466959_0796026 Ga0466959_0796026_50_286 77
1061 3300045836 Ga0466958_0000185 Ga0466958_0000185_10678_10911 77
1062 3300045836 Ga0466958_0013097 Ga0466958_0013097_3686_3922 77
1063 3300045836 Ga0466958_0015443 Ga0466958_0015443_1031_1267 77
1064 3300045836 Ga0466958_0034058 Ga0466958_0034058_2188_2424 77
1065 3300045836 Ga0466958_0050301 Ga0466958_0050301_84_335 77
1066 3300045836 Ga0466958_0177273 Ga0466958_0177273_920_1156 77
1067 3300045836 Ga0466958_0434593 Ga0466958_0434593_79_315 77
1068 3300045836 Ga0466958_0434798 Ga0466958_0434798_140_376 77
1069 3300045836 Ga0466958_0612196 Ga0466958_0612196_51_287 77
1070 3300045836 Ga0466958_0882127 Ga0466958_0882127_259_492 77
1071 3300045836 Ga0466958_0887339 Ga0466958_0887339_296_532 77
1072 3300045976 Ga0466967_0012726 Ga0466967_0012726_2118_2360 77
1073 3300045976 Ga0466967_0024439 Ga0466967_0024439_953_1189 77
1074 3300045976 Ga0466967_0042374 Ga0466967_0042374_146_379 77
1075 3300045976 Ga0466967_0162097 Ga0466967_0162097_1627_1863 77
1076 3300045976 Ga0466967_0186708 Ga0466967_0186708_1063_1299 77
1077 3300045976 Ga0466967_0191205 Ga0466967_0191205_690_923 77
1078 3300045976 Ga0466967_0200361 Ga0466967_0200361_626_862 77
1079 3300045976 Ga0466967_0252272 Ga0466967_0252272_360_596 77
1080 3300045976 Ga0466967_0494070 Ga0466967_0494070_700_936 77
1081 3300045976 Ga0466967_0657819 Ga0466967_0657819_200_436 77
1082 3300045976 Ga0466967_1004103 Ga0466967_1004103_234_467 77
1083 3300045976 Ga0466967_1137537 Ga0466967_1137537_160_396 77
1084 3300045976 Ga0466967_1879981 Ga0466967_1879981_35_271 77
1085 3300046452 Ga0495617_113804 Ga0495617_113804_383_637 77
1086 3300046454 Ga0495592_0003261 Ga0495592_0003261_7045_7278 77
1087 3300046454 Ga0495592_0020580 Ga0495592_0020580_54_287 77
1088 3300046454 Ga0495592_0022586 Ga0495592_0022586_1296_1529 77
1089 3300046455 Ga0495603_0004326 Ga0495603_0004326_3986_4219 77
1090 3300046455 Ga0495603_0006636 Ga0495603_0006636_4431_4664 77
1091 3300046455 Ga0495603_0035572 Ga0495603_0035572_2167_2400 77
1092 3300046455 Ga0495603_0306303 Ga0495603_0306303_422_655 77
1093 3300046455 Ga0495603_0593524 Ga0495603_0593524_325_558 77
1094 3300046459 Ga0495629_0000710 Ga0495629_0000710_5349_5582 77
1095 3300046459 Ga0495629_0008081 Ga0495629_0008081_4419_4652 77
1096 3300046459 Ga0495629_0009932 Ga0495629_0009932_4453_4686 77
1097 3300046459 Ga0495629_0034307 Ga0495629_0034307_2168_2401 77
1098 3300046459 Ga0495629_0045243 Ga0495629_0045243_1973_2206 77
1099 3300046460 Ga0495638_0019718 Ga0495638_0019718_813_1046 77
1100 3300046461 Ga0495641_0033691 Ga0495641_0033691_1914_2147 77
1101 3300046461 Ga0495641_0253296 Ga0495641_0253296_489_722 77
1102 3300046461 Ga0495641_0487062 Ga0495641_0487062_115_348 77
1103 3300046462 Ga0495651_0001993 Ga0495651_0001993_13512_13763 77
1104 3300046462 Ga0495651_0002231 Ga0495651_0002231_14537_14770 77
1105 3300046462 Ga0495651_0005685 Ga0495651_0005685_1033_1266 77
1106 3300046462 Ga0495651_0031302 Ga0495651_0031302_1552_1785 77
1107 3300046463 Ga0495653_0020146 Ga0495653_0020146_4771_5004 77
1108 3300046472 Ga0495580_0368845 Ga0495580_0368845_687_920 77
1109 3300046473 Ga0495582_0105708 Ga0495582_0105708_50_283 77
1110 3300046475 Ga0495639_0008151 Ga0495639_0008151_3589_3822 77
1111 3300046475 Ga0495639_0027525 Ga0495639_0027525_61_294 77
1112 3300046475 Ga0495639_0054394 Ga0495639_0054394_229_462 77
1113 3300046476 Ga0495662_0031072 Ga0495662_0031072_1673_1906 77
1114 3300046476 Ga0495662_0080214 Ga0495662_0080214_1249_1482 77
1115 3300046476 Ga0495662_0083229 Ga0495662_0083229_57_290 77
1116 3300046476 Ga0495662_0084294 Ga0495662_0084294_354_587 77
1117 3300046477 Ga0495664_0000321 Ga0495664_0000321_4756_4989 77
1118 3300046477 Ga0495664_0088739 Ga0495664_0088739_1296_1529 77
1119 3300046477 Ga0495664_0095726 Ga0495664_0095726_260_511 77
1120 3300046477 Ga0495664_0098595 Ga0495664_0098595_1156_1392 77
1121 3300046477 Ga0495664_0314144 Ga0495664_0314144_267_500 77
1122 3300046477 Ga0495664_0395118 Ga0495664_0395118_68_301 77
1123 3300046491 Ga0495584_0136123 Ga0495584_0136123_461_715 77
1124 3300046492 Ga0495585_0017733 Ga0495585_0017733_658_891 77
1125 3300046492 Ga0495585_0033369 Ga0495585_0033369_905_1138 77
1126 3300046492 Ga0495585_0111064 Ga0495585_0111064_790_1044 77
1127 3300046499 Ga0495594_0039331 Ga0495594_0039331_929_1162 77
1128 3300046499 Ga0495594_0145721 Ga0495594_0145721_68_301 77
1129 3300046499 Ga0495594_0150653 Ga0495594_0150653_552_785 77
1130 3300046499 Ga0495594_0802764 Ga0495594_0802764_194_427 77
1131 3300046500 Ga0495596_0082647 Ga0495596_0082647_659_892 77
1132 3300046501 Ga0495607_0206477 Ga0495607_0206477_382_615 77
1133 3300046506 Ga0495583_0099426 Ga0495583_0099426_79_312 77
1134 3300046511 Ga0495608_0006672 Ga0495608_0006672_3588_3821 77
1135 3300046513 Ga0495616_0077806 Ga0495616_0077806_387_620 77
1136 3300046514 Ga0495618_0010799 Ga0495618_0010799_3384_3617 77
1137 3300046514 Ga0495618_0080528 Ga0495618_0080528_1568_1819 77
1138 3300046514 Ga0495618_0103068 Ga0495618_0103068_1296_1529 77
1139 3300046514 Ga0495618_0220040 Ga0495618_0220040_120_353 77
1140 3300046516 Ga0495628_0039915 Ga0495628_0039915_2056_2289 77
1141 3300046516 Ga0495628_0165401 Ga0495628_0165401_1094_1327 77
1142 3300046516 Ga0495628_0238241 Ga0495628_0238241_22_255 77
1143 3300046517 Ga0495630_0016999 Ga0495630_0016999_1809_2042 77
1144 3300046517 Ga0495630_0084225 Ga0495630_0084225_403_636 77
1145 3300046517 Ga0495630_0216871 Ga0495630_0216871_16_249 77
1146 3300046517 Ga0495630_0636853 Ga0495630_0636853_431_664 77
1147 3300046517 Ga0495630_0676156 Ga0495630_0676156_24_257 77
1148 3300046517 Ga0495630_0713047 Ga0495630_0713047_302_535 77
1149 3300046519 Ga0495632_0020483 Ga0495632_0020483_1141_1374 77
1150 3300046522 Ga0495643_0001559 Ga0495643_0001559_1630_1863 77
1151 3300046523 Ga0495644_0063076 Ga0495644_0063076_382_615 77
1152 3300046523 Ga0495644_0083621 Ga0495644_0083621_500_754 77
1153 3300046525 Ga0495663_0056690 Ga0495663_0056690_523_777 77
1154 3300046526 Ga0495666_0084330 Ga0495666_0084330_693_926 77
1155 3300046528 Ga0495642_0223776 Ga0495642_0223776_495_749 77
1156 3300046528 Ga0495642_0511575 Ga0495642_0511575_224_457 77
1157 3300046529 Ga0495652_0017484 Ga0495652_0017484_4019_4270 77
1158 3300046529 Ga0495652_0025898 Ga0495652_0025898_1856_2089 77
1159 3300046529 Ga0495652_0034744 Ga0495652_0034744_403_636 77
1160 3300046529 Ga0495652_0352308 Ga0495652_0352308_45_278 77
1161 3300046529 Ga0495652_0377922 Ga0495652_0377922_30_263 77
1162 3300046529 Ga0495652_1033179 Ga0495652_1033179_288_524 77
1163 3300046531 Ga0495665_0008441 Ga0495665_0008441_5246_5479 77
1164 3300046531 Ga0495665_0010940 Ga0495665_0010940_1018_1251 77
1165 3300046531 Ga0495665_0017919 Ga0495665_0017919_1076_1309 77
1166 3300046531 Ga0495665_0211559 Ga0495665_0211559_102_335 77
1167 3300046531 Ga0495665_0339482 Ga0495665_0339482_11_244 77
1168 3300046533 Ga0495640_0096099 Ga0495640_0096099_558_791 77
1169 3300046533 Ga0495640_0109840 Ga0495640_0109840_504_737 77
1170 3300046533 Ga0495640_0121285 Ga0495640_0121285_1296_1529 77
1171 3300046533 Ga0495640_0815792 Ga0495640_0815792_14_247 77
1172 3300046535 Ga0495586_0003363 Ga0495586_0003363_3654_3887 77
1173 3300046535 Ga0495586_0126535 Ga0495586_0126535_424_657 77
1174 3300046535 Ga0495586_0379976 Ga0495586_0379976_135_368 77
1175 3300046535 Ga0495586_0430274 Ga0495586_0430274_280_531 77
1176 3300046535 Ga0495586_0677679 Ga0495586_0677679_311_544 77
1177 3300046536 Ga0495587_0002686 Ga0495587_0002686_10681_10914 77
1178 3300046536 Ga0495587_0007528 Ga0495587_0007528_3655_3888 77
1179 3300046536 Ga0495587_0066958 Ga0495587_0066958_1290_1541 77
1180 3300046537 Ga0495598_0044534 Ga0495598_0044534_332_586 77
1181 3300046543 Ga0495645_0020552 Ga0495645_0020552_235_468 77
1182 3300046543 Ga0495645_0153683 Ga0495645_0153683_526_777 77
1183 3300046557 Ga0495622_0085722 Ga0495622_0085722_934_1167 77
1184 3300046557 Ga0495622_0108014 Ga0495622_0108014_11_244 77
1185 3300046557 Ga0495622_0141533 Ga0495622_0141533_413_646 77
1186 3300046558 Ga0495633_0212677 Ga0495633_0212677_375_608 77
1187 3300046558 Ga0495633_0562945 Ga0495633_0562945_39_272 77
1188 3300046559 Ga0495667_0023497 Ga0495667_0023497_3105_3338 77
1189 3300046615 Ga0495656_0006417 Ga0495656_0006417_1711_1965 77
1190 3300046615 Ga0495656_0015188 Ga0495656_0015188_2423_2656 77
1191 3300046615 Ga0495656_0523719 Ga0495656_0523719_106_339 77
1192 3300046616 Ga0495668_0274835 Ga0495668_0274835_86_319 77
1193 3300046642 Ga0495634_0001805 Ga0495634_0001805_10939_11172 77
1194 3300046642 Ga0495634_0024244 Ga0495634_0024244_2453_2686 77
1195 3300046642 Ga0495634_0536005 Ga0495634_0536005_403_636 77
1196 3300046648 Ga0495611_0051654 Ga0495611_0051654_17_250 77
1197 3300046648 Ga0495611_0162654 Ga0495611_0162654_493_747 77
1198 3300046648 Ga0495611_0231408 Ga0495611_0231408_552_785 77
1199 3300046660 Ga0495625_0002573 Ga0495625_0002573_19003_19236 77
1200 3300046663 Ga0495635_0002591 Ga0495635_0002591_11487_11720 77
1201 3300046663 Ga0495635_0006046 Ga0495635_0006046_1127_1378 77
1202 3300046663 Ga0495635_0052660 Ga0495635_0052660_2209_2442 77
1203 3300046663 Ga0495635_0398335 Ga0495635_0398335_601_837 77
1204 3300046663 Ga0495635_0853723 Ga0495635_0853723_108_341 77
1205 3300046664 Ga0495659_0142221 Ga0495659_0142221_193_447 77
1206 3300046665 Ga0495661_0164531 Ga0495661_0164531_852_1085 77
1207 3300046665 Ga0495661_0622543 Ga0495661_0622543_12_245 77
1208 3300046674 Ga0495588_0000642 Ga0495588_0000642_15327_15560 77
1209 3300046674 Ga0495588_0002751 Ga0495588_0002751_7279_7512 77
1210 3300046674 Ga0495588_0142205 Ga0495588_0142205_89_322 77
1211 3300046675 Ga0495657_0003132 Ga0495657_0003132_13418_13651 77
1212 3300046675 Ga0495657_0038819 Ga0495657_0038819_417_650 77
1213 3300046675 Ga0495657_0191587 Ga0495657_0191587_54_287 77
1214 3300046678 Ga0495599_0072878 Ga0495599_0072878_1508_1741 77
1215 3300046678 Ga0495599_0263261 Ga0495599_0263261_636_869 77
1216 3300046679 Ga0495623_0013318 Ga0495623_0013318_798_1049 77
1217 3300046679 Ga0495623_0026406 Ga0495623_0026406_3138_3371 77
1218 3300046679 Ga0495623_0278068 Ga0495623_0278068_583_816 77
1219 3300046680 Ga0495646_0000324 Ga0495646_0000324_10702_10935 77
1220 3300046680 Ga0495646_0015431 Ga0495646_0015431_2810_3061 77
1221 3300046680 Ga0495646_0095738 Ga0495646_0095738_531_764 77
1222 3300046681 Ga0495647_0129790 Ga0495647_0129790_148_381 77
1223 3300046683 Ga0495658_0008765 Ga0495658_0008765_4576_4809 77
1224 3300046683 Ga0495658_0051207 Ga0495658_0051207_283_516 77
1225 3300046683 Ga0495658_0279756 Ga0495658_0279756_120_353 77
1226 3300046683 Ga0495658_0374186 Ga0495658_0374186_106_339 77
1227 3300046684 Ga0495669_0222810 Ga0495669_0222810_619_873 77
1228 3300046689 Ga0495613_0000764 Ga0495613_0000764_14186_14419 77
1229 3300046689 Ga0495613_0006537 Ga0495613_0006537_4766_4999 77
1230 3300046689 Ga0495613_0010964 Ga0495613_0010964_992_1225 77
1231 3300046689 Ga0495613_0015577 Ga0495613_0015577_3140_3373 77
1232 3300046689 Ga0495613_0404236 Ga0495613_0404236_355_588 77
1233 3300046689 Ga0495613_0716355 Ga0495613_0716355_31_264 77
1234 3300046689 Ga0495613_1035109 Ga0495613_1035109_173_424 77
1235 3300046690 Ga0495624_0026063 Ga0495624_0026063_1621_1854 77
1236 3300046690 Ga0495624_0058275 Ga0495624_0058275_597_830 77
1237 3300046690 Ga0495624_0355367 Ga0495624_0355367_351_584 77
1238 3300046691 Ga0495670_0013814 Ga0495670_0013814_3395_3628 77
1239 3300046691 Ga0495670_0019327 Ga0495670_0019327_535_768 77
1240 3300046691 Ga0495670_0051167 Ga0495670_0051167_396_650 77
1241 3300046691 Ga0495670_0077290 Ga0495670_0077290_1307_1540 77
1242 3300046692 Ga0495671_0036258 Ga0495671_0036258_2241_2474 77
1243 3300046692 Ga0495671_0070031 Ga0495671_0070031_79_312 77
1244 3300046794 Ga0495589_0116420 Ga0495589_0116420_780_1034 77
1245 3300046794 Ga0495589_0282406 Ga0495589_0282406_372_605 77
1246 3300046794 Ga0495589_0313285 Ga0495589_0313285_93_326 77
1247 3300046809 Ga0495600_0004577 Ga0495600_0004577_4622_4855 77
1248 3300046809 Ga0495600_0013881 Ga0495600_0013881_3329_3562 77
1249 3300046809 Ga0495600_0017958 Ga0495600_0017958_1690_1941 77
1250 3300046809 Ga0495600_0031433 Ga0495600_0031433_2854_3087 77
1251 3300046810 Ga0495660_0054464 Ga0495660_0054464_321_554 77
1252 3300047315 Ga0495581_0000238 Ga0495581_0000238_20986_21219 77
1253 3300047315 Ga0495581_0003747 Ga0495581_0003747_54_287 77
1254 3300047315 Ga0495581_0019051 Ga0495581_0019051_2591_2824 77
1255 3300047315 Ga0495581_0049246 Ga0495581_0049246_1499_1732 77
1256 3300047315 Ga0495581_0050619 Ga0495581_0050619_2049_2282 77
1257 3300047315 Ga0495581_0064715 Ga0495581_0064715_540_773 77
1258 3300047317 Ga0495604_0002587 Ga0495604_0002587_45_278 77
1259 3300047317 Ga0495604_0014277 Ga0495604_0014277_3214_3447 77
1260 3300047317 Ga0495604_0015750 Ga0495604_0015750_4143_4376 77
1261 3300047317 Ga0495604_0124864 Ga0495604_0124864_531_764 77
1262 3300047318 Ga0495636_0001805 Ga0495636_0001805_3302_3535 77
1263 3300047318 Ga0495636_0020472 Ga0495636_0020472_532_786 77
1264 3300047318 Ga0495636_0054268 Ga0495636_0054268_744_977 77
1265 3300047318 Ga0495636_0123511 Ga0495636_0123511_809_1120 77
1266 3300047319 Ga0495674_0046634 Ga0495674_0046634_2663_2896 77
1267 3300047319 Ga0495674_0125423 Ga0495674_0125423_389_622 77
1268 3300047319 Ga0495674_0174904 Ga0495674_0174904_48_281 77
1269 3300047319 Ga0495674_1241798 Ga0495674_1241798_171_404 77
1270 3300047321 Ga0495676_0001601 Ga0495676_0001601_908_1141 77
1271 3300047321 Ga0495676_0016702 Ga0495676_0016702_2251_2484 77
1272 3300047321 Ga0495676_0025794 Ga0495676_0025794_528_761 77
1273 3300047321 Ga0495676_0049046 Ga0495676_0049046_2512_2745 77
1274 3300047321 Ga0495676_0230854 Ga0495676_0230854_36_269 77
1275 3300047321 Ga0495676_0589931 Ga0495676_0589931_278_511 77
1276 3300047321 Ga0495676_0694091 Ga0495676_0694091_30_263 77
1277 3300047321 Ga0495676_0777352 Ga0495676_0777352_98_331 77
1278 3300047321 Ga0495676_0922942 Ga0495676_0922942_311_544 77
1279 3300047322 Ga0495680_0013650 Ga0495680_0013650_3588_3821 77
1280 3300047322 Ga0495680_0227853 Ga0495680_0227853_56_289 77
1281 3300047443 Ga0495687_001481 Ga0495687_001481_1969_2202 77
1282 3300047444 Ga0495675_0003598 Ga0495675_0003598_2948_3181 77
1283 3300047444 Ga0495675_0225808 Ga0495675_0225808_492_725 77
1284 3300047445 Ga0495677_0090778 Ga0495677_0090778_25_258 77
1285 3300047447 Ga0495685_000247 Ga0495685_000247_1732_1965 77
1286 3300047447 Ga0495685_133299 Ga0495685_133299_131_364 77
1287 3300047447 Ga0495685_215545 Ga0495685_215545_15_248 77
1288 3300047470 Ga0495681_0000245 Ga0495681_0000245_39176_39409 77
1289 3300047470 Ga0495681_0002253 Ga0495681_0002253_281_514 77
1290 3300047471 Ga0495684_0029888 Ga0495684_0029888_1002_1235 77
1291 3300047472 Ga0495686_0016970 Ga0495686_0016970_3173_3406 77
1292 3300047472 Ga0495686_0145358 Ga0495686_0145358_1128_1361 77
1293 3300047673 Ga0495593_0000138 Ga0495593_0000138_27708_27941 77
1294 3300047673 Ga0495593_0027904 Ga0495593_0027904_1423_1656 77
1295 3300047673 Ga0495593_0419964 Ga0495593_0419964_114_347 77
1296 3300048088 Ga0495602_0025051 Ga0495602_0025051_4873_5106 77
1297 3300048088 Ga0495602_0106055 Ga0495602_0106055_1018_1251 77
1298 3300048088 Ga0495602_0280340 Ga0495602_0280340_333_584 77
1299 3300048088 Ga0495602_0425073 Ga0495602_0425073_484_717 77
1300 3300048089 Ga0495614_0003797 Ga0495614_0003797_6358_6591 77
1301 3300048089 Ga0495614_0007036 Ga0495614_0007036_826_1059 77
1302 3300048089 Ga0495614_0115694 Ga0495614_0115694_893_1126 77
1303 3300048091 Ga0495626_0254129 Ga0495626_0254129_86_319 77
1304 3300048903 Ga0496100_0075470 Ga0496100_0075470_1062_1295 77
1305 3300048903 Ga0496100_0099232 Ga0496100_0099232_1662_1895 77
1306 3300048904 Ga0496101_0045807 Ga0496101_0045807_2769_3002 77
1307 3300048904 Ga0496101_0755843 Ga0496101_0755843_384_617 77
1308 3300048904 Ga0496101_0969990 Ga0496101_0969990_98_331 77
1309 3300048905 Ga0496102_0005011 Ga0496102_0005011_825_1058 77
1310 3300048905 Ga0496102_0010869 Ga0496102_0010869_2606_2839 77
1311 3300048905 Ga0496102_0035508 Ga0496102_0035508_549_782 77
1312 3300048906 Ga0496103_0027147 Ga0496103_0027147_1553_1786 77
1313 3300048906 Ga0496103_0113802 Ga0496103_0113802_970_1203 77
1314 3300048906 Ga0496103_0137800 Ga0496103_0137800_116_364 77
1315 3300048906 Ga0496103_1059738 Ga0496103_1059738_109_345 77
1316 3300048907 Ga0496104_0008259 Ga0496104_0008259_1023_1256 77
1317 3300048907 Ga0496104_0751688 Ga0496104_0751688_535_771 77
1318 3300048907 Ga0496104_1126017 Ga0496104_1126017_278_511 77
1319 3300048908 Ga0496105_0060824 Ga0496105_0060824_2186_2419 77
1320 3300048908 Ga0496105_0353605 Ga0496105_0353605_258_491 77
1321 3300048908 Ga0496105_0520553 Ga0496105_0520553_269_505 77
1322 3300048908 Ga0496105_0527843 Ga0496105_0527843_291_524 77
1323 3300048909 Ga0496106_0047288 Ga0496106_0047288_768_1001 77
1324 3300048909 Ga0496106_0063796 Ga0496106_0063796_1523_1756 77
1325 3300048909 Ga0496106_0118244 Ga0496106_0118244_759_992 77
1326 3300048910 Ga0496107_0002569 Ga0496107_0002569_11334_11567 77
1327 3300048910 Ga0496107_0060942 Ga0496107_0060942_1842_2075 77
1328 3300048911 Ga0496108_0058515 Ga0496108_0058515_2595_2828 77
1329 3300048911 Ga0496108_0085285 Ga0496108_0085285_2427_2660 77
1330 3300048911 Ga0496108_0188911 Ga0496108_0188911_356_589 77
1331 3300048912 Ga0496109_0127666 Ga0496109_0127666_1481_1714 77
1332 3300048912 Ga0496109_0544574 Ga0496109_0544574_579_812 77
1333 3300048912 Ga0496109_0716823 Ga0496109_0716823_632_868 77
1334 3300048912 Ga0496109_0764108 Ga0496109_0764108_225_458 77
1335 3300048912 Ga0496109_1056385 Ga0496109_1056385_430_666 77
1336 3300048912 Ga0496109_1462390 Ga0496109_1462390_237_470 77
1337 3300048913 Ga0496110_0027642 Ga0496110_0027642_3998_4231 77
1338 3300048913 Ga0496110_0038230 Ga0496110_0038230_2596_2829 77
1339 3300048913 Ga0496110_0174858 Ga0496110_0174858_479_712 77
1340 3300048913 Ga0496110_1864313 Ga0496110_1864313_201_440 77
1341 3300048914 Ga0496111_0035067 Ga0496111_0035067_2487_2720 77
1342 3300048914 Ga0496111_0741937 Ga0496111_0741937_328_564 77
1343 3300048915 Ga0496112_0113328 Ga0496112_0113328_760_993 77
1344 3300048915 Ga0496112_0404333 Ga0496112_0404333_174_407 77
1345 3300048915 Ga0496112_0832628 Ga0496112_0832628_592_828 77
1346 3300048916 Ga0496113_0040177 Ga0496113_0040177_2427_2660 77
1347 3300048916 Ga0496113_0088139 Ga0496113_0088139_582_815 77
1348 3300048916 Ga0496113_0720869 Ga0496113_0720869_124_357 77
1349 3300048917 Ga0496114_0038329 Ga0496114_0038329_83_316 77
1350 3300048917 Ga0496114_0107652 Ga0496114_0107652_381_617 77
1351 3300048917 Ga0496114_1802307 Ga0496114_1802307_172_405 77
1352 3300048918 Ga0496115_0400190 Ga0496115_0400190_307_540 77
1353 3300048922 Ga0496119_0234972 Ga0496119_0234972_487_720 77
1354 3300048929 Ga0496126_0684430 Ga0496126_0684430_285_518 77
1355 3300049534 Ga0501318_081340 Ga0501318_081340_55_288 77
1356 3300049568 Ga0501031_0001780 Ga0501031_0001780_4570_4806 77
1357 3300049568 Ga0501031_0017177 Ga0501031_0017177_174_407 77
1358 3300049568 Ga0501031_0029479 Ga0501031_0029479_335_568 77
1359 3300049568 Ga0501031_0061817 Ga0501031_0061817_2103_2342 77
1360 3300049568 Ga0501031_0936363 Ga0501031_0936363_220_456 77
1361 3300049569 Ga0501032_0028713 Ga0501032_0028713_3051_3290 77
1362 3300049569 Ga0501032_0123909 Ga0501032_0123909_1265_1504 77
1363 3300049569 Ga0501032_0552085 Ga0501032_0552085_458_691 77
1364 3300049570 Ga0501033_0006059 Ga0501033_0006059_2117_2350 77
1365 3300049570 Ga0501033_0021304 Ga0501033_0021304_1476_1709 77
1366 3300049570 Ga0501033_0037724 Ga0501033_0037724_2287_2523 77
1367 3300049570 Ga0501033_0072646 Ga0501033_0072646_1918_2151 77
1368 3300049570 Ga0501033_0192030 Ga0501033_0192030_732_971 77
1369 3300049570 Ga0501033_1007595 Ga0501033_1007595_33_266 77
1370 3300049570 Ga0501033_1019594 Ga0501033_1019594_17_250 77
1371 3300049571 Ga0501034_0000924 Ga0501034_0000924_38880_39116 77
1372 3300049571 Ga0501034_0002789 Ga0501034_0002789_10266_10499 77
1373 3300049571 Ga0501034_0022110 Ga0501034_0022110_5840_6076 77
1374 3300049571 Ga0501034_0171104 Ga0501034_0171104_821_1054 77
1375 3300049571 Ga0501034_0172536 Ga0501034_0172536_395_631 77
1376 3300049571 Ga0501034_0495594 Ga0501034_0495594_848_1084 77
1377 3300049572 Ga0501036_0000311 Ga0501036_0000311_5940_6179 77
1378 3300049572 Ga0501036_0035488 Ga0501036_0035488_2094_2327 77
1379 3300049572 Ga0501036_0056446 Ga0501036_0056446_597_830 77
1380 3300049572 Ga0501036_0060193 Ga0501036_0060193_1078_1314 77
1381 3300049572 Ga0501036_0322210 Ga0501036_0322210_507_746 77
1382 3300049572 Ga0501036_0392960 Ga0501036_0392960_255_488 77
1383 3300049572 Ga0501036_1090149 Ga0501036_1090149_174_407 77
1384 3300049573 Ga0501037_0056238 Ga0501037_0056238_1885_2121 77
1385 3300049573 Ga0501037_0096108 Ga0501037_0096108_1598_1831 77
1386 3300049573 Ga0501037_0111730 Ga0501037_0111730_442_675 77
1387 3300049573 Ga0501037_0180209 Ga0501037_0180209_555_794 77
1388 3300049574 Ga0501038_0000729 Ga0501038_0000729_24375_24611 77
1389 3300049574 Ga0501038_0001008 Ga0501038_0001008_2482_2721 77
1390 3300049574 Ga0501038_0001438 Ga0501038_0001438_21250_21483 77
1391 3300049574 Ga0501038_0003450 Ga0501038_0003450_13213_13446 77
1392 3300049574 Ga0501038_0022056 Ga0501038_0022056_1235_1474 77
1393 3300049574 Ga0501038_0183858 Ga0501038_0183858_592_825 77
1394 3300049575 Ga0501039_0001818 Ga0501039_0001818_9178_9417 77
1395 3300049575 Ga0501039_0012672 Ga0501039_0012672_6127_6360 77
1396 3300049575 Ga0501039_0395712 Ga0501039_0395712_466_705 77
1397 3300049575 Ga0501039_0493035 Ga0501039_0493035_336_572 77
1398 3300049576 Ga0501040_0000601 Ga0501040_0000601_2811_3050 77
1399 3300049576 Ga0501040_0030966 Ga0501040_0030966_584_823 77
1400 3300049576 Ga0501040_0357376 Ga0501040_0357376_559_792 77
1401 3300049577 Ga0501041_0000058 Ga0501041_0000058_12231_12464 77
1402 3300049577 Ga0501041_0017390 Ga0501041_0017390_898_1137 77
1403 3300049578 Ga0501042_0000028 Ga0501042_0000028_41075_41308 77
1404 3300049578 Ga0501042_0001191 Ga0501042_0001191_3594_3833 77
1405 3300049578 Ga0501042_0163184 Ga0501042_0163184_1192_1431 77
1406 3300049578 Ga0501042_0164637 Ga0501042_0164637_921_1154 77
1407 3300049579 Ga0501043_0006711 Ga0501043_0006711_8897_9130 77
1408 3300049579 Ga0501043_0047630 Ga0501043_0047630_145_381 77
1409 3300049579 Ga0501043_0248654 Ga0501043_0248654_617_856 77
1410 3300049579 Ga0501043_0374102 Ga0501043_0374102_57_290 77
1411 3300049580 Ga0501046_0000269 Ga0501046_0000269_15245_15478 77
1412 3300049580 Ga0501046_0002221 Ga0501046_0002221_11682_11921 77
1413 3300049580 Ga0501046_0332087 Ga0501046_0332087_466_702 77
1414 3300049580 Ga0501046_0948634 Ga0501046_0948634_290_523 77
1415 3300049581 Ga0501047_0000029 Ga0501047_0000029_48737_48970 77
1416 3300049581 Ga0501047_0051999 Ga0501047_0051999_2165_2401 77
1417 3300049581 Ga0501047_0100758 Ga0501047_0100758_2306_2545 77
1418 3300049581 Ga0501047_0124606 Ga0501047_0124606_333_566 77
1419 3300049581 Ga0501047_0199083 Ga0501047_0199083_89_322 77
1420 3300049581 Ga0501047_0653749 Ga0501047_0653749_187_420 77
1421 3300049581 Ga0501047_1227583 Ga0501047_1227583_266_499 77
1422 3300049582 Ga0501048_0000208 Ga0501048_0000208_10241_10474 77
1423 3300049582 Ga0501048_0000611 Ga0501048_0000611_9413_9649 77
1424 3300049582 Ga0501048_0326634 Ga0501048_0326634_55_288 77
1425 3300049583 Ga0501067_0200869 Ga0501067_0200869_101_334 77
1426 3300049583 Ga0501067_0293683 Ga0501067_0293683_183_416 77
1427 3300049583 Ga0501067_0729157 Ga0501067_0729157_167_400 77
1428 3300049584 Ga0501068_0066237 Ga0501068_0066237_1608_1841 77
1429 3300049584 Ga0501068_0216071 Ga0501068_0216071_467_700 77
1430 3300049585 Ga0501069_0085582 Ga0501069_0085582_203_436 77
1431 3300049585 Ga0501069_0111832 Ga0501069_0111832_265_498 77
1432 3300049585 Ga0501069_0351033 Ga0501069_0351033_332_565 77
1433 3300049585 Ga0501069_0560716 Ga0501069_0560716_404_637 77
1434 3300049586 Ga0501070_0003598 Ga0501070_0003598_1872_2105 77
1435 3300049586 Ga0501070_0038542 Ga0501070_0038542_1268_1504 77
1436 3300049586 Ga0501070_0082761 Ga0501070_0082761_617_853 77
1437 3300049586 Ga0501070_0259504 Ga0501070_0259504_1165_1401 77
1438 3300049586 Ga0501070_0537171 Ga0501070_0537171_95_328 77
1439 3300049586 Ga0501070_0615630 Ga0501070_0615630_575_811 77
1440 3300049586 Ga0501070_0755595 Ga0501070_0755595_423_656 77
1441 3300049587 Ga0501071_0001455 Ga0501071_0001455_6224_6463 77
1442 3300049587 Ga0501071_0003307 Ga0501071_0003307_1444_1677 77
1443 3300049587 Ga0501071_0022572 Ga0501071_0022572_3629_3868 77
1444 3300049587 Ga0501071_0245959 Ga0501071_0245959_1072_1305 77
1445 3300049588 Ga0501072_0000452 Ga0501072_0000452_6088_6321 77
1446 3300049588 Ga0501072_0607383 Ga0501072_0607383_321_560 77
1447 3300049589 Ga0501073_0148755 Ga0501073_0148755_453_689 77
1448 3300049589 Ga0501073_0269320 Ga0501073_0269320_741_974 77
1449 3300049589 Ga0501073_0428564 Ga0501073_0428564_121_354 77
1450 3300049590 Ga0501074_0006540 Ga0501074_0006540_5656_5889 77
1451 3300049590 Ga0501074_0010495 Ga0501074_0010495_1948_2187 77
1452 3300049590 Ga0501074_0156894 Ga0501074_0156894_240_476 77
1453 3300049590 Ga0501074_0501964 Ga0501074_0501964_325_564 77
1454 3300049591 Ga0501075_0002435 Ga0501075_0002435_3509_3742 77
1455 3300049591 Ga0501075_0025620 Ga0501075_0025620_1231_1470 77
1456 3300049591 Ga0501075_0206031 Ga0501075_0206031_1210_1443 77
1457 3300049592 Ga0501076_0000061 Ga0501076_0000061_26214_26453 77
1458 3300049592 Ga0501076_0363209 Ga0501076_0363209_678_911 77
1459 3300049593 Ga0501077_0000349 Ga0501077_0000349_23973_24212 77
1460 3300049593 Ga0501077_0285411 Ga0501077_0285411_106_345 77
1461 3300049661 Ga0501217_094455 Ga0501217_094455_156_389 77
1462 3300049662 Ga0501222_074394 Ga0501222_074394_209_442 77
1463 3300049675 Ga0501243_099432 Ga0501243_099432_300_533 77
1464 3300049680 Ga0501250_016109 Ga0501250_016109_348_581 77
1465 3300049741 Ga0501079_0000185 Ga0501079_0000185_20081_20314 77
1466 3300049741 Ga0501079_0004729 Ga0501079_0004729_495_731 77
1467 3300049741 Ga0501079_0167023 Ga0501079_0167023_273_512 77
1468 3300049742 Ga0501080_0035150 Ga0501080_0035150_1399_1638 77
1469 3300049742 Ga0501080_0050424 Ga0501080_0050424_1419_1652 77
1470 3300049742 Ga0501080_0091102 Ga0501080_0091102_2566_2799 77
1471 3300049742 Ga0501080_0922097 Ga0501080_0922097_478_714 77
1472 3300049742 Ga0501080_1263783 Ga0501080_1263783_254_487 77
1473 3300049743 Ga0501081_0000808 Ga0501081_0000808_3032_3271 77
1474 3300049743 Ga0501081_0014905 Ga0501081_0014905_1205_1444 77
1475 3300049744 Ga0501083_0072299 Ga0501083_0072299_1155_1394 77
1476 3300049744 Ga0501083_0081237 Ga0501083_0081237_1717_1956 77
1477 3300049822 Ga0501035_0005880 Ga0501035_0005880_7008_7241 77
1478 3300049822 Ga0501035_0030498 Ga0501035_0030498_2332_2568 77
1479 3300049822 Ga0501035_0057970 Ga0501035_0057970_1941_2174 77
1480 3300049822 Ga0501035_0059274 Ga0501035_0059274_499_738 77
1481 3300049822 Ga0501035_0082543 Ga0501035_0082543_750_983 77
1482 3300049822 Ga0501035_0629839 Ga0501035_0629839_354_587 77
1483 3300049822 Ga0501035_0677754 Ga0501035_0677754_535_768 77
1484 3300049822 Ga0501035_0813446 Ga0501035_0813446_93_329 77
1485 3300049823 Ga0501044_0004269 Ga0501044_0004269_8812_9045 77
1486 3300049823 Ga0501044_0016800 Ga0501044_0016800_5468_5701 77
1487 3300049823 Ga0501044_0053274 Ga0501044_0053274_1646_1882 77
1488 3300049823 Ga0501044_0130851 Ga0501044_0130851_1845_2078 77
1489 3300049823 Ga0501044_0313001 Ga0501044_0313001_1156_1389 77
1490 3300049823 Ga0501044_0794045 Ga0501044_0794045_247_480 77
1491 3300049823 Ga0501044_1328849 Ga0501044_1328849_113_346 77
1492 3300049824 Ga0501045_0000044 Ga0501045_0000044_44163_44396 77
1493 3300049824 Ga0501045_0000099 Ga0501045_0000099_30374_30613 77
1494 3300049824 Ga0501045_0003799 Ga0501045_0003799_10061_10300 77
1495 3300049824 Ga0501045_0416961 Ga0501045_0416961_34_267 77
1496 3300050490 nmdc:mga03n38_642101_c1 nmdc:mga03n38_642101_c1_340_573 77
1497 3300050494 nmdc:mga06z11_6901_c1 nmdc:mga06z11_6901_c1_3179_3412 77
1498 3300050495 nmdc:mga04h51_7603_c1 nmdc:mga04h51_7603_c1_380_613 77
1499 3300050496 nmdc:mga07m45_412112_c1 nmdc:mga07m45_412112_c1_339_572 77
1500 3300050507 nmdc:mga05p37_1978877_c1 nmdc:mga05p37_1978877_c1_235_474 77
1501 3300050507 nmdc:mga05p37_2500_c1 nmdc:mga05p37_2500_c1_14999_15238 77
1502 3300050507 nmdc:mga05p37_296234_c1 nmdc:mga05p37_296234_c1_177_410 77
1503 3300050507 nmdc:mga05p37_476371_c1 nmdc:mga05p37_476371_c1_514_753 77
1504 3300050508 nmdc:mga09592_29416_c1 nmdc:mga09592_29416_c1_3941_4180 77
1505 3300050508 nmdc:mga09592_297686_c1 nmdc:mga09592_297686_c1_154_387 77
1506 3300050508 nmdc:mga09592_621605_c1 nmdc:mga09592_621605_c1_285_524 77
1507 3300050509 nmdc:mga0qj67_11266_c1 nmdc:mga0qj67_11266_c1_372_611 77
1508 3300050509 nmdc:mga0qj67_1196375_c1 nmdc:mga0qj67_1196375_c1_167_403 77
1509 3300050510 nmdc:mga06r32_39821_c1 nmdc:mga06r32_39821_c1_3568_3807 77
1510 3300050511 nmdc:mga08y16_1109_c1 nmdc:mga08y16_1109_c1_2455_2694 77
1511 3300050512 nmdc:mga0n895_2244304_c1 nmdc:mga0n895_2244304_c1_64_300 77
1512 3300050512 nmdc:mga0n895_336722_c1 nmdc:mga0n895_336722_c1_274_507 77
1513 3300050512 nmdc:mga0n895_557889_c1 nmdc:mga0n895_557889_c1_23_256 77
1514 3300050513 nmdc:mga0rr50_6991_c1 nmdc:mga0rr50_6991_c1_795_1028 77
1515 3300050514 nmdc:mga08x19_43194_c1 nmdc:mga08x19_43194_c1_941_1174 77
1516 3300050514 nmdc:mga08x19_927160_c1 nmdc:mga08x19_927160_c1_244_531 77
1517 3300050515 nmdc:mga0a205_18720_c2 nmdc:mga0a205_18720_c2_2693_2932 77
1518 3300050515 nmdc:mga0a205_1920_c1 nmdc:mga0a205_1920_c1_15967_16200 77
1519 3300050515 nmdc:mga0a205_472147_c1 nmdc:mga0a205_472147_c1_14_247 77
1520 3300053077 Ga0495601_0054938 Ga0495601_0054938_1592_1843 77
1521 3300053077 Ga0495601_0315218 Ga0495601_0315218_530_763 77
1522 3300053077 Ga0495601_0507899 Ga0495601_0507899_53_286 77
1523 3300053078 Ga0495612_0024870 Ga0495612_0024870_2009_2242 77
1524 3300053078 Ga0495612_0052359 Ga0495612_0052359_84_317 77
1525 3300053078 Ga0495612_0106079 Ga0495612_0106079_267_518 77
1526 3300053083 Ga0495655_0183927 Ga0495655_0183927_144_377 77
1527 3300053083 Ga0495655_0242719 Ga0495655_0242719_86_319 77
1528 3300053084 Ga0495595_0004357 Ga0495595_0004357_4682_4915 77
1529 3300053084 Ga0495595_0317009 Ga0495595_0317009_532_768 77
1530 3300053085 Ga0495619_0080196 Ga0495619_0080196_1319_1552 77
1531 3300053085 Ga0495619_0081314 Ga0495619_0081314_1253_1504 77
1532 3300053086 Ga0500578_0061920 Ga0500578_0061920_1226_1459 77
1533 3300053086 Ga0500578_0073961 Ga0500578_0073961_498_731 77
1534 3300053088 Ga0500644_0087099 Ga0500644_0087099_794_1027 77
1535 3300053090 Ga0500646_0172845 Ga0500646_0172845_208_441 77
1536 3300053092 Ga0500583_0177827 Ga0500583_0177827_227_460 77
1537 3300053094 Ga0500566_0029128 Ga0500566_0029128_211_444 77
1538 3300053095 Ga0500640_001975 Ga0500640_001975_1445_1678 77
1539 3300053100 Ga0500660_133674 Ga0500660_133674_281_514 77
1540 3300053101 Ga0500553_121642 Ga0500553_121642_749_982 77
1541 3300053107 Ga0500560_043872 Ga0500560_043872_87_320 77
1542 3300053107 Ga0500560_239485 Ga0500560_239485_219_452 77
1543 3300053109 Ga0500569_005079 Ga0500569_005079_151_384 77
1544 3300053113 Ga0500580_239330 Ga0500580_239330_36_269 77
1545 3300053114 Ga0500582_185900 Ga0500582_185900_115_348 77
1546 3300053123 Ga0500614_010286 Ga0500614_010286_1171_1404 77
1547 3300053126 Ga0500621_206050 Ga0500621_206050_163_396 77
1548 3300053129 Ga0500628_001049 Ga0500628_001049_3330_3563 77
1549 3300053131 Ga0500652_001997 Ga0500652_001997_4112_4345 77
1550 3300053134 Ga0500658_0004724 Ga0500658_0004724_4025_4258 77
1551 3300053136 Ga0500559_0304142 Ga0500559_0304142_430_663 77
1552 3300053137 Ga0500561_0000420 Ga0500561_0000420_2775_3008 77
1553 3300053140 Ga0500573_0025239 Ga0500573_0025239_227_460 77
1554 3300053140 Ga0500573_0508023 Ga0500573_0508023_266_499 77
1555 3300053142 Ga0500577_0268877 Ga0500577_0268877_225_458 77
1556 3300053143 Ga0500579_036618 Ga0500579_036618_1042_1275 77
1557 3300053145 Ga0500586_260713 Ga0500586_260713_193_426 77
1558 3300053146 Ga0500588_0176562 Ga0500588_0176562_439_672 77
1559 3300053149 Ga0500600_0047044 Ga0500600_0047044_1353_1586 77
1560 3300053149 Ga0500600_0231398 Ga0500600_0231398_201_434 77
1561 3300053150 Ga0500603_178475 Ga0500603_178475_300_533 77
1562 3300053152 Ga0500606_139456 Ga0500606_139456_193_426 77
1563 3300053153 Ga0500616_0029739 Ga0500616_0029739_1842_2075 77
1564 3300053158 Ga0500627_0221498 Ga0500627_0221498_222_455 77
1565 3300053160 Ga0500633_0000496 Ga0500633_0000496_2878_3111 77
1566 3300053161 Ga0500634_0000253 Ga0500634_0000253_1586_1819 77
1567 3300053161 Ga0500634_0187598 Ga0500634_0187598_360_593 77
1568 3300053732 Ga0500656_000060 Ga0500656_000060_249_482 77
1569 3300053739 Ga0500587_002698 Ga0500587_002698_1353_1586 77
1570 3300054114 Ga0501084_0002725 Ga0501084_0002725_12862_13101 77
1571 3300054114 Ga0501084_0007261 Ga0501084_0007261_8839_9072 77
1572 3300054114 Ga0501084_0190792 Ga0501084_0190792_531_764 77
1573 3300054114 Ga0501084_0903292 Ga0501084_0903292_96_329 77
1574 3300059421 Ga0590071_003818 Ga0590071_003818_1283_1516 77
1575 3300059423 Ga0590074_013428 Ga0590074_013428_271_504 77
1576 3300059423 Ga0590074_021961 Ga0590074_021961_505_744 77
1577 3300059424 Ga0590075_018110 Ga0590075_018110_1330_1563 77
1578 3300059426 Ga0590077_000958 Ga0590077_000958_6660_6893 77
1579 3300059426 Ga0590077_073095 Ga0590077_073095_478_717 77
1580 3300059492 Ga0587073_0298714 Ga0587073_0298714_159_392 77
1581 3300059504 Ga0587082_162506 Ga0587082_162506_132_365 77
1582 3300059643 Ga0587072_186239 Ga0587072_186239_130_363 77
1583 3300060353 Ga0501082_0003253 Ga0501082_0003253_5194_5427 77
1584 3300060353 Ga0501082_0041255 Ga0501082_0041255_1652_1891 77
1585 3300060353 Ga0501082_0385269 Ga0501082_0385269_199_438 77
1586 3300061719 Ga0466962_0000765 Ga0466962_0000765_12910_13161 77
1587 3300061719 Ga0466962_0027782 Ga0466962_0027782_109_342 77
1588 3300061719 Ga0466962_0077974 Ga0466962_0077974_1042_1278 77
1589 3300061734 Ga0530510_0000204 Ga0530510_0000204_25760_25999 77
1590 3300061734 Ga0530510_0036828 Ga0530510_0036828_206_439 77
1591 3300061734 Ga0530510_0817184 Ga0530510_0817184_453_692 77

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01037

AsnC_trans_reg

Lrp/AsnC ligand binding domain

14

84

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zbc-assembly1.cif.gz_C-2 crystal structure of sts042, a stand-alone ram module protein, from hyperthermophilic archaeon sulfolobus tokodaii strain7. 0.9017 3 75
2djw-assembly1.cif.gz_F crystal structure of ttha0845 from thermus thermophilus hb8 0.8893 1 77
2e1a-assembly1.cif.gz_B crystal structure of ffrp-dm1 0.8817 1 75
2djw-assembly1.cif.gz_F crystal structure of ttha0845 from thermus thermophilus hb8 0.8786 1 77
2efo-assembly1.cif.gz_A crystal structure of tyr77 to ala of st1022 from sulfolobus tokodaii 7 0.878 2 77
ID Description Score Start End Superfamily
2djwE01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.8937 1 74 3.30.70.920
2zbcB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.8935 3 71 3.30.70.920
2djwE01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.8826 1 74 3.30.70.920
2z4pD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.8791 1 74 3.30.70.920
2jsxA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.8773 3 72 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A1I4CSG5-F1-model_v4 AsnC family protein 0.9747 2 77
AF-A0A1H5RBS8-F1-model_v4 AsnC family protein 0.9745 2 77
AF-A0A0L0KXZ7-F1-model_v4 deleted 0.974 1 77
AF-A0A6F7VTE0-F1-model_v4 deleted 0.9739 1 77
AF-H0B7P4-F1-model_v4 Transcription regulator AsnC/Lrp ligand binding domain-containing protein 0.9734 2 77

Feature Viewer

pLDDT pTM Quality
90.82 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map