F494817

General Info

Members Datasets Scaffolds Average Seq Length
1570 728 1272 196

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10044644|Ga0157372_100446442
Length 234
Sequence LKCRCADATCASDIVQRPAGKSFEGCLQVRIQEVRNAMLLMIDNYDSFTYNVVQYLGELGAEVKVVRNDELTVAEIEALNPERIVVSPGPCTPTEAGISIEAIKHFAGKLPILGVCLGHQSIGQAFGGDVVRARQVMHGKTSPVFHEDKGVFAGLNRPLTVTRYHSLIVKHDTLPECLELTAWTQHDDGSVDEIMGLRHKTLNIEGVQFHPESILTEQGHELFANFLKQTGGTR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2511231012 Pseudomonas sp. GM33 Isolate Nodule
10 2511231014 Pseudomonas sp. GM48 Isolate Nodule
11 2511231015 Pseudomonas sp. GM49 Isolate Nodule
12 2511231016 Pseudomonas sp. GM50 Isolate Nodule
13 2511231017 Pseudomonas sp. GM55 Isolate Nodule
14 2511231018 Pseudomonas sp. GM60 Isolate Nodule
15 2511231019 Pseudomonas sp. GM67 Isolate Nodule
16 2511231020 Pseudomonas sp. GM74 Isolate Nodule
17 2511231021 Pseudomonas sp. GM78 Isolate Nodule
18 2511231022 Pseudomonas sp. GM79 Isolate Nodule
19 2511231023 Pseudomonas sp. GM80 Isolate Nodule
20 2511231024 Pseudomonas sp. GM84 Isolate Nodule
21 2511231031 Pseudomonas sp. GM16 Isolate Nodule
22 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
23 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
24 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
25 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
26 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
27 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
28 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
29 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
30 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
31 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
32 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
33 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
34 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
35 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
36 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
37 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
38 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
39 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
40 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
41 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
42 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
43 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
44 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
45 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
46 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
47 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
48 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
49 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
50 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
51 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
52 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
53 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
54 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
55 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
56 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
57 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
58 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
59 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
60 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
61 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
62 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
63 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
64 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
65 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
66 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
67 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
68 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
69 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
70 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
71 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
72 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
73 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
74 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
75 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
76 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
77 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
78 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
79 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
80 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
81 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
82 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
83 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
84 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
85 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
86 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
87 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
88 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
89 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
90 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
91 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
92 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
93 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
94 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
95 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
96 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
97 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
98 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
99 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
100 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
101 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
102 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
103 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
104 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
105 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
106 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
107 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
108 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
109 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
110 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
111 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
112 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
113 2643221695 Lysobacter sp. Root494 Isolate Unclassified
114 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
115 2643221731 Bacillus sp. Root147 Isolate Unclassified
116 2643221732 Bacillus sp. Root239 Isolate Unclassified
117 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
118 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
119 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
120 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
121 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
122 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
123 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
124 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
125 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
126 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
127 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
128 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
129 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
130 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
131 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
132 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
133 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
134 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
135 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
136 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
137 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
138 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
139 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
140 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
141 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
142 2765235841 Pseudomonas putida AA7 Isolate Unclassified
143 2773857670 Pseudomonas sp. 478 Isolate Unclassified
144 2773857673 Pseudomonas sp. 443 Isolate Unclassified
145 2784132063 Pseudomonas sp. 424 Isolate Unclassified
146 2784132072 Pseudomonas sp. 460 Isolate Unclassified
147 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
148 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
149 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
150 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
151 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
152 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
153 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
154 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
155 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
156 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
157 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
158 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
159 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
160 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
161 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
162 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
163 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
164 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
165 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
166 2818991459 Paenibacillus sp. 597 Isolate Unclassified
167 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
168 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
169 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
170 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
171 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
172 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
173 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
174 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
175 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
176 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
177 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
178 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
179 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
180 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
181 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
182 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
183 2842882022 Bacillus sp. R-71893 Isolate Unclassified
184 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
185 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
186 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
187 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
188 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
189 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
190 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
191 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
192 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
193 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
194 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
195 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
196 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
197 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
198 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
199 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
200 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
201 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
202 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
203 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
204 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
205 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
206 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
207 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
208 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
209 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
210 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
211 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
212 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
213 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
214 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
215 2919720352 Priestia megaterium 4340 Isolate Unclassified
216 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
217 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
218 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
219 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
220 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
221 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
222 2929004312 Priestia megaterium 1104 Isolate Unclassified
223 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
224 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
225 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
226 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
227 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
228 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
229 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
230 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
231 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
232 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
233 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
234 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
235 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
236 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
237 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
238 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
239 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
240 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
241 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
242 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
243 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
244 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
245 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
246 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
247 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
248 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
249 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
250 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
251 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
252 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
253 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
254 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
255 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
256 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
257 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
258 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
259 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
260 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
261 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
262 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
263 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
264 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
265 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
266 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
267 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
268 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
269 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
270 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
271 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
272 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
273 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
274 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
275 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
276 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
277 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
278 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
279 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
280 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
281 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
282 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
283 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
284 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
285 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
286 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
287 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
288 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
289 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
290 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
291 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
292 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
293 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
294 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
295 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
296 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
297 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
298 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
299 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
300 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
301 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
302 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
303 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
304 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
305 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
306 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
307 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
308 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
309 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
310 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
311 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
312 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
313 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
314 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
315 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
316 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
317 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
318 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
319 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
320 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
321 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
322 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
323 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
324 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
325 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
326 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
327 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
328 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
329 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
330 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
331 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
332 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
333 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
334 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
335 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
336 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
337 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
338 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
339 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
340 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
341 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
342 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
343 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
344 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
345 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
346 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
347 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
348 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
349 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
350 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
351 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
352 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
353 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
354 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
355 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
356 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
357 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
358 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
359 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
360 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
361 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
362 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
363 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
364 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
365 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
366 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
367 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
368 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
369 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
370 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
371 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
372 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
373 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
374 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
375 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
376 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
377 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
378 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
379 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
380 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
381 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
382 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
383 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
384 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
385 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
386 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
387 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
388 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
389 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
390 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
391 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
392 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
393 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
394 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
395 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
396 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
397 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
398 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
399 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
400 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
401 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
402 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
403 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
404 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
405 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
406 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
407 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
408 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
442 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
444 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
445 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
446 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
448 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
449 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
450 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
451 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
452 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
453 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
454 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
455 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
456 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
457 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
458 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
460 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
461 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
462 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
463 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
464 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
465 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
466 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
467 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
468 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
469 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
470 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
471 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
472 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
473 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
474 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
475 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
476 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
477 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
478 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
479 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
480 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
481 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
482 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
483 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
484 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
485 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
486 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
487 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
488 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
489 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
490 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
491 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
492 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
493 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
494 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
495 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
496 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
497 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
498 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
499 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
500 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
501 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
502 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
503 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
504 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
505 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
506 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
507 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
508 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
509 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
510 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
511 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
512 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
513 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
514 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
515 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
516 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
517 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
518 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
519 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
520 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
521 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
522 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
523 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
524 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
525 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
526 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
527 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
528 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
529 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
530 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
531 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
532 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
533 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
534 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
535 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
536 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
537 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
538 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
539 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
540 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
541 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
542 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
543 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
544 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
545 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
546 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
547 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
548 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
549 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
550 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
551 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
552 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
553 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
554 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
555 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
556 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
557 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
558 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
559 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
560 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
561 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
562 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
563 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
564 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
565 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
566 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
567 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
568 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
569 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
570 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
571 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
572 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
573 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
574 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
575 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
576 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
577 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
578 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
579 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
580 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
581 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
582 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
583 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
584 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
585 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
586 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
587 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
588 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
589 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
590 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
591 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
592 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
593 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
594 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
595 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
596 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
597 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
598 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
599 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
600 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
601 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
602 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
603 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
604 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
605 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
606 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
607 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
608 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
609 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
610 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
611 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
612 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
613 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
614 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
615 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
616 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
617 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
618 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
619 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
620 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
621 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
622 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
623 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
624 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
625 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
626 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
627 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
628 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
629 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
630 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
631 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
632 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
633 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
634 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
635 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
636 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
637 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
638 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
639 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
640 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
641 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
642 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
643 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
644 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
645 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
646 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
647 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
648 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
649 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
650 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
651 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
652 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
653 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
654 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
655 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
656 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
657 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
658 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
659 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
660 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
661 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
662 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
663 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
664 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
665 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
666 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
667 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
668 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
669 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
670 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
671 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
672 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
673 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
674 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
675 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
676 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
677 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
678 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
679 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
680 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
681 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
682 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
683 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
684 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
685 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
686 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
687 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
688 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
689 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
690 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
691 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
692 641522639 Methylobacterium sp. 4-46 Isolate Nodule
693 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
694 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
695 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
696 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
697 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
698 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
699 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
700 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
701 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
702 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
703 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
704 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
705 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
706 8052494512 Pseudomonas putida LD6 Isolate Unclassified
707 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
708 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
709 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
710 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
711 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
712 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
713 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
714 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
715 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
716 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
717 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
718 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
719 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
720 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
721 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
722 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
723 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
724 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
725 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
726 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
727 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
728 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.64
Metatranscriptomes 0.32
Isolates 19.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.16
Nodule 1.97
Rhizoplane 5.92
Rhizosphere 74.39
Stem 0
Stem Tuber 0
Unclassified 12.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_25655 2124908027 Bacteria 942
2 SwRhRL2b_contig_2033802 2162886007 Bacteria 1272
3 SwRhRL2b_contig_2301832 2162886007 Bacteria 1773
4 SwRhRL2b_contig_2561713 2162886007 Bacteria 4817
5 SwRhRL2b_contig_3690329 2162886007 Bacteria 2696
6 JGI24741J21665_1019860 3300001915 Bacteria 1061
7 JGI25155J39150_1003044 3300002704 Bacteria 862
8 JGI25162J39368_1000324 3300002737 Bacteria 41886
9 JGI25154J39366_1004696 3300002738 Bacteria 2366
10 JGI25163J39215_1000382 3300002771 Bacteria 14268
11 JGI25163J39215_1001230 3300002771 Bacteria 4773
12 JGI25164J39214_1000240 3300002772 Bacteria 41886
13 JGI25164J39214_1000410 3300002772 Bacteria 24396
14 JGI25406J46586_10039583 3300003203 Bacteria 1678
15 JGI25165J46597_1000439 3300003214 Bacteria 41886
16 JGI25165J46597_1000774 3300003214 Bacteria 24396
17 rootH1_10000959 3300003316 Bacteria 49127
18 rootH1_10000959 3300003323 Bacteria 4421
19 rootH2_10342474 3300003320 Bacteria 3110
20 rootL2_10014887 3300003322 Bacteria 23126
21 rootH1_10248111 3300003323 Bacteria 2940
22 Ga0006562J51391_1001260 3300003578 Bacteria 8767
23 Ga0006562J51391_1020783 3300003578 Bacteria 1311
24 Ga0055538_1000274 3300003751 Bacteria 26739
25 Ga0055538_1000784 3300003751 Bacteria 8833
26 Ga0055539_1000302 3300003752 Bacteria 26739
27 Ga0055533_1000282 3300003756 Bacteria 26739
28 Ga0055532_1000427 3300003758 Bacteria 20119
29 Ga0055525_1000407 3300003759 Bacteria 26739
30 Ga0055536_1001108 3300003781 Bacteria 16921
31 Ga0055536_1001147 3300003781 Bacteria 16571
32 Ga0055536_1002226 3300003781 Bacteria 11039
33 Ga0055528_1009121 3300003790 Bacteria 4180
34 Ga0055530_10000513 3300003791 Bacteria 33776
35 Ga0055530_10000832 3300003791 Bacteria 25491
36 Ga0055530_10002706 3300003791 Bacteria 11022
37 Ga0055540_1000426 3300003792 Bacteria 33776
38 Ga0055540_1000516 3300003792 Bacteria 29231
39 Ga0055540_1000533 3300003792 Bacteria 28667
40 Ga0055531_10000286 3300003794 Bacteria 51010
41 Ga0055531_10001251 3300003794 Bacteria 19278
42 Ga0055531_10011026 3300003794 Bacteria 4416
43 Ga0055541_1000194 3300003841 Bacteria 26739
44 Ga0058692_1009942 3300003856 Bacteria 2375
45 Ga0058692_1019879 3300003856 Bacteria 1422
46 Ga0058859_11723765 3300004798 Bacteria 861
47 Ga0065714_10000306 3300005288 Bacteria 5922
48 Ga0065714_10002430 3300005288 Bacteria 22712
49 Ga0065714_10012426 3300005288 Bacteria 1809
50 Ga0065714_10020040 3300005288 Bacteria 1998
51 Ga0065714_10021513 3300005288 Bacteria 1723
52 Ga0065714_10071564 3300005288 Bacteria 3546
53 Ga0065714_10078003 3300005288 Bacteria 2638
54 Ga0065714_10080836 3300005288 Bacteria 2413
55 Ga0065714_10100953 3300005288 Bacteria 1653
56 Ga0065714_10112890 3300005288 Bacteria 1449
57 Ga0065714_10133243 3300005288 Bacteria 1224
58 Ga0065714_10155289 3300005288 Bacteria 1076
59 Ga0065714_10186172 3300005288 Bacteria 944
60 Ga0065714_10295223 3300005288 Bacteria 698
61 Ga0065704_10004129 3300005289 Bacteria 6335
62 Ga0065704_10070839 3300005289 Bacteria 15542
63 Ga0065704_10072990 3300005289 Bacteria 7703
64 Ga0065704_10078228 3300005289 Bacteria 4491
65 Ga0065704_10090384 3300005289 Bacteria 2784
66 Ga0065704_10124966 3300005289 Bacteria 1710
67 Ga0065704_10127787 3300005289 Bacteria 1671
68 Ga0065704_10156983 3300005289 Bacteria 1383
69 Ga0065704_10196810 3300005289 Bacteria 1164
70 Ga0065712_10013841 3300005290 Bacteria 2111
71 Ga0065712_10069870 3300005290 Bacteria 6592
72 Ga0065715_10130202 3300005293 Bacteria 2031
73 Ga0065715_10142984 3300005293 Bacteria 1826
74 Ga0065707_10139083 3300005295 Bacteria 1797
75 Ga0070676_10051532 3300005328 Bacteria 2417
76 Ga0070676_10191837 3300005328 Bacteria 1334
77 Ga0070690_100006182 3300005330 Bacteria 6788
78 Ga0070690_100037381 3300005330 Bacteria 3059
79 Ga0070670_100012900 3300005331 Bacteria 7153
80 Ga0070670_100017837 3300005331 Bacteria 6092
81 Ga0070670_100274530 3300005331 Bacteria 1471
82 Ga0070666_10040384 3300005335 Bacteria 3114
83 Ga0070666_10087543 3300005335 Bacteria 2135
84 Ga0070680_100000103 3300005336 Bacteria 48805
85 Ga0070680_101014380 3300005336 Bacteria 717
86 Ga0070682_100563835 3300005337 Bacteria 893
87 Ga0070687_100000398 3300005343 Bacteria 14763
88 Ga0070661_100004022 3300005344 Bacteria 10108
89 Ga0070692_10106283 3300005345 Bacteria 1546
90 Ga0070668_100622722 3300005347 Bacteria 946
91 Ga0070669_100001100 3300005353 Bacteria 19776
92 Ga0070669_100003634 3300005353 Bacteria 11125
93 Ga0070669_100015089 3300005353 Bacteria 5505
94 Ga0070669_100051734 3300005353 Bacteria 3004
95 Ga0070675_100751324 3300005354 Bacteria 890
96 Ga0070671_100009700 3300005355 Bacteria 7735
97 Ga0070671_100136458 3300005355 Bacteria 2068
98 Ga0070667_100045943 3300005367 Bacteria 3673
99 Ga0070714_100584969 3300005435 Bacteria 1071
100 Ga0070700_100033884 3300005441 Bacteria 3080
101 Ga0070700_100164939 3300005441 Bacteria 1529
102 Ga0070694_100045868 3300005444 Bacteria 2931
103 Ga0070694_100220890 3300005444 Bacteria 1421
104 Ga0070694_100654360 3300005444 Bacteria 851
105 Ga0070708_100020142 3300005445 Bacteria 5619
106 Ga0070678_100002659 3300005456 Bacteria 9842
107 Ga0070662_100002186 3300005457 Bacteria 11989
108 Ga0070662_100253909 3300005457 Bacteria 1414
109 Ga0070681_10000095 3300005458 Bacteria 65410
110 Ga0068867_100023979 3300005459 Bacteria 4372
111 Ga0070706_100007674 3300005467 Bacteria 10091
112 Ga0070706_101271572 3300005467 Bacteria 675
113 Ga0070707_101031528 3300005468 Bacteria 788
114 Ga0070698_100917037 3300005471 Bacteria 822
115 Ga0070699_100194051 3300005518 Bacteria 1805
116 Ga0070679_100003442 3300005530 Bacteria 14494
117 Ga0068853_100000211 3300005539 Bacteria 41402
118 Ga0070672_100019742 3300005543 Bacteria 4899
119 Ga0070686_100003705 3300005544 Bacteria 8396
120 Ga0070696_100017260 3300005546 Bacteria 4871
121 Ga0070696_100466966 3300005546 Bacteria 998
122 Ga0070693_100115702 3300005547 Bacteria 1656
123 Ga0070665_100010924 3300005548 Bacteria 9182
124 Ga0070665_100013078 3300005548 Bacteria 8357
125 Ga0070665_100349065 3300005548 Bacteria 1485
126 Ga0068855_100157658 3300005563 Bacteria 2578
127 Ga0068855_100653631 3300005563 Bacteria 1129
128 Ga0070664_100006387 3300005564 Bacteria 9508
129 Ga0070664_100020240 3300005564 Bacteria 5479
130 Ga0068854_100002246 3300005578 Bacteria 11892
131 Ga0068854_100206146 3300005578 Bacteria 1548
132 Ga0068856_100117130 3300005614 Bacteria 2664
133 Ga0070702_100327653 3300005615 Bacteria 1070
134 Ga0068859_101252319 3300005617 Bacteria 817
135 Ga0068861_100045557 3300005719 Bacteria 3303
136 Ga0068861_100553868 3300005719 Bacteria 1048
137 Ga0068851_10000063 3300005834 Bacteria 60338
138 Ga0068862_100998573 3300005844 Bacteria 827
139 Ga0081455_10039238 3300005937 Bacteria 4187
140 Ga0081539_10000103 3300005985 Bacteria 197839
141 Ga0070717_10295176 3300006028 Bacteria 1440
142 Ga0075364_10058470 3300006051 Bacteria 2527
143 Ga0075364_10092886 3300006051 Bacteria 2003
144 Ga0075364_10167323 3300006051 Bacteria 1485
145 Ga0075364_10247871 3300006051 Bacteria 1210
146 Ga0075364_10422924 3300006051 Bacteria 909
147 Ga0075364_10436045 3300006051 Bacteria 895
148 Ga0075432_10001688 3300006058 Bacteria 7271
149 Ga0075432_10002396 3300006058 Bacteria 6245
150 Ga0075432_10008700 3300006058 Bacteria 3464
151 Ga0075432_10024262 3300006058 Bacteria 2078
152 Ga0075432_10076427 3300006058 Bacteria 1209
153 Ga0075432_10143886 3300006058 Bacteria 912
154 Ga0075432_10268893 3300006058 Bacteria 697
155 Ga0075362_10199448 3300006177 Bacteria 974
156 Ga0075366_10139516 3300006195 Bacteria 1465
157 Ga0075370_10267446 3300006353 Bacteria 1014
158 Ga0075433_10046867 3300006852 Bacteria 3760
159 Ga0075433_10049658 3300006852 Bacteria 3649
160 Ga0075433_10065482 3300006852 Bacteria 3187
161 Ga0075434_100269967 3300006871 Bacteria 1720
162 Ga0075436_100072665 3300006914 Bacteria 2380
163 Ga0075436_100086441 3300006914 Bacteria 2178
164 Ga0097620_101252767 3300006931 Bacteria 817
165 Ga0099823_1000115 3300006944 Bacteria 40134
166 Ga0079104_1000620 3300006946 Bacteria 34817
167 Ga0079104_1000927 3300006946 Bacteria 23453
168 Ga0079104_1037758 3300006946 Bacteria 1148
169 Ga0099826_10067152 3300006948 Bacteria 2296
170 Ga0075435_100754186 3300007076 Bacteria 847
171 Ga0105251_10000322 3300009011 Bacteria 48000
172 Ga0105251_10001209 3300009011 Bacteria 22310
173 Ga0105251_10001813 3300009011 Bacteria 17692
174 Ga0105251_10002972 3300009011 Bacteria 12686
175 Ga0105251_10003491 3300009011 Bacteria 11386
176 Ga0105251_10005113 3300009011 Bacteria 8681
177 Ga0105251_10009217 3300009011 Bacteria 5852
178 Ga0105251_10024014 3300009011 Bacteria 3137
179 Ga0105251_10026194 3300009011 Bacteria 2972
180 Ga0105251_10029175 3300009011 Bacteria 2781
181 Ga0105251_10063787 3300009011 Bacteria 1728
182 Ga0105244_10001414 3300009036 Bacteria 19428
183 Ga0105244_10001557 3300009036 Bacteria 18226
184 Ga0105244_10002629 3300009036 Bacteria 13467
185 Ga0105244_10008501 3300009036 Bacteria 6406
186 Ga0105244_10014653 3300009036 Bacteria 4528
187 Ga0105244_10014938 3300009036 Bacteria 4469
188 Ga0105244_10021784 3300009036 Bacteria 3537
189 Ga0105244_10029719 3300009036 Bacteria 2916
190 Ga0105244_10043179 3300009036 Bacteria 2327
191 Ga0105244_10068307 3300009036 Bacteria 1776
192 Ga0105244_10161908 3300009036 Bacteria 1068
193 Ga0105244_10215018 3300009036 Bacteria 903
194 Ga0105250_10000708 3300009092 Bacteria 20546
195 Ga0105250_10003391 3300009092 Bacteria 7553
196 Ga0105250_10003781 3300009092 Bacteria 7104
197 Ga0105250_10008778 3300009092 Bacteria 4281
198 Ga0105250_10025688 3300009092 Bacteria 2373
199 Ga0105250_10164639 3300009092 Bacteria 927
200 Ga0105250_10318331 3300009092 Bacteria 676
201 Ga0111539_10103471 3300009094 Bacteria 3342
202 Ga0111539_10176388 3300009094 Bacteria 2497
203 Ga0111539_10209881 3300009094 Bacteria 2269
204 Ga0105245_10030861 3300009098 Bacteria 4740
205 Ga0105245_10091058 3300009098 Bacteria 2806
206 Ga0105245_11275215 3300009098 Bacteria 783
207 Ga0105245_11431088 3300009098 Bacteria 741
208 Ga0105247_10005167 3300009101 Bacteria 8255
209 Ga0114129_10001731 3300009147 Bacteria 29753
210 Ga0114129_10015302 3300009147 Bacteria 10917
211 Ga0114129_10111506 3300009147 Bacteria 3774
212 Ga0114129_10274496 3300009147 Bacteria 2254
213 Ga0114129_10994089 3300009147 Bacteria 1057
214 Ga0105243_10000462 3300009148 Bacteria 42016
215 Ga0105243_10000593 3300009148 Bacteria 36221
216 Ga0105243_10001219 3300009148 Bacteria 23167
217 Ga0105243_10005262 3300009148 Bacteria 10123
218 Ga0105243_10010209 3300009148 Bacteria 7137
219 Ga0105243_10025858 3300009148 Bacteria 4489
220 Ga0105243_10034083 3300009148 Bacteria 3939
221 Ga0105243_10079625 3300009148 Bacteria 2671
222 Ga0105243_10288010 3300009148 Bacteria 1483
223 Ga0105241_11434475 3300009174 Bacteria 662
224 Ga0105242_10000538 3300009176 Bacteria 29959
225 Ga0105242_10011203 3300009176 Bacteria 6891
226 Ga0105242_10579230 3300009176 Bacteria 1081
227 Ga0105248_10323209 3300009177 Bacteria 1738
228 Ga0105248_10925579 3300009177 Bacteria 984
229 Ga0105237_10003767 3300009545 Bacteria 17850
230 Ga0105237_10077502 3300009545 Bacteria 3314
231 Ga0105249_10020568 3300009553 Bacteria 5902
232 Ga0105249_10030494 3300009553 Bacteria 4875
233 Ga0105249_10046060 3300009553 Bacteria 3969
234 Ga0105249_10179897 3300009553 Bacteria 2057
235 Ga0099796_10034611 3300010159 Bacteria 1669
236 Ga0105239_10520790 3300010375 Bacteria 1353
237 Ga0105246_10000309 3300011119 Bacteria 25912
238 Ga0105246_10005628 3300011119 Bacteria 7642
239 Ga0105246_10015586 3300011119 Bacteria 4802
240 Ga0105246_10039625 3300011119 Bacteria 3175
241 Ga0105246_10045955 3300011119 Bacteria 2977
242 Ga0105246_10169351 3300011119 Bacteria 1671
243 Ga0105246_10277243 3300011119 Bacteria 1343
244 Ga0105246_10515592 3300011119 Bacteria 1018
245 Ga0157345_1000470 3300012498 Bacteria 3850
246 Ga0157373_10001670 3300013100 Bacteria 16940
247 Ga0157373_10011514 3300013100 Bacteria 6499
248 Ga0157373_10061615 3300013100 Bacteria 2657
249 Ga0157373_10084249 3300013100 Bacteria 2241
250 Ga0157373_10495497 3300013100 Bacteria 882
251 Ga0157371_10000536 3300013102 Bacteria 45189
252 Ga0157371_10000653 3300013102 Bacteria 41097
253 Ga0157371_10008395 3300013102 Bacteria 8231
254 Ga0157371_10142559 3300013102 Bacteria 1706
255 Ga0157371_10952025 3300013102 Bacteria 653
256 Ga0157370_10071533 3300013104 Bacteria 3272
257 Ga0157370_10074138 3300013104 Bacteria 3210
258 Ga0157370_10137185 3300013104 Bacteria 2279
259 Ga0157370_10175877 3300013104 Bacteria 1989
260 Ga0157370_10418602 3300013104 Bacteria 1233
261 Ga0157369_10014110 3300013105 Bacteria 9032
262 Ga0157369_10110393 3300013105 Bacteria 2924
263 Ga0157369_10130486 3300013105 Bacteria 2664
264 Ga0157369_10228138 3300013105 Bacteria 1948
265 Ga0157369_10319522 3300013105 Bacteria 1614
266 Ga0157374_10181372 3300013296 Bacteria 2057
267 Ga0157374_10421317 3300013296 Bacteria 1334
268 Ga0157378_10002956 3300013297 Bacteria 15114
269 Ga0157378_10095500 3300013297 Bacteria 2708
270 Ga0157378_10326591 3300013297 Bacteria 1492
271 Ga0157378_11098939 3300013297 Bacteria 832
272 Ga0163162_10010721 3300013306 Bacteria 8916
273 Ga0163162_10019133 3300013306 Bacteria 6716
274 Ga0163162_10080041 3300013306 Bacteria 3334
275 Ga0163162_10137801 3300013306 Bacteria 2552
276 Ga0163162_10384487 3300013306 Bacteria 1537
277 Ga0163162_10992583 3300013306 Bacteria 949
278 Ga0157372_10002703 3300013307 Bacteria 19175
279 Ga0157372_10044644 3300013307 Bacteria 4912
280 Ga0157372_10173735 3300013307 Bacteria 2493
281 Ga0157372_10798190 3300013307 Bacteria 1097
282 Ga0157375_10208550 3300013308 Bacteria 2111
283 Ga0157375_12092728 3300013308 Bacteria 673
284 Ga0163163_10033774 3300014325 Bacteria 4950
285 Ga0163163_10669493 3300014325 Bacteria 1101
286 Ga0157380_10004465 3300014326 Bacteria 9691
287 Ga0157380_10074452 3300014326 Bacteria 2757
288 Ga0182008_10000945 3300014497 Bacteria 20228
289 Ga0182008_10007577 3300014497 Bacteria 5985
290 Ga0182008_10010620 3300014497 Bacteria 4925
291 Ga0182008_10017352 3300014497 Bacteria 3736
292 Ga0182008_10035642 3300014497 Bacteria 2491
293 Ga0182008_10049314 3300014497 Bacteria 2090
294 Ga0182008_10068610 3300014497 Bacteria 1744
295 Ga0182008_10083210 3300014497 Bacteria 1575
296 Ga0182008_10200988 3300014497 Bacteria 1014
297 Ga0157377_10103943 3300014745 Bacteria 1697
298 Ga0157377_10223688 3300014745 Bacteria 1206
299 Ga0157376_10070492 3300014969 Bacteria 2967
300 Ga0157376_10133055 3300014969 Bacteria 2222
301 Ga0182006_1002602 3300015261 Bacteria 9753
302 Ga0182006_1004208 3300015261 Bacteria 7135
303 Ga0182006_1005406 3300015261 Bacteria 6100
304 Ga0182006_1005584 3300015261 Bacteria 5969
305 Ga0182006_1009986 3300015261 Bacteria 4237
306 Ga0182006_1016613 3300015261 Bacteria 3137
307 Ga0182006_1047921 3300015261 Bacteria 1654
308 Ga0182007_10001903 3300015262 Bacteria 10870
309 Ga0182005_1011495 3300015265 Bacteria 2521
310 Ga0182005_1018174 3300015265 Bacteria 1943
311 Ga0182005_1023184 3300015265 Bacteria 1698
312 Ga0182005_1040805 3300015265 Bacteria 1262
313 Ga0163161_10016761 3300017792 Bacteria 5121
314 Ga0163161_10022207 3300017792 Bacteria 4466
315 Ga0163161_10022712 3300017792 Bacteria 4418
316 Ga0163161_10032103 3300017792 Bacteria 3747
317 Ga0163161_10150529 3300017792 Bacteria 1768
318 Ga0163161_10156922 3300017792 Bacteria 1733
319 Ga0163161_10280501 3300017792 Bacteria 1307
320 Ga0163161_10874550 3300017792 Bacteria 760
321 Ga0163161_11057385 3300017792 Bacteria 696
322 Ga0213876_10157097 3300021384 Bacteria 1210
323 Ga0209435_100696 3300025206 Bacteria 5783
324 Ga0209760_100155 3300025207 Bacteria 41538
325 Ga0209760_100167 3300025207 Bacteria 38282
326 Ga0209784_100007 3300025224 Bacteria 747715
327 Ga0209784_100151 3300025224 Bacteria 63336
328 Ga0209566_100062 3300025225 Bacteria 193033
329 Ga0209674_100132 3300025226 Bacteria 117820
330 Ga0209147_100009 3300025229 Bacteria 747409
331 Ga0209147_102009 3300025229 Bacteria 5874
332 Ga0209563_100018 3300025230 Bacteria 747850
333 Ga0209563_100863 3300025230 Bacteria 9009
334 Ga0207427_100005 3300025231 Bacteria 797999
335 Ga0207427_100006 3300025231 Bacteria 785415
336 Ga0209437_100013 3300025233 Bacteria 785457
337 Ga0209437_100220 3300025233 Bacteria 104235
338 Ga0209437_112664 3300025233 Bacteria 1226
339 Ga0209258_100365 3300025242 Bacteria 59822
340 Ga0209646_1000510 3300025246 Bacteria 17562
341 Ga0209026_1009226 3300025250 Bacteria 1960
342 Ga0209677_100385 3300025253 Bacteria 26947
343 Ga0209233_1000021 3300025261 Bacteria 798078
344 Ga0209233_1000022 3300025261 Bacteria 785415
345 Ga0209673_1024318 3300025273 Bacteria 2038
346 Ga0209676_1000015 3300025292 Bacteria 784458
347 Ga0209676_1000668 3300025292 Bacteria 48922
348 Ga0209676_1001175 3300025292 Bacteria 28332
349 Ga0209676_1001477 3300025292 Bacteria 21754
350 Ga0209676_1008947 3300025292 Bacteria 4395
351 Ga0209676_1027365 3300025292 Bacteria 1796
352 Ga0209025_1026868 3300025294 Bacteria 2873
353 Ga0209050_1000024 3300025298 Bacteria 533389
354 Ga0209050_1000128 3300025298 Bacteria 187432
355 Ga0209050_1001031 3300025298 Bacteria 34644
356 Ga0209050_1001704 3300025298 Bacteria 21968
357 Ga0209051_1000023 3300025303 Bacteria 437371
358 Ga0209051_1000041 3300025303 Bacteria 311155
359 Ga0209051_1000791 3300025303 Bacteria 33280
360 Ga0209051_1008475 3300025303 Bacteria 5434
361 Ga0209257_1000069 3300025304 Bacteria 339826
362 Ga0209257_1000078 3300025304 Bacteria 317483
363 Ga0209257_1022421 3300025304 Bacteria 2253
364 Ga0207656_10000006 3300025321 Bacteria 395044
365 Ga0207696_1000064 3300025711 Bacteria 238379
366 Ga0207696_1000094 3300025711 Bacteria 184065
367 Ga0207696_1000319 3300025711 Bacteria 51975
368 Ga0207696_1000324 3300025711 Bacteria 51146
369 Ga0207696_1000663 3300025711 Bacteria 24393
370 Ga0207696_1001938 3300025711 Bacteria 10525
371 Ga0207696_1004659 3300025711 Bacteria 5861
372 Ga0207696_1005001 3300025711 Bacteria 5587
373 Ga0207696_1009666 3300025711 Bacteria 3584
374 Ga0207696_1015377 3300025711 Bacteria 2597
375 Ga0207655_1000107 3300025728 Bacteria 178758
376 Ga0207655_1000473 3300025728 Bacteria 52002
377 Ga0207655_1000486 3300025728 Bacteria 51236
378 Ga0207655_1000598 3300025728 Bacteria 44045
379 Ga0207655_1001041 3300025728 Bacteria 27873
380 Ga0207655_1001446 3300025728 Bacteria 21992
381 Ga0207655_1001643 3300025728 Bacteria 19816
382 Ga0207655_1003651 3300025728 Bacteria 11358
383 Ga0207655_1004827 3300025728 Bacteria 9381
384 Ga0207655_1008357 3300025728 Bacteria 6586
385 Ga0207655_1009040 3300025728 Bacteria 6238
386 Ga0207655_1012139 3300025728 Bacteria 5062
387 Ga0207655_1013334 3300025728 Bacteria 4727
388 Ga0207655_1013627 3300025728 Bacteria 4654
389 Ga0207655_1017305 3300025728 Bacteria 3894
390 Ga0207655_1023381 3300025728 Bacteria 3067
391 Ga0207655_1024600 3300025728 Bacteria 2946
392 Ga0207655_1028115 3300025728 Bacteria 2659
393 Ga0207655_1133902 3300025728 Bacteria 804
394 Ga0207713_1000010 3300025735 Bacteria 528374
395 Ga0207713_1000813 3300025735 Bacteria 28855
396 Ga0207713_1001149 3300025735 Bacteria 22401
397 Ga0207713_1001206 3300025735 Bacteria 21649
398 Ga0207713_1001689 3300025735 Bacteria 17076
399 Ga0207713_1002240 3300025735 Bacteria 14314
400 Ga0207713_1002379 3300025735 Bacteria 13747
401 Ga0207713_1002491 3300025735 Bacteria 13380
402 Ga0207713_1003517 3300025735 Bacteria 10620
403 Ga0207713_1004875 3300025735 Bacteria 8593
404 Ga0207713_1006794 3300025735 Bacteria 6902
405 Ga0207713_1008805 3300025735 Bacteria 5753
406 Ga0207713_1012981 3300025735 Bacteria 4422
407 Ga0207713_1018085 3300025735 Bacteria 3501
408 Ga0207713_1020745 3300025735 Bacteria 3171
409 Ga0207713_1021581 3300025735 Bacteria 3083
410 Ga0207713_1023812 3300025735 Bacteria 2871
411 Ga0207713_1030730 3300025735 Bacteria 2388
412 Ga0207713_1052108 3300025735 Bacteria 1623
413 Ga0207713_1086635 3300025735 Bacteria 1112
414 Ga0207713_1154095 3300025735 Bacteria 739
415 Ga0207680_10106969 3300025903 Bacteria 1807
416 Ga0207645_10134567 3300025907 Bacteria 1610
417 Ga0207645_10378156 3300025907 Bacteria 950
418 Ga0207684_10018265 3300025910 Bacteria 6004
419 Ga0207654_10627483 3300025911 Bacteria 768
420 Ga0207707_10000503 3300025912 Bacteria 40256
421 Ga0207671_10000159 3300025914 Bacteria 105261
422 Ga0207671_10088107 3300025914 Bacteria 2335
423 Ga0207660_10003576 3300025917 Bacteria 10120
424 Ga0207662_10007661 3300025918 Bacteria 5884
425 Ga0207649_10000197 3300025920 Bacteria 50000
426 Ga0207652_10000427 3300025921 Bacteria 43779
427 Ga0207646_10907101 3300025922 Bacteria 781
428 Ga0207681_10000254 3300025923 Bacteria 40622
429 Ga0207681_10002634 3300025923 Bacteria 11382
430 Ga0207681_10032206 3300025923 Bacteria 3431
431 Ga0207650_10000591 3300025925 Bacteria 29057
432 Ga0207650_10000699 3300025925 Bacteria 26228
433 Ga0207650_10208045 3300025925 Bacteria 1570
434 Ga0207659_10829247 3300025926 Bacteria 795
435 Ga0207687_10037911 3300025927 Bacteria 3291
436 Ga0207687_10041419 3300025927 Bacteria 3162
437 Ga0207700_10440774 3300025928 Bacteria 1146
438 Ga0207664_10574669 3300025929 Bacteria 1012
439 Ga0207644_10007799 3300025931 Bacteria 6992
440 Ga0207690_10404787 3300025932 Bacteria 1089
441 Ga0207706_10000395 3300025933 Bacteria 47041
442 Ga0207706_10116210 3300025933 Bacteria 2353
443 Ga0207686_10001265 3300025934 Bacteria 14545
444 Ga0207686_10024581 3300025934 Bacteria 3493
445 Ga0207709_10000409 3300025935 Bacteria 41995
446 Ga0207709_10000506 3300025935 Bacteria 34436
447 Ga0207709_10018481 3300025935 Bacteria 3905
448 Ga0207709_10020151 3300025935 Bacteria 3759
449 Ga0207709_10039446 3300025935 Bacteria 2821
450 Ga0207709_10159126 3300025935 Bacteria 1573
451 Ga0207691_10109639 3300025940 Bacteria 2456
452 Ga0207679_10000027 3300025945 Bacteria 196811
453 Ga0207679_10079009 3300025945 Bacteria 2508
454 Ga0207667_10035321 3300025949 Bacteria 5363
455 Ga0207712_10003678 3300025961 Bacteria 9671
456 Ga0207712_10101490 3300025961 Bacteria 2140
457 Ga0207712_10133569 3300025961 Bacteria 1895
458 Ga0207712_10358477 3300025961 Bacteria 1214
459 Ga0207668_10059000 3300025972 Bacteria 2686
460 Ga0207640_10024300 3300025981 Bacteria 3654
461 Ga0207640_10150584 3300025981 Bacteria 1709
462 Ga0207658_10096814 3300025986 Bacteria 2302
463 Ga0207639_10000238 3300026041 Bacteria 41262
464 Ga0207708_10149403 3300026075 Bacteria 1838
465 Ga0207708_10443002 3300026075 Bacteria 1080
466 Ga0207702_10113495 3300026078 Bacteria 2413
467 Ga0207702_10499302 3300026078 Bacteria 1186
468 Ga0207648_10109146 3300026089 Bacteria 2429
469 Ga0207675_100018166 3300026118 Bacteria 6556
470 Ga0207683_10002811 3300026121 Bacteria 15204
471 Ga0209281_1000016 3300027111 Bacteria 588107
472 Ga0209281_1000019 3300027111 Bacteria 576164
473 Ga0209389_1000173 3300027296 Bacteria 51663
474 Ga0209371_1000127 3300027312 Bacteria 127069
475 Ga0209371_1000508 3300027312 Bacteria 37263
476 Ga0209969_1004274 3300027360 Bacteria 1999
477 Ga0209981_1001494 3300027378 Bacteria 2951
478 Ga0209996_1001151 3300027395 Bacteria 3171
479 Ga0209968_1002462 3300027526 Bacteria 2798
480 Ga0209999_1039969 3300027543 Bacteria 878
481 Ga0210002_1004006 3300027617 Bacteria 2185
482 Ga0209971_1000802 3300027682 Bacteria 8095
483 Ga0207428_10021576 3300027907 Bacteria 5451
484 Ga0207428_10132408 3300027907 Bacteria 1907
485 Ga0207428_10149323 3300027907 Bacteria 1780
486 Ga0207428_10708493 3300027907 Bacteria 720
487 Ga0268266_10002381 3300028379 Bacteria 20323
488 Ga0268266_10007991 3300028379 Bacteria 9456
489 Ga0268266_10150929 3300028379 Bacteria 2094
490 Ga0268266_10442886 3300028379 Bacteria 1234
491 Ga0268266_10470917 3300028379 Bacteria 1196
492 Ga0268265_11226928 3300028380 Bacteria 748
493 Ga0268264_10055953 3300028381 Bacteria 3297
494 Ga0268264_10592187 3300028381 Bacteria 1092
495 Ga0265337_1082475 3300028556 Bacteria 879
496 Ga0307515_10235144 3300028794 Bacteria 1615
497 Ga0265338_10003536 3300028800 Bacteria 21867
498 Ga0265338_10111205 3300028800 Bacteria 2206
499 Ga0265324_10044856 3300029957 Bacteria 1523
500 Ga0268256_1000104 3300030500 Bacteria 127069
501 Ga0268256_1000729 3300030500 Bacteria 24217
502 Ga0307511_10090751 3300030521 Bacteria 2073
503 Ga0307511_10095754 3300030521 Bacteria 1981
504 Ga0316177_1022266 3300030731 Bacteria 3053
505 Ga0314311_1104549 3300030733 Bacteria 3092
506 Ga0314311_1203784 3300030733 Bacteria 1410
507 Ga0316179_1035621 3300030734 Bacteria 2855
508 Ga0316178_1009978 3300030735 Bacteria 23983
509 Ga0316183_1125898 3300030742 Bacteria 4891
510 Ga0316183_1182093 3300030742 Bacteria 985
511 Ga0316181_1075824 3300030744 Bacteria 2435
512 Ga0265328_10025681 3300031239 Bacteria 2218
513 Ga0265339_10000314 3300031249 Bacteria 39563
514 Ga0265327_10000002 3300031251 Bacteria 856593
515 Ga0265316_10000034 3300031344 Bacteria 153181
516 Ga0265316_10012925 3300031344 Bacteria 7449
517 Ga0307513_10218447 3300031456 Bacteria 1730
518 Ga0307408_100000065 3300031548 Bacteria 122365
519 Ga0307408_100005505 3300031548 Bacteria 8462
520 Ga0307408_100027784 3300031548 Bacteria 3903
521 Ga0307408_100031541 3300031548 Bacteria 3690
522 Ga0307408_100278687 3300031548 Bacteria 1391
523 Ga0265314_10001242 3300031711 Bacteria 29082
524 Ga0265342_10004070 3300031712 Bacteria 11662
525 Ga0307516_10045162 3300031730 Bacteria 4353
526 Ga0307405_10000248 3300031731 Bacteria 19649
527 Ga0307405_10010653 3300031731 Bacteria 4779
528 Ga0307405_10364372 3300031731 Bacteria 1119
529 Ga0307413_10026423 3300031824 Bacteria 3198
530 Ga0307413_10047063 3300031824 Bacteria 2569
531 Ga0307413_10101601 3300031824 Bacteria 1901
532 Ga0307413_10159374 3300031824 Bacteria 1583
533 Ga0307410_10260956 3300031852 Bacteria 1351
534 Ga0307406_10029257 3300031901 Bacteria 3335
535 Ga0307406_10069943 3300031901 Bacteria 2296
536 Ga0307412_10005724 3300031911 Bacteria 6982
537 Ga0307412_10086386 3300031911 Bacteria 2182
538 Ga0307409_100006735 3300031995 Bacteria 6794
539 Ga0307409_100819463 3300031995 Bacteria 939
540 Ga0307416_100020743 3300032002 Bacteria 4698
541 Ga0307416_100146187 3300032002 Bacteria 2159
542 Ga0307414_10002231 3300032004 Bacteria 10107
543 Ga0307414_10003410 3300032004 Bacteria 8487
544 Ga0307414_10026746 3300032004 Bacteria 3718
545 Ga0307414_10031845 3300032004 Bacteria 3464
546 Ga0307414_10058843 3300032004 Bacteria 2709
547 Ga0307414_10092598 3300032004 Bacteria 2250
548 Ga0307414_10184760 3300032004 Bacteria 1680
549 Ga0307414_10484367 3300032004 Bacteria 1091
550 Ga0307411_10014695 3300032005 Bacteria 4366
551 Ga0307411_10020432 3300032005 Bacteria 3851
552 Ga0307411_10709535 3300032005 Bacteria 877
553 Ga0307411_10801110 3300032005 Bacteria 829
554 Ga0316585_10093708 3300032137 Bacteria 983
555 Ga0307510_10042102 3300033180 Bacteria 4980
556 Ga0307510_10092052 3300033180 Bacteria 2871
557 Ga0316574_0048478 3300035398 Bacteria 2638
558 Ga0316582_0421340 3300036647 Bacteria 920
559 Ga0316584_0082547 3300036712 Bacteria 2407
560 Ga0316584_0113056 3300036712 Bacteria 2031
561 Ga0316584_0188557 3300036712 Bacteria 1525
562 Ga0395899_0019170 3300037312 Bacteria 5199
563 Ga0395900_0552586 3300037418 Bacteria 1096
564 Ga0395898_0135589 3300037466 Bacteria 2357
565 Ga0395905_0000491 3300037471 Bacteria 54464
566 Ga0395901_0029014 3300038443 Bacteria 5692
567 Ga0395901_0170037 3300038443 Bacteria 2287
568 Ga0237819_00998 3300038705 Bacteria 8547
569 Ga0242420_002825 3300038996 Bacteria 2514
570 Ga0400483_106483 3300039062 Bacteria 1551
571 Ga0400483_209934 3300039062 Bacteria 1344
572 Ga0400483_250930 3300039062 Bacteria 3433
573 Ga0400483_253958 3300039062 Bacteria 2338
574 Ga0439436_0001473 3300041404 Bacteria 6839
575 Ga0439436_0045754 3300041404 Bacteria 1244
576 Ga0439436_0064175 3300041404 Bacteria 1026
577 Ga0439438_000617 3300041405 Bacteria 16040
578 Ga0439438_001268 3300041405 Bacteria 11155
579 Ga0439438_002009 3300041405 Bacteria 8867
580 Ga0439438_002825 3300041405 Bacteria 7247
581 Ga0439438_004498 3300041405 Bacteria 5328
582 Ga0439438_007373 3300041405 Bacteria 3762
583 Ga0439438_011972 3300041405 Bacteria 2678
584 Ga0439438_024952 3300041405 Bacteria 1633
585 Ga0439438_085014 3300041405 Bacteria 774
586 Ga0439439_0052072 3300041406 Bacteria 1075
587 Ga0439439_0091458 3300041406 Bacteria 831
588 Ga0439447_000387 3300041407 Bacteria 16130
589 Ga0439447_001621 3300041407 Bacteria 8253
590 Ga0439447_001724 3300041407 Bacteria 8009
591 Ga0439447_002361 3300041407 Bacteria 6893
592 Ga0439447_006833 3300041407 Bacteria 3666
593 Ga0439447_009466 3300041407 Bacteria 2949
594 Ga0439466_0000606 3300041411 Bacteria 13473
595 Ga0439466_0000656 3300041411 Bacteria 13021
596 Ga0439466_0000867 3300041411 Bacteria 11539
597 Ga0439466_0001014 3300041411 Bacteria 10800
598 Ga0439466_0002320 3300041411 Bacteria 7471
599 Ga0439466_0004366 3300041411 Bacteria 5451
600 Ga0439466_0011868 3300041411 Bacteria 3217
601 Ga0439466_0019094 3300041411 Bacteria 2455
602 Ga0439466_0127384 3300041411 Bacteria 784
603 Ga0439465_0000332 3300041413 Bacteria 13448
604 Ga0439465_0006516 3300041413 Bacteria 3709
605 Ga0451791_0383327 3300041451 Bacteria 1110
606 Ga0451802_2109608 3300041460 Bacteria 711
607 Ga0451843_0270651 3300041509 Bacteria 814
608 Ga0451855_0945503 3300041511 Bacteria 726
609 Ga0451853_1135199 3300041512 Bacteria 1471
610 Ga0439431_0037668 3300041997 Bacteria 1222
611 Ga0439437_000206 3300042000 Bacteria 5194
612 Ga0439443_025366 3300042003 Bacteria 955
613 Ga0439432_000309 3300042006 Bacteria 17590
614 Ga0439432_000568 3300042006 Bacteria 13848
615 Ga0439432_000616 3300042006 Bacteria 13400
616 Ga0439432_000707 3300042006 Bacteria 12500
617 Ga0439432_000848 3300042006 Bacteria 11460
618 Ga0439432_001393 3300042006 Bacteria 9128
619 Ga0439432_007023 3300042006 Bacteria 4005
620 Ga0439432_012123 3300042006 Bacteria 2957
621 Ga0439449_0000008 3300042007 Bacteria 62060
622 Ga0439449_0012488 3300042007 Bacteria 3193
623 Ga0439449_0031262 3300042007 Bacteria 1985
624 Ga0439451_014541 3300042009 Bacteria 1588
625 Ga0439452_000363 3300042010 Bacteria 27675
626 Ga0439452_000649 3300042010 Bacteria 17350
627 Ga0439452_001118 3300042010 Bacteria 11794
628 Ga0439452_001197 3300042010 Bacteria 11143
629 Ga0439452_001682 3300042010 Bacteria 8686
630 Ga0439452_001733 3300042010 Bacteria 8547
631 Ga0439452_002177 3300042010 Bacteria 7409
632 Ga0439452_007350 3300042010 Bacteria 3378
633 Ga0439452_011156 3300042010 Bacteria 2590
634 Ga0439456_000065 3300042013 Bacteria 37775
635 Ga0439456_003150 3300042013 Bacteria 3336
636 Ga0439462_0027738 3300042015 Bacteria 1495
637 Ga0439462_0124685 3300042015 Bacteria 717
638 Ga0439463_000583 3300042016 Bacteria 10213
639 Ga0439463_000621 3300042016 Bacteria 9811
640 Ga0439463_000657 3300042016 Bacteria 9599
641 Ga0439463_003410 3300042016 Bacteria 4025
642 Ga0439463_081351 3300042016 Bacteria 833
643 Ga0439463_101722 3300042016 Bacteria 741
644 Ga0450911_000330 3300042115 Bacteria 16996
645 Ga0450911_000833 3300042115 Bacteria 8426
646 Ga0450911_001999 3300042115 Bacteria 4236
647 Ga0450919_000202 3300042121 Bacteria 6568
648 Ga0450922_000708 3300042124 Bacteria 3452
649 Ga0450922_004640 3300042124 Bacteria 1264
650 Ga0450923_015924 3300042125 Bacteria 1411
651 Ga0450890_012117 3300042127 Bacteria 1118
652 Ga0450898_051653 3300042134 Bacteria 795
653 Ga0450900_003588 3300042136 Bacteria 1731
654 Ga0450902_000962 3300042137 Bacteria 3773
655 Ga0450903_001195 3300042138 Bacteria 4885
656 Ga0450903_020645 3300042138 Bacteria 1018
657 Ga0450904_000169 3300042139 Bacteria 14258
658 Ga0450904_001465 3300042139 Bacteria 3292
659 Ga0450905_000181 3300042142 Bacteria 7011
660 Ga0450905_000890 3300042142 Bacteria 3737
661 Ga0450905_027399 3300042142 Bacteria 865
662 Ga0450905_028833 3300042142 Bacteria 848
663 Ga0450906_001647 3300042145 Bacteria 4901
664 Ga0450906_002103 3300042145 Bacteria 4354
665 Ga0450906_004720 3300042145 Bacteria 2839
666 Ga0450906_009504 3300042145 Bacteria 1853
667 Ga0450907_000429 3300042146 Bacteria 12562
668 Ga0450907_000808 3300042146 Bacteria 7766
669 Ga0450907_001432 3300042146 Bacteria 5162
670 Ga0450910_001051 3300042147 Bacteria 3383
671 Ga0450910_036561 3300042147 Bacteria 785
672 Ga0439446_0001073 3300042156 Bacteria 6023
673 Ga0439446_0002987 3300042156 Bacteria 4139
674 Ga0439446_0009059 3300042156 Bacteria 2656
675 Ga0450908_006477 3300042184 Bacteria 2222
676 Ga0450908_008529 3300042184 Bacteria 1920
677 Ga0450908_028276 3300042184 Bacteria 976
678 Ga0450909_000342 3300042185 Bacteria 5904
679 Ga0450909_001538 3300042185 Bacteria 3216
680 Ga0450909_001968 3300042185 Bacteria 2898
681 Ga0439434_0002178 3300042435 Bacteria 5682
682 Ga0439464_0008172 3300042439 Bacteria 2743
683 Ga0439464_0081592 3300042439 Bacteria 966
684 Ga0439460_0003807 3300042461 Bacteria 3650
685 Ga0439460_0015112 3300042461 Bacteria 2038
686 Ga0439460_0016606 3300042461 Bacteria 1962
687 Ga0450916_000500 3300042530 Bacteria 3433
688 Ga0450918_001692 3300042531 Bacteria 4313
689 Ga0450901_001121 3300042533 Bacteria 3105
690 Ga0450901_005971 3300042533 Bacteria 1249
691 Ga0451577_0014833 3300042876 Bacteria 7259
692 Ga0451577_0064690 3300042876 Bacteria 3261
693 Ga0466972_0003199 3300044658 Bacteria 8130
694 Ga0453683_0002204 3300044673 Bacteria 15477
695 Ga0466965_0007064 3300044683 Bacteria 5139
696 Ga0453684_0014003 3300044712 Bacteria 12916
697 Ga0453684_0028387 3300044712 Bacteria 7985
698 Ga0453684_0335459 3300044712 Bacteria 1709
699 Ga0466968_0001139 3300044735 Bacteria 9424
700 Ga0466960_0000599 3300044901 Bacteria 12475
701 Ga0451576_0027010 3300045051 Bacteria 6169
702 Ga0466967_0615374 3300045976 Bacteria 1073
703 Ga0495617_004709 3300046452 Bacteria 4934
704 Ga0495617_008604 3300046452 Bacteria 3513
705 Ga0495617_030346 3300046452 Bacteria 1817
706 Ga0495617_031696 3300046452 Bacteria 1774
707 Ga0495617_052121 3300046452 Bacteria 1359
708 Ga0495617_084411 3300046452 Bacteria 1039
709 Ga0495627_000236 3300046453 Bacteria 58365
710 Ga0495627_000913 3300046453 Bacteria 20472
711 Ga0495627_005326 3300046453 Bacteria 5207
712 Ga0495627_025161 3300046453 Bacteria 1932
713 Ga0495627_046126 3300046453 Bacteria 1325
714 Ga0495603_0018220 3300046455 Bacteria 4247
715 Ga0495603_0140379 3300046455 Bacteria 1405
716 Ga0495590_0005795 3300046457 Bacteria 4854
717 Ga0495591_000262 3300046458 Bacteria 50259
718 Ga0495591_000781 3300046458 Bacteria 22669
719 Ga0495591_000908 3300046458 Bacteria 20592
720 Ga0495591_001525 3300046458 Bacteria 14236
721 Ga0495591_004619 3300046458 Bacteria 6636
722 Ga0495591_004914 3300046458 Bacteria 6349
723 Ga0495591_006798 3300046458 Bacteria 4978
724 Ga0495591_009769 3300046458 Bacteria 3779
725 Ga0495591_010141 3300046458 Bacteria 3676
726 Ga0495591_011780 3300046458 Bacteria 3288
727 Ga0495591_012435 3300046458 Bacteria 3170
728 Ga0495591_026194 3300046458 Bacteria 1816
729 Ga0495591_030140 3300046458 Bacteria 1640
730 Ga0495638_0005263 3300046460 Bacteria 9665
731 Ga0495638_0005629 3300046460 Bacteria 9236
732 Ga0495638_0017411 3300046460 Bacteria 4790
733 Ga0495638_0187744 3300046460 Bacteria 1174
734 Ga0495638_0221720 3300046460 Bacteria 1056
735 Ga0495641_0097397 3300046461 Bacteria 1313
736 Ga0495653_0003057 3300046463 Bacteria 13431
737 Ga0495653_0012722 3300046463 Bacteria 6872
738 Ga0495653_0020087 3300046463 Bacteria 5415
739 Ga0495653_0136662 3300046463 Bacteria 1728
740 Ga0495650_0000573 3300046471 Bacteria 51370
741 Ga0495650_0001753 3300046471 Bacteria 19743
742 Ga0495650_0005282 3300046471 Bacteria 8455
743 Ga0495650_0015102 3300046471 Bacteria 3978
744 Ga0495650_0027049 3300046471 Bacteria 2657
745 Ga0495605_0000278 3300046474 Bacteria 57625
746 Ga0495605_0000305 3300046474 Bacteria 52699
747 Ga0495605_0000761 3300046474 Bacteria 23558
748 Ga0495605_0000930 3300046474 Bacteria 20030
749 Ga0495605_0001833 3300046474 Bacteria 13584
750 Ga0495605_0002875 3300046474 Bacteria 10463
751 Ga0495605_0007779 3300046474 Bacteria 6072
752 Ga0495605_0013475 3300046474 Bacteria 4501
753 Ga0495605_0017237 3300046474 Bacteria 3892
754 Ga0495605_0017789 3300046474 Bacteria 3821
755 Ga0495605_0021303 3300046474 Bacteria 3435
756 Ga0495605_0021395 3300046474 Bacteria 3425
757 Ga0495605_0138870 3300046474 Bacteria 1091
758 Ga0495605_0190236 3300046474 Bacteria 898
759 Ga0495639_0005256 3300046475 Bacteria 5565
760 Ga0495639_0179689 3300046475 Bacteria 1030
761 Ga0495584_0001213 3300046491 Bacteria 15750
762 Ga0495584_0019638 3300046491 Bacteria 3432
763 Ga0495584_0020294 3300046491 Bacteria 3377
764 Ga0495584_0021544 3300046491 Bacteria 3273
765 Ga0495584_0027557 3300046491 Bacteria 2878
766 Ga0495584_0036567 3300046491 Bacteria 2480
767 Ga0495584_0066669 3300046491 Bacteria 1810
768 Ga0495584_0365422 3300046491 Bacteria 733
769 Ga0495585_0002376 3300046492 Bacteria 13510
770 Ga0495585_0004219 3300046492 Bacteria 9378
771 Ga0495585_0005216 3300046492 Bacteria 8236
772 Ga0495585_0034066 3300046492 Bacteria 2879
773 Ga0495585_0176203 3300046492 Bacteria 1101
774 Ga0495585_0206879 3300046492 Bacteria 996
775 Ga0495594_0000635 3300046499 Bacteria 18070
776 Ga0495594_0257316 3300046499 Bacteria 994
777 Ga0495596_0000396 3300046500 Bacteria 27748
778 Ga0495596_0012585 3300046500 Bacteria 3617
779 Ga0495596_0014380 3300046500 Bacteria 3335
780 Ga0495607_0001037 3300046501 Bacteria 25477
781 Ga0495607_0001512 3300046501 Bacteria 20500
782 Ga0495607_0001663 3300046501 Bacteria 19235
783 Ga0495607_0001685 3300046501 Bacteria 19046
784 Ga0495607_0001747 3300046501 Bacteria 18602
785 Ga0495607_0001805 3300046501 Bacteria 18284
786 Ga0495607_0002473 3300046501 Bacteria 14994
787 Ga0495607_0010360 3300046501 Bacteria 6272
788 Ga0495607_0026373 3300046501 Bacteria 3605
789 Ga0495607_0029172 3300046501 Bacteria 3397
790 Ga0495607_0038891 3300046501 Bacteria 2846
791 Ga0495607_0082023 3300046501 Bacteria 1770
792 Ga0495607_0167961 3300046501 Bacteria 1110
793 Ga0495607_0242365 3300046501 Bacteria 871
794 Ga0495583_0000504 3300046506 Bacteria 56210
795 Ga0495583_0002263 3300046506 Bacteria 16900
796 Ga0495583_0002447 3300046506 Bacteria 15847
797 Ga0495583_0003618 3300046506 Bacteria 11573
798 Ga0495583_0003780 3300046506 Bacteria 11247
799 Ga0495583_0011770 3300046506 Bacteria 5004
800 Ga0495583_0014046 3300046506 Bacteria 4432
801 Ga0495583_0204531 3300046506 Bacteria 801
802 Ga0495606_0000631 3300046507 Bacteria 55444
803 Ga0495606_0000785 3300046507 Bacteria 48544
804 Ga0495606_0000946 3300046507 Bacteria 42763
805 Ga0495606_0003478 3300046507 Bacteria 16690
806 Ga0495606_0006363 3300046507 Bacteria 10918
807 Ga0495606_0015783 3300046507 Bacteria 5797
808 Ga0495606_0019840 3300046507 Bacteria 4978
809 Ga0495606_0030451 3300046507 Bacteria 3770
810 Ga0495606_0044825 3300046507 Bacteria 2938
811 Ga0495606_0299671 3300046507 Bacteria 871
812 Ga0495610_0013365 3300046512 Bacteria 4883
813 Ga0495610_0015618 3300046512 Bacteria 4403
814 Ga0495610_0015842 3300046512 Bacteria 4364
815 Ga0495610_0015851 3300046512 Bacteria 4363
816 Ga0495610_0022943 3300046512 Bacteria 3400
817 Ga0495610_0032286 3300046512 Bacteria 2721
818 Ga0495610_0038404 3300046512 Bacteria 2430
819 Ga0495610_0078851 3300046512 Bacteria 1517
820 Ga0495610_0186919 3300046512 Bacteria 858
821 Ga0495616_0001961 3300046513 Bacteria 13850
822 Ga0495616_0011668 3300046513 Bacteria 5024
823 Ga0495616_0015137 3300046513 Bacteria 4292
824 Ga0495616_0020625 3300046513 Bacteria 3580
825 Ga0495616_0022288 3300046513 Bacteria 3420
826 Ga0495616_0024304 3300046513 Bacteria 3250
827 Ga0495620_0000033 3300046515 Bacteria 118157
828 Ga0495620_0000153 3300046515 Bacteria 56187
829 Ga0495620_0001468 3300046515 Bacteria 14106
830 Ga0495620_0004357 3300046515 Bacteria 7994
831 Ga0495620_0006660 3300046515 Bacteria 6329
832 Ga0495620_0015151 3300046515 Bacteria 3899
833 Ga0495620_0016016 3300046515 Bacteria 3772
834 Ga0495620_0019810 3300046515 Bacteria 3297
835 Ga0495620_0038017 3300046515 Bacteria 2138
836 Ga0495630_0785259 3300046517 Bacteria 727
837 Ga0495631_0000885 3300046518 Bacteria 18745
838 Ga0495631_0001408 3300046518 Bacteria 14633
839 Ga0495631_0007235 3300046518 Bacteria 5658
840 Ga0495631_0014592 3300046518 Bacteria 3785
841 Ga0495631_0049403 3300046518 Bacteria 1841
842 Ga0495631_0053109 3300046518 Bacteria 1769
843 Ga0495631_0103891 3300046518 Bacteria 1222
844 Ga0495632_0000399 3300046519 Bacteria 40815
845 Ga0495632_0001643 3300046519 Bacteria 18317
846 Ga0495632_0006003 3300046519 Bacteria 7904
847 Ga0495632_0006716 3300046519 Bacteria 7356
848 Ga0495632_0007833 3300046519 Bacteria 6648
849 Ga0495632_0013417 3300046519 Bacteria 4676
850 Ga0495632_0021904 3300046519 Bacteria 3434
851 Ga0495632_0041459 3300046519 Bacteria 2313
852 Ga0495632_0044979 3300046519 Bacteria 2201
853 Ga0495632_0047289 3300046519 Bacteria 2134
854 Ga0495632_0083550 3300046519 Bacteria 1520
855 Ga0495632_0094969 3300046519 Bacteria 1409
856 Ga0495632_0140922 3300046519 Bacteria 1118
857 Ga0495632_0200603 3300046519 Bacteria 908
858 Ga0495637_0001305 3300046520 Bacteria 14964
859 Ga0495637_0001314 3300046520 Bacteria 14925
860 Ga0495637_0001512 3300046520 Bacteria 13623
861 Ga0495637_0002210 3300046520 Bacteria 10867
862 Ga0495637_0002604 3300046520 Bacteria 9906
863 Ga0495637_0005444 3300046520 Bacteria 6485
864 Ga0495637_0006986 3300046520 Bacteria 5624
865 Ga0495637_0014387 3300046520 Bacteria 3732
866 Ga0495637_0015260 3300046520 Bacteria 3605
867 Ga0495637_0025214 3300046520 Bacteria 2680
868 Ga0495637_0104107 3300046520 Bacteria 1106
869 Ga0495637_0113249 3300046520 Bacteria 1049
870 Ga0495637_0150094 3300046520 Bacteria 879
871 Ga0495643_0000652 3300046522 Bacteria 41014
872 Ga0495643_0001069 3300046522 Bacteria 27292
873 Ga0495643_0001356 3300046522 Bacteria 22936
874 Ga0495643_0014147 3300046522 Bacteria 4755
875 Ga0495643_0021682 3300046522 Bacteria 3680
876 Ga0495643_0024610 3300046522 Bacteria 3413
877 Ga0495643_0028517 3300046522 Bacteria 3128
878 Ga0495643_0032702 3300046522 Bacteria 2884
879 Ga0495643_0041178 3300046522 Bacteria 2519
880 Ga0495643_0178973 3300046522 Bacteria 1031
881 Ga0495644_0004207 3300046523 Bacteria 5655
882 Ga0495644_0010967 3300046523 Bacteria 3493
883 Ga0495644_0017583 3300046523 Bacteria 2733
884 Ga0495644_0066053 3300046523 Bacteria 1359
885 Ga0495648_0002072 3300046524 Bacteria 18977
886 Ga0495648_0002328 3300046524 Bacteria 17684
887 Ga0495648_0002836 3300046524 Bacteria 15600
888 Ga0495648_0007939 3300046524 Bacteria 8417
889 Ga0495648_0009716 3300046524 Bacteria 7410
890 Ga0495648_0022409 3300046524 Bacteria 4348
891 Ga0495648_0024962 3300046524 Bacteria 4057
892 Ga0495648_0029232 3300046524 Bacteria 3660
893 Ga0495648_0048529 3300046524 Bacteria 2612
894 Ga0495648_0076376 3300046524 Bacteria 1924
895 Ga0495648_0148052 3300046524 Bacteria 1227
896 Ga0495648_0285304 3300046524 Bacteria 780
897 Ga0495648_0318895 3300046524 Bacteria 721
898 Ga0495648_0327548 3300046524 Bacteria 707
899 Ga0495666_0081156 3300046526 Bacteria 1534
900 Ga0495666_0183558 3300046526 Bacteria 965
901 Ga0495642_0000848 3300046528 Bacteria 14563
902 Ga0495642_0000910 3300046528 Bacteria 13902
903 Ga0495642_0116356 3300046528 Bacteria 1145
904 Ga0495654_0001290 3300046530 Bacteria 17577
905 Ga0495654_0001456 3300046530 Bacteria 16218
906 Ga0495654_0001804 3300046530 Bacteria 14270
907 Ga0495654_0003274 3300046530 Bacteria 9985
908 Ga0495654_0007193 3300046530 Bacteria 6243
909 Ga0495654_0009829 3300046530 Bacteria 5227
910 Ga0495654_0010691 3300046530 Bacteria 4985
911 Ga0495654_0013743 3300046530 Bacteria 4326
912 Ga0495654_0020358 3300046530 Bacteria 3457
913 Ga0495654_0055833 3300046530 Bacteria 1910
914 Ga0495654_0080252 3300046530 Bacteria 1531
915 Ga0495654_0120863 3300046530 Bacteria 1185
916 Ga0495654_0169578 3300046530 Bacteria 952
917 Ga0495586_0130925 3300046535 Bacteria 1404
918 Ga0495587_0097271 3300046536 Bacteria 1697
919 Ga0495587_0330039 3300046536 Bacteria 852
920 Ga0495609_0000166 3300046538 Bacteria 69064
921 Ga0495609_0000226 3300046538 Bacteria 55095
922 Ga0495609_0000662 3300046538 Bacteria 26739
923 Ga0495609_0007009 3300046538 Bacteria 5680
924 Ga0495609_0009026 3300046538 Bacteria 4847
925 Ga0495609_0030491 3300046538 Bacteria 2455
926 Ga0495597_0000235 3300046542 Bacteria 49912
927 Ga0495597_0007076 3300046542 Bacteria 5742
928 Ga0495597_0011979 3300046542 Bacteria 4191
929 Ga0495597_0013412 3300046542 Bacteria 3927
930 Ga0495597_0013498 3300046542 Bacteria 3908
931 Ga0495597_0017680 3300046542 Bacteria 3350
932 Ga0495597_0084303 3300046542 Bacteria 1355
933 Ga0495597_0084602 3300046542 Bacteria 1352
934 Ga0495597_0088977 3300046542 Bacteria 1312
935 Ga0495645_0057046 3300046543 Bacteria 2835
936 Ga0495622_0002766 3300046557 Bacteria 8383
937 Ga0495622_0005690 3300046557 Bacteria 5781
938 Ga0495622_0009436 3300046557 Bacteria 4513
939 Ga0495622_0015866 3300046557 Bacteria 3502
940 Ga0495633_0000291 3300046558 Bacteria 57655
941 Ga0495633_0005673 3300046558 Bacteria 7556
942 Ga0495668_0004076 3300046616 Bacteria 10597
943 Ga0495668_0016707 3300046616 Bacteria 4267
944 Ga0495668_0025934 3300046616 Bacteria 3328
945 Ga0495668_0068055 3300046616 Bacteria 1958
946 Ga0495611_0003776 3300046648 Bacteria 6613
947 Ga0495611_0007464 3300046648 Bacteria 4640
948 Ga0495611_0008058 3300046648 Bacteria 4474
949 Ga0495611_0035548 3300046648 Bacteria 2207
950 Ga0495625_0000499 3300046660 Bacteria 58578
951 Ga0495625_0008349 3300046660 Bacteria 8841
952 Ga0495625_0012667 3300046660 Bacteria 6823
953 Ga0495625_0015249 3300046660 Bacteria 6095
954 Ga0495625_0026052 3300046660 Bacteria 4422
955 Ga0495625_0159973 3300046660 Bacteria 1509
956 Ga0495625_0222080 3300046660 Bacteria 1237
957 Ga0495625_0405662 3300046660 Bacteria 850
958 Ga0495659_0010788 3300046664 Bacteria 2940
959 Ga0495659_0049064 3300046664 Bacteria 1532
960 Ga0495659_0137337 3300046664 Bacteria 973
961 Ga0495661_0000277 3300046665 Bacteria 58877
962 Ga0495661_0000294 3300046665 Bacteria 56661
963 Ga0495661_0000320 3300046665 Bacteria 53065
964 Ga0495661_0000340 3300046665 Bacteria 51118
965 Ga0495661_0002305 3300046665 Bacteria 14735
966 Ga0495661_0004957 3300046665 Bacteria 9520
967 Ga0495661_0033419 3300046665 Bacteria 3245
968 Ga0495661_0038949 3300046665 Bacteria 2956
969 Ga0495661_0059757 3300046665 Bacteria 2267
970 Ga0495661_0090771 3300046665 Bacteria 1738
971 Ga0495661_0119099 3300046665 Bacteria 1460
972 Ga0495661_0160464 3300046665 Bacteria 1207
973 Ga0495588_0005211 3300046674 Bacteria 5779
974 Ga0495588_0216760 3300046674 Bacteria 1010
975 Ga0495657_0150817 3300046675 Bacteria 1443
976 Ga0495646_0044249 3300046680 Bacteria 2722
977 Ga0495669_0012437 3300046684 Bacteria 3622
978 Ga0495670_0003231 3300046691 Bacteria 8026
979 Ga0495670_0013360 3300046691 Bacteria 4039
980 Ga0495670_0014883 3300046691 Bacteria 3829
981 Ga0495670_0018802 3300046691 Bacteria 3403
982 Ga0495670_0023445 3300046691 Bacteria 3045
983 Ga0495670_0034114 3300046691 Bacteria 2534
984 Ga0495670_0055652 3300046691 Bacteria 1984
985 Ga0495670_0093948 3300046691 Bacteria 1537
986 Ga0495670_0374124 3300046691 Bacteria 768
987 Ga0495671_0001637 3300046692 Bacteria 14695
988 Ga0495671_0002699 3300046692 Bacteria 11116
989 Ga0495671_0005887 3300046692 Bacteria 7135
990 Ga0495671_0006472 3300046692 Bacteria 6767
991 Ga0495671_0007885 3300046692 Bacteria 6020
992 Ga0495671_0008224 3300046692 Bacteria 5884
993 Ga0495671_0010054 3300046692 Bacteria 5262
994 Ga0495671_0016386 3300046692 Bacteria 3957
995 Ga0495671_0073221 3300046692 Bacteria 1681
996 Ga0495671_0084871 3300046692 Bacteria 1551
997 Ga0495671_0248196 3300046692 Bacteria 859
998 Ga0495671_0344760 3300046692 Bacteria 714
999 Ga0495649_0001345 3300046694 Bacteria 18678
1000 Ga0495649_0001639 3300046694 Bacteria 16650
1001 Ga0495649_0009394 3300046694 Bacteria 5819
1002 Ga0495649_0012897 3300046694 Bacteria 4840
1003 Ga0495649_0022895 3300046694 Bacteria 3493
1004 Ga0495649_0067197 3300046694 Bacteria 1923
1005 Ga0495649_0205130 3300046694 Bacteria 1023
1006 Ga0495649_0261306 3300046694 Bacteria 887
1007 Ga0495649_0268344 3300046694 Bacteria 873
1008 Ga0495649_0368916 3300046694 Bacteria 723
1009 Ga0495589_0000676 3300046794 Bacteria 22317
1010 Ga0495589_0000890 3300046794 Bacteria 18550
1011 Ga0495589_0004594 3300046794 Bacteria 7339
1012 Ga0495589_0007330 3300046794 Bacteria 5778
1013 Ga0495589_0012518 3300046794 Bacteria 4391
1014 Ga0495589_0015583 3300046794 Bacteria 3908
1015 Ga0495660_0000629 3300046810 Bacteria 27548
1016 Ga0495660_0004190 3300046810 Bacteria 8763
1017 Ga0495660_0016508 3300046810 Bacteria 4257
1018 Ga0495660_0016932 3300046810 Bacteria 4197
1019 Ga0495660_0021737 3300046810 Bacteria 3669
1020 Ga0495660_0025598 3300046810 Bacteria 3349
1021 Ga0495660_0030405 3300046810 Bacteria 3042
1022 Ga0495660_0053803 3300046810 Bacteria 2183
1023 Ga0495660_0077179 3300046810 Bacteria 1753
1024 Ga0495660_0086846 3300046810 Bacteria 1632
1025 Ga0495660_0102114 3300046810 Bacteria 1474
1026 Ga0495660_0262593 3300046810 Bacteria 796
1027 Ga0495581_0092206 3300047315 Bacteria 1758
1028 Ga0495604_0019118 3300047317 Bacteria 5485
1029 Ga0495604_0229376 3300047317 Bacteria 1274
1030 Ga0495636_0001234 3300047318 Bacteria 9664
1031 Ga0495636_0002965 3300047318 Bacteria 6564
1032 Ga0495636_0055488 3300047318 Bacteria 1666
1033 Ga0495672_0001307 3300047320 Bacteria 24818
1034 Ga0495672_0003882 3300047320 Bacteria 12563
1035 Ga0495672_0004186 3300047320 Bacteria 11955
1036 Ga0495672_0005455 3300047320 Bacteria 10090
1037 Ga0495672_0008854 3300047320 Bacteria 7362
1038 Ga0495672_0011861 3300047320 Bacteria 6119
1039 Ga0495672_0014942 3300047320 Bacteria 5290
1040 Ga0495672_0025572 3300047320 Bacteria 3774
1041 Ga0495672_0027754 3300047320 Bacteria 3592
1042 Ga0495672_0070870 3300047320 Bacteria 1973
1043 Ga0495672_0170025 3300047320 Bacteria 1112
1044 Ga0495672_0240381 3300047320 Bacteria 884
1045 Ga0495672_0243557 3300047320 Bacteria 876
1046 Ga0495676_0000125 3300047321 Bacteria 58716
1047 Ga0495676_0009441 3300047321 Bacteria 8884
1048 Ga0495680_0041730 3300047322 Bacteria 3646
1049 Ga0495680_0077699 3300047322 Bacteria 2513
1050 Ga0495680_0081777 3300047322 Bacteria 2437
1051 Ga0495680_0209887 3300047322 Bacteria 1394
1052 Ga0495683_0000016 3300047323 Bacteria 191396
1053 Ga0495683_0000196 3300047323 Bacteria 57478
1054 Ga0495683_0001587 3300047323 Bacteria 14649
1055 Ga0495683_0004413 3300047323 Bacteria 7991
1056 Ga0495683_0018946 3300047323 Bacteria 3553
1057 Ga0495683_0022738 3300047323 Bacteria 3223
1058 Ga0495683_0023068 3300047323 Bacteria 3199
1059 Ga0495683_0047037 3300047323 Bacteria 2165
1060 Ga0495683_0056848 3300047323 Bacteria 1946
1061 Ga0495683_0107453 3300047323 Bacteria 1335
1062 Ga0495687_003652 3300047443 Bacteria 10959
1063 Ga0495687_052182 3300047443 Bacteria 1730
1064 Ga0495675_0031107 3300047444 Bacteria 3407
1065 Ga0495675_0049674 3300047444 Bacteria 2665
1066 Ga0495679_000414 3300047446 Bacteria 31798
1067 Ga0495679_000987 3300047446 Bacteria 17554
1068 Ga0495679_060081 3300047446 Bacteria 1116
1069 Ga0495679_077259 3300047446 Bacteria 950
1070 Ga0495685_035925 3300047447 Bacteria 1702
1071 Ga0495673_0000789 3300047469 Bacteria 29813
1072 Ga0495673_0002977 3300047469 Bacteria 11414
1073 Ga0495673_0005027 3300047469 Bacteria 8105
1074 Ga0495673_0005263 3300047469 Bacteria 7856
1075 Ga0495673_0008041 3300047469 Bacteria 5976
1076 Ga0495673_0008501 3300047469 Bacteria 5767
1077 Ga0495673_0013086 3300047469 Bacteria 4370
1078 Ga0495673_0016854 3300047469 Bacteria 3723
1079 Ga0495673_0017011 3300047469 Bacteria 3703
1080 Ga0495673_0017395 3300047469 Bacteria 3654
1081 Ga0495673_0025420 3300047469 Bacteria 2843
1082 Ga0495673_0033006 3300047469 Bacteria 2406
1083 Ga0495673_0072323 3300047469 Bacteria 1447
1084 Ga0495681_0007194 3300047470 Bacteria 7155
1085 Ga0495681_0008255 3300047470 Bacteria 6542
1086 Ga0495681_0010039 3300047470 Bacteria 5765
1087 Ga0495681_0015552 3300047470 Bacteria 4299
1088 Ga0495681_0015578 3300047470 Bacteria 4294
1089 Ga0495681_0017201 3300047470 Bacteria 4025
1090 Ga0495681_0018803 3300047470 Bacteria 3792
1091 Ga0495681_0024719 3300047470 Bacteria 3155
1092 Ga0495681_0032145 3300047470 Bacteria 2645
1093 Ga0495681_0048651 3300047470 Bacteria 2008
1094 Ga0495681_0074187 3300047470 Bacteria 1534
1095 Ga0495681_0246626 3300047470 Bacteria 707
1096 Ga0495686_0008947 3300047472 Bacteria 7274
1097 Ga0495686_0095385 3300047472 Bacteria 1801
1098 Ga0495686_0232776 3300047472 Bacteria 1042
1099 Ga0495686_0479454 3300047472 Bacteria 657
1100 Ga0495593_0010538 3300047673 Bacteria 5334
1101 Ga0495626_0000283 3300048091 Bacteria 55345
1102 Ga0495626_0001088 3300048091 Bacteria 23117
1103 Ga0495626_0005076 3300048091 Bacteria 7851
1104 Ga0495626_0007445 3300048091 Bacteria 6095
1105 Ga0495626_0011628 3300048091 Bacteria 4647
1106 Ga0495626_0012471 3300048091 Bacteria 4454
1107 Ga0495626_0023281 3300048091 Bacteria 3051
1108 Ga0496100_0010333 3300048903 Bacteria 5281
1109 Ga0496100_0241234 3300048903 Bacteria 1334
1110 Ga0496101_0002590 3300048904 Bacteria 11115
1111 Ga0496102_0003362 3300048905 Bacteria 13560
1112 Ga0496102_0031641 3300048905 Bacteria 4746
1113 Ga0496103_0013057 3300048906 Bacteria 4924
1114 Ga0496104_0001033 3300048907 Bacteria 23825
1115 Ga0496105_0009317 3300048908 Bacteria 7674
1116 Ga0496106_0002003 3300048909 Bacteria 15326
1117 Ga0496107_0000417 3300048910 Bacteria 23129
1118 Ga0496108_0000838 3300048911 Bacteria 23921
1119 Ga0496108_0206130 3300048911 Bacteria 1706
1120 Ga0496109_0027653 3300048912 Bacteria 5067
1121 Ga0496109_0418011 3300048912 Bacteria 1267
1122 Ga0496110_0016191 3300048913 Bacteria 6219
1123 Ga0496110_0031362 3300048913 Bacteria 4585
1124 Ga0496110_0059052 3300048913 Bacteria 3379
1125 Ga0496110_0940561 3300048913 Bacteria 771
1126 Ga0496112_0005006 3300048915 Bacteria 11370
1127 Ga0496112_0158190 3300048915 Bacteria 2232
1128 Ga0496113_0218720 3300048916 Bacteria 1518
1129 Ga0496115_0074257 3300048918 Bacteria 2761
1130 Ga0496116_0000401 3300048919 Bacteria 62910
1131 Ga0496116_0006698 3300048919 Bacteria 10383
1132 Ga0496116_0019798 3300048919 Bacteria 5139
1133 Ga0496116_0024160 3300048919 Bacteria 4501
1134 Ga0496116_0026706 3300048919 Bacteria 4213
1135 Ga0496116_0026885 3300048919 Bacteria 4198
1136 Ga0496116_0068396 3300048919 Bacteria 2263
1137 Ga0496116_0152944 3300048919 Bacteria 1278
1138 Ga0496117_0001058 3300048920 Bacteria 41996
1139 Ga0496117_0001828 3300048920 Bacteria 28862
1140 Ga0496117_0003652 3300048920 Bacteria 17701
1141 Ga0496117_0003735 3300048920 Bacteria 17441
1142 Ga0496117_0040319 3300048920 Bacteria 3435
1143 Ga0496117_0143023 3300048920 Bacteria 1429
1144 Ga0496118_0002905 3300048921 Bacteria 22275
1145 Ga0496118_0014136 3300048921 Bacteria 7486
1146 Ga0496118_0114437 3300048921 Bacteria 1778
1147 Ga0496118_0178862 3300048921 Bacteria 1284
1148 Ga0496118_0289465 3300048921 Bacteria 906
1149 Ga0496118_0319819 3300048921 Bacteria 842
1150 Ga0496119_0000071 3300048922 Bacteria 153652
1151 Ga0496119_0005387 3300048922 Bacteria 12296
1152 Ga0496119_0053549 3300048922 Bacteria 2464
1153 Ga0496119_0139561 3300048922 Bacteria 1310
1154 Ga0496120_0031128 3300048923 Bacteria 3235
1155 Ga0496120_0035886 3300048923 Bacteria 2957
1156 Ga0496121_0000688 3300048924 Bacteria 63017
1157 Ga0496121_0003876 3300048924 Bacteria 20792
1158 Ga0496121_0009864 3300048924 Bacteria 10893
1159 Ga0496121_0039800 3300048924 Bacteria 4134
1160 Ga0496121_0063333 3300048924 Bacteria 3022
1161 Ga0496121_0097178 3300048924 Bacteria 2283
1162 Ga0496121_0157702 3300048924 Bacteria 1663
1163 Ga0496121_0157967 3300048924 Bacteria 1662
1164 Ga0496121_0428974 3300048924 Bacteria 858
1165 Ga0496122_0003272 3300048925 Bacteria 21480
1166 Ga0496122_0003639 3300048925 Bacteria 20044
1167 Ga0496122_0004379 3300048925 Bacteria 17595
1168 Ga0496122_0006923 3300048925 Bacteria 12808
1169 Ga0496122_0012184 3300048925 Bacteria 8600
1170 Ga0496122_0018451 3300048925 Bacteria 6443
1171 Ga0496122_0022852 3300048925 Bacteria 5538
1172 Ga0496122_0025045 3300048925 Bacteria 5199
1173 Ga0496122_0038774 3300048925 Bacteria 3809
1174 Ga0496122_0094780 3300048925 Bacteria 2019
1175 Ga0496122_0128813 3300048925 Bacteria 1613
1176 Ga0496123_0002596 3300048926 Bacteria 21964
1177 Ga0496123_0002904 3300048926 Bacteria 20054
1178 Ga0496123_0005284 3300048926 Bacteria 13086
1179 Ga0496123_0017557 3300048926 Bacteria 5750
1180 Ga0496123_0024566 3300048926 Bacteria 4577
1181 Ga0496123_0032402 3300048926 Bacteria 3784
1182 Ga0496123_0067519 3300048926 Bacteria 2258
1183 Ga0496124_0000730 3300048927 Bacteria 53903
1184 Ga0496124_0003010 3300048927 Bacteria 21078
1185 Ga0496124_0006846 3300048927 Bacteria 12276
1186 Ga0496124_0008721 3300048927 Bacteria 10535
1187 Ga0496124_0015433 3300048927 Bacteria 7321
1188 Ga0496124_0020806 3300048927 Bacteria 6056
1189 Ga0496124_0047918 3300048927 Bacteria 3653
1190 Ga0496124_0049585 3300048927 Bacteria 3580
1191 Ga0496124_0102599 3300048927 Bacteria 2314
1192 Ga0496124_0173379 3300048927 Bacteria 1667
1193 Ga0496124_0180524 3300048927 Bacteria 1625
1194 Ga0496124_0222271 3300048927 Bacteria 1419
1195 Ga0496125_0001109 3300048928 Bacteria 41385
1196 Ga0496125_0004182 3300048928 Bacteria 16827
1197 Ga0496125_0006175 3300048928 Bacteria 13054
1198 Ga0496125_0033200 3300048928 Bacteria 4572
1199 Ga0496125_0105661 3300048928 Bacteria 2057
1200 Ga0496125_0154350 3300048928 Bacteria 1571
1201 Ga0496126_0003262 3300048929 Bacteria 20722
1202 Ga0496126_0030106 3300048929 Bacteria 5148
1203 Ga0501305_000831 3300049161 Bacteria 2752
1204 Ga0495678_000268 3300049459 Bacteria 57604
1205 Ga0495678_001974 3300049459 Bacteria 14782
1206 Ga0495678_002020 3300049459 Bacteria 14560
1207 Ga0495678_009204 3300049459 Bacteria 4912
1208 Ga0495678_009987 3300049459 Bacteria 4644
1209 Ga0495678_014234 3300049459 Bacteria 3705
1210 Ga0495678_020969 3300049459 Bacteria 2884
1211 Ga0495678_060988 3300049459 Bacteria 1417
1212 Ga0495682_0000198 3300049460 Bacteria 48570
1213 Ga0495682_0000911 3300049460 Bacteria 18044
1214 Ga0495682_0007131 3300049460 Bacteria 4466
1215 Ga0495682_0032965 3300049460 Bacteria 1912
1216 Ga0495682_0073475 3300049460 Bacteria 1230
1217 Ga0495682_0101949 3300049460 Bacteria 1029
1218 Ga0495682_0115553 3300049460 Bacteria 961
1219 Ga0501032_0066359 3300049569 Bacteria 2411
1220 Ga0501032_0208229 3300049569 Bacteria 1275
1221 Ga0501034_0000165 3300049571 Bacteria 123084
1222 Ga0501034_0000189 3300049571 Bacteria 115780
1223 Ga0501034_0006635 3300049571 Bacteria 12424
1224 Ga0501034_0021097 3300049571 Bacteria 6648
1225 Ga0501034_0540356 3300049571 Bacteria 1075
1226 Ga0501034_0705782 3300049571 Bacteria 907
1227 Ga0501034_0804734 3300049571 Bacteria 832
1228 Ga0501036_0128013 3300049572 Bacteria 2144
1229 Ga0501036_0428197 3300049572 Bacteria 1103
1230 Ga0501037_0014232 3300049573 Bacteria 5860
1231 Ga0501037_0069863 3300049573 Bacteria 2556
1232 Ga0501038_0013534 3300049574 Bacteria 7436
1233 Ga0501038_0192436 3300049574 Bacteria 1641
1234 Ga0501039_0046612 3300049575 Bacteria 3349
1235 Ga0501042_0220645 3300049578 Bacteria 1367
1236 Ga0501043_0292224 3300049579 Bacteria 1247
1237 Ga0501046_0673721 3300049580 Bacteria 730
1238 Ga0501047_0116761 3300049581 Bacteria 2550
1239 Ga0501048_0823502 3300049582 Bacteria 667
1240 Ga0501067_0334157 3300049583 Bacteria 844
1241 Ga0501068_0049189 3300049584 Bacteria 2546
1242 Ga0501070_0112228 3300049586 Bacteria 2253
1243 Ga0501075_0409854 3300049591 Bacteria 1033
1244 Ga0501076_0290970 3300049592 Bacteria 1338
1245 Ga0501217_083295 3300049661 Bacteria 888
1246 Ga0501222_005912 3300049662 Bacteria 1645
1247 Ga0501243_011811 3300049675 Bacteria 1374
1248 Ga0501225_0000850 3300049705 Bacteria 9490
1249 Ga0501079_0490799 3300049741 Bacteria 965
1250 Ga0501080_0637771 3300049742 Bacteria 943
1251 Ga0501035_0157432 3300049822 Bacteria 1968
1252 Ga0501044_0031771 3300049823 Bacteria 5553
1253 Ga0501226_000033 3300049853 Bacteria 72088
1254 nmdc:mga00v17_23725_c1 3300050491 Bacteria 3551
1255 nmdc:mga05p37_195737_c1 3300050507 Bacteria 2451
1256 nmdc:mga05p37_255093_c1 3300050507 Bacteria 2102
1257 nmdc:mga05p37_8187_c1 3300050507 Bacteria 12359
1258 nmdc:mga05p37_825915_c1 3300050507 Bacteria 1010
1259 nmdc:mga08y16_808602_c1 3300050511 Bacteria 930
1260 nmdc:mga0n895_1535471_c1 3300050512 Bacteria 631
1261 nmdc:mga0n895_556156_c1 3300050512 Bacteria 1153
1262 nmdc:mga0n895_920717_c1 3300050512 Bacteria 859
1263 nmdc:mga0a205_43892_c1 3300050515 Bacteria 4309
1264 nmdc:mga0a205_84496_c1 3300050515 Bacteria 3066
1265 Ga0500618_005581 3300053125 Bacteria 3802
1266 Ga0500618_008051 3300053125 Bacteria 2968
1267 Ga0500659_0004185 3300053135 Bacteria 8292
1268 Ga0500573_0019307 3300053140 Bacteria 3900
1269 Ga0500586_113397 3300053145 Bacteria 947
1270 Ga0500622_0220547 3300053156 Bacteria 850
1271 Ga0587068_018319 3300059641 Bacteria 1127
1272 Ga0501082_0194341 3300060353 Bacteria 1765

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042134 Ga0450898_051653 Ga0450898_051653_12_506 164
2 3300049574 Ga0501038_0192436 Ga0501038_0192436_885_1514 179
3 iso_pu_bacteria 2840878972 2840879430 185
4 iso_pu_bacteria 2854681122 2854682991 185
5 iso_pu_bacteria 3000405567 3000409074 185
6 3300005328 Ga0070676_10191837 Ga0070676_101918371 186
7 3300053156 Ga0500622_0220547 Ga0500622_0220547_137_706 186
8 iso_pu_bacteria 2643221598 2644000244 186
9 iso_pu_bacteria 2643221614 2644084994 186
10 iso_pu_bacteria 2643221661 2644342546 186
11 iso_pu_bacteria 2643221666 2644365846 186
12 3300005289 Ga0065704_10127787 Ga0065704_101277872 187
13 3300005293 Ga0065715_10130202 Ga0065715_101302021 187
14 3300005295 Ga0065707_10139083 Ga0065707_101390832 187
15 3300005330 Ga0070690_100006182 Ga0070690_1000061822 187
16 3300005330 Ga0070690_100037381 Ga0070690_1000373814 187
17 3300005336 Ga0070680_100000103 Ga0070680_10000010313 187
18 3300005336 Ga0070680_101014380 Ga0070680_1010143801 187
19 3300005343 Ga0070687_100000398 Ga0070687_10000039812 187
20 3300005345 Ga0070692_10106283 Ga0070692_101062831 187
21 3300005353 Ga0070669_100051734 Ga0070669_1000517341 187
22 3300005441 Ga0070700_100033884 Ga0070700_1000338841 187
23 3300005441 Ga0070700_100164939 Ga0070700_1001649392 187
24 3300005444 Ga0070694_100045868 Ga0070694_1000458682 187
25 3300005444 Ga0070694_100220890 Ga0070694_1002208902 187
26 3300005444 Ga0070694_100654360 Ga0070694_1006543601 187
27 3300005445 Ga0070708_100020142 Ga0070708_1000201422 187
28 3300005458 Ga0070681_10000095 Ga0070681_1000009531 187
29 3300005467 Ga0070706_100007674 Ga0070706_1000076748 187
30 3300005467 Ga0070706_101271572 Ga0070706_1012715721 187
31 3300005471 Ga0070698_100917037 Ga0070698_1009170372 187
32 3300005518 Ga0070699_100194051 Ga0070699_1001940512 187
33 3300005530 Ga0070679_100003442 Ga0070679_10000344212 187
34 3300005544 Ga0070686_100003705 Ga0070686_1000037058 187
35 3300005546 Ga0070696_100017260 Ga0070696_1000172605 187
36 3300005546 Ga0070696_100466966 Ga0070696_1004669661 187
37 3300005547 Ga0070693_100115702 Ga0070693_1001157023 187
38 3300005563 Ga0068855_100653631 Ga0068855_1006536312 187
39 3300005614 Ga0068856_100117130 Ga0068856_1001171302 187
40 3300005719 Ga0068861_100045557 Ga0068861_1000455572 187
41 3300005719 Ga0068861_100553868 Ga0068861_1005538681 187
42 3300005844 Ga0068862_100998573 Ga0068862_1009985732 187
43 3300006852 Ga0075433_10046867 Ga0075433_100468672 187
44 3300006852 Ga0075433_10049658 Ga0075433_100496584 187
45 3300006852 Ga0075433_10065482 Ga0075433_100654824 187
46 3300006871 Ga0075434_100269967 Ga0075434_1002699672 187
47 3300007076 Ga0075435_100754186 Ga0075435_1007541862 187
48 3300009094 Ga0111539_10176388 Ga0111539_101763883 187
49 3300009094 Ga0111539_10209881 Ga0111539_102098811 187
50 3300009098 Ga0105245_11431088 Ga0105245_114310881 187
51 3300009147 Ga0114129_10001731 Ga0114129_1000173112 187
52 3300009147 Ga0114129_10015302 Ga0114129_100153025 187
53 3300009147 Ga0114129_10274496 Ga0114129_102744961 187
54 3300009147 Ga0114129_10994089 Ga0114129_109940891 187
55 3300009174 Ga0105241_11434475 Ga0105241_114344751 187
56 3300009176 Ga0105242_10579230 Ga0105242_105792302 187
57 3300009545 Ga0105237_10077502 Ga0105237_100775022 187
58 3300009553 Ga0105249_10020568 Ga0105249_100205686 187
59 3300009553 Ga0105249_10030494 Ga0105249_100304942 187
60 3300009553 Ga0105249_10046060 Ga0105249_100460602 187
61 3300010375 Ga0105239_10520790 Ga0105239_105207901 187
62 3300013102 Ga0157371_10142559 Ga0157371_101425592 187
63 3300013297 Ga0157378_10095500 Ga0157378_100955001 187
64 3300013297 Ga0157378_11098939 Ga0157378_110989392 187
65 3300013306 Ga0163162_10080041 Ga0163162_100800412 187
66 3300013306 Ga0163162_10137801 Ga0163162_101378012 187
67 3300013306 Ga0163162_10992583 Ga0163162_109925832 187
68 3300013308 Ga0157375_10208550 Ga0157375_102085502 187
69 3300014326 Ga0157380_10004465 Ga0157380_100044659 187
70 3300014326 Ga0157380_10074452 Ga0157380_100744521 187
71 3300014745 Ga0157377_10223688 Ga0157377_102236882 187
72 3300017792 Ga0163161_10150529 Ga0163161_101505292 187
73 3300025910 Ga0207684_10018265 Ga0207684_100182654 187
74 3300025912 Ga0207707_10000503 Ga0207707_100005038 187
75 3300025914 Ga0207671_10088107 Ga0207671_100881071 187
76 3300025917 Ga0207660_10003576 Ga0207660_100035761 187
77 3300025918 Ga0207662_10007661 Ga0207662_100076614 187
78 3300025921 Ga0207652_10000427 Ga0207652_1000042712 187
79 3300025961 Ga0207712_10003678 Ga0207712_100036789 187
80 3300025961 Ga0207712_10101490 Ga0207712_101014902 187
81 3300025961 Ga0207712_10133569 Ga0207712_101335693 187
82 3300025981 Ga0207640_10150584 Ga0207640_101505843 187
83 3300026075 Ga0207708_10149403 Ga0207708_101494033 187
84 3300026075 Ga0207708_10443002 Ga0207708_104430022 187
85 3300026078 Ga0207702_10113495 Ga0207702_101134952 187
86 3300026089 Ga0207648_10109146 Ga0207648_101091462 187
87 3300026118 Ga0207675_100018166 Ga0207675_1000181668 187
88 3300027907 Ga0207428_10132408 Ga0207428_101324082 187
89 3300028380 Ga0268265_11226928 Ga0268265_112269281 187
90 3300028381 Ga0268264_10055953 Ga0268264_100559533 187
91 3300038996 Ga0242420_002825 Ga0242420_002825_664_1230 187
92 3300042015 Ga0439462_0124685 Ga0439462_0124685_126_692 187
93 3300044658 Ga0466972_0003199 Ga0466972_0003199_1091_1654 187
94 3300044683 Ga0466965_0007064 Ga0466965_0007064_562_1125 187
95 3300044735 Ga0466968_0001139 Ga0466968_0001139_8450_9013 187
96 3300044901 Ga0466960_0000599 Ga0466960_0000599_3465_4028 187
97 3300048912 Ga0496109_0418011 Ga0496109_0418011_387_953 187
98 3300049582 Ga0501048_0823502 Ga0501048_0823502_76_642 187
99 3300050507 nmdc:mga05p37_195737_c1 nmdc:mga05p37_195737_c1_913_1479 187
100 3300050507 nmdc:mga05p37_8187_c1 nmdc:mga05p37_8187_c1_3108_3674 187
101 3300050507 nmdc:mga05p37_825915_c1 nmdc:mga05p37_825915_c1_41_607 187
102 3300050511 nmdc:mga08y16_808602_c1 nmdc:mga08y16_808602_c1_307_873 187
103 3300050512 nmdc:mga0n895_1535471_c1 nmdc:mga0n895_1535471_c1_28_594 187
104 3300050512 nmdc:mga0n895_556156_c1 nmdc:mga0n895_556156_c1_54_620 187
105 3300050512 nmdc:mga0n895_920717_c1 nmdc:mga0n895_920717_c1_261_827 187
106 3300050515 nmdc:mga0a205_43892_c1 nmdc:mga0a205_43892_c1_3469_4035 187
107 3300050515 nmdc:mga0a205_84496_c1 nmdc:mga0a205_84496_c1_1856_2422 187
108 3300005468 Ga0070707_101031528 Ga0070707_1010315282 188
109 3300009147 Ga0114129_10111506 Ga0114129_101115063 188
110 3300025922 Ga0207646_10907101 Ga0207646_109071011 188
111 3300044673 Ga0453683_0002204 Ga0453683_0002204_5351_5926 188
112 3300049583 Ga0501067_0334157 Ga0501067_0334157_54_620 188
113 3300049584 Ga0501068_0049189 Ga0501068_0049189_785_1357 188
114 iso_pu_bacteria 2545555834 2545676099 188
115 iso_pu_bacteria 2571042143 2571533613 188
116 iso_pu_bacteria 2571042365 2572254916 188
117 iso_pu_bacteria 2576861424 2578334577 188
118 iso_pu_bacteria 2579778775 2580935517 188
119 iso_pu_bacteria 2585428059 2587743931 188
120 iso_pu_bacteria 2600255286 2601636870 188
121 iso_pu_bacteria 2619619294 2621272604 188
122 iso_pu_bacteria 2643221676 2644423999 188
123 iso_pu_bacteria 2643221731 2644718620 188
124 iso_pu_bacteria 2643221732 2644723459 188
125 iso_pu_bacteria 2728368933 2728529784 188
126 iso_pu_bacteria 2738541299 2738840656 188
127 iso_pu_bacteria 2818991459 2819676000 188
128 iso_pu_bacteria 2818991465 2819712088 188
129 iso_pu_bacteria 2829745981 2829749903 188
130 iso_pu_bacteria 2842882022 2842888069 188
131 iso_pu_bacteria 2857453340 2857460190 188
132 iso_pu_bacteria 2861691609 2861692696 188
133 iso_pu_bacteria 2881636855 2881639547 188
134 iso_pu_bacteria 2904524088 2904530318 188
135 iso_pu_bacteria 2904755435 2904758207 188
136 iso_pu_bacteria 2919143609 2919149547 188
137 iso_pu_bacteria 2919425241 2919432304 188
138 iso_pu_bacteria 2919517244 2919523163 188
139 iso_pu_bacteria 2919720352 2919726267 188
140 iso_pu_bacteria 2923516293 2923519582 188
141 iso_pu_bacteria 2928093941 2928099821 188
142 iso_pu_bacteria 2929004312 2929010010 188
143 iso_pu_bacteria 2960319331 2960323568 188
144 iso_pu_bacteria 2960375949 2960379275 188
145 iso_pu_bacteria 2971403814 2971406948 188
146 iso_pu_bacteria 2971410472 2971412878 188
147 iso_pu_bacteria 2971511577 2971513885 188
148 iso_pu_bacteria 2980176882 2980179606 188
149 iso_pu_bacteria 3003665799 3003666552 188
150 iso_pu_bacteria 641522639 641645530 188
151 iso_pu_bacteria 643348564 643603204 188
152 iso_pu_bacteria 8021622325 8021625400 188
153 iso_pu_bacteria 8021626552 8021628452 188
154 iso_pu_bacteria 8021648035 8021649291 188
155 iso_pu_bacteria 8022893055 8022896374 188
156 iso_pu_bacteria 8022914991 8022918003 188
157 iso_pu_bacteria 8054465665 8054468562 188
158 iso_pu_bacteria 8056533031 8056534102 188
159 3300005335 Ga0070666_10040384 Ga0070666_100403842 189
160 3300005355 Ga0070671_100009700 Ga0070671_1000097002 189
161 3300005367 Ga0070667_100045943 Ga0070667_1000459433 189
162 3300005456 Ga0070678_100002659 Ga0070678_10000265911 189
163 3300005459 Ga0068867_100023979 Ga0068867_1000239792 189
164 3300005543 Ga0070672_100019742 Ga0070672_1000197425 189
165 3300005548 Ga0070665_100010924 Ga0070665_1000109249 189
166 3300005617 Ga0068859_101252319 Ga0068859_1012523191 189
167 3300006051 Ga0075364_10436045 Ga0075364_104360452 189
168 3300006931 Ga0097620_101252767 Ga0097620_1012527671 189
169 3300009177 Ga0105248_10323209 Ga0105248_103232092 189
170 3300013296 Ga0157374_10421317 Ga0157374_104213172 189
171 3300013297 Ga0157378_10326591 Ga0157378_103265912 189
172 3300014969 Ga0157376_10070492 Ga0157376_100704923 189
173 3300025229 Ga0209147_102009 Ga0209147_1020096 189
174 3300025273 Ga0209673_1024318 Ga0209673_10243182 189
175 3300025294 Ga0209025_1026868 Ga0209025_10268684 189
176 3300025711 Ga0207696_1001938 Ga0207696_10019388 189
177 3300025728 Ga0207655_1003651 Ga0207655_10036514 189
178 3300025735 Ga0207713_1001689 Ga0207713_100168911 189
179 3300025903 Ga0207680_10106969 Ga0207680_101069692 189
180 3300025907 Ga0207645_10378156 Ga0207645_103781562 189
181 3300025925 Ga0207650_10208045 Ga0207650_102080452 189
182 3300025926 Ga0207659_10829247 Ga0207659_108292471 189
183 3300025927 Ga0207687_10041419 Ga0207687_100414193 189
184 3300025931 Ga0207644_10007799 Ga0207644_100077992 189
185 3300025934 Ga0207686_10024581 Ga0207686_100245812 189
186 3300025935 Ga0207709_10020151 Ga0207709_100201513 189
187 3300025940 Ga0207691_10109639 Ga0207691_101096393 189
188 3300025961 Ga0207712_10358477 Ga0207712_103584772 189
189 3300025972 Ga0207668_10059000 Ga0207668_100590002 189
190 3300025986 Ga0207658_10096814 Ga0207658_100968142 189
191 3300026121 Ga0207683_10002811 Ga0207683_100028115 189
192 3300028379 Ga0268266_10007991 Ga0268266_100079914 189
193 3300031548 Ga0307408_100027784 Ga0307408_1000277844 189
194 3300036712 Ga0316584_0188557 Ga0316584_0188557_669_1250 189
195 3300037312 Ga0395899_0019170 Ga0395899_0019170_1166_1735 189
196 3300037418 Ga0395900_0552586 Ga0395900_0552586_347_916 189
197 3300037466 Ga0395898_0135589 Ga0395898_0135589_1042_1611 189
198 3300037471 Ga0395905_0000491 Ga0395905_0000491_4123_4692 189
199 3300038443 Ga0395901_0029014 Ga0395901_0029014_3551_4120 189
200 3300038443 Ga0395901_0170037 Ga0395901_0170037_1315_1884 189
201 3300039062 Ga0400483_106483 Ga0400483_106483_871_1452 189
202 3300039062 Ga0400483_209934 Ga0400483_209934_287_868 189
203 3300039062 Ga0400483_250930 Ga0400483_250930_639_1220 189
204 3300039062 Ga0400483_253958 Ga0400483_253958_1485_2066 189
205 3300045976 Ga0466967_0615374 Ga0466967_0615374_489_1061 189
206 3300048903 Ga0496100_0241234 Ga0496100_0241234_641_1210 189
207 3300048911 Ga0496108_0206130 Ga0496108_0206130_261_830 189
208 3300048915 Ga0496112_0158190 Ga0496112_0158190_549_1118 189
209 3300049571 Ga0501034_0000189 Ga0501034_0000189_113191_113850 189
210 3300049571 Ga0501034_0006635 Ga0501034_0006635_9565_10134 189
211 3300049572 Ga0501036_0428197 Ga0501036_0428197_462_1055 189
212 3300009098 Ga0105245_10091058 Ga0105245_100910583 190
213 3300025250 Ga0209026_1009226 Ga0209026_10092263 190
214 3300025927 Ga0207687_10037911 Ga0207687_100379111 190
215 3300032137 Ga0316585_10093708 Ga0316585_100937081 190
216 3300035398 Ga0316574_0048478 Ga0316574_0048478_569_1141 190
217 3300036647 Ga0316582_0421340 Ga0316582_0421340_301_873 190
218 3300036712 Ga0316584_0082547 Ga0316584_0082547_1782_2354 190
219 3300048928 Ga0496125_0154350 Ga0496125_0154350_719_1309 190
220 3300050507 nmdc:mga05p37_255093_c1 nmdc:mga05p37_255093_c1_106_678 190
221 iso_pu_bacteria 2643221695 2644530644 190
222 3300003203 JGI25406J46586_10039583 JGI25406J46586_100395832 191
223 3300005615 Ga0070702_100327653 Ga0070702_1003276532 191
224 3300005937 Ga0081455_10039238 Ga0081455_100392385 191
225 3300005985 Ga0081539_10000103 Ga0081539_10000103138 191
226 3300009094 Ga0111539_10103471 Ga0111539_101034712 191
227 3300010159 Ga0099796_10034611 Ga0099796_100346111 191
228 3300013296 Ga0157374_10181372 Ga0157374_101813722 191
229 3300014325 Ga0163163_10033774 Ga0163163_100337745 191
230 3300021384 Ga0213876_10157097 Ga0213876_101570971 191
231 3300025928 Ga0207700_10440774 Ga0207700_104407742 191
232 3300026078 Ga0207702_10499302 Ga0207702_104993022 191
233 3300028556 Ga0265337_1082475 Ga0265337_10824751 191
234 3300028800 Ga0265338_10111205 Ga0265338_101112051 191
235 3300031344 Ga0265316_10000034 Ga0265316_1000003422 191
236 3300031852 Ga0307410_10260956 Ga0307410_102609562 191
237 3300041512 Ga0451853_1135199 Ga0451853_1135199_476_1051 191
238 3300042145 Ga0450906_009504 Ga0450906_009504_48_623 191
239 3300042876 Ga0451577_0064690 Ga0451577_0064690_210_785 191
240 3300045051 Ga0451576_0027010 Ga0451576_0027010_3435_4010 191
241 3300046461 Ga0495641_0097397 Ga0495641_0097397_120_695 191
242 2162886007 SwRhRL2b_contig_3690329 SwRhRL2b_0859.00006160 192
243 3300003316 rootH1_10000959 rootH1_100009595 192
244 3300003320 rootH2_10342474 rootH2_103424742 192
245 3300003322 rootL2_10014887 rootL2_1001488720 192
246 3300003323 rootH1_10248111 rootH1_102481113 192
247 3300003578 Ga0006562J51391_1001260 Ga0006562J51391_10012606 192
248 3300003751 Ga0055538_1000784 Ga0055538_10007849 192
249 3300003790 Ga0055528_1009121 Ga0055528_10091213 192
250 3300003794 Ga0055531_10011026 Ga0055531_100110265 192
251 3300005289 Ga0065704_10072990 Ga0065704_100729907 192
252 3300005328 Ga0070676_10051532 Ga0070676_100515322 192
253 3300005331 Ga0070670_100012900 Ga0070670_1000129005 192
254 3300005335 Ga0070666_10087543 Ga0070666_100875432 192
255 3300005337 Ga0070682_100563835 Ga0070682_1005638351 192
256 3300005347 Ga0070668_100622722 Ga0070668_1006227221 192
257 3300005354 Ga0070675_100751324 Ga0070675_1007513242 192
258 3300005355 Ga0070671_100136458 Ga0070671_1001364582 192
259 3300005548 Ga0070665_100349065 Ga0070665_1003490651 192
260 3300005563 Ga0068855_100157658 Ga0068855_1001576583 192
261 3300005578 Ga0068854_100206146 Ga0068854_1002061462 192
262 3300006028 Ga0070717_10295176 Ga0070717_102951761 192
263 3300006195 Ga0075366_10139516 Ga0075366_101395162 192
264 3300009092 Ga0105250_10164639 Ga0105250_101646392 192
265 3300009098 Ga0105245_10030861 Ga0105245_100308613 192
266 3300009101 Ga0105247_10005167 Ga0105247_100051677 192
267 3300009148 Ga0105243_10000593 Ga0105243_1000059334 192
268 3300009176 Ga0105242_10011203 Ga0105242_100112033 192
269 3300009553 Ga0105249_10179897 Ga0105249_101798972 192
270 3300011119 Ga0105246_10169351 Ga0105246_101693512 192
271 3300013105 Ga0157369_10130486 Ga0157369_101304863 192
272 3300013297 Ga0157378_10002956 Ga0157378_1000295611 192
273 3300013307 Ga0157372_10173735 Ga0157372_101737353 192
274 3300014325 Ga0163163_10669493 Ga0163163_106694932 192
275 3300014745 Ga0157377_10103943 Ga0157377_101039432 192
276 3300014969 Ga0157376_10133055 Ga0157376_101330552 192
277 3300017792 Ga0163161_10874550 Ga0163161_108745501 192
278 3300025224 Ga0209784_100151 Ga0209784_1001519 192
279 3300025304 Ga0209257_1000078 Ga0209257_1000078250 192
280 3300025907 Ga0207645_10134567 Ga0207645_101345672 192
281 3300025949 Ga0207667_10035321 Ga0207667_100353213 192
282 3300028379 Ga0268266_10442886 Ga0268266_104428862 192
283 3300028381 Ga0268264_10592187 Ga0268264_105921872 192
284 3300028794 Ga0307515_10235144 Ga0307515_102351442 192
285 3300028800 Ga0265338_10003536 Ga0265338_100035367 192
286 3300029957 Ga0265324_10044856 Ga0265324_100448561 192
287 3300030731 Ga0316177_1022266 Ga0316177_10222662 192
288 3300030733 Ga0314311_1203784 Ga0314311_12037842 192
289 3300031239 Ga0265328_10025681 Ga0265328_100256812 192
290 3300031249 Ga0265339_10000314 Ga0265339_1000031433 192
291 3300031251 Ga0265327_10000002 Ga0265327_10000002225 192
292 3300031344 Ga0265316_10012925 Ga0265316_100129254 192
293 3300031456 Ga0307513_10218447 Ga0307513_102184472 192
294 3300031711 Ga0265314_10001242 Ga0265314_100012427 192
295 3300031712 Ga0265342_10004070 Ga0265342_100040704 192
296 3300031824 Ga0307413_10047063 Ga0307413_100470631 192
297 3300031824 Ga0307413_10159374 Ga0307413_101593742 192
298 3300032002 Ga0307416_100146187 Ga0307416_1001461872 192
299 3300032004 Ga0307414_10002231 Ga0307414_100022316 192
300 3300032004 Ga0307414_10003410 Ga0307414_100034104 192
301 3300032004 Ga0307414_10026746 Ga0307414_100267465 192
302 3300032004 Ga0307414_10092598 Ga0307414_100925982 192
303 3300032004 Ga0307414_10484367 Ga0307414_104843672 192
304 3300032005 Ga0307411_10020432 Ga0307411_100204323 192
305 3300032005 Ga0307411_10709535 Ga0307411_107095351 192
306 3300036712 Ga0316584_0113056 Ga0316584_0113056_1144_1749 192
307 3300041404 Ga0439436_0045754 Ga0439436_0045754_427_1005 192
308 3300041404 Ga0439436_0064175 Ga0439436_0064175_211_789 192
309 3300041406 Ga0439439_0052072 Ga0439439_0052072_265_843 192
310 3300041411 Ga0439466_0127384 Ga0439466_0127384_157_735 192
311 3300041413 Ga0439465_0000332 Ga0439465_0000332_6768_7346 192
312 3300041413 Ga0439465_0006516 Ga0439465_0006516_779_1357 192
313 3300041451 Ga0451791_0383327 Ga0451791_0383327_435_1013 192
314 3300041460 Ga0451802_2109608 Ga0451802_2109608_30_608 192
315 3300041509 Ga0451843_0270651 Ga0451843_0270651_204_782 192
316 3300041511 Ga0451855_0945503 Ga0451855_0945503_127_705 192
317 3300042007 Ga0439449_0000008 Ga0439449_0000008_42083_42661 192
318 3300042007 Ga0439449_0012488 Ga0439449_0012488_1172_1750 192
319 3300042007 Ga0439449_0031262 Ga0439449_0031262_1261_1839 192
320 3300042015 Ga0439462_0027738 Ga0439462_0027738_834_1475 192
321 3300044712 Ga0453684_0014003 Ga0453684_0014003_11552_12157 192
322 3300044712 Ga0453684_0028387 Ga0453684_0028387_2507_3112 192
323 3300044712 Ga0453684_0335459 Ga0453684_0335459_130_735 192
324 3300046455 Ga0495603_0140379 Ga0495603_0140379_154_735 192
325 3300046518 Ga0495631_0053109 Ga0495631_0053109_480_1061 192
326 3300046520 Ga0495637_0104107 Ga0495637_0104107_366_947 192
327 3300046664 Ga0495659_0137337 Ga0495659_0137337_61_639 192
328 3300046665 Ga0495661_0033419 Ga0495661_0033419_1309_1890 192
329 3300046665 Ga0495661_0090771 Ga0495661_0090771_610_1191 192
330 3300046691 Ga0495670_0034114 Ga0495670_0034114_492_1070 192
331 3300046694 Ga0495649_0205130 Ga0495649_0205130_276_857 192
332 3300046810 Ga0495660_0030405 Ga0495660_0030405_1084_1665 192
333 3300047318 Ga0495636_0001234 Ga0495636_0001234_1247_1915 192
334 3300047323 Ga0495683_0047037 Ga0495683_0047037_1244_1825 192
335 3300048903 Ga0496100_0010333 Ga0496100_0010333_1845_2426 192
336 3300048904 Ga0496101_0002590 Ga0496101_0002590_2777_3358 192
337 3300048905 Ga0496102_0031641 Ga0496102_0031641_3386_3967 192
338 3300048907 Ga0496104_0001033 Ga0496104_0001033_3722_4303 192
339 3300048908 Ga0496105_0009317 Ga0496105_0009317_3820_4401 192
340 3300048909 Ga0496106_0002003 Ga0496106_0002003_11969_12550 192
341 3300048910 Ga0496107_0000417 Ga0496107_0000417_694_1275 192
342 3300048911 Ga0496108_0000838 Ga0496108_0000838_19523_20104 192
343 3300048912 Ga0496109_0027653 Ga0496109_0027653_657_1238 192
344 3300048913 Ga0496110_0031362 Ga0496110_0031362_3225_3806 192
345 3300048913 Ga0496110_0940561 Ga0496110_0940561_103_681 192
346 3300048915 Ga0496112_0005006 Ga0496112_0005006_3838_4419 192
347 3300048918 Ga0496115_0074257 Ga0496115_0074257_1855_2436 192
348 3300048919 Ga0496116_0006698 Ga0496116_0006698_1816_2397 192
349 3300048919 Ga0496116_0026885 Ga0496116_0026885_3303_3884 192
350 3300048922 Ga0496119_0005387 Ga0496119_0005387_3829_4410 192
351 3300048923 Ga0496120_0035886 Ga0496120_0035886_1926_2507 192
352 3300048924 Ga0496121_0097178 Ga0496121_0097178_687_1268 192
353 3300048924 Ga0496121_0157967 Ga0496121_0157967_894_1475 192
354 3300048925 Ga0496122_0012184 Ga0496122_0012184_5680_6258 192
355 3300048925 Ga0496122_0018451 Ga0496122_0018451_5816_6403 192
356 3300048925 Ga0496122_0025045 Ga0496122_0025045_3839_4420 192
357 3300048926 Ga0496123_0024566 Ga0496123_0024566_2680_3258 192
358 3300048927 Ga0496124_0020806 Ga0496124_0020806_1233_1814 192
359 3300048928 Ga0496125_0004182 Ga0496125_0004182_512_1093 192
360 3300048929 Ga0496126_0003262 Ga0496126_0003262_2962_3543 192
361 3300049161 Ga0501305_000831 Ga0501305_000831_1425_2006 192
362 3300049578 Ga0501042_0220645 Ga0501042_0220645_574_1188 192
363 3300049580 Ga0501046_0673721 Ga0501046_0673721_119_700 192
364 3300049591 Ga0501075_0409854 Ga0501075_0409854_73_687 192
365 3300049592 Ga0501076_0290970 Ga0501076_0290970_567_1181 192
366 3300049661 Ga0501217_083295 Ga0501217_083295_118_699 192
367 3300049675 Ga0501243_011811 Ga0501243_011811_92_673 192
368 3300049705 Ga0501225_0000850 Ga0501225_0000850_4306_4884 192
369 3300060353 Ga0501082_0194341 Ga0501082_0194341_934_1515 192
370 iso_pu_bacteria 2511231024 2511373673 192
371 3300025945 Ga0207679_10079009 Ga0207679_100790092 193
372 3300030733 Ga0314311_1104549 Ga0314311_11045493 193
373 3300049822 Ga0501035_0157432 Ga0501035_0157432_1095_1676 193
374 iso_pu_bacteria 2511231004 2511258008 193
375 iso_pu_bacteria 2511231006 2511267848 193
376 iso_pu_bacteria 2511231007 2511274446 193
377 iso_pu_bacteria 2511231008 2511279730 193
378 iso_pu_bacteria 2511231010 2511290919 193
379 iso_pu_bacteria 2511231011 2511296887 193
380 iso_pu_bacteria 2511231012 2511304591 193
381 iso_pu_bacteria 2511231014 2511313571 193
382 iso_pu_bacteria 2511231015 2511318349 193
383 iso_pu_bacteria 2511231016 2511325472 193
384 iso_pu_bacteria 2511231017 2511331340 193
385 iso_pu_bacteria 2511231018 2511337410 193
386 iso_pu_bacteria 2511231019 2511341773 193
387 iso_pu_bacteria 2511231020 2511351436 193
388 iso_pu_bacteria 2511231021 2511357681 193
389 iso_pu_bacteria 2511231022 2511360562 193
390 iso_pu_bacteria 2511231023 2511372523 193
391 iso_pu_bacteria 2511231031 2511415772 193
392 iso_pu_bacteria 2511231156 2511827336 193
393 iso_pu_bacteria 2512047018 2512329510 193
394 iso_pu_bacteria 2554235231 2555246723 193
395 iso_pu_bacteria 2554235341 2555672520 193
396 iso_pu_bacteria 2582580891 2583795009 193
397 iso_pu_bacteria 2597489887 2597860585 193
398 iso_pu_bacteria 2597489888 2597866337 193
399 iso_pu_bacteria 2597489889 2597872181 193
400 iso_pu_bacteria 2599185155 2599330854 193
401 iso_pu_bacteria 2599185160 2599356278 193
402 iso_pu_bacteria 2599185161 2599362325 193
403 iso_pu_bacteria 2599185162 2599369369 193
404 iso_pu_bacteria 2599185163 2599375434 193
405 iso_pu_bacteria 2599185164 2599381383 193
406 iso_pu_bacteria 2599185165 2599387101 193
407 iso_pu_bacteria 2599185166 2599394292 193
408 iso_pu_bacteria 2599185167 2599400838 193
409 iso_pu_bacteria 2599185168 2599406057 193
410 iso_pu_bacteria 2599185179 2599450165 193
411 iso_pu_bacteria 2599185181 2599463111 193
412 iso_pu_bacteria 2599185182 2599467470 193
413 iso_pu_bacteria 2599185185 2599486178 193
414 iso_pu_bacteria 2599185186 2599492128 193
415 iso_pu_bacteria 2599185188 2599502356 193
416 iso_pu_bacteria 2599185189 2599505468 193
417 iso_pu_bacteria 2599185190 2599512237 193
418 iso_pu_bacteria 2599185191 2599517218 193
419 iso_pu_bacteria 2599185212 2599616966 193
420 iso_pu_bacteria 2599185248 2599768477 193
421 iso_pu_bacteria 2599185257 2599804961 193
422 iso_pu_bacteria 2599185288 2599878738 193
423 iso_pu_bacteria 2599185289 2599885897 193
424 iso_pu_bacteria 2599185290 2599892401 193
425 iso_pu_bacteria 2599185291 2599897611 193
426 iso_pu_bacteria 2599185300 2599933946 193
427 iso_pu_bacteria 2599185302 2599945761 193
428 iso_pu_bacteria 2599185303 2599951115 193
429 iso_pu_bacteria 2599185304 2599956755 193
430 iso_pu_bacteria 2599185305 2599961482 193
431 iso_pu_bacteria 2599185306 2599965741 193
432 iso_pu_bacteria 2599185307 2599975280 193
433 iso_pu_bacteria 2599185308 2599978585 193
434 iso_pu_bacteria 2599185309 2599984846 193
435 iso_pu_bacteria 2599185310 2599988069 193
436 iso_pu_bacteria 2599185311 2599993724 193
437 iso_pu_bacteria 2599185312 2599998859 193
438 iso_pu_bacteria 2599185313 2600008536 193
439 iso_pu_bacteria 2599185314 2600012652 193
440 iso_pu_bacteria 2599185315 2600018717 193
441 iso_pu_bacteria 2599185316 2600025136 193
442 iso_pu_bacteria 2599185317 2600030021 193
443 iso_pu_bacteria 2599185318 2600036592 193
444 iso_pu_bacteria 2599185319 2600041901 193
445 iso_pu_bacteria 2599185320 2600046397 193
446 iso_pu_bacteria 2599185321 2600053111 193
447 iso_pu_bacteria 2599185322 2600062819 193
448 iso_pu_bacteria 2599185323 2600066086 193
449 iso_pu_bacteria 2599185324 2600073664 193
450 iso_pu_bacteria 2599185325 2600079641 193
451 iso_pu_bacteria 2599185356 2600215739 193
452 iso_pu_bacteria 2600254930 2600359694 193
453 iso_pu_bacteria 2600254931 2600366242 193
454 iso_pu_bacteria 2600254954 2600446013 193
455 iso_pu_bacteria 2600255283 2601628553 193
456 iso_pu_bacteria 2600255296 2601693730 193
457 iso_pu_bacteria 2600255313 2601775906 193
458 iso_pu_bacteria 2600255318 2601801086 193
459 iso_pu_bacteria 2600255389 2602011388 193
460 iso_pu_bacteria 2603880185 2606073180 193
461 iso_pu_bacteria 2603880199 2606125974 193
462 iso_pu_bacteria 2623620443 2624483111 193
463 iso_pu_bacteria 2623620446 2624494642 193
464 iso_pu_bacteria 2643221565 2643842344 193
465 iso_pu_bacteria 2643221571 2643871971 193
466 iso_pu_bacteria 2643221589 2643955938 193
467 iso_pu_bacteria 2643221602 2644020732 193
468 iso_pu_bacteria 2643221633 2644186241 193
469 iso_pu_bacteria 2643221650 2644283371 193
470 iso_pu_bacteria 2643221713 2644620668 193
471 iso_pu_bacteria 2651869719 2652545975 193
472 iso_pu_bacteria 2667528170 2671089236 193
473 iso_pu_bacteria 2667528171 2671098964 193
474 iso_pu_bacteria 2667528176 2671128740 193
475 iso_pu_bacteria 2671180172 2671771967 193
476 iso_pu_bacteria 2675903420 2677901292 193
477 iso_pu_bacteria 2675903515 2678265848 193
478 iso_pu_bacteria 2713897148 2715750120 193
479 iso_pu_bacteria 2713897149 2715756521 193
480 iso_pu_bacteria 2718217725 2718636313 193
481 iso_pu_bacteria 2721755607 2723251073 193
482 iso_pu_bacteria 2728369097 2729145141 193
483 iso_pu_bacteria 2738541271 2738690341 193
484 iso_pu_bacteria 2738541294 2738812041 193
485 iso_pu_bacteria 2738541309 2738899401 193
486 iso_pu_bacteria 2738543004 2739198761 193
487 iso_pu_bacteria 2738543015 2739261488 193
488 iso_pu_bacteria 2738543016 2739266115 193
489 iso_pu_bacteria 2738543020 2739289800 193
490 iso_pu_bacteria 2738543021 2739295112 193
491 iso_pu_bacteria 2738543025 2739312810 193
492 iso_pu_bacteria 2740892503 2743740136 193
493 iso_pu_bacteria 2744054620 2745007080 193
494 iso_pu_bacteria 2765235841 2765586331 193
495 iso_pu_bacteria 2773857670 2774123678 193
496 iso_pu_bacteria 2773857673 2774135865 193
497 iso_pu_bacteria 2784132063 2784262118 193
498 iso_pu_bacteria 2784132072 2784317512 193
499 iso_pu_bacteria 2791355520 2794598541 193
500 iso_pu_bacteria 2806310737 2807410565 193
501 iso_pu_bacteria 2806310745 2807458910 193
502 iso_pu_bacteria 2808606361 2808858118 193
503 iso_pu_bacteria 2808606373 2808906409 193
504 iso_pu_bacteria 2808606376 2808925971 193
505 iso_pu_bacteria 2808606377 2808932274 193
506 iso_pu_bacteria 2808606378 2808938289 193
507 iso_pu_bacteria 2808606379 2808941963 193
508 iso_pu_bacteria 2808606380 2808948142 193
509 iso_pu_bacteria 2808606381 2808954395 193
510 iso_pu_bacteria 2808606382 2808960823 193
511 iso_pu_bacteria 2808606383 2808966603 193
512 iso_pu_bacteria 2808606385 2808975846 193
513 iso_pu_bacteria 2808606388 2808992955 193
514 iso_pu_bacteria 2808606389 2809001433 193
515 iso_pu_bacteria 2808606445 2809216888 193
516 iso_pu_bacteria 2811994881 2812369148 193
517 iso_pu_bacteria 2818991456 2819654833 193
518 iso_pu_bacteria 2818991464 2819704086 193
519 iso_pu_bacteria 2823421272 2823421916 193
520 iso_pu_bacteria 2825651385 2825655401 193
521 iso_pu_bacteria 2826581358 2826582156 193
522 iso_pu_bacteria 2834028612 2834034470 193
523 iso_pu_bacteria 2842805378 2842808015 193
524 iso_pu_bacteria 2842815866 2842821167 193
525 iso_pu_bacteria 2842826826 2842829300 193
526 iso_pu_bacteria 2842832357 2842833163 193
527 iso_pu_bacteria 2842837860 2842842149 193
528 iso_pu_bacteria 2842843487 2842845402 193
529 iso_pu_bacteria 2842849001 2842852482 193
530 iso_pu_bacteria 2842854478 2842855321 193
531 iso_pu_bacteria 2844665904 2844666696 193
532 iso_pu_bacteria 2852612431 2852616035 193
533 iso_pu_bacteria 2852657418 2852662545 193
534 iso_pu_bacteria 2852667396 2852671003 193
535 iso_pu_bacteria 2860339153 2860341416 193
536 iso_pu_bacteria 2860867994 2860872733 193
537 iso_pu_bacteria 2878029506 2878035049 193
538 iso_pu_bacteria 2880230671 2880235691 193
539 iso_pu_bacteria 2904518522 2904519249 193
540 iso_pu_bacteria 2904550169 2904555458 193
541 iso_pu_bacteria 2908446538 2908452272 193
542 iso_pu_bacteria 2912963787 2912968604 193
543 iso_pu_bacteria 2913036834 2913042259 193
544 iso_pu_bacteria 2917070673 2917076407 193
545 iso_pu_bacteria 2919063839 2919065866 193
546 iso_pu_bacteria 2919155634 2919155649 193
547 iso_pu_bacteria 2919385768 2919389488 193
548 iso_pu_bacteria 2919456309 2919457255 193
549 iso_pu_bacteria 2919481497 2919486685 193
550 iso_pu_bacteria 2919487758 2919488454 193
551 iso_pu_bacteria 2919501602 2919506490 193
552 iso_pu_bacteria 2919697872 2919700864 193
553 iso_pu_bacteria 2923153595 2923159228 193
554 iso_pu_bacteria 2923519811 2923523229 193
555 iso_pu_bacteria 2923586266 2923591928 193
556 iso_pu_bacteria 2926063275 2926068194 193
557 iso_pu_bacteria 2929144301 2929149644 193
558 iso_pu_bacteria 2929189879 2929194845 193
559 iso_pu_bacteria 2931369376 2931372950 193
560 iso_pu_bacteria 2931390751 2931396122 193
561 iso_pu_bacteria 2931396565 2931397766 193
562 iso_pu_bacteria 2935353572 2935358620 193
563 iso_pu_bacteria 2939636861 2939642172 193
564 iso_pu_bacteria 2939651529 2939653944 193
565 iso_pu_bacteria 2945928738 2945931210 193
566 iso_pu_bacteria 2945961074 2945966494 193
567 iso_pu_bacteria 2946006987 2946007246 193
568 iso_pu_bacteria 2946027586 2946027608 193
569 iso_pu_bacteria 2947233263 2947234127 193
570 iso_pu_bacteria 2969304461 2969309877 193
571 iso_pu_bacteria 2974289157 2974294376 193
572 iso_pu_bacteria 2984286254 2984286919 193
573 iso_pu_bacteria 2988728565 2988731192 193
574 iso_pu_bacteria 2990196909 2990197034 193
575 iso_pu_bacteria 2998139840 2998145103 193
576 iso_pu_bacteria 3007252601 3007255550 193
577 iso_pu_bacteria 3007315729 3007320356 193
578 iso_pu_bacteria 3007395558 3007398876 193
579 iso_pu_bacteria 3007419365 3007425416 193
580 iso_pu_bacteria 3007511990 3007516894 193
581 iso_pu_bacteria 3007614139 3007618935 193
582 iso_pu_bacteria 3007619802 3007622249 193
583 iso_pu_bacteria 3007718800 3007720026 193
584 iso_pu_bacteria 3007803356 3007803668 193
585 iso_pu_bacteria 3007855910 3007858131 193
586 iso_pu_bacteria 3007861166 3007866564 193
587 iso_pu_bacteria 3007866637 3007867047 193
588 iso_pu_bacteria 3007872151 3007872413 193
589 iso_pu_bacteria 637000220 637322958 193
590 iso_pu_bacteria 640427133 640486701 193
591 iso_pu_bacteria 651053060 651174552 193
592 iso_pu_bacteria 8011350971 8011353572 193
593 iso_pu_bacteria 8015687852 8015693317 193
594 iso_pu_bacteria 8019769354 8019770078 193
595 iso_pu_bacteria 8019775933 8019777972 193
596 iso_pu_bacteria 8029995093 8029995793 193
597 iso_pu_bacteria 8034962539 8034966298 193
598 iso_pu_bacteria 8052494512 8052499543 193
599 iso_pu_bacteria 8054285046 8054291442 193
600 iso_pu_bacteria 8054347763 8054349868 193
601 iso_pu_bacteria 8054503363 8054508622 193
602 iso_pu_bacteria 8054929484 8054934278 193
603 iso_pu_bacteria 8055770955 8055776567 193
604 iso_pu_bacteria 8055878733 8055879309 193
605 iso_pu_bacteria 8056115690 8056115857 193
606 iso_pu_bacteria 8056120720 8056121183 193
607 iso_pu_bacteria 8056125926 8056131310 193
608 iso_pu_bacteria 8056131705 8056137026 193
609 iso_pu_bacteria 8056137416 8056137900 193
610 iso_pu_bacteria 8056143049 8056148468 193
611 iso_pu_bacteria 8056148874 8056151790 193
612 iso_pu_bacteria 8056155041 8056160544 193
613 iso_pu_bacteria 8056161164 8056163322 193
614 iso_pu_bacteria 8056166840 8056171465 193
615 iso_pu_bacteria 8056172158 8056177709 193
616 iso_pu_bacteria 8056177738 8056181705 193
617 iso_pu_bacteria 8056569372 8056570172 193
618 iso_pu_bacteria 8057798959 8057801620 193
619 2162886007 SwRhRL2b_contig_2033802 SwRhRL2b_0799.00000090 194
620 3300005289 Ga0065704_10078228 Ga0065704_100782286 194
621 3300005353 Ga0070669_100015089 Ga0070669_1000150894 194
622 3300013102 Ga0157371_10000536 Ga0157371_1000053630 194
623 3300025923 Ga0207681_10032206 Ga0207681_100322063 194
624 3300041406 Ga0439439_0091458 Ga0439439_0091458_129_713 194
625 3300042006 Ga0439432_001393 Ga0439432_001393_5602_6186 194
626 3300042876 Ga0451577_0014833 Ga0451577_0014833_346_930 194
627 3300046522 Ga0495643_0032702 Ga0495643_0032702_2182_2769 194
628 3300047470 Ga0495681_0032145 Ga0495681_0032145_1661_2248 194
629 3300047472 Ga0495686_0232776 Ga0495686_0232776_411_998 194
630 3300048925 Ga0496122_0094780 Ga0496122_0094780_1371_1955 194
631 3300048926 Ga0496123_0017557 Ga0496123_0017557_3058_3642 194
632 3300049569 Ga0501032_0066359 Ga0501032_0066359_498_1082 194
633 3300049571 Ga0501034_0540356 Ga0501034_0540356_59_643 194
634 3300049572 Ga0501036_0128013 Ga0501036_0128013_600_1184 194
635 3300049573 Ga0501037_0069863 Ga0501037_0069863_1652_2236 194
636 3300049574 Ga0501038_0013534 Ga0501038_0013534_6794_7378 194
637 3300049575 Ga0501039_0046612 Ga0501039_0046612_599_1183 194
638 3300049579 Ga0501043_0292224 Ga0501043_0292224_172_756 194
639 3300049581 Ga0501047_0116761 Ga0501047_0116761_355_939 194
640 3300049586 Ga0501070_0112228 Ga0501070_0112228_1335_1919 194
641 3300049741 Ga0501079_0490799 Ga0501079_0490799_27_611 194
642 3300049742 Ga0501080_0637771 Ga0501080_0637771_162_746 194
643 3300049823 Ga0501044_0031771 Ga0501044_0031771_810_1394 194
644 2124908027 MRS2a_Contig_25655 MRS2a_00517350 197
645 2162886007 SwRhRL2b_contig_2301832 SwRhRL2b_0743.00001640 197
646 2162886007 SwRhRL2b_contig_2561713 SwRhRL2b_0913.00002180 197
647 3300001915 JGI24741J21665_1019860 JGI24741J21665_10198602 197
648 3300002704 JGI25155J39150_1003044 JGI25155J39150_10030441 197
649 3300002737 JGI25162J39368_1000324 JGI25162J39368_100032424 197
650 3300002738 JGI25154J39366_1004696 JGI25154J39366_10046962 197
651 3300002771 JGI25163J39215_1000382 JGI25163J39215_100038210 197
652 3300002771 JGI25163J39215_1001230 JGI25163J39215_10012305 197
653 3300002772 JGI25164J39214_1000240 JGI25164J39214_100024024 197
654 3300002772 JGI25164J39214_1000410 JGI25164J39214_10004107 197
655 3300003214 JGI25165J46597_1000439 JGI25165J46597_100043917 197
656 3300003214 JGI25165J46597_1000774 JGI25165J46597_10007747 197
657 3300003578 Ga0006562J51391_1020783 Ga0006562J51391_10207832 197
658 3300003751 Ga0055538_1000274 Ga0055538_100027418 197
659 3300003752 Ga0055539_1000302 Ga0055539_100030218 197
660 3300003756 Ga0055533_1000282 Ga0055533_100028218 197
661 3300003758 Ga0055532_1000427 Ga0055532_100042712 197
662 3300003759 Ga0055525_1000407 Ga0055525_100040718 197
663 3300003781 Ga0055536_1001108 Ga0055536_100110812 197
664 3300003781 Ga0055536_1001147 Ga0055536_100114711 197
665 3300003781 Ga0055536_1002226 Ga0055536_100222612 197
666 3300003791 Ga0055530_10000513 Ga0055530_1000051316 197
667 3300003791 Ga0055530_10000832 Ga0055530_1000083213 197
668 3300003791 Ga0055530_10002706 Ga0055530_1000270612 197
669 3300003792 Ga0055540_1000426 Ga0055540_100042616 197
670 3300003792 Ga0055540_1000516 Ga0055540_100051610 197
671 3300003792 Ga0055540_1000533 Ga0055540_100053316 197
672 3300003794 Ga0055531_10000286 Ga0055531_1000028634 197
673 3300003794 Ga0055531_10001251 Ga0055531_1000125120 197
674 3300003841 Ga0055541_1000194 Ga0055541_100019418 197
675 3300003856 Ga0058692_1009942 Ga0058692_10099422 197
676 3300003856 Ga0058692_1019879 Ga0058692_10198792 197
677 3300004798 Ga0058859_11723765 Ga0058859_117237652 197
678 3300005288 Ga0065714_10000306 Ga0065714_100003064 197
679 3300005288 Ga0065714_10002430 Ga0065714_1000243016 197
680 3300005288 Ga0065714_10012426 Ga0065714_100124261 197
681 3300005288 Ga0065714_10020040 Ga0065714_100200402 197
682 3300005288 Ga0065714_10021513 Ga0065714_100215132 197
683 3300005288 Ga0065714_10071564 Ga0065714_100715642 197
684 3300005288 Ga0065714_10078003 Ga0065714_100780033 197
685 3300005288 Ga0065714_10080836 Ga0065714_100808362 197
686 3300005288 Ga0065714_10100953 Ga0065714_101009532 197
687 3300005288 Ga0065714_10112890 Ga0065714_101128902 197
688 3300005288 Ga0065714_10133243 Ga0065714_101332431 197
689 3300005288 Ga0065714_10155289 Ga0065714_101552892 197
690 3300005288 Ga0065714_10186172 Ga0065714_101861722 197
691 3300005288 Ga0065714_10295223 Ga0065714_102952231 197
692 3300005289 Ga0065704_10004129 Ga0065704_100041292 197
693 3300005289 Ga0065704_10070839 Ga0065704_100708392 197
694 3300005289 Ga0065704_10090384 Ga0065704_100903842 197
695 3300005289 Ga0065704_10124966 Ga0065704_101249662 197
696 3300005289 Ga0065704_10156983 Ga0065704_101569832 197
697 3300005289 Ga0065704_10196810 Ga0065704_101968101 197
698 3300005290 Ga0065712_10013841 Ga0065712_100138412 197
699 3300005290 Ga0065712_10069870 Ga0065712_100698704 197
700 3300005293 Ga0065715_10142984 Ga0065715_101429842 197
701 3300005331 Ga0070670_100017837 Ga0070670_1000178371 197
702 3300005331 Ga0070670_100274530 Ga0070670_1002745301 197
703 3300005344 Ga0070661_100004022 Ga0070661_1000040222 197
704 3300005353 Ga0070669_100001100 Ga0070669_1000011005 197
705 3300005353 Ga0070669_100003634 Ga0070669_10000363414 197
706 3300005435 Ga0070714_100584969 Ga0070714_1005849691 197
707 3300005457 Ga0070662_100002186 Ga0070662_1000021868 197
708 3300005457 Ga0070662_100253909 Ga0070662_1002539091 197
709 3300005539 Ga0068853_100000211 Ga0068853_10000021117 197
710 3300005548 Ga0070665_100013078 Ga0070665_1000130787 197
711 3300005564 Ga0070664_100006387 Ga0070664_1000063879 197
712 3300005564 Ga0070664_100020240 Ga0070664_1000202406 197
713 3300005578 Ga0068854_100002246 Ga0068854_10000224610 197
714 3300005834 Ga0068851_10000063 Ga0068851_1000006340 197
715 3300006051 Ga0075364_10058470 Ga0075364_100584702 197
716 3300006051 Ga0075364_10092886 Ga0075364_100928862 197
717 3300006051 Ga0075364_10167323 Ga0075364_101673232 197
718 3300006051 Ga0075364_10247871 Ga0075364_102478712 197
719 3300006051 Ga0075364_10422924 Ga0075364_104229241 197
720 3300006058 Ga0075432_10001688 Ga0075432_100016883 197
721 3300006058 Ga0075432_10002396 Ga0075432_100023963 197
722 3300006058 Ga0075432_10008700 Ga0075432_100087001 197
723 3300006058 Ga0075432_10024262 Ga0075432_100242623 197
724 3300006058 Ga0075432_10076427 Ga0075432_100764272 197
725 3300006058 Ga0075432_10143886 Ga0075432_101438861 197
726 3300006058 Ga0075432_10268893 Ga0075432_102688931 197
727 3300006177 Ga0075362_10199448 Ga0075362_101994481 197
728 3300006353 Ga0075370_10267446 Ga0075370_102674461 197
729 3300006914 Ga0075436_100072665 Ga0075436_1000726651 197
730 3300006914 Ga0075436_100086441 Ga0075436_1000864413 197
731 3300006944 Ga0099823_1000115 Ga0099823_100011517 197
732 3300006946 Ga0079104_1000620 Ga0079104_100062018 197
733 3300006946 Ga0079104_1000927 Ga0079104_100092717 197
734 3300006946 Ga0079104_1037758 Ga0079104_10377581 197
735 3300006948 Ga0099826_10067152 Ga0099826_100671521 197
736 3300009011 Ga0105251_10000322 Ga0105251_1000032231 197
737 3300009011 Ga0105251_10001209 Ga0105251_100012098 197
738 3300009011 Ga0105251_10001813 Ga0105251_1000181314 197
739 3300009011 Ga0105251_10002972 Ga0105251_100029727 197
740 3300009011 Ga0105251_10003491 Ga0105251_100034918 197
741 3300009011 Ga0105251_10005113 Ga0105251_100051134 197
742 3300009011 Ga0105251_10009217 Ga0105251_100092176 197
743 3300009011 Ga0105251_10024014 Ga0105251_100240142 197
744 3300009011 Ga0105251_10026194 Ga0105251_100261942 197
745 3300009011 Ga0105251_10029175 Ga0105251_100291752 197
746 3300009011 Ga0105251_10063787 Ga0105251_100637872 197
747 3300009036 Ga0105244_10001414 Ga0105244_100014146 197
748 3300009036 Ga0105244_10001557 Ga0105244_100015579 197
749 3300009036 Ga0105244_10002629 Ga0105244_100026297 197
750 3300009036 Ga0105244_10008501 Ga0105244_100085013 197
751 3300009036 Ga0105244_10014653 Ga0105244_100146532 197
752 3300009036 Ga0105244_10014938 Ga0105244_100149382 197
753 3300009036 Ga0105244_10021784 Ga0105244_100217843 197
754 3300009036 Ga0105244_10029719 Ga0105244_100297192 197
755 3300009036 Ga0105244_10043179 Ga0105244_100431792 197
756 3300009036 Ga0105244_10068307 Ga0105244_100683071 197
757 3300009036 Ga0105244_10161908 Ga0105244_101619081 197
758 3300009036 Ga0105244_10215018 Ga0105244_102150182 197
759 3300009092 Ga0105250_10000708 Ga0105250_1000070817 197
760 3300009092 Ga0105250_10003391 Ga0105250_100033916 197
761 3300009092 Ga0105250_10003781 Ga0105250_100037817 197
762 3300009092 Ga0105250_10008778 Ga0105250_100087785 197
763 3300009092 Ga0105250_10025688 Ga0105250_100256882 197
764 3300009092 Ga0105250_10318331 Ga0105250_103183311 197
765 3300009098 Ga0105245_11275215 Ga0105245_112752151 197
766 3300009148 Ga0105243_10000462 Ga0105243_1000046217 197
767 3300009148 Ga0105243_10001219 Ga0105243_100012197 197
768 3300009148 Ga0105243_10005262 Ga0105243_100052628 197
769 3300009148 Ga0105243_10010209 Ga0105243_100102096 197
770 3300009148 Ga0105243_10025858 Ga0105243_100258582 197
771 3300009148 Ga0105243_10034083 Ga0105243_100340834 197
772 3300009148 Ga0105243_10079625 Ga0105243_100796253 197
773 3300009148 Ga0105243_10288010 Ga0105243_102880102 197
774 3300009176 Ga0105242_10000538 Ga0105242_1000053817 197
775 3300009177 Ga0105248_10925579 Ga0105248_109255792 197
776 3300009545 Ga0105237_10003767 Ga0105237_1000376716 197
777 3300011119 Ga0105246_10000309 Ga0105246_1000030914 197
778 3300011119 Ga0105246_10005628 Ga0105246_100056283 197
779 3300011119 Ga0105246_10015586 Ga0105246_100155863 197
780 3300011119 Ga0105246_10039625 Ga0105246_100396252 197
781 3300011119 Ga0105246_10045955 Ga0105246_100459551 197
782 3300011119 Ga0105246_10277243 Ga0105246_102772432 197
783 3300011119 Ga0105246_10515592 Ga0105246_105155922 197
784 3300012498 Ga0157345_1000470 Ga0157345_10004701 197
785 3300013100 Ga0157373_10001670 Ga0157373_1000167017 197
786 3300013100 Ga0157373_10011514 Ga0157373_100115143 197
787 3300013100 Ga0157373_10061615 Ga0157373_100616153 197
788 3300013100 Ga0157373_10084249 Ga0157373_100842493 197
789 3300013100 Ga0157373_10495497 Ga0157373_104954971 197
790 3300013102 Ga0157371_10000653 Ga0157371_1000065324 197
791 3300013102 Ga0157371_10008395 Ga0157371_100083957 197
792 3300013102 Ga0157371_10952025 Ga0157371_109520251 197
793 3300013104 Ga0157370_10071533 Ga0157370_100715333 197
794 3300013104 Ga0157370_10074138 Ga0157370_100741384 197
795 3300013104 Ga0157370_10137185 Ga0157370_101371851 197
796 3300013104 Ga0157370_10175877 Ga0157370_101758773 197
797 3300013104 Ga0157370_10418602 Ga0157370_104186022 197
798 3300013105 Ga0157369_10014110 Ga0157369_100141106 197
799 3300013105 Ga0157369_10110393 Ga0157369_101103932 197
800 3300013105 Ga0157369_10228138 Ga0157369_102281381 197
801 3300013105 Ga0157369_10319522 Ga0157369_103195222 197
802 3300013306 Ga0163162_10010721 Ga0163162_100107216 197
803 3300013306 Ga0163162_10019133 Ga0163162_100191335 197
804 3300013306 Ga0163162_10384487 Ga0163162_103844872 197
805 3300013307 Ga0157372_10002703 Ga0157372_1000270315 197
806 3300013307 Ga0157372_10044644 Ga0157372_100446442 197
807 3300013307 Ga0157372_10798190 Ga0157372_107981901 197
808 3300013308 Ga0157375_12092728 Ga0157375_120927281 197
809 3300014497 Ga0182008_10000945 Ga0182008_1000094515 197
810 3300014497 Ga0182008_10007577 Ga0182008_100075774 197
811 3300014497 Ga0182008_10010620 Ga0182008_100106201 197
812 3300014497 Ga0182008_10017352 Ga0182008_100173522 197
813 3300014497 Ga0182008_10035642 Ga0182008_100356422 197
814 3300014497 Ga0182008_10049314 Ga0182008_100493142 197
815 3300014497 Ga0182008_10068610 Ga0182008_100686102 197
816 3300014497 Ga0182008_10083210 Ga0182008_100832101 197
817 3300014497 Ga0182008_10200988 Ga0182008_102009882 197
818 3300015261 Ga0182006_1002602 Ga0182006_100260212 197
819 3300015261 Ga0182006_1004208 Ga0182006_10042083 197
820 3300015261 Ga0182006_1005406 Ga0182006_10054067 197
821 3300015261 Ga0182006_1005584 Ga0182006_10055843 197
822 3300015261 Ga0182006_1009986 Ga0182006_10099863 197
823 3300015261 Ga0182006_1016613 Ga0182006_10166132 197
824 3300015261 Ga0182006_1047921 Ga0182006_10479212 197
825 3300015262 Ga0182007_10001903 Ga0182007_100019037 197
826 3300015265 Ga0182005_1011495 Ga0182005_10114952 197
827 3300015265 Ga0182005_1018174 Ga0182005_10181742 197
828 3300015265 Ga0182005_1023184 Ga0182005_10231841 197
829 3300015265 Ga0182005_1040805 Ga0182005_10408052 197
830 3300017792 Ga0163161_10016761 Ga0163161_100167613 197
831 3300017792 Ga0163161_10022207 Ga0163161_100222071 197
832 3300017792 Ga0163161_10022712 Ga0163161_100227122 197
833 3300017792 Ga0163161_10032103 Ga0163161_100321032 197
834 3300017792 Ga0163161_10156922 Ga0163161_101569222 197
835 3300017792 Ga0163161_10280501 Ga0163161_102805011 197
836 3300017792 Ga0163161_11057385 Ga0163161_110573851 197
837 3300025206 Ga0209435_100696 Ga0209435_1006964 197
838 3300025207 Ga0209760_100155 Ga0209760_1001557 197
839 3300025207 Ga0209760_100167 Ga0209760_10016717 197
840 3300025224 Ga0209784_100007 Ga0209784_100007676 197
841 3300025225 Ga0209566_100062 Ga0209566_100062161 197
842 3300025226 Ga0209674_100132 Ga0209674_10013295 197
843 3300025229 Ga0209147_100009 Ga0209147_100009676 197
844 3300025230 Ga0209563_100018 Ga0209563_100018676 197
845 3300025230 Ga0209563_100863 Ga0209563_10086310 197
846 3300025231 Ga0207427_100005 Ga0207427_10000517 197
847 3300025231 Ga0207427_100006 Ga0207427_100006724 197
848 3300025233 Ga0209437_100013 Ga0209437_100013724 197
849 3300025233 Ga0209437_100220 Ga0209437_10022018 197
850 3300025233 Ga0209437_112664 Ga0209437_1126642 197
851 3300025242 Ga0209258_100365 Ga0209258_10036545 197
852 3300025246 Ga0209646_1000510 Ga0209646_100051018 197
853 3300025253 Ga0209677_100385 Ga0209677_10038512 197
854 3300025261 Ga0209233_1000021 Ga0209233_100002117 197
855 3300025261 Ga0209233_1000022 Ga0209233_1000022724 197
856 3300025292 Ga0209676_1000015 Ga0209676_1000015708 197
857 3300025292 Ga0209676_1000668 Ga0209676_100066817 197
858 3300025292 Ga0209676_1001175 Ga0209676_100117518 197
859 3300025292 Ga0209676_1001477 Ga0209676_10014776 197
860 3300025292 Ga0209676_1008947 Ga0209676_10089473 197
861 3300025292 Ga0209676_1027365 Ga0209676_10273652 197
862 3300025298 Ga0209050_1000024 Ga0209050_1000024474 197
863 3300025298 Ga0209050_1000128 Ga0209050_100012817 197
864 3300025298 Ga0209050_1001031 Ga0209050_100103118 197
865 3300025298 Ga0209050_1001704 Ga0209050_10017044 197
866 3300025303 Ga0209051_1000023 Ga0209051_1000023390 197
867 3300025303 Ga0209051_1000041 Ga0209051_100004118 197
868 3300025303 Ga0209051_1000791 Ga0209051_100079117 197
869 3300025303 Ga0209051_1008475 Ga0209051_10084751 197
870 3300025304 Ga0209257_1000069 Ga0209257_1000069291 197
871 3300025304 Ga0209257_1022421 Ga0209257_10224211 197
872 3300025321 Ga0207656_10000006 Ga0207656_10000006354 197
873 3300025711 Ga0207696_1000064 Ga0207696_1000064195 197
874 3300025711 Ga0207696_1000094 Ga0207696_100009417 197
875 3300025711 Ga0207696_1000319 Ga0207696_100031918 197
876 3300025711 Ga0207696_1000324 Ga0207696_100032417 197
877 3300025711 Ga0207696_1000663 Ga0207696_100066312 197
878 3300025711 Ga0207696_1004659 Ga0207696_10046594 197
879 3300025711 Ga0207696_1005001 Ga0207696_10050014 197
880 3300025711 Ga0207696_1009666 Ga0207696_10096665 197
881 3300025711 Ga0207696_1015377 Ga0207696_10153772 197
882 3300025728 Ga0207655_1000107 Ga0207655_1000107147 197
883 3300025728 Ga0207655_1000473 Ga0207655_100047317 197
884 3300025728 Ga0207655_1000486 Ga0207655_100048618 197
885 3300025728 Ga0207655_1000598 Ga0207655_100059828 197
886 3300025728 Ga0207655_1001041 Ga0207655_100104116 197
887 3300025728 Ga0207655_1001446 Ga0207655_100144613 197
888 3300025728 Ga0207655_1001643 Ga0207655_100164318 197
889 3300025728 Ga0207655_1004827 Ga0207655_100482712 197
890 3300025728 Ga0207655_1008357 Ga0207655_10083573 197
891 3300025728 Ga0207655_1009040 Ga0207655_10090404 197
892 3300025728 Ga0207655_1012139 Ga0207655_10121393 197
893 3300025728 Ga0207655_1013334 Ga0207655_10133342 197
894 3300025728 Ga0207655_1013627 Ga0207655_10136271 197
895 3300025728 Ga0207655_1017305 Ga0207655_10173053 197
896 3300025728 Ga0207655_1023381 Ga0207655_10233814 197
897 3300025728 Ga0207655_1024600 Ga0207655_10246002 197
898 3300025728 Ga0207655_1028115 Ga0207655_10281152 197
899 3300025728 Ga0207655_1133902 Ga0207655_11339021 197
900 3300025735 Ga0207713_1000010 Ga0207713_100001017 197
901 3300025735 Ga0207713_1000813 Ga0207713_100081316 197
902 3300025735 Ga0207713_1001149 Ga0207713_100114916 197
903 3300025735 Ga0207713_1001206 Ga0207713_100120616 197
904 3300025735 Ga0207713_1002240 Ga0207713_10022403 197
905 3300025735 Ga0207713_1002379 Ga0207713_10023794 197
906 3300025735 Ga0207713_1002491 Ga0207713_100249114 197
907 3300025735 Ga0207713_1003517 Ga0207713_10035172 197
908 3300025735 Ga0207713_1004875 Ga0207713_10048753 197
909 3300025735 Ga0207713_1006794 Ga0207713_10067944 197
910 3300025735 Ga0207713_1008805 Ga0207713_10088056 197
911 3300025735 Ga0207713_1012981 Ga0207713_10129813 197
912 3300025735 Ga0207713_1018085 Ga0207713_10180852 197
913 3300025735 Ga0207713_1020745 Ga0207713_10207452 197
914 3300025735 Ga0207713_1021581 Ga0207713_10215813 197
915 3300025735 Ga0207713_1023812 Ga0207713_10238122 197
916 3300025735 Ga0207713_1030730 Ga0207713_10307302 197
917 3300025735 Ga0207713_1052108 Ga0207713_10521082 197
918 3300025735 Ga0207713_1086635 Ga0207713_10866352 197
919 3300025735 Ga0207713_1154095 Ga0207713_11540951 197
920 3300025911 Ga0207654_10627483 Ga0207654_106274831 197
921 3300025914 Ga0207671_10000159 Ga0207671_1000015917 197
922 3300025920 Ga0207649_10000197 Ga0207649_1000019732 197
923 3300025923 Ga0207681_10000254 Ga0207681_1000025417 197
924 3300025923 Ga0207681_10002634 Ga0207681_100026346 197
925 3300025925 Ga0207650_10000591 Ga0207650_1000059116 197
926 3300025925 Ga0207650_10000699 Ga0207650_1000069915 197
927 3300025929 Ga0207664_10574669 Ga0207664_105746692 197
928 3300025932 Ga0207690_10404787 Ga0207690_104047872 197
929 3300025933 Ga0207706_10000395 Ga0207706_1000039517 197
930 3300025933 Ga0207706_10116210 Ga0207706_101162102 197
931 3300025934 Ga0207686_10001265 Ga0207686_100012652 197
932 3300025935 Ga0207709_10000409 Ga0207709_1000040924 197
933 3300025935 Ga0207709_10000506 Ga0207709_1000050617 197
934 3300025935 Ga0207709_10018481 Ga0207709_100184814 197
935 3300025935 Ga0207709_10039446 Ga0207709_100394462 197
936 3300025935 Ga0207709_10159126 Ga0207709_101591262 197
937 3300025945 Ga0207679_10000027 Ga0207679_10000027158 197
938 3300025981 Ga0207640_10024300 Ga0207640_100243002 197
939 3300026041 Ga0207639_10000238 Ga0207639_1000023824 197
940 3300027111 Ga0209281_1000016 Ga0209281_100001618 197
941 3300027111 Ga0209281_1000019 Ga0209281_1000019515 197
942 3300027296 Ga0209389_1000173 Ga0209389_100017317 197
943 3300027312 Ga0209371_1000127 Ga0209371_100012793 197
944 3300027312 Ga0209371_1000508 Ga0209371_100050817 197
945 3300027360 Ga0209969_1004274 Ga0209969_10042742 197
946 3300027378 Ga0209981_1001494 Ga0209981_10014943 197
947 3300027395 Ga0209996_1001151 Ga0209996_10011512 197
948 3300027526 Ga0209968_1002462 Ga0209968_10024624 197
949 3300027543 Ga0209999_1039969 Ga0209999_10399691 197
950 3300027617 Ga0210002_1004006 Ga0210002_10040062 197
951 3300027682 Ga0209971_1000802 Ga0209971_10008023 197
952 3300027907 Ga0207428_10021576 Ga0207428_100215767 197
953 3300027907 Ga0207428_10149323 Ga0207428_101493232 197
954 3300027907 Ga0207428_10708493 Ga0207428_107084931 197
955 3300028379 Ga0268266_10002381 Ga0268266_100023813 197
956 3300028379 Ga0268266_10150929 Ga0268266_101509293 197
957 3300028379 Ga0268266_10470917 Ga0268266_104709172 197
958 3300030500 Ga0268256_1000104 Ga0268256_100010493 197
959 3300030500 Ga0268256_1000729 Ga0268256_10007293 197
960 3300030521 Ga0307511_10090751 Ga0307511_100907512 197
961 3300030521 Ga0307511_10095754 Ga0307511_100957542 197
962 3300030734 Ga0316179_1035621 Ga0316179_10356213 197
963 3300030735 Ga0316178_1009978 Ga0316178_100997818 197
964 3300030742 Ga0316183_1125898 Ga0316183_11258984 197
965 3300030742 Ga0316183_1182093 Ga0316183_11820932 197
966 3300030744 Ga0316181_1075824 Ga0316181_10758242 197
967 3300031548 Ga0307408_100000065 Ga0307408_10000006521 197
968 3300031548 Ga0307408_100005505 Ga0307408_1000055053 197
969 3300031548 Ga0307408_100031541 Ga0307408_1000315412 197
970 3300031548 Ga0307408_100278687 Ga0307408_1002786872 197
971 3300031730 Ga0307516_10045162 Ga0307516_100451623 197
972 3300031731 Ga0307405_10000248 Ga0307405_100002483 197
973 3300031731 Ga0307405_10010653 Ga0307405_100106533 197
974 3300031731 Ga0307405_10364372 Ga0307405_103643721 197
975 3300031824 Ga0307413_10026423 Ga0307413_100264232 197
976 3300031824 Ga0307413_10101601 Ga0307413_101016012 197
977 3300031901 Ga0307406_10029257 Ga0307406_100292572 197
978 3300031901 Ga0307406_10069943 Ga0307406_100699432 197
979 3300031911 Ga0307412_10005724 Ga0307412_100057242 197
980 3300031911 Ga0307412_10086386 Ga0307412_100863862 197
981 3300031995 Ga0307409_100006735 Ga0307409_1000067357 197
982 3300031995 Ga0307409_100819463 Ga0307409_1008194631 197
983 3300032002 Ga0307416_100020743 Ga0307416_1000207433 197
984 3300032004 Ga0307414_10031845 Ga0307414_100318453 197
985 3300032004 Ga0307414_10058843 Ga0307414_100588432 197
986 3300032004 Ga0307414_10184760 Ga0307414_101847602 197
987 3300032005 Ga0307411_10014695 Ga0307411_100146952 197
988 3300032005 Ga0307411_10801110 Ga0307411_108011102 197
989 3300033180 Ga0307510_10042102 Ga0307510_100421021 197
990 3300033180 Ga0307510_10092052 Ga0307510_100920521 197
991 3300038705 Ga0237819_00998 Ga0237819_00998_312_905 197
992 3300041404 Ga0439436_0001473 Ga0439436_0001473_4425_5018 197
993 3300041405 Ga0439438_000617 Ga0439438_000617_12484_13077 197
994 3300041405 Ga0439438_001268 Ga0439438_001268_6788_7381 197
995 3300041405 Ga0439438_002009 Ga0439438_002009_4350_4943 197
996 3300041405 Ga0439438_002825 Ga0439438_002825_1194_1787 197
997 3300041405 Ga0439438_004498 Ga0439438_004498_631_1224 197
998 3300041405 Ga0439438_007373 Ga0439438_007373_51_644 197
999 3300041405 Ga0439438_011972 Ga0439438_011972_230_823 197
1000 3300041405 Ga0439438_024952 Ga0439438_024952_243_836 197
1001 3300041405 Ga0439438_085014 Ga0439438_085014_11_604 197
1002 3300041407 Ga0439447_000387 Ga0439447_000387_198_791 197
1003 3300041407 Ga0439447_001621 Ga0439447_001621_2935_3528 197
1004 3300041407 Ga0439447_001724 Ga0439447_001724_7241_7834 197
1005 3300041407 Ga0439447_002361 Ga0439447_002361_4380_4973 197
1006 3300041407 Ga0439447_006833 Ga0439447_006833_2898_3491 197
1007 3300041407 Ga0439447_009466 Ga0439447_009466_501_1094 197
1008 3300041411 Ga0439466_0000606 Ga0439466_0000606_9902_10495 197
1009 3300041411 Ga0439466_0000656 Ga0439466_0000656_3721_4314 197
1010 3300041411 Ga0439466_0000867 Ga0439466_0000867_923_1516 197
1011 3300041411 Ga0439466_0001014 Ga0439466_0001014_7423_8016 197
1012 3300041411 Ga0439466_0002320 Ga0439466_0002320_6582_7175 197
1013 3300041411 Ga0439466_0004366 Ga0439466_0004366_631_1224 197
1014 3300041411 Ga0439466_0011868 Ga0439466_0011868_235_828 197
1015 3300041411 Ga0439466_0019094 Ga0439466_0019094_51_644 197
1016 3300041997 Ga0439431_0037668 Ga0439431_0037668_585_1178 197
1017 3300042000 Ga0439437_000206 Ga0439437_000206_2312_2905 197
1018 3300042003 Ga0439443_025366 Ga0439443_025366_264_857 197
1019 3300042006 Ga0439432_000309 Ga0439432_000309_5433_6101 197
1020 3300042006 Ga0439432_000568 Ga0439432_000568_10176_10775 197
1021 3300042006 Ga0439432_000616 Ga0439432_000616_10861_11454 197
1022 3300042006 Ga0439432_000707 Ga0439432_000707_8913_9506 197
1023 3300042006 Ga0439432_000848 Ga0439432_000848_3711_4304 197
1024 3300042006 Ga0439432_007023 Ga0439432_007023_2812_3405 197
1025 3300042006 Ga0439432_012123 Ga0439432_012123_1653_2246 197
1026 3300042009 Ga0439451_014541 Ga0439451_014541_705_1298 197
1027 3300042010 Ga0439452_000363 Ga0439452_000363_18262_18855 197
1028 3300042010 Ga0439452_000649 Ga0439452_000649_10179_10772 197
1029 3300042010 Ga0439452_001118 Ga0439452_001118_2785_3378 197
1030 3300042010 Ga0439452_001197 Ga0439452_001197_8786_9379 197
1031 3300042010 Ga0439452_001682 Ga0439452_001682_5055_5648 197
1032 3300042010 Ga0439452_001733 Ga0439452_001733_3823_4416 197
1033 3300042010 Ga0439452_002177 Ga0439452_002177_4000_4593 197
1034 3300042010 Ga0439452_007350 Ga0439452_007350_2731_3324 197
1035 3300042010 Ga0439452_011156 Ga0439452_011156_443_1036 197
1036 3300042013 Ga0439456_000065 Ga0439456_000065_15382_15975 197
1037 3300042013 Ga0439456_003150 Ga0439456_003150_215_808 197
1038 3300042016 Ga0439463_000583 Ga0439463_000583_8709_9302 197
1039 3300042016 Ga0439463_000621 Ga0439463_000621_3393_3986 197
1040 3300042016 Ga0439463_000657 Ga0439463_000657_6112_6711 197
1041 3300042016 Ga0439463_003410 Ga0439463_003410_3422_4015 197
1042 3300042016 Ga0439463_081351 Ga0439463_081351_92_685 197
1043 3300042016 Ga0439463_101722 Ga0439463_101722_25_624 197
1044 3300042115 Ga0450911_000330 Ga0450911_000330_358_951 197
1045 3300042115 Ga0450911_000833 Ga0450911_000833_3697_4290 197
1046 3300042115 Ga0450911_001999 Ga0450911_001999_474_1067 197
1047 3300042121 Ga0450919_000202 Ga0450919_000202_5623_6216 197
1048 3300042124 Ga0450922_000708 Ga0450922_000708_2840_3433 197
1049 3300042124 Ga0450922_004640 Ga0450922_004640_504_1097 197
1050 3300042125 Ga0450923_015924 Ga0450923_015924_528_1121 197
1051 3300042127 Ga0450890_012117 Ga0450890_012117_350_943 197
1052 3300042136 Ga0450900_003588 Ga0450900_003588_489_1082 197
1053 3300042137 Ga0450902_000962 Ga0450902_000962_885_1478 197
1054 3300042138 Ga0450903_001195 Ga0450903_001195_493_1086 197
1055 3300042138 Ga0450903_020645 Ga0450903_020645_387_980 197
1056 3300042139 Ga0450904_000169 Ga0450904_000169_36_629 197
1057 3300042139 Ga0450904_001465 Ga0450904_001465_2680_3273 197
1058 3300042142 Ga0450905_000181 Ga0450905_000181_4865_5458 197
1059 3300042142 Ga0450905_000890 Ga0450905_000890_2605_3198 197
1060 3300042142 Ga0450905_027399 Ga0450905_027399_16_609 197
1061 3300042142 Ga0450905_028833 Ga0450905_028833_213_806 197
1062 3300042145 Ga0450906_001647 Ga0450906_001647_2538_3131 197
1063 3300042145 Ga0450906_002103 Ga0450906_002103_2967_3560 197
1064 3300042145 Ga0450906_004720 Ga0450906_004720_1818_2411 197
1065 3300042146 Ga0450907_000429 Ga0450907_000429_9363_9956 197
1066 3300042146 Ga0450907_000808 Ga0450907_000808_4114_4707 197
1067 3300042146 Ga0450907_001432 Ga0450907_001432_2284_2877 197
1068 3300042147 Ga0450910_001051 Ga0450910_001051_2247_2840 197
1069 3300042147 Ga0450910_036561 Ga0450910_036561_25_618 197
1070 3300042156 Ga0439446_0001073 Ga0439446_0001073_2538_3131 197
1071 3300042156 Ga0439446_0002987 Ga0439446_0002987_3064_3657 197
1072 3300042156 Ga0439446_0009059 Ga0439446_0009059_1764_2360 197
1073 3300042184 Ga0450908_006477 Ga0450908_006477_116_709 197
1074 3300042184 Ga0450908_008529 Ga0450908_008529_1196_1789 197
1075 3300042184 Ga0450908_028276 Ga0450908_028276_192_785 197
1076 3300042185 Ga0450909_000342 Ga0450909_000342_2963_3556 197
1077 3300042185 Ga0450909_001538 Ga0450909_001538_119_712 197
1078 3300042185 Ga0450909_001968 Ga0450909_001968_1877_2470 197
1079 3300042435 Ga0439434_0002178 Ga0439434_0002178_2854_3447 197
1080 3300042439 Ga0439464_0008172 Ga0439464_0008172_1283_1879 197
1081 3300042439 Ga0439464_0081592 Ga0439464_0081592_163_756 197
1082 3300042461 Ga0439460_0003807 Ga0439460_0003807_529_1122 197
1083 3300042461 Ga0439460_0015112 Ga0439460_0015112_21_614 197
1084 3300042461 Ga0439460_0016606 Ga0439460_0016606_1048_1641 197
1085 3300042530 Ga0450916_000500 Ga0450916_000500_1480_2073 197
1086 3300042531 Ga0450918_001692 Ga0450918_001692_3171_3764 197
1087 3300042533 Ga0450901_001121 Ga0450901_001121_1832_2425 197
1088 3300042533 Ga0450901_005971 Ga0450901_005971_637_1230 197
1089 3300046452 Ga0495617_004709 Ga0495617_004709_3266_3859 197
1090 3300046452 Ga0495617_008604 Ga0495617_008604_2901_3494 197
1091 3300046452 Ga0495617_030346 Ga0495617_030346_1052_1645 197
1092 3300046452 Ga0495617_031696 Ga0495617_031696_262_855 197
1093 3300046452 Ga0495617_052121 Ga0495617_052121_709_1302 197
1094 3300046452 Ga0495617_084411 Ga0495617_084411_64_759 197
1095 3300046453 Ga0495627_000236 Ga0495627_000236_43282_43896 197
1096 3300046453 Ga0495627_000913 Ga0495627_000913_13199_13798 197
1097 3300046453 Ga0495627_005326 Ga0495627_005326_4174_4767 197
1098 3300046453 Ga0495627_025161 Ga0495627_025161_878_1471 197
1099 3300046453 Ga0495627_046126 Ga0495627_046126_102_701 197
1100 3300046455 Ga0495603_0018220 Ga0495603_0018220_535_1128 197
1101 3300046457 Ga0495590_0005795 Ga0495590_0005795_3232_3825 197
1102 3300046458 Ga0495591_000262 Ga0495591_000262_14666_15280 197
1103 3300046458 Ga0495591_000781 Ga0495591_000781_7720_8319 197
1104 3300046458 Ga0495591_000908 Ga0495591_000908_10842_11441 197
1105 3300046458 Ga0495591_001525 Ga0495591_001525_3170_3763 197
1106 3300046458 Ga0495591_004619 Ga0495591_004619_4101_4700 197
1107 3300046458 Ga0495591_004914 Ga0495591_004914_138_737 197
1108 3300046458 Ga0495591_006798 Ga0495591_006798_4165_4758 197
1109 3300046458 Ga0495591_009769 Ga0495591_009769_41_634 197
1110 3300046458 Ga0495591_010141 Ga0495591_010141_3005_3598 197
1111 3300046458 Ga0495591_011780 Ga0495591_011780_1681_2274 197
1112 3300046458 Ga0495591_012435 Ga0495591_012435_126_719 197
1113 3300046458 Ga0495591_026194 Ga0495591_026194_762_1355 197
1114 3300046458 Ga0495591_030140 Ga0495591_030140_424_1023 197
1115 3300046460 Ga0495638_0005263 Ga0495638_0005263_2862_3455 197
1116 3300046460 Ga0495638_0005629 Ga0495638_0005629_5531_6124 197
1117 3300046460 Ga0495638_0017411 Ga0495638_0017411_3172_3765 197
1118 3300046460 Ga0495638_0187744 Ga0495638_0187744_77_670 197
1119 3300046460 Ga0495638_0221720 Ga0495638_0221720_267_860 197
1120 3300046463 Ga0495653_0003057 Ga0495653_0003057_5862_6461 197
1121 3300046463 Ga0495653_0012722 Ga0495653_0012722_892_1485 197
1122 3300046463 Ga0495653_0020087 Ga0495653_0020087_60_752 197
1123 3300046463 Ga0495653_0136662 Ga0495653_0136662_357_950 197
1124 3300046471 Ga0495650_0000573 Ga0495650_0000573_13312_13911 197
1125 3300046471 Ga0495650_0001753 Ga0495650_0001753_13397_13996 197
1126 3300046471 Ga0495650_0005282 Ga0495650_0005282_4661_5254 197
1127 3300046471 Ga0495650_0015102 Ga0495650_0015102_908_1501 197
1128 3300046471 Ga0495650_0027049 Ga0495650_0027049_1375_1968 197
1129 3300046474 Ga0495605_0000278 Ga0495605_0000278_42343_42942 197
1130 3300046474 Ga0495605_0000305 Ga0495605_0000305_38561_39160 197
1131 3300046474 Ga0495605_0000761 Ga0495605_0000761_14556_15170 197
1132 3300046474 Ga0495605_0000930 Ga0495605_0000930_11382_11981 197
1133 3300046474 Ga0495605_0001833 Ga0495605_0001833_10747_11346 197
1134 3300046474 Ga0495605_0002875 Ga0495605_0002875_7952_8551 197
1135 3300046474 Ga0495605_0007779 Ga0495605_0007779_1830_2429 197
1136 3300046474 Ga0495605_0013475 Ga0495605_0013475_2469_3062 197
1137 3300046474 Ga0495605_0017237 Ga0495605_0017237_3229_3822 197
1138 3300046474 Ga0495605_0017789 Ga0495605_0017789_53_646 197
1139 3300046474 Ga0495605_0021303 Ga0495605_0021303_2382_2975 197
1140 3300046474 Ga0495605_0021395 Ga0495605_0021395_300_893 197
1141 3300046474 Ga0495605_0138870 Ga0495605_0138870_323_916 197
1142 3300046474 Ga0495605_0190236 Ga0495605_0190236_220_813 197
1143 3300046475 Ga0495639_0005256 Ga0495639_0005256_4624_5217 197
1144 3300046475 Ga0495639_0179689 Ga0495639_0179689_361_954 197
1145 3300046491 Ga0495584_0001213 Ga0495584_0001213_4968_5561 197
1146 3300046491 Ga0495584_0019638 Ga0495584_0019638_2425_3024 197
1147 3300046491 Ga0495584_0020294 Ga0495584_0020294_2442_3035 197
1148 3300046491 Ga0495584_0021544 Ga0495584_0021544_2563_3156 197
1149 3300046491 Ga0495584_0027557 Ga0495584_0027557_2188_2781 197
1150 3300046491 Ga0495584_0036567 Ga0495584_0036567_1630_2223 197
1151 3300046491 Ga0495584_0066669 Ga0495584_0066669_626_1219 197
1152 3300046491 Ga0495584_0365422 Ga0495584_0365422_62_661 197
1153 3300046492 Ga0495585_0002376 Ga0495585_0002376_2812_3405 197
1154 3300046492 Ga0495585_0004219 Ga0495585_0004219_7082_7681 197
1155 3300046492 Ga0495585_0005216 Ga0495585_0005216_3689_4288 197
1156 3300046492 Ga0495585_0034066 Ga0495585_0034066_1535_2128 197
1157 3300046492 Ga0495585_0176203 Ga0495585_0176203_187_780 197
1158 3300046492 Ga0495585_0206879 Ga0495585_0206879_213_806 197
1159 3300046499 Ga0495594_0000635 Ga0495594_0000635_14492_15091 197
1160 3300046499 Ga0495594_0257316 Ga0495594_0257316_367_960 197
1161 3300046500 Ga0495596_0000396 Ga0495596_0000396_10009_10602 197
1162 3300046500 Ga0495596_0012585 Ga0495596_0012585_81_674 197
1163 3300046500 Ga0495596_0014380 Ga0495596_0014380_2446_3045 197
1164 3300046501 Ga0495607_0001037 Ga0495607_0001037_14569_15168 197
1165 3300046501 Ga0495607_0001512 Ga0495607_0001512_14306_14905 197
1166 3300046501 Ga0495607_0001663 Ga0495607_0001663_7069_7668 197
1167 3300046501 Ga0495607_0001685 Ga0495607_0001685_3972_4586 197
1168 3300046501 Ga0495607_0001747 Ga0495607_0001747_10161_10754 197
1169 3300046501 Ga0495607_0001805 Ga0495607_0001805_3242_3841 197
1170 3300046501 Ga0495607_0002473 Ga0495607_0002473_12952_13551 197
1171 3300046501 Ga0495607_0010360 Ga0495607_0010360_2703_3302 197
1172 3300046501 Ga0495607_0026373 Ga0495607_0026373_44_637 197
1173 3300046501 Ga0495607_0029172 Ga0495607_0029172_1668_2261 197
1174 3300046501 Ga0495607_0038891 Ga0495607_0038891_2064_2663 197
1175 3300046501 Ga0495607_0082023 Ga0495607_0082023_590_1189 197
1176 3300046501 Ga0495607_0167961 Ga0495607_0167961_232_831 197
1177 3300046501 Ga0495607_0242365 Ga0495607_0242365_58_651 197
1178 3300046506 Ga0495583_0000504 Ga0495583_0000504_41027_41626 197
1179 3300046506 Ga0495583_0002263 Ga0495583_0002263_2750_3349 197
1180 3300046506 Ga0495583_0002447 Ga0495583_0002447_6410_7009 197
1181 3300046506 Ga0495583_0003618 Ga0495583_0003618_8076_8675 197
1182 3300046506 Ga0495583_0003780 Ga0495583_0003780_7342_7941 197
1183 3300046506 Ga0495583_0011770 Ga0495583_0011770_323_916 197
1184 3300046506 Ga0495583_0014046 Ga0495583_0014046_2885_3484 197
1185 3300046506 Ga0495583_0204531 Ga0495583_0204531_76_669 197
1186 3300046507 Ga0495606_0000631 Ga0495606_0000631_18605_19201 197
1187 3300046507 Ga0495606_0000785 Ga0495606_0000785_33509_34108 197
1188 3300046507 Ga0495606_0000946 Ga0495606_0000946_7070_7669 197
1189 3300046507 Ga0495606_0003478 Ga0495606_0003478_7135_7734 197
1190 3300046507 Ga0495606_0006363 Ga0495606_0006363_7425_8024 197
1191 3300046507 Ga0495606_0015783 Ga0495606_0015783_3462_4055 197
1192 3300046507 Ga0495606_0019840 Ga0495606_0019840_4159_4752 197
1193 3300046507 Ga0495606_0030451 Ga0495606_0030451_2253_2846 197
1194 3300046507 Ga0495606_0044825 Ga0495606_0044825_2316_2909 197
1195 3300046507 Ga0495606_0299671 Ga0495606_0299671_213_806 197
1196 3300046512 Ga0495610_0013365 Ga0495610_0013365_3412_4005 197
1197 3300046512 Ga0495610_0015618 Ga0495610_0015618_2861_3454 197
1198 3300046512 Ga0495610_0015842 Ga0495610_0015842_3009_3608 197
1199 3300046512 Ga0495610_0015851 Ga0495610_0015851_2646_3245 197
1200 3300046512 Ga0495610_0022943 Ga0495610_0022943_2732_3325 197
1201 3300046512 Ga0495610_0032286 Ga0495610_0032286_1505_2104 197
1202 3300046512 Ga0495610_0038404 Ga0495610_0038404_754_1347 197
1203 3300046512 Ga0495610_0078851 Ga0495610_0078851_258_851 197
1204 3300046512 Ga0495610_0186919 Ga0495610_0186919_220_813 197
1205 3300046513 Ga0495616_0001961 Ga0495616_0001961_10166_10759 197
1206 3300046513 Ga0495616_0011668 Ga0495616_0011668_217_810 197
1207 3300046513 Ga0495616_0015137 Ga0495616_0015137_963_1556 197
1208 3300046513 Ga0495616_0020625 Ga0495616_0020625_2960_3553 197
1209 3300046513 Ga0495616_0022288 Ga0495616_0022288_2248_2847 197
1210 3300046513 Ga0495616_0024304 Ga0495616_0024304_2336_2929 197
1211 3300046515 Ga0495620_0000033 Ga0495620_0000033_14380_14973 197
1212 3300046515 Ga0495620_0000153 Ga0495620_0000153_14562_15161 197
1213 3300046515 Ga0495620_0001468 Ga0495620_0001468_12627_13226 197
1214 3300046515 Ga0495620_0004357 Ga0495620_0004357_3182_3781 197
1215 3300046515 Ga0495620_0006660 Ga0495620_0006660_4187_4780 197
1216 3300046515 Ga0495620_0015151 Ga0495620_0015151_363_956 197
1217 3300046515 Ga0495620_0016016 Ga0495620_0016016_3117_3710 197
1218 3300046515 Ga0495620_0019810 Ga0495620_0019810_2635_3228 197
1219 3300046515 Ga0495620_0038017 Ga0495620_0038017_96_695 197
1220 3300046517 Ga0495630_0785259 Ga0495630_0785259_64_657 197
1221 3300046518 Ga0495631_0000885 Ga0495631_0000885_7150_7743 197
1222 3300046518 Ga0495631_0001408 Ga0495631_0001408_6606_7205 197
1223 3300046518 Ga0495631_0007235 Ga0495631_0007235_3416_4015 197
1224 3300046518 Ga0495631_0014592 Ga0495631_0014592_2073_2672 197
1225 3300046518 Ga0495631_0049403 Ga0495631_0049403_1177_1770 197
1226 3300046518 Ga0495631_0103891 Ga0495631_0103891_128_727 197
1227 3300046519 Ga0495632_0000399 Ga0495632_0000399_14384_14977 197
1228 3300046519 Ga0495632_0001643 Ga0495632_0001643_7542_8135 197
1229 3300046519 Ga0495632_0006003 Ga0495632_0006003_4143_4736 197
1230 3300046519 Ga0495632_0006716 Ga0495632_0006716_4144_4743 197
1231 3300046519 Ga0495632_0007833 Ga0495632_0007833_4527_5120 197
1232 3300046519 Ga0495632_0013417 Ga0495632_0013417_1364_1957 197
1233 3300046519 Ga0495632_0021904 Ga0495632_0021904_255_848 197
1234 3300046519 Ga0495632_0041459 Ga0495632_0041459_1645_2238 197
1235 3300046519 Ga0495632_0044979 Ga0495632_0044979_87_680 197
1236 3300046519 Ga0495632_0047289 Ga0495632_0047289_963_1562 197
1237 3300046519 Ga0495632_0083550 Ga0495632_0083550_567_1160 197
1238 3300046519 Ga0495632_0094969 Ga0495632_0094969_226_819 197
1239 3300046519 Ga0495632_0140922 Ga0495632_0140922_334_933 197
1240 3300046519 Ga0495632_0200603 Ga0495632_0200603_80_673 197
1241 3300046520 Ga0495637_0001305 Ga0495637_0001305_13403_14002 197
1242 3300046520 Ga0495637_0001314 Ga0495637_0001314_11822_12421 197
1243 3300046520 Ga0495637_0001512 Ga0495637_0001512_3011_3604 197
1244 3300046520 Ga0495637_0002210 Ga0495637_0002210_7591_8190 197
1245 3300046520 Ga0495637_0002604 Ga0495637_0002604_2960_3574 197
1246 3300046520 Ga0495637_0005444 Ga0495637_0005444_2986_3579 197
1247 3300046520 Ga0495637_0006986 Ga0495637_0006986_4815_5408 197
1248 3300046520 Ga0495637_0014387 Ga0495637_0014387_190_783 197
1249 3300046520 Ga0495637_0015260 Ga0495637_0015260_329_928 197
1250 3300046520 Ga0495637_0025214 Ga0495637_0025214_101_694 197
1251 3300046520 Ga0495637_0113249 Ga0495637_0113249_189_782 197
1252 3300046520 Ga0495637_0150094 Ga0495637_0150094_213_806 197
1253 3300046522 Ga0495643_0000652 Ga0495643_0000652_25809_26402 197
1254 3300046522 Ga0495643_0001069 Ga0495643_0001069_18705_19301 197
1255 3300046522 Ga0495643_0001356 Ga0495643_0001356_7828_8421 197
1256 3300046522 Ga0495643_0014147 Ga0495643_0014147_4100_4693 197
1257 3300046522 Ga0495643_0021682 Ga0495643_0021682_2726_3325 197
1258 3300046522 Ga0495643_0024610 Ga0495643_0024610_602_1201 197
1259 3300046522 Ga0495643_0028517 Ga0495643_0028517_977_1570 197
1260 3300046522 Ga0495643_0041178 Ga0495643_0041178_263_856 197
1261 3300046522 Ga0495643_0178973 Ga0495643_0178973_139_732 197
1262 3300046523 Ga0495644_0004207 Ga0495644_0004207_4041_4634 197
1263 3300046523 Ga0495644_0010967 Ga0495644_0010967_48_641 197
1264 3300046523 Ga0495644_0017583 Ga0495644_0017583_674_1273 197
1265 3300046523 Ga0495644_0066053 Ga0495644_0066053_134_748 197
1266 3300046524 Ga0495648_0002072 Ga0495648_0002072_1425_2018 197
1267 3300046524 Ga0495648_0002328 Ga0495648_0002328_14228_14821 197
1268 3300046524 Ga0495648_0002836 Ga0495648_0002836_11962_12561 197
1269 3300046524 Ga0495648_0007939 Ga0495648_0007939_5760_6359 197
1270 3300046524 Ga0495648_0009716 Ga0495648_0009716_3659_4252 197
1271 3300046524 Ga0495648_0022409 Ga0495648_0022409_66_659 197
1272 3300046524 Ga0495648_0024962 Ga0495648_0024962_478_1071 197
1273 3300046524 Ga0495648_0029232 Ga0495648_0029232_3023_3616 197
1274 3300046524 Ga0495648_0048529 Ga0495648_0048529_73_666 197
1275 3300046524 Ga0495648_0076376 Ga0495648_0076376_1021_1614 197
1276 3300046524 Ga0495648_0148052 Ga0495648_0148052_315_914 197
1277 3300046524 Ga0495648_0285304 Ga0495648_0285304_162_755 197
1278 3300046524 Ga0495648_0318895 Ga0495648_0318895_47_640 197
1279 3300046524 Ga0495648_0327548 Ga0495648_0327548_49_642 197
1280 3300046526 Ga0495666_0081156 Ga0495666_0081156_32_625 197
1281 3300046526 Ga0495666_0183558 Ga0495666_0183558_354_947 197
1282 3300046528 Ga0495642_0000848 Ga0495642_0000848_11083_11676 197
1283 3300046528 Ga0495642_0000910 Ga0495642_0000910_10030_10623 197
1284 3300046528 Ga0495642_0116356 Ga0495642_0116356_179_772 197
1285 3300046530 Ga0495654_0001290 Ga0495654_0001290_3370_3969 197
1286 3300046530 Ga0495654_0001456 Ga0495654_0001456_14989_15588 197
1287 3300046530 Ga0495654_0001804 Ga0495654_0001804_588_1187 197
1288 3300046530 Ga0495654_0003274 Ga0495654_0003274_5426_6019 197
1289 3300046530 Ga0495654_0007193 Ga0495654_0007193_1010_1609 197
1290 3300046530 Ga0495654_0009829 Ga0495654_0009829_2537_3130 197
1291 3300046530 Ga0495654_0010691 Ga0495654_0010691_217_810 197
1292 3300046530 Ga0495654_0013743 Ga0495654_0013743_2826_3419 197
1293 3300046530 Ga0495654_0020358 Ga0495654_0020358_413_1006 197
1294 3300046530 Ga0495654_0055833 Ga0495654_0055833_1056_1649 197
1295 3300046530 Ga0495654_0080252 Ga0495654_0080252_854_1447 197
1296 3300046530 Ga0495654_0120863 Ga0495654_0120863_376_969 197
1297 3300046530 Ga0495654_0169578 Ga0495654_0169578_315_908 197
1298 3300046535 Ga0495586_0130925 Ga0495586_0130925_143_736 197
1299 3300046536 Ga0495587_0097271 Ga0495587_0097271_539_1132 197
1300 3300046536 Ga0495587_0330039 Ga0495587_0330039_213_806 197
1301 3300046538 Ga0495609_0000166 Ga0495609_0000166_53867_54466 197
1302 3300046538 Ga0495609_0000226 Ga0495609_0000226_41105_41704 197
1303 3300046538 Ga0495609_0000662 Ga0495609_0000662_12320_12919 197
1304 3300046538 Ga0495609_0007009 Ga0495609_0007009_1818_2411 197
1305 3300046538 Ga0495609_0009026 Ga0495609_0009026_213_806 197
1306 3300046538 Ga0495609_0030491 Ga0495609_0030491_322_915 197
1307 3300046542 Ga0495597_0000235 Ga0495597_0000235_14549_15163 197
1308 3300046542 Ga0495597_0007076 Ga0495597_0007076_2011_2604 197
1309 3300046542 Ga0495597_0011979 Ga0495597_0011979_1329_1922 197
1310 3300046542 Ga0495597_0013412 Ga0495597_0013412_225_824 197
1311 3300046542 Ga0495597_0013498 Ga0495597_0013498_16_609 197
1312 3300046542 Ga0495597_0017680 Ga0495597_0017680_1581_2174 197
1313 3300046542 Ga0495597_0084303 Ga0495597_0084303_365_958 197
1314 3300046542 Ga0495597_0084602 Ga0495597_0084602_337_930 197
1315 3300046542 Ga0495597_0088977 Ga0495597_0088977_347_940 197
1316 3300046543 Ga0495645_0057046 Ga0495645_0057046_134_733 197
1317 3300046557 Ga0495622_0002766 Ga0495622_0002766_3173_3766 197
1318 3300046557 Ga0495622_0005690 Ga0495622_0005690_4840_5433 197
1319 3300046557 Ga0495622_0009436 Ga0495622_0009436_3857_4450 197
1320 3300046557 Ga0495622_0015866 Ga0495622_0015866_2772_3467 197
1321 3300046558 Ga0495633_0000291 Ga0495633_0000291_14766_15365 197
1322 3300046558 Ga0495633_0005673 Ga0495633_0005673_3183_3776 197
1323 3300046616 Ga0495668_0004076 Ga0495668_0004076_3106_3699 197
1324 3300046616 Ga0495668_0016707 Ga0495668_0016707_3374_3973 197
1325 3300046616 Ga0495668_0025934 Ga0495668_0025934_735_1334 197
1326 3300046616 Ga0495668_0068055 Ga0495668_0068055_1000_1599 197
1327 3300046648 Ga0495611_0003776 Ga0495611_0003776_1292_1891 197
1328 3300046648 Ga0495611_0007464 Ga0495611_0007464_1348_1947 197
1329 3300046648 Ga0495611_0008058 Ga0495611_0008058_62_655 197
1330 3300046648 Ga0495611_0035548 Ga0495611_0035548_1553_2146 197
1331 3300046660 Ga0495625_0000499 Ga0495625_0000499_44665_45264 197
1332 3300046660 Ga0495625_0008349 Ga0495625_0008349_4382_4975 197
1333 3300046660 Ga0495625_0012667 Ga0495625_0012667_6089_6682 197
1334 3300046660 Ga0495625_0015249 Ga0495625_0015249_2349_2963 197
1335 3300046660 Ga0495625_0026052 Ga0495625_0026052_2444_3040 197
1336 3300046660 Ga0495625_0159973 Ga0495625_0159973_662_1255 197
1337 3300046660 Ga0495625_0222080 Ga0495625_0222080_85_678 197
1338 3300046660 Ga0495625_0405662 Ga0495625_0405662_41_634 197
1339 3300046664 Ga0495659_0010788 Ga0495659_0010788_2169_2762 197
1340 3300046664 Ga0495659_0049064 Ga0495659_0049064_827_1420 197
1341 3300046665 Ga0495661_0000277 Ga0495661_0000277_13561_14160 197
1342 3300046665 Ga0495661_0000294 Ga0495661_0000294_41662_42261 197
1343 3300046665 Ga0495661_0000320 Ga0495661_0000320_13465_14064 197
1344 3300046665 Ga0495661_0000340 Ga0495661_0000340_37619_38218 197
1345 3300046665 Ga0495661_0002305 Ga0495661_0002305_5515_6108 197
1346 3300046665 Ga0495661_0004957 Ga0495661_0004957_7565_8164 197
1347 3300046665 Ga0495661_0038949 Ga0495661_0038949_48_641 197
1348 3300046665 Ga0495661_0059757 Ga0495661_0059757_53_646 197
1349 3300046665 Ga0495661_0119099 Ga0495661_0119099_737_1330 197
1350 3300046665 Ga0495661_0160464 Ga0495661_0160464_247_846 197
1351 3300046674 Ga0495588_0005211 Ga0495588_0005211_1840_2433 197
1352 3300046674 Ga0495588_0216760 Ga0495588_0216760_396_989 197
1353 3300046675 Ga0495657_0150817 Ga0495657_0150817_561_1154 197
1354 3300046680 Ga0495646_0044249 Ga0495646_0044249_560_1153 197
1355 3300046684 Ga0495669_0012437 Ga0495669_0012437_2440_3033 197
1356 3300046691 Ga0495670_0003231 Ga0495670_0003231_3311_3904 197
1357 3300046691 Ga0495670_0013360 Ga0495670_0013360_3026_3619 197
1358 3300046691 Ga0495670_0014883 Ga0495670_0014883_460_1053 197
1359 3300046691 Ga0495670_0018802 Ga0495670_0018802_20_613 197
1360 3300046691 Ga0495670_0023445 Ga0495670_0023445_1724_2323 197
1361 3300046691 Ga0495670_0055652 Ga0495670_0055652_976_1575 197
1362 3300046691 Ga0495670_0093948 Ga0495670_0093948_844_1437 197
1363 3300046691 Ga0495670_0374124 Ga0495670_0374124_163_756 197
1364 3300046692 Ga0495671_0001637 Ga0495671_0001637_4034_4633 197
1365 3300046692 Ga0495671_0002699 Ga0495671_0002699_10266_10859 197
1366 3300046692 Ga0495671_0005887 Ga0495671_0005887_2520_3113 197
1367 3300046692 Ga0495671_0006472 Ga0495671_0006472_4258_4854 197
1368 3300046692 Ga0495671_0007885 Ga0495671_0007885_3103_3696 197
1369 3300046692 Ga0495671_0008224 Ga0495671_0008224_4730_5329 197
1370 3300046692 Ga0495671_0010054 Ga0495671_0010054_4363_4962 197
1371 3300046692 Ga0495671_0016386 Ga0495671_0016386_3230_3823 197
1372 3300046692 Ga0495671_0073221 Ga0495671_0073221_1013_1612 197
1373 3300046692 Ga0495671_0084871 Ga0495671_0084871_828_1421 197
1374 3300046692 Ga0495671_0248196 Ga0495671_0248196_123_716 197
1375 3300046692 Ga0495671_0344760 Ga0495671_0344760_48_641 197
1376 3300046694 Ga0495649_0001345 Ga0495649_0001345_7903_8496 197
1377 3300046694 Ga0495649_0001639 Ga0495649_0001639_13578_14177 197
1378 3300046694 Ga0495649_0009394 Ga0495649_0009394_1504_2100 197
1379 3300046694 Ga0495649_0012897 Ga0495649_0012897_2916_3509 197
1380 3300046694 Ga0495649_0022895 Ga0495649_0022895_134_727 197
1381 3300046694 Ga0495649_0067197 Ga0495649_0067197_347_961 197
1382 3300046694 Ga0495649_0261306 Ga0495649_0261306_117_713 197
1383 3300046694 Ga0495649_0268344 Ga0495649_0268344_214_807 197
1384 3300046694 Ga0495649_0368916 Ga0495649_0368916_21_614 197
1385 3300046794 Ga0495589_0000676 Ga0495589_0000676_10222_10821 197
1386 3300046794 Ga0495589_0000890 Ga0495589_0000890_7762_8355 197
1387 3300046794 Ga0495589_0004594 Ga0495589_0004594_3814_4407 197
1388 3300046794 Ga0495589_0007330 Ga0495589_0007330_4127_4720 197
1389 3300046794 Ga0495589_0012518 Ga0495589_0012518_1527_2120 197
1390 3300046794 Ga0495589_0015583 Ga0495589_0015583_2875_3468 197
1391 3300046810 Ga0495660_0000629 Ga0495660_0000629_9978_10577 197
1392 3300046810 Ga0495660_0004190 Ga0495660_0004190_959_1573 197
1393 3300046810 Ga0495660_0016508 Ga0495660_0016508_2040_2639 197
1394 3300046810 Ga0495660_0016932 Ga0495660_0016932_3471_4064 197
1395 3300046810 Ga0495660_0021737 Ga0495660_0021737_296_889 197
1396 3300046810 Ga0495660_0025598 Ga0495660_0025598_2710_3309 197
1397 3300046810 Ga0495660_0053803 Ga0495660_0053803_1489_2082 197
1398 3300046810 Ga0495660_0077179 Ga0495660_0077179_1026_1619 197
1399 3300046810 Ga0495660_0086846 Ga0495660_0086846_355_948 197
1400 3300046810 Ga0495660_0102114 Ga0495660_0102114_559_1152 197
1401 3300046810 Ga0495660_0262593 Ga0495660_0262593_39_632 197
1402 3300047315 Ga0495581_0092206 Ga0495581_0092206_482_1075 197
1403 3300047317 Ga0495604_0019118 Ga0495604_0019118_54_647 197
1404 3300047317 Ga0495604_0229376 Ga0495604_0229376_595_1188 197
1405 3300047318 Ga0495636_0002965 Ga0495636_0002965_5020_5613 197
1406 3300047318 Ga0495636_0055488 Ga0495636_0055488_982_1575 197
1407 3300047320 Ga0495672_0001307 Ga0495672_0001307_9280_9879 197
1408 3300047320 Ga0495672_0003882 Ga0495672_0003882_1805_2398 197
1409 3300047320 Ga0495672_0004186 Ga0495672_0004186_3163_3756 197
1410 3300047320 Ga0495672_0005455 Ga0495672_0005455_220_813 197
1411 3300047320 Ga0495672_0008854 Ga0495672_0008854_1895_2494 197
1412 3300047320 Ga0495672_0011861 Ga0495672_0011861_2405_3004 197
1413 3300047320 Ga0495672_0014942 Ga0495672_0014942_1084_1677 197
1414 3300047320 Ga0495672_0025572 Ga0495672_0025572_72_764 197
1415 3300047320 Ga0495672_0027754 Ga0495672_0027754_2577_3176 197
1416 3300047320 Ga0495672_0070870 Ga0495672_0070870_635_1228 197
1417 3300047320 Ga0495672_0170025 Ga0495672_0170025_197_790 197
1418 3300047320 Ga0495672_0240381 Ga0495672_0240381_13_606 197
1419 3300047320 Ga0495672_0243557 Ga0495672_0243557_26_619 197
1420 3300047321 Ga0495676_0000125 Ga0495676_0000125_44589_45188 197
1421 3300047321 Ga0495676_0009441 Ga0495676_0009441_3611_4210 197
1422 3300047322 Ga0495680_0041730 Ga0495680_0041730_3003_3596 197
1423 3300047322 Ga0495680_0077699 Ga0495680_0077699_1646_2239 197
1424 3300047322 Ga0495680_0081777 Ga0495680_0081777_270_863 197
1425 3300047322 Ga0495680_0209887 Ga0495680_0209887_654_1247 197
1426 3300047323 Ga0495683_0000016 Ga0495683_0000016_13315_13914 197
1427 3300047323 Ga0495683_0000196 Ga0495683_0000196_14711_15310 197
1428 3300047323 Ga0495683_0001587 Ga0495683_0001587_3057_3650 197
1429 3300047323 Ga0495683_0004413 Ga0495683_0004413_2938_3531 197
1430 3300047323 Ga0495683_0018946 Ga0495683_0018946_75_668 197
1431 3300047323 Ga0495683_0022738 Ga0495683_0022738_2170_2769 197
1432 3300047323 Ga0495683_0023068 Ga0495683_0023068_2429_3022 197
1433 3300047323 Ga0495683_0056848 Ga0495683_0056848_1071_1664 197
1434 3300047323 Ga0495683_0107453 Ga0495683_0107453_72_665 197
1435 3300047443 Ga0495687_003652 Ga0495687_003652_205_798 197
1436 3300047443 Ga0495687_052182 Ga0495687_052182_987_1580 197
1437 3300047444 Ga0495675_0031107 Ga0495675_0031107_2106_2699 197
1438 3300047444 Ga0495675_0049674 Ga0495675_0049674_1408_2001 197
1439 3300047446 Ga0495679_000414 Ga0495679_000414_17925_18524 197
1440 3300047446 Ga0495679_000987 Ga0495679_000987_13711_14310 197
1441 3300047446 Ga0495679_060081 Ga0495679_060081_39_632 197
1442 3300047446 Ga0495679_077259 Ga0495679_077259_237_830 197
1443 3300047447 Ga0495685_035925 Ga0495685_035925_790_1383 197
1444 3300047469 Ga0495673_0000789 Ga0495673_0000789_13979_14578 197
1445 3300047469 Ga0495673_0002977 Ga0495673_0002977_8811_9410 197
1446 3300047469 Ga0495673_0005027 Ga0495673_0005027_4323_4916 197
1447 3300047469 Ga0495673_0005263 Ga0495673_0005263_1994_2593 197
1448 3300047469 Ga0495673_0008041 Ga0495673_0008041_2916_3509 197
1449 3300047469 Ga0495673_0008501 Ga0495673_0008501_985_1584 197
1450 3300047469 Ga0495673_0013086 Ga0495673_0013086_3565_4164 197
1451 3300047469 Ga0495673_0016854 Ga0495673_0016854_178_771 197
1452 3300047469 Ga0495673_0017011 Ga0495673_0017011_489_1082 197
1453 3300047469 Ga0495673_0017395 Ga0495673_0017395_2990_3583 197
1454 3300047469 Ga0495673_0025420 Ga0495673_0025420_735_1328 197
1455 3300047469 Ga0495673_0033006 Ga0495673_0033006_786_1379 197
1456 3300047469 Ga0495673_0072323 Ga0495673_0072323_814_1407 197
1457 3300047470 Ga0495681_0007194 Ga0495681_0007194_3011_3604 197
1458 3300047470 Ga0495681_0008255 Ga0495681_0008255_3680_4273 197
1459 3300047470 Ga0495681_0010039 Ga0495681_0010039_604_1197 197
1460 3300047470 Ga0495681_0015552 Ga0495681_0015552_649_1248 197
1461 3300047470 Ga0495681_0015578 Ga0495681_0015578_84_677 197
1462 3300047470 Ga0495681_0017201 Ga0495681_0017201_3069_3662 197
1463 3300047470 Ga0495681_0018803 Ga0495681_0018803_3065_3760 197
1464 3300047470 Ga0495681_0024719 Ga0495681_0024719_2407_3000 197
1465 3300047470 Ga0495681_0048651 Ga0495681_0048651_213_806 197
1466 3300047470 Ga0495681_0074187 Ga0495681_0074187_419_1012 197
1467 3300047470 Ga0495681_0246626 Ga0495681_0246626_58_651 197
1468 3300047472 Ga0495686_0008947 Ga0495686_0008947_3130_3723 197
1469 3300047472 Ga0495686_0095385 Ga0495686_0095385_420_1013 197
1470 3300047472 Ga0495686_0479454 Ga0495686_0479454_45_644 197
1471 3300047673 Ga0495593_0010538 Ga0495593_0010538_213_806 197
1472 3300048091 Ga0495626_0000283 Ga0495626_0000283_13341_13940 197
1473 3300048091 Ga0495626_0001088 Ga0495626_0001088_14649_15242 197
1474 3300048091 Ga0495626_0005076 Ga0495626_0005076_4333_4926 197
1475 3300048091 Ga0495626_0007445 Ga0495626_0007445_4684_5277 197
1476 3300048091 Ga0495626_0011628 Ga0495626_0011628_49_642 197
1477 3300048091 Ga0495626_0012471 Ga0495626_0012471_28_621 197
1478 3300048091 Ga0495626_0023281 Ga0495626_0023281_498_1091 197
1479 3300048905 Ga0496102_0003362 Ga0496102_0003362_3077_3670 197
1480 3300048906 Ga0496103_0013057 Ga0496103_0013057_33_626 197
1481 3300048913 Ga0496110_0016191 Ga0496110_0016191_970_1563 197
1482 3300048913 Ga0496110_0059052 Ga0496110_0059052_976_1569 197
1483 3300048916 Ga0496113_0218720 Ga0496113_0218720_73_672 197
1484 3300048919 Ga0496116_0000401 Ga0496116_0000401_14367_14960 197
1485 3300048919 Ga0496116_0019798 Ga0496116_0019798_4495_5088 197
1486 3300048919 Ga0496116_0024160 Ga0496116_0024160_2796_3389 197
1487 3300048919 Ga0496116_0026706 Ga0496116_0026706_2886_3590 197
1488 3300048919 Ga0496116_0068396 Ga0496116_0068396_559_1158 197
1489 3300048919 Ga0496116_0152944 Ga0496116_0152944_206_799 197
1490 3300048920 Ga0496117_0001058 Ga0496117_0001058_26935_27528 197
1491 3300048920 Ga0496117_0001828 Ga0496117_0001828_18416_19009 197
1492 3300048920 Ga0496117_0003652 Ga0496117_0003652_2233_2901 197
1493 3300048920 Ga0496117_0003735 Ga0496117_0003735_8037_8630 197
1494 3300048920 Ga0496117_0040319 Ga0496117_0040319_62_655 197
1495 3300048920 Ga0496117_0143023 Ga0496117_0143023_224_817 197
1496 3300048921 Ga0496118_0002905 Ga0496118_0002905_6671_7264 197
1497 3300048921 Ga0496118_0014136 Ga0496118_0014136_2731_3399 197
1498 3300048921 Ga0496118_0114437 Ga0496118_0114437_352_1056 197
1499 3300048921 Ga0496118_0178862 Ga0496118_0178862_660_1259 197
1500 3300048921 Ga0496118_0289465 Ga0496118_0289465_285_884 197
1501 3300048921 Ga0496118_0319819 Ga0496118_0319819_156_749 197
1502 3300048922 Ga0496119_0000071 Ga0496119_0000071_13724_14317 197
1503 3300048922 Ga0496119_0053549 Ga0496119_0053549_1496_2089 197
1504 3300048922 Ga0496119_0139561 Ga0496119_0139561_71_664 197
1505 3300048923 Ga0496120_0031128 Ga0496120_0031128_584_1288 197
1506 3300048924 Ga0496121_0000688 Ga0496121_0000688_47920_48513 197
1507 3300048924 Ga0496121_0003876 Ga0496121_0003876_14698_15297 197
1508 3300048924 Ga0496121_0009864 Ga0496121_0009864_4337_4936 197
1509 3300048924 Ga0496121_0039800 Ga0496121_0039800_2915_3619 197
1510 3300048924 Ga0496121_0063333 Ga0496121_0063333_482_1075 197
1511 3300048924 Ga0496121_0157702 Ga0496121_0157702_26_721 197
1512 3300048924 Ga0496121_0428974 Ga0496121_0428974_62_655 197
1513 3300048925 Ga0496122_0003272 Ga0496122_0003272_14308_14901 197
1514 3300048925 Ga0496122_0003639 Ga0496122_0003639_5942_6541 197
1515 3300048925 Ga0496122_0004379 Ga0496122_0004379_7892_8491 197
1516 3300048925 Ga0496122_0006923 Ga0496122_0006923_7923_8516 197
1517 3300048925 Ga0496122_0022852 Ga0496122_0022852_615_1214 197
1518 3300048925 Ga0496122_0038774 Ga0496122_0038774_3201_3794 197
1519 3300048925 Ga0496122_0128813 Ga0496122_0128813_257_850 197
1520 3300048926 Ga0496123_0002596 Ga0496123_0002596_14792_15385 197
1521 3300048926 Ga0496123_0002904 Ga0496123_0002904_5952_6551 197
1522 3300048926 Ga0496123_0005284 Ga0496123_0005284_9544_10137 197
1523 3300048926 Ga0496123_0032402 Ga0496123_0032402_3173_3766 197
1524 3300048926 Ga0496123_0067519 Ga0496123_0067519_298_897 197
1525 3300048927 Ga0496124_0000730 Ga0496124_0000730_38869_39468 197
1526 3300048927 Ga0496124_0003010 Ga0496124_0003010_6086_6685 197
1527 3300048927 Ga0496124_0006846 Ga0496124_0006846_8646_9239 197
1528 3300048927 Ga0496124_0008721 Ga0496124_0008721_5640_6239 197
1529 3300048927 Ga0496124_0015433 Ga0496124_0015433_3051_3644 197
1530 3300048927 Ga0496124_0047918 Ga0496124_0047918_354_947 197
1531 3300048927 Ga0496124_0049585 Ga0496124_0049585_2919_3512 197
1532 3300048927 Ga0496124_0102599 Ga0496124_0102599_1543_2247 197
1533 3300048927 Ga0496124_0173379 Ga0496124_0173379_690_1283 197
1534 3300048927 Ga0496124_0180524 Ga0496124_0180524_875_1474 197
1535 3300048927 Ga0496124_0222271 Ga0496124_0222271_489_1082 197
1536 3300048928 Ga0496125_0001109 Ga0496125_0001109_14627_15220 197
1537 3300048928 Ga0496125_0006175 Ga0496125_0006175_1588_2181 197
1538 3300048928 Ga0496125_0033200 Ga0496125_0033200_2906_3499 197
1539 3300048928 Ga0496125_0105661 Ga0496125_0105661_1100_1693 197
1540 3300048929 Ga0496126_0030106 Ga0496126_0030106_776_1369 197
1541 3300049459 Ga0495678_000268 Ga0495678_000268_42420_43019 197
1542 3300049459 Ga0495678_001974 Ga0495678_001974_13372_13971 197
1543 3300049459 Ga0495678_002020 Ga0495678_002020_3775_4368 197
1544 3300049459 Ga0495678_009204 Ga0495678_009204_4259_4852 197
1545 3300049459 Ga0495678_009987 Ga0495678_009987_3039_3632 197
1546 3300049459 Ga0495678_014234 Ga0495678_014234_258_851 197
1547 3300049459 Ga0495678_020969 Ga0495678_020969_198_797 197
1548 3300049459 Ga0495678_060988 Ga0495678_060988_174_770 197
1549 3300049460 Ga0495682_0000198 Ga0495682_0000198_33741_34340 197
1550 3300049460 Ga0495682_0000911 Ga0495682_0000911_3105_3704 197
1551 3300049460 Ga0495682_0007131 Ga0495682_0007131_3831_4424 197
1552 3300049460 Ga0495682_0032965 Ga0495682_0032965_997_1590 197
1553 3300049460 Ga0495682_0073475 Ga0495682_0073475_539_1132 197
1554 3300049460 Ga0495682_0101949 Ga0495682_0101949_389_982 197
1555 3300049460 Ga0495682_0115553 Ga0495682_0115553_109_702 197
1556 3300049569 Ga0501032_0208229 Ga0501032_0208229_177_770 197
1557 3300049571 Ga0501034_0000165 Ga0501034_0000165_107718_108386 197
1558 3300049571 Ga0501034_0021097 Ga0501034_0021097_1688_2284 197
1559 3300049571 Ga0501034_0705782 Ga0501034_0705782_224_817 197
1560 3300049571 Ga0501034_0804734 Ga0501034_0804734_17_610 197
1561 3300049573 Ga0501037_0014232 Ga0501037_0014232_531_1124 197
1562 3300049662 Ga0501222_005912 Ga0501222_005912_610_1203 197
1563 3300049853 Ga0501226_000033 Ga0501226_000033_55353_55946 197
1564 3300050491 nmdc:mga00v17_23725_c1 nmdc:mga00v17_23725_c1_303_956 197
1565 3300053125 Ga0500618_005581 Ga0500618_005581_2385_2984 197
1566 3300053125 Ga0500618_008051 Ga0500618_008051_2298_2897 197
1567 3300053135 Ga0500659_0004185 Ga0500659_0004185_5372_6040 197
1568 3300053140 Ga0500573_0019307 Ga0500573_0019307_2686_3300 197
1569 3300053145 Ga0500586_113397 Ga0500586_113397_137_751 197
1570 3300059641 Ga0587068_018319 Ga0587068_018319_234_827 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

40

230

0.96

PF07722

Peptidase_C26

Peptidase C26

98

212

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qur-assembly1.cif.gz_A mapping the allosteric communication network of aminodeoxychorismate synthase 0.9382 1 194
6qur-assembly1.cif.gz_A mapping the allosteric communication network of aminodeoxychorismate synthase 0.9241 1 194
8hx7-assembly1.cif.gz_A crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine 0.9146 2 190
8hx6-assembly1.cif.gz_A crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae 0.9136 2 189
8hx6-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae 0.912 2 189
ID Description Score Start End Superfamily
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9645 1 192 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9594 1 192 3.40.50.880
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.94 1 190 3.40.50.880
af_Q2FYR8_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9232 1 190 3.40.50.880
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9208 1 190 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A432U8T7-F1-model_v4 Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) 0.9859 1 173 GO:0000162
GO:0004049
GO:0005829
AF-A0A3C1SV08-F1-model_v4 Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) 0.9842 1 174 GO:0000162
GO:0004049
GO:0005829
GO:0046654
GO:0046820
AF-A0A0C3RJA9-F1-model_v4 Anthranilate synthase component II (EC 4.1.3.27) 0.9804 44 166 GO:0000162
GO:0004049
GO:0005829
GO:0046654
GO:0046820
AF-A0A432U8T7-F1-model_v4 Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) 0.9803 1 173 GO:0000162
GO:0004049
GO:0005829
AF-A0A3C1SV08-F1-model_v4 Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) 0.9786 1 174 GO:0000162
GO:0004049
GO:0005829
GO:0046654
GO:0046820

Feature Viewer

pLDDT pTM Quality
93.37 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map