F494751

General Info

Members Datasets Scaffolds Average Seq Length
1558 812 1234 280

Family's Representative Sequence

Representative Sequence 3300035083|Ga0373926_0042224|Ga0373926_0042224_306_1292
Length 328
Sequence MVNRTDERVTPENRLGTYLKDRRTKLDPAALGFPAQRRRTPGLRREEVAQRANISATWYTWLEQGRGGAPSADVLERIARALMLTDVEREHLFLLGLGRPPDVRYQTSEGVTPRLQRVLDALEFSPAVVSTVTWDIVAWNRAAAAVLTDYSALAPEQRNVLRLIFCDPRVRAAQLDWEAVARFVVGAFRADAARAGAAAEVAALVDELCRLSPEFEAMWRDNDVRGYGGGVKHLRHPIAGPIAFEYSAFAVDGRPDLRMVVYNPATVADAERIRSLIKLPTRKTVGLTVAAPTTAGQVARLGSARPDKSRPNRKGFSSASAKRARAHR

Samples

Sample ID Description Type Environment
1 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
2 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
3 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
4 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
7 2512875024 Mesorhizobium loti R88b Isolate Nodule
8 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
9 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
10 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
11 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
12 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
13 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
14 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
17 2519103095 Burkholderia sp. KJ006 Isolate Nodule
18 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
19 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
20 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
21 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
22 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
23 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
24 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
25 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
26 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
27 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
28 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
29 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
30 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
31 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
32 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
33 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
34 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
35 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
36 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
37 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
38 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
39 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
40 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
41 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
42 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
43 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
44 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
45 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
46 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
47 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
48 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
49 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
50 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
51 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
52 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
53 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
54 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
55 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
56 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
57 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
58 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
59 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
60 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
61 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
62 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
63 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
64 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
65 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
66 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
67 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
68 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
69 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
70 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
71 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
72 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
73 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
74 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
75 2636415599 Klebsiella variicola DX120E Isolate Unclassified
76 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
77 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
78 2643221599 Rhizobium sp. Root708 Isolate Unclassified
79 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
80 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
81 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
82 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
83 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
84 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
85 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
86 2775507074 Klebsiella sp. D5A Isolate Unclassified
87 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
88 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
89 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
90 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
91 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
92 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
93 2818991435 Caulobacter henricii 536 Isolate Unclassified
94 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
95 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
96 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
97 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
98 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
99 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
100 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
101 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
102 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
103 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
104 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
105 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
106 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
107 2831864461 Roseateles noduli HZ7 Isolate Nodule
108 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
109 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
110 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
111 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
112 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
113 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
114 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
115 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
116 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
117 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
118 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
119 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
120 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
121 2855730933 Achromobacter sp. HZ28 Isolate Nodule
122 2855767633 Achromobacter sp. HZ34 Isolate Nodule
123 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
124 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
125 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
126 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
127 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
128 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
129 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
130 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
131 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
132 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
133 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
134 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
135 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
136 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
137 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
138 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
139 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
140 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
141 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
142 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
143 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
144 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
145 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
146 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
147 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
148 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
149 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
150 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
151 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
152 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
153 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
154 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
155 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
156 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
157 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
158 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
159 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
160 2884411467 Dyella sp. AD56 Isolate Rhizosphere
161 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
162 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
163 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
164 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
165 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
166 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
167 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
168 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
169 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
170 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
171 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
172 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
173 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
174 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
175 2904564687 Burkholderia sp. 571 Isolate Unclassified
176 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
177 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
178 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
179 2904699407
180 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
181 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
182 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
183 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
184 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
185 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
186 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
187 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
188 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
189 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
190 2909042592 Labrys sp. LIt4 Isolate Nodule
191 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
192 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
193 2919085039 Luteibacter sp. 1214 Isolate Unclassified
194 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
195 2919404418 Luteibacter sp. 3190 Isolate Unclassified
196 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
197 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
198 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
199 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
200 2922368715
201 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
202 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
203 2928163908 Burkholderia sp. 567 Isolate Unclassified
204 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
205 2928536128 Burkholderia sola 565 Isolate Unclassified
206 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
207 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
208 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
209 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
210 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
211 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
212 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
213 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
214 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
215 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
216 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
217 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
218 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
219 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
220 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
221 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
222 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
223 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
224 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
225 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
226 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
227 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
228 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
229 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
230 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
231 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
232 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
233 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
234 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
235 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
236 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
237 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
238 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
239 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
240 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
241 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
242 2936381700 Rhizobium chutanense C16 Isolate Unclassified
243 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
244 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
245 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
246 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
247 2941471342 Luteibacter sp. 621 Isolate Unclassified
248 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
249 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
250 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
251 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
252 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
253 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
254 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
255 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
256 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
257 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
258 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
259 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
260 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
261 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
262 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
263 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
264 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
265 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
266 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
267 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
268 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
269 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
270 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
271 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
272 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
273 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
274 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
275 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
276 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
277 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
278 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
279 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
280 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
281 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
282 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
283 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
284 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
285 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
286 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
287 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
288 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
289 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
290 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
291 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
292 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
293 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
294 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
295 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
296 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
297 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
298 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
299 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
300 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
301 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
302 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
303 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
304 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
305 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
306 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
307 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
308 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
309 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
310 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
311 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
312 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
313 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
314 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
315 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
316 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
317 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
318 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
319 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
320 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
321 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
322 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
323 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
324 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
325 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
326 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
327 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
328 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
329 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
330 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
331 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
332 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
333 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
334 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
335 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
336 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
337 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
338 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
339 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
340 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
341 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
342 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
343 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
344 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
345 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
346 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
347 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
348 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
349 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
350 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
351 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
352 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
353 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
354 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
355 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
356 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
357 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
358 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
359 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
360 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
361 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
362 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
363 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
364 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
365 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
366 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
367 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
368 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
369 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
370 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
371 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
372 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
373 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
374 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
375 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
376 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
377 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
378 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
379 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
380 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
381 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
382 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
383 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
384 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
385 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
386 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
387 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
388 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
389 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
390 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
391 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
392 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
393 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
394 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
395 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
396 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
397 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
398 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
399 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
400 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
401 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
402 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
403 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
404 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
405 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
406 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
407 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
408 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
409 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
410 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
411 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
412 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
413 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
414 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
415 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
416 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
417 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
418 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
419 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
420 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
421 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
422 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
423 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
424 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
425 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
426 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
427 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
428 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
429 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
430 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
431 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
432 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
433 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
434 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
435 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
436 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
437 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
438 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
439 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
440 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
441 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
442 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
443 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
444 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
445 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
446 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
447 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
448 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
449 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
450 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
451 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
452 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
453 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
454 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
455 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
456 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
457 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
458 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
459 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
465 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
466 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
467 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
471 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
472 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
479 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
480 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
482 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
483 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
484 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
485 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
486 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
487 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
488 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
489 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
490 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
491 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
492 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
493 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
494 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
495 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
496 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
497 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
498 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
499 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
500 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
501 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
502 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
503 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
504 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
505 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
506 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
507 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
508 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
509 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
510 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
511 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
512 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
513 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
514 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
515 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
516 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
517 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
518 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
519 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
520 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
521 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
522 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
523 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
524 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
525 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
526 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
527 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
528 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
529 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
530 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
531 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
532 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
533 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
534 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
535 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
536 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
537 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
538 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
539 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
540 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
541 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
542 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
543 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
544 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
545 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
546 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
547 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
548 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
549 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
550 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
551 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
552 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
553 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
554 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
555 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
556 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
557 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
558 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
559 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
560 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
561 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
562 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
563 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
564 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
565 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
566 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
567 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
568 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
569 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
570 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
571 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
572 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
573 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
574 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
575 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
576 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
577 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
578 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
579 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
580 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
581 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
582 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
583 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
584 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
585 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
586 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
587 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
588 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
589 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
590 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
591 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
592 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
593 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
594 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
595 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
596 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
597 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
598 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
599 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
600 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
601 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
602 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
603 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
604 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
605 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
606 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
607 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
608 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
609 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
610 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
611 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
612 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
613 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
614 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
615 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
616 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
617 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
618 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
619 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
620 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
621 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
622 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
623 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
624 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
625 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
626 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
627 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
628 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
629 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
630 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
631 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
632 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
633 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
634 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
635 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
636 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
637 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
638 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
639 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
640 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
641 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
642 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
643 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
644 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
645 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
646 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
647 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
648 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
649 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
650 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
651 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
652 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
653 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
654 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
655 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
656 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
657 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
658 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
659 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
660 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
661 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
662 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
663 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
664 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
665 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
666 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
667 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
668 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
669 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
670 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
671 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
672 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
673 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
674 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
675 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
676 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
677 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
678 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
679 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
680 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
681 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
682 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
683 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
684 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
685 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
686 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
687 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
688 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
689 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
690 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
691 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
692 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
693 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
694 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
695 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
696 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
697 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
698 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
699 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
700 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
701 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
702 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
703 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
704 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
705 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
706 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
707 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
708 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
709 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
710 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
711 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
712 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
713 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
714 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
715 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
716 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
717 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
718 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
719 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
720 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
721 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
722 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
723 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
724 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
725 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
726 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
727 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
728 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
729 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
730 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
731 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
732 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
733 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
734 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
735 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
736 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
737 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
738 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
739 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
740 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
741 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
742 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
743 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
744 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
745 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
746 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
747 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
748 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
749 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
750 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
751 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
752 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
753 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
754 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
755 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
756 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
757 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
758 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
759 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
760 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
761 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
762 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
763 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
764 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
765 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
766 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
767 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
768 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
769 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
770 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
771 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
772 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
773 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
774 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
775 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
776 8005395548 Rhizobium sp. R339 Isolate Nodule
777 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
778 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
779 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
780 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
781 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
782 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
783 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
784 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
785 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
786 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
787 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
788 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
789 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
790 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
791 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
792 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
793 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
794 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
795 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
796 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
797 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
798 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
799 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
800 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
801 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
802 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
803 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
804 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
805 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
806 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
807 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
808 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
809 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
810 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
811 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
812 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.18
Metatranscriptomes 0.13
Isolates 20.69

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 19.77
Nodule 11.81
Rhizoplane 6.1
Rhizosphere 48.97
Stem 0
Stem Tuber 0
Unclassified 13.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000570 3300001979 Bacteria 15869
2 JGI24740J21852_10012680 3300001979 Bacteria 3170
3 JGI24739J22299_10062697 3300001989 Bacteria 1172
4 JGI24737J22298_10005281 3300001990 Bacteria 4466
5 JGI24737J22298_10013841 3300001990 Bacteria 2624
6 JGI24735J21928_10002093 3300002067 Bacteria 7026
7 JGI24735J21928_10036537 3300002067 Bacteria 1441
8 JGI24744J21845_10002209 3300002077 Bacteria 3956
9 JGI25162J39368_1000353 3300002737 Bacteria 39445
10 JGI25158J39367_1007151 3300002739 Bacteria 1580
11 JGI25157J39369_1011312 3300002741 Bacteria 1157
12 JGI25152J39213_1001392 3300002773 Bacteria 10475
13 JGI25152J39213_1002012 3300002773 Bacteria 8016
14 JGI25152J39213_1003675 3300002773 Bacteria 5156
15 JGI25152J39213_1010330 3300002773 Bacteria 2145
16 JGI25152J39213_1016124 3300002773 Bacteria 1451
17 JGI25159J45721_1000905 3300002987 Bacteria 12899
18 JGI25159J45721_1012472 3300002987 Bacteria 2025
19 JGI25151J46595_10004403 3300003187 Bacteria 7460
20 JGI25151J46595_10009539 3300003187 Bacteria 4583
21 JGI25165J46597_1000046 3300003214 Bacteria 255996
22 JGI25165J46597_1000390 3300003214 Bacteria 46779
23 JGI25165J46597_1001069 3300003214 Bacteria 17583
24 JGI25165J46597_1007037 3300003214 Bacteria 1917
25 JGI25153J46596_10002531 3300003215 Bacteria 10475
26 JGI25153J46596_10003111 3300003215 Bacteria 9359
27 JGI25153J46596_10006842 3300003215 Bacteria 5698
28 JGI25153J46596_10006854 3300003215 Bacteria 5693
29 JGI25153J46596_10013191 3300003215 Bacteria 3511
30 JGI25153J46596_10027768 3300003215 Bacteria 1976
31 rootL2_10007895 3300003322 Bacteria 11929
32 JGI25160J50197_1000040 3300003354 Bacteria 154507
33 JGI25160J50197_1002284 3300003354 Bacteria 8980
34 JGI25160J50197_1002762 3300003354 Bacteria 8047
35 JGI25161J50226_1000023 3300003374 Bacteria 154507
36 JGI25161J50226_1000107 3300003374 Bacteria 65408
37 Ga0006562J51391_1101058 3300003578 Bacteria 2470
38 Ga0006562J51391_1101059 3300003578 Bacteria 1200
39 Ga0055539_1003008 3300003752 Bacteria 2430
40 Ga0055533_1002720 3300003756 Bacteria 3888
41 Ga0055535_1001904 3300003761 Bacteria 8784
42 Ga0055542_1000401 3300003762 Bacteria 42708
43 Ga0055542_1001119 3300003762 Bacteria 15952
44 Ga0055529_1000247 3300003763 Bacteria 66795
45 Ga0055529_1010335 3300003763 Bacteria 1214
46 Ga0055526_1007264 3300003771 Bacteria 5805
47 Ga0055526_1024832 3300003771 Bacteria 1944
48 Ga0055537_1001993 3300003773 Bacteria 7282
49 Ga0055524_1002658 3300003775 Bacteria 9066
50 Ga0055524_1022643 3300003775 Bacteria 2046
51 Ga0055524_1035328 3300003775 Bacteria 1364
52 Ga0055536_1001559 3300003781 Bacteria 13742
53 Ga0055528_1000035 3300003790 Bacteria 117498
54 Ga0055528_1000044 3300003790 Bacteria 102325
55 Ga0055528_1000275 3300003790 Bacteria 43696
56 Ga0055528_1008010 3300003790 Bacteria 4591
57 Ga0055528_1008628 3300003790 Bacteria 4338
58 Ga0055530_10003087 3300003791 Bacteria 9896
59 Ga0055540_1012566 3300003792 Bacteria 2648
60 Ga0055531_10002792 3300003794 Bacteria 11453
61 Ga0055531_10005497 3300003794 Bacteria 7408
62 Ga0058692_1017822 3300003856 Bacteria 1549
63 Ga0058692_1017924 3300003856 Bacteria 1542
64 Ga0055543_1000074 3300004625 Bacteria 88424
65 Ga0055543_1000475 3300004625 Bacteria 23556
66 Ga0065165_1000041 3300005262 Bacteria 203876
67 Ga0065165_1000484 3300005262 Bacteria 61542
68 Ga0065165_1000498 3300005262 Bacteria 60773
69 Ga0065165_1000844 3300005262 Bacteria 40173
70 Ga0065165_1000979 3300005262 Bacteria 35374
71 Ga0070658_10014112 3300005327 Bacteria 6414
72 Ga0070658_10110684 3300005327 Bacteria 2275
73 Ga0070658_10117893 3300005327 Bacteria 2204
74 Ga0070676_10057774 3300005328 Bacteria 2297
75 Ga0070690_100222032 3300005330 Bacteria 1324
76 Ga0070670_100000479 3300005331 Bacteria 32154
77 Ga0068869_100156270 3300005334 Bacteria 1772
78 Ga0070666_10005024 3300005335 Bacteria 8089
79 Ga0070666_10393887 3300005335 Bacteria 995
80 Ga0070680_100015594 3300005336 Bacteria 5963
81 Ga0068868_100573556 3300005338 Bacteria 997
82 Ga0070660_100000315 3300005339 Bacteria 32211
83 Ga0070660_100032530 3300005339 Bacteria 3926
84 Ga0070660_100455926 3300005339 Bacteria 1061
85 Ga0070689_100432490 3300005340 Bacteria 1117
86 Ga0070691_10095922 3300005341 Bacteria 1468
87 Ga0070661_100219031 3300005344 Bacteria 1459
88 Ga0070668_100015545 3300005347 Bacteria 5690
89 Ga0070668_100115768 3300005347 Bacteria 2137
90 Ga0070668_100437194 3300005347 Bacteria 1122
91 Ga0070669_100127687 3300005353 Bacteria 1947
92 Ga0070669_100205599 3300005353 Bacteria 1551
93 Ga0070675_100018974 3300005354 Bacteria 5479
94 Ga0070671_100063246 3300005355 Bacteria 3081
95 Ga0070671_100083820 3300005355 Bacteria 2666
96 Ga0070671_100180736 3300005355 Bacteria 1786
97 Ga0070671_100275443 3300005355 Bacteria 1430
98 Ga0070659_100000858 3300005366 Bacteria 22204
99 Ga0070659_100022742 3300005366 Bacteria 4789
100 Ga0070659_100072498 3300005366 Bacteria 2741
101 Ga0070659_100164653 3300005366 Bacteria 1814
102 Ga0070667_100000399 3300005367 Bacteria 46943
103 Ga0070714_100026154 3300005435 Bacteria 4821
104 Ga0070713_100048994 3300005436 Bacteria 3483
105 Ga0070713_100111382 3300005436 Bacteria 2387
106 Ga0070713_100140491 3300005436 Bacteria 2139
107 Ga0070713_100382496 3300005436 Bacteria 1311
108 Ga0070694_100177183 3300005444 Bacteria 1574
109 Ga0070694_100264525 3300005444 Bacteria 1306
110 Ga0070708_100119305 3300005445 Bacteria 2431
111 Ga0070708_100129949 3300005445 Bacteria 2330
112 Ga0070663_100000256 3300005455 Bacteria 26565
113 Ga0070663_100009112 3300005455 Bacteria 6135
114 Ga0070663_100021715 3300005455 Bacteria 4275
115 Ga0070663_100077640 3300005455 Bacteria 2432
116 Ga0070663_100103027 3300005455 Bacteria 2132
117 Ga0070663_100319099 3300005455 Bacteria 1249
118 Ga0070678_100011183 3300005456 Bacteria 5525
119 Ga0070678_100028137 3300005456 Bacteria 3828
120 Ga0070662_100072927 3300005457 Bacteria 2536
121 Ga0070681_10156768 3300005458 Bacteria 2201
122 Ga0070706_100051569 3300005467 Bacteria 3797
123 Ga0070706_100124398 3300005467 Bacteria 2404
124 Ga0070706_100183019 3300005467 Bacteria 1957
125 Ga0070698_100030563 3300005471 Bacteria 5584
126 Ga0070698_100276563 3300005471 Bacteria 1611
127 Ga0070699_100299920 3300005518 Bacteria 1441
128 Ga0070699_100435538 3300005518 Bacteria 1188
129 Ga0070679_100174001 3300005530 Bacteria 2125
130 Ga0070684_100340743 3300005535 Bacteria 1378
131 Ga0070697_100429408 3300005536 Bacteria 1149
132 Ga0068853_100010248 3300005539 Bacteria 7580
133 Ga0068853_100054058 3300005539 Bacteria 3460
134 Ga0068853_100065900 3300005539 Bacteria 3143
135 Ga0068853_100093034 3300005539 Bacteria 2653
136 Ga0068853_100115707 3300005539 Bacteria 2387
137 Ga0068853_100208524 3300005539 Bacteria 1780
138 Ga0068853_100642328 3300005539 Bacteria 1010
139 Ga0070695_100136944 3300005545 Bacteria 1693
140 Ga0070696_100038682 3300005546 Bacteria 3293
141 Ga0070696_100148712 3300005546 Bacteria 1717
142 Ga0070696_100270512 3300005546 Bacteria 1292
143 Ga0070693_100065767 3300005547 Bacteria 2120
144 Ga0070693_100291419 3300005547 Bacteria 1097
145 Ga0070665_100005024 3300005548 Bacteria 13724
146 Ga0070665_100030501 3300005548 Bacteria 5424
147 Ga0070665_100033014 3300005548 Bacteria 5208
148 Ga0070665_100037434 3300005548 Bacteria 4879
149 Ga0070665_100084166 3300005548 Bacteria 3186
150 Ga0070665_100109511 3300005548 Bacteria 2764
151 Ga0070665_100127393 3300005548 Bacteria 2548
152 Ga0070665_100180272 3300005548 Bacteria 2113
153 Ga0070704_100204943 3300005549 Bacteria 1595
154 Ga0068855_100021449 3300005563 Bacteria 7746
155 Ga0068855_100029955 3300005563 Bacteria 6508
156 Ga0068855_100050530 3300005563 Bacteria 4899
157 Ga0068855_100050993 3300005563 Bacteria 4875
158 Ga0068855_100089020 3300005563 Bacteria 3565
159 Ga0068855_100131256 3300005563 Bacteria 2861
160 Ga0068855_100413514 3300005563 Bacteria 1476
161 Ga0070664_100091297 3300005564 Bacteria 2636
162 Ga0070664_100149901 3300005564 Bacteria 2058
163 Ga0070664_100174906 3300005564 Bacteria 1906
164 Ga0070664_100286306 3300005564 Bacteria 1487
165 Ga0068857_100017788 3300005577 Bacteria 6232
166 Ga0068857_100142342 3300005577 Bacteria 2168
167 Ga0068854_100013343 3300005578 Bacteria 5390
168 Ga0068854_100013817 3300005578 Bacteria 5310
169 Ga0068854_100101703 3300005578 Bacteria 2155
170 Ga0068856_100000020 3300005614 Bacteria 146775
171 Ga0068856_100002838 3300005614 Bacteria 17741
172 Ga0068856_100134835 3300005614 Bacteria 2474
173 Ga0068856_100216000 3300005614 Bacteria 1933
174 Ga0068856_100296184 3300005614 Bacteria 1635
175 Ga0068856_100532570 3300005614 Bacteria 1196
176 Ga0068852_100001260 3300005616 Bacteria 16879
177 Ga0068852_100023118 3300005616 Bacteria 4997
178 Ga0068852_100059793 3300005616 Bacteria 3306
179 Ga0068852_100225697 3300005616 Bacteria 1783
180 Ga0068859_100216998 3300005617 Bacteria 2000
181 Ga0068859_100342410 3300005617 Bacteria 1589
182 Ga0068859_100614424 3300005617 Bacteria 1180
183 Ga0068864_100017585 3300005618 Bacteria 5960
184 Ga0068864_100061876 3300005618 Bacteria 3242
185 Ga0068864_100420637 3300005618 Bacteria 1273
186 Ga0068864_100494737 3300005618 Bacteria 1175
187 Ga0068866_10067313 3300005718 Bacteria 1880
188 Ga0068861_100023482 3300005719 Bacteria 4448
189 Ga0068861_100043310 3300005719 Bacteria 3378
190 Ga0068851_10000402 3300005834 Bacteria 19592
191 Ga0068870_10341595 3300005840 Bacteria 958
192 Ga0068863_100093973 3300005841 Bacteria 2846
193 Ga0068863_100105367 3300005841 Bacteria 2682
194 Ga0068863_100238374 3300005841 Bacteria 1756
195 Ga0068858_100029711 3300005842 Bacteria 5077
196 Ga0068858_100121251 3300005842 Bacteria 2445
197 Ga0068858_100378317 3300005842 Bacteria 1358
198 Ga0068860_100111840 3300005843 Bacteria 2611
199 Ga0068860_100250103 3300005843 Bacteria 1726
200 Ga0068862_100144624 3300005844 Bacteria 2112
201 Ga0081455_10001542 3300005937 Bacteria 28381
202 Ga0081455_10002199 3300005937 Bacteria 23230
203 Ga0081455_10014958 3300005937 Bacteria 7559
204 Ga0081540_1012326 3300005983 Bacteria 5641
205 Ga0081540_1019535 3300005983 Bacteria 4111
206 Ga0081539_10003744 3300005985 Bacteria 18082
207 Ga0081539_10010606 3300005985 Bacteria 7443
208 Ga0070717_10038335 3300006028 Bacteria 3896
209 Ga0075365_10004790 3300006038 Bacteria 7222
210 Ga0075365_10046196 3300006038 Bacteria 2859
211 Ga0075365_10116444 3300006038 Bacteria 1840
212 Ga0075365_10203926 3300006038 Bacteria 1386
213 Ga0075368_10023818 3300006042 Bacteria 2342
214 Ga0075368_10168858 3300006042 Bacteria 919
215 Ga0075363_100006810 3300006048 Bacteria 5222
216 Ga0075363_100065509 3300006048 Bacteria 1964
217 Ga0075363_100108390 3300006048 Bacteria 1542
218 Ga0075364_10014894 3300006051 Bacteria 4812
219 Ga0075364_10029999 3300006051 Bacteria 3489
220 Ga0075364_10047382 3300006051 Bacteria 2799
221 Ga0075362_10050490 3300006177 Bacteria 1860
222 Ga0075362_10059213 3300006177 Bacteria 1729
223 Ga0075367_10065559 3300006178 Bacteria 2175
224 Ga0075367_10137743 3300006178 Bacteria 1511
225 Ga0075369_10000740 3300006186 Bacteria 10584
226 Ga0075369_10021344 3300006186 Bacteria 2660
227 Ga0075369_10030499 3300006186 Bacteria 2271
228 Ga0075369_10049490 3300006186 Bacteria 1815
229 Ga0075369_10146409 3300006186 Bacteria 1078
230 Ga0075369_10147708 3300006186 Bacteria 1074
231 Ga0075366_10031045 3300006195 Bacteria 3143
232 Ga0075366_10031394 3300006195 Bacteria 3126
233 Ga0075366_10033710 3300006195 Bacteria 3017
234 Ga0075366_10185202 3300006195 Bacteria 1265
235 Ga0075366_10205551 3300006195 Bacteria 1198
236 Ga0097621_100064859 3300006237 Bacteria 3004
237 Ga0075370_10013990 3300006353 Bacteria 4272
238 Ga0075370_10020985 3300006353 Bacteria 3576
239 Ga0075370_10056883 3300006353 Bacteria 2223
240 Ga0075370_10083054 3300006353 Bacteria 1842
241 Ga0075370_10228067 3300006353 Bacteria 1102
242 Ga0068871_100289518 3300006358 Bacteria 1435
243 Ga0075428_100025112 3300006844 Bacteria 6592
244 Ga0075434_100125782 3300006871 Bacteria 2580
245 Ga0075434_100238505 3300006871 Bacteria 1838
246 Ga0075436_100021452 3300006914 Bacteria 4435
247 Ga0097620_100217015 3300006931 Bacteria 2000
248 Ga0097620_100342427 3300006931 Bacteria 1589
249 Ga0097620_100614444 3300006931 Bacteria 1180
250 Ga0099825_1037378 3300006941 Bacteria 1609
251 Ga0099824_1004900 3300006942 Bacteria 19056
252 Ga0099822_1000677 3300006943 Bacteria 34391
253 Ga0079104_1000129 3300006946 Bacteria 108427
254 Ga0099794_10072951 3300007265 Bacteria 1684
255 Ga0099795_10021718 3300007788 Bacteria 2109
256 Ga0099795_10071435 3300007788 Bacteria 1310
257 Ga0105251_10000251 3300009011 Bacteria 53888
258 Ga0105244_10000148 3300009036 Bacteria 73416
259 Ga0105244_10005524 3300009036 Bacteria 8388
260 Ga0105250_10000070 3300009092 Bacteria 96227
261 Ga0105250_10001351 3300009092 Bacteria 13352
262 Ga0105240_10000027 3300009093 Bacteria 348486
263 Ga0105240_10000244 3300009093 Bacteria 107739
264 Ga0105240_10000301 3300009093 Bacteria 96340
265 Ga0105240_10000333 3300009093 Bacteria 88420
266 Ga0105240_10002439 3300009093 Bacteria 29909
267 Ga0105240_10004430 3300009093 Bacteria 21410
268 Ga0105240_10076156 3300009093 Bacteria 4137
269 Ga0105240_10271630 3300009093 Bacteria 1952
270 Ga0105240_10389123 3300009093 Bacteria 1573
271 Ga0105240_10411901 3300009093 Bacteria 1520
272 Ga0105240_10427502 3300009093 Bacteria 1487
273 Ga0105240_10435929 3300009093 Bacteria 1469
274 Ga0105240_10506060 3300009093 Bacteria 1342
275 Ga0111539_10105643 3300009094 Bacteria 3303
276 Ga0105245_10105248 3300009098 Bacteria 2617
277 Ga0105245_10619440 3300009098 Bacteria 1110
278 Ga0105247_10173540 3300009101 Bacteria 1435
279 Ga0105247_10201048 3300009101 Bacteria 1339
280 Ga0114129_10043432 3300009147 Bacteria 6324
281 Ga0114129_10440338 3300009147 Bacteria 1711
282 Ga0105243_10005831 3300009148 Bacteria 9549
283 Ga0105243_10124180 3300009148 Bacteria 2181
284 Ga0105241_10001668 3300009174 Bacteria 16913
285 Ga0105241_10072742 3300009174 Bacteria 2673
286 Ga0105242_10087007 3300009176 Bacteria 2623
287 Ga0105242_10449428 3300009176 Bacteria 1214
288 Ga0105248_10113603 3300009177 Bacteria 3054
289 Ga0105248_10145012 3300009177 Bacteria 2679
290 Ga0105248_10317850 3300009177 Bacteria 1754
291 Ga0105248_10831328 3300009177 Bacteria 1042
292 Ga0105237_10001533 3300009545 Bacteria 30234
293 Ga0105237_10003395 3300009545 Bacteria 18937
294 Ga0105237_10023955 3300009545 Bacteria 6247
295 Ga0105237_10089479 3300009545 Bacteria 3068
296 Ga0105237_10127412 3300009545 Bacteria 2540
297 Ga0105237_10164047 3300009545 Bacteria 2221
298 Ga0105237_10181704 3300009545 Bacteria 2104
299 Ga0105237_10306545 3300009545 Bacteria 1591
300 Ga0105238_10005661 3300009551 Bacteria 12351
301 Ga0105238_10009609 3300009551 Bacteria 9677
302 Ga0105238_10021242 3300009551 Bacteria 6615
303 Ga0105238_10037001 3300009551 Bacteria 4962
304 Ga0105238_10045018 3300009551 Bacteria 4458
305 Ga0105238_10132971 3300009551 Bacteria 2466
306 Ga0105238_10140111 3300009551 Bacteria 2395
307 Ga0105238_10152479 3300009551 Bacteria 2286
308 Ga0105238_10274011 3300009551 Bacteria 1668
309 Ga0105238_10285544 3300009551 Bacteria 1632
310 Ga0105249_10000222 3300009553 Bacteria 64888
311 Ga0105249_10030193 3300009553 Bacteria 4899
312 Ga0105249_10138742 3300009553 Bacteria 2329
313 Ga0105249_10198558 3300009553 Bacteria 1962
314 Ga0105249_10265162 3300009553 Bacteria 1708
315 Ga0123341_1002866 3300009765 Bacteria 14487
316 Ga0123342_1019294 3300009766 Bacteria 5238
317 Ga0105033_101161 3300009986 Bacteria 2132
318 Ga0099796_10024312 3300010159 Bacteria 1901
319 Ga0105239_10000043 3300010375 Bacteria 196600
320 Ga0105239_10000769 3300010375 Bacteria 45350
321 Ga0105239_10015010 3300010375 Bacteria 8587
322 Ga0105239_10031365 3300010375 Bacteria 5846
323 Ga0105239_10100955 3300010375 Bacteria 3192
324 Ga0105239_10102690 3300010375 Bacteria 3164
325 Ga0105239_10213229 3300010375 Bacteria 2165
326 Ga0105239_10303153 3300010375 Bacteria 1799
327 Ga0105239_10305988 3300010375 Bacteria 1790
328 Ga0105239_10422011 3300010375 Bacteria 1511
329 Ga0105239_10493794 3300010375 Bacteria 1391
330 Ga0105246_10028136 3300011119 Bacteria 3691
331 Ga0105246_10171803 3300011119 Bacteria 1661
332 Ga0157373_10074765 3300013100 Bacteria 2390
333 Ga0157371_10000010 3300013102 Bacteria 384921
334 Ga0157370_10000008 3300013104 Bacteria 240668
335 Ga0157370_10000048 3300013104 Bacteria 124683
336 Ga0157370_10143174 3300013104 Bacteria 2227
337 Ga0157370_10174678 3300013104 Bacteria 1997
338 Ga0157369_10072699 3300013105 Bacteria 3691
339 Ga0157369_10222361 3300013105 Bacteria 1976
340 Ga0157369_10353584 3300013105 Bacteria 1526
341 Ga0157374_10117843 3300013296 Bacteria 2560
342 Ga0157374_10153909 3300013296 Bacteria 2237
343 Ga0157378_10039744 3300013297 Bacteria 4173
344 Ga0157378_10082429 3300013297 Bacteria 2908
345 Ga0157378_10092130 3300013297 Bacteria 2757
346 Ga0163162_10293531 3300013306 Bacteria 1757
347 Ga0163162_10721983 3300013306 Bacteria 1117
348 Ga0157372_10028961 3300013307 Bacteria 6043
349 Ga0157372_10336585 3300013307 Bacteria 1758
350 Ga0157375_10648729 3300013308 Bacteria 1212
351 Ga0163163_10053473 3300014325 Bacteria 3986
352 Ga0163163_10395967 3300014325 Bacteria 1439
353 Ga0163163_10414364 3300014325 Bacteria 1406
354 Ga0157380_10055433 3300014326 Bacteria 3148
355 Ga0157380_10222114 3300014326 Bacteria 1691
356 Ga0157380_10241406 3300014326 Bacteria 1629
357 Ga0182008_10007814 3300014497 Bacteria 5882
358 Ga0182008_10055853 3300014497 Bacteria 1952
359 Ga0157379_10033678 3300014968 Bacteria 4569
360 Ga0157379_10116279 3300014968 Bacteria 2405
361 Ga0157379_10136497 3300014968 Bacteria 2210
362 Ga0157379_10438532 3300014968 Bacteria 1204
363 Ga0157376_10398976 3300014969 Bacteria 1329
364 Ga0182006_1067312 3300015261 Bacteria 1337
365 Ga0182007_10004419 3300015262 Bacteria 6372
366 Ga0182005_1006489 3300015265 Bacteria 3569
367 Ga0163161_10315766 3300017792 Bacteria 1234
368 Ga0213873_10003441 3300021358 Bacteria 2850
369 Ga0213873_10009894 3300021358 Bacteria 1994
370 Ga0213872_10005848 3300021361 Bacteria 6245
371 Ga0213872_10084237 3300021361 Bacteria 1426
372 Ga0213876_10002722 3300021384 Bacteria 10297
373 Ga0213876_10144265 3300021384 Bacteria 1266
374 Ga0213875_10114015 3300021388 Bacteria 1263
375 Ga0213871_10035227 3300021441 Bacteria 1323
376 Ga0209436_100011 3300025208 Bacteria 139405
377 Ga0209674_100048 3300025226 Bacteria 353032
378 Ga0209672_100058 3300025228 Bacteria 211992
379 Ga0209563_101810 3300025230 Bacteria 5293
380 Ga0209437_100050 3300025233 Bacteria 394010
381 Ga0209437_100205 3300025233 Bacteria 115669
382 Ga0209437_106410 3300025233 Bacteria 1960
383 Ga0209258_100164 3300025242 Bacteria 148838
384 Ga0207425_1000695 3300025245 Bacteria 18209
385 Ga0209026_1000231 3300025250 Bacteria 75789
386 Ga0209026_1000784 3300025250 Bacteria 17581
387 Ga0209677_100188 3300025253 Bacteria 50341
388 Ga0209677_104791 3300025253 Bacteria 3757
389 Ga0209148_1000037 3300025254 Bacteria 494767
390 Ga0209148_1000039 3300025254 Bacteria 482479
391 Ga0209148_1000947 3300025254 Bacteria 19052
392 Ga0209759_1000032 3300025256 Bacteria 278697
393 Ga0209759_1000249 3300025256 Bacteria 80341
394 Ga0209759_1013026 3300025256 Bacteria 2271
395 Ga0209129_1000019 3300025258 Bacteria 460802
396 Ga0209129_1000244 3300025258 Bacteria 57688
397 Ga0209129_1000495 3300025258 Bacteria 28665
398 Ga0209129_1000642 3300025258 Bacteria 23416
399 Ga0209129_1001683 3300025258 Bacteria 11965
400 Ga0209233_1000013 3300025261 Bacteria 1013785
401 Ga0209233_1000037 3300025261 Bacteria 554620
402 Ga0209233_1000187 3300025261 Bacteria 133091
403 Ga0209233_1000271 3300025261 Bacteria 73658
404 Ga0209233_1002186 3300025261 Bacteria 7322
405 Ga0209233_1012104 3300025261 Bacteria 2514
406 Ga0209233_1015577 3300025261 Bacteria 2114
407 Ga0209233_1015772 3300025261 Bacteria 2095
408 Ga0209233_1028404 3300025261 Bacteria 1342
409 Ga0209455_1000034 3300025272 Bacteria 483129
410 Ga0209455_1000036 3300025272 Bacteria 473309
411 Ga0209455_1001778 3300025272 Bacteria 9111
412 Ga0209455_1004319 3300025272 Bacteria 4697
413 Ga0209455_1005152 3300025272 Bacteria 4109
414 Ga0209455_1025050 3300025272 Bacteria 1093
415 Ga0209673_1000013 3300025273 Bacteria 571633
416 Ga0209673_1000132 3300025273 Bacteria 162349
417 Ga0209673_1004907 3300025273 Bacteria 6967
418 Ga0209673_1005691 3300025273 Bacteria 6216
419 Ga0209673_1006226 3300025273 Bacteria 5822
420 Ga0209673_1014579 3300025273 Bacteria 3034
421 Ga0209130_1000081 3300025284 Bacteria 166440
422 Ga0209130_1000142 3300025284 Bacteria 114724
423 Ga0209130_1000793 3300025284 Bacteria 27090
424 Ga0209676_1004295 3300025292 Bacteria 8032
425 Ga0209676_1019408 3300025292 Bacteria 2340
426 Ga0209025_1000186 3300025294 Bacteria 155131
427 Ga0209025_1004158 3300025294 Bacteria 12821
428 Ga0209025_1006069 3300025294 Bacteria 9553
429 Ga0209025_1006600 3300025294 Bacteria 8942
430 Ga0209564_1000021 3300025295 Bacteria 571316
431 Ga0209564_1000167 3300025295 Bacteria 159653
432 Ga0209564_1000225 3300025295 Bacteria 126209
433 Ga0209564_1001247 3300025295 Bacteria 28312
434 Ga0209564_1004005 3300025295 Bacteria 9335
435 Ga0209564_1005262 3300025295 Bacteria 7468
436 Ga0209564_1009175 3300025295 Bacteria 4753
437 Ga0209564_1015129 3300025295 Bacteria 3158
438 Ga0209758_1000463 3300025297 Bacteria 67158
439 Ga0209758_1000520 3300025297 Bacteria 61722
440 Ga0209758_1000908 3300025297 Bacteria 40149
441 Ga0209758_1002435 3300025297 Bacteria 18992
442 Ga0209758_1002555 3300025297 Bacteria 18327
443 Ga0209758_1005502 3300025297 Bacteria 9701
444 Ga0209758_1005696 3300025297 Bacteria 9411
445 Ga0209758_1006338 3300025297 Bacteria 8570
446 Ga0209050_1000034 3300025298 Bacteria 433906
447 Ga0209050_1002088 3300025298 Bacteria 18308
448 Ga0209050_1003257 3300025298 Bacteria 12215
449 Ga0209050_1043377 3300025298 Bacteria 1216
450 Ga0209256_1000805 3300025299 Bacteria 40172
451 Ga0209256_1001227 3300025299 Bacteria 28538
452 Ga0209256_1001833 3300025299 Bacteria 19808
453 Ga0209256_1003935 3300025299 Bacteria 9784
454 Ga0209256_1022486 3300025299 Bacteria 1907
455 Ga0209256_1030320 3300025299 Bacteria 1494
456 Ga0207426_1000008 3300025302 Bacteria 848730
457 Ga0207426_1000076 3300025302 Bacteria 320851
458 Ga0207426_1000179 3300025302 Bacteria 158635
459 Ga0207426_1000599 3300025302 Bacteria 47456
460 Ga0209051_1001738 3300025303 Bacteria 17362
461 Ga0209051_1025340 3300025303 Bacteria 2416
462 Ga0209051_1036923 3300025303 Bacteria 1798
463 Ga0209257_1000052 3300025304 Bacteria 430947
464 Ga0209257_1000100 3300025304 Bacteria 253399
465 Ga0209257_1000150 3300025304 Bacteria 191487
466 Ga0209257_1000350 3300025304 Bacteria 95008
467 Ga0209257_1000504 3300025304 Bacteria 68999
468 Ga0209257_1001490 3300025304 Bacteria 27487
469 Ga0209257_1014953 3300025304 Bacteria 3278
470 Ga0207697_10065277 3300025315 Bacteria 1519
471 Ga0207656_10005096 3300025321 Bacteria 4620
472 Ga0207696_1000038 3300025711 Bacteria 328221
473 Ga0207655_1006920 3300025728 Bacteria 7439
474 Ga0207713_1000002 3300025735 Bacteria 1061749
475 Ga0207710_10065256 3300025900 Bacteria 1659
476 Ga0207710_10116799 3300025900 Bacteria 1271
477 Ga0207688_10025501 3300025901 Bacteria 3247
478 Ga0207680_10023183 3300025903 Bacteria 3386
479 Ga0207680_10093612 3300025903 Bacteria 1917
480 Ga0207647_10006363 3300025904 Bacteria 8586
481 Ga0207647_10231554 3300025904 Bacteria 1063
482 Ga0207699_10102512 3300025906 Bacteria 1819
483 Ga0207705_10000003 3300025909 Bacteria 709270
484 Ga0207705_10022777 3300025909 Bacteria 4467
485 Ga0207705_10121717 3300025909 Bacteria 1937
486 Ga0207705_10240169 3300025909 Bacteria 1380
487 Ga0207705_10304147 3300025909 Bacteria 1223
488 Ga0207705_10357598 3300025909 Bacteria 1126
489 Ga0207684_10355458 3300025910 Bacteria 1261
490 Ga0207654_10000058 3300025911 Bacteria 75628
491 Ga0207654_10201811 3300025911 Bacteria 1310
492 Ga0207707_10011916 3300025912 Bacteria 7566
493 Ga0207695_10000024 3300025913 Bacteria 632311
494 Ga0207695_10000171 3300025913 Bacteria 191448
495 Ga0207695_10000262 3300025913 Bacteria 133005
496 Ga0207695_10000399 3300025913 Bacteria 97109
497 Ga0207695_10000453 3300025913 Bacteria 89314
498 Ga0207695_10000623 3300025913 Bacteria 71205
499 Ga0207695_10001151 3300025913 Bacteria 45829
500 Ga0207695_10034241 3300025913 Bacteria 5528
501 Ga0207695_10117754 3300025913 Bacteria 2628
502 Ga0207695_10468866 3300025913 Bacteria 1142
503 Ga0207671_10001033 3300025914 Bacteria 33897
504 Ga0207671_10001214 3300025914 Bacteria 30625
505 Ga0207671_10003232 3300025914 Bacteria 16391
506 Ga0207671_10005863 3300025914 Bacteria 11155
507 Ga0207671_10034499 3300025914 Bacteria 3758
508 Ga0207671_10037705 3300025914 Bacteria 3584
509 Ga0207671_10068898 3300025914 Bacteria 2637
510 Ga0207671_10085199 3300025914 Bacteria 2374
511 Ga0207693_10463115 3300025915 Bacteria 990
512 Ga0207660_10006535 3300025917 Bacteria 7564
513 Ga0207657_10000002 3300025919 Bacteria 444378
514 Ga0207657_10010100 3300025919 Bacteria 9439
515 Ga0207657_10040869 3300025919 Bacteria 4106
516 Ga0207657_10102064 3300025919 Bacteria 2380
517 Ga0207649_10001056 3300025920 Bacteria 16892
518 Ga0207649_10241665 3300025920 Bacteria 1296
519 Ga0207652_10007891 3300025921 Bacteria 8542
520 Ga0207646_10044616 3300025922 Bacteria 3979
521 Ga0207681_10281232 3300025923 Bacteria 1310
522 Ga0207694_10000564 3300025924 Bacteria 33580
523 Ga0207694_10041683 3300025924 Bacteria 3538
524 Ga0207694_10098745 3300025924 Bacteria 2312
525 Ga0207694_10351902 3300025924 Bacteria 1219
526 Ga0207650_10000896 3300025925 Bacteria 22492
527 Ga0207659_10011844 3300025926 Bacteria 5523
528 Ga0207687_10004421 3300025927 Bacteria 9375
529 Ga0207700_10029340 3300025928 Bacteria 3880
530 Ga0207700_10538338 3300025928 Bacteria 1036
531 Ga0207664_10008230 3300025929 Bacteria 7260
532 Ga0207644_10031439 3300025931 Bacteria 3698
533 Ga0207644_10305534 3300025931 Bacteria 1283
534 Ga0207690_10000011 3300025932 Bacteria 295252
535 Ga0207690_10010704 3300025932 Bacteria 5466
536 Ga0207706_10035523 3300025933 Bacteria 4430
537 Ga0207706_10144278 3300025933 Bacteria 2095
538 Ga0207686_10051132 3300025934 Bacteria 2573
539 Ga0207709_10024675 3300025935 Bacteria 3436
540 Ga0207670_10091957 3300025936 Bacteria 2146
541 Ga0207670_10366519 3300025936 Bacteria 1144
542 Ga0207711_10117033 3300025941 Bacteria 2376
543 Ga0207689_10045302 3300025942 Bacteria 3638
544 Ga0207679_10086271 3300025945 Bacteria 2414
545 Ga0207679_10187937 3300025945 Bacteria 1715
546 Ga0207667_10000035 3300025949 Bacteria 301056
547 Ga0207667_10009339 3300025949 Bacteria 11566
548 Ga0207667_10026498 3300025949 Bacteria 6333
549 Ga0207667_10039559 3300025949 Bacteria 5025
550 Ga0207667_10135401 3300025949 Bacteria 2537
551 Ga0207667_10261841 3300025949 Bacteria 1768
552 Ga0207667_10370058 3300025949 Bacteria 1460
553 Ga0207712_10000248 3300025961 Bacteria 52803
554 Ga0207668_10191932 3300025972 Bacteria 1619
555 Ga0207668_10209922 3300025972 Bacteria 1557
556 Ga0207658_10000006 3300025986 Bacteria 392309
557 Ga0207658_10072414 3300025986 Bacteria 2612
558 Ga0207658_10115763 3300025986 Bacteria 2128
559 Ga0207677_10044580 3300026023 Bacteria 2956
560 Ga0207677_10050505 3300026023 Bacteria 2814
561 Ga0207677_10551624 3300026023 Bacteria 1004
562 Ga0207703_10016119 3300026035 Bacteria 5826
563 Ga0207703_10059069 3300026035 Bacteria 3132
564 Ga0207703_10072639 3300026035 Bacteria 2844
565 Ga0207703_10417654 3300026035 Bacteria 1248
566 Ga0207639_10001424 3300026041 Bacteria 16178
567 Ga0207639_10060937 3300026041 Bacteria 2912
568 Ga0207639_10106558 3300026041 Bacteria 2275
569 Ga0207639_10145583 3300026041 Bacteria 1979
570 Ga0207639_10312487 3300026041 Bacteria 1392
571 Ga0207678_10000081 3300026067 Bacteria 77634
572 Ga0207678_10000677 3300026067 Bacteria 31159
573 Ga0207678_10002336 3300026067 Bacteria 17192
574 Ga0207678_10007546 3300026067 Bacteria 9614
575 Ga0207678_10007573 3300026067 Bacteria 9597
576 Ga0207678_10018195 3300026067 Bacteria 6170
577 Ga0207678_10098500 3300026067 Bacteria 2498
578 Ga0207678_10342881 3300026067 Bacteria 1288
579 Ga0207702_10000004 3300026078 Bacteria 422182
580 Ga0207702_10000748 3300026078 Bacteria 34672
581 Ga0207702_10061728 3300026078 Bacteria 3198
582 Ga0207702_10075516 3300026078 Bacteria 2912
583 Ga0207702_10177897 3300026078 Bacteria 1957
584 Ga0207702_10286567 3300026078 Bacteria 1559
585 Ga0207702_10457287 3300026078 Bacteria 1239
586 Ga0207641_10087690 3300026088 Bacteria 2715
587 Ga0207648_10021205 3300026089 Bacteria 5841
588 Ga0207648_10280466 3300026089 Bacteria 1490
589 Ga0207676_10000732 3300026095 Bacteria 25736
590 Ga0207676_10109348 3300026095 Bacteria 2310
591 Ga0207676_10253520 3300026095 Bacteria 1585
592 Ga0207674_10005590 3300026116 Bacteria 14903
593 Ga0207675_100058584 3300026118 Bacteria 3594
594 Ga0207675_100076984 3300026118 Bacteria 3124
595 Ga0207683_10007822 3300026121 Bacteria 9149
596 Ga0207683_10285599 3300026121 Bacteria 1508
597 Ga0207683_10642106 3300026121 Bacteria 983
598 Ga0207683_10716830 3300026121 Bacteria 928
599 Ga0207698_10001361 3300026142 Bacteria 14242
600 Ga0207698_10021118 3300026142 Bacteria 4496
601 Ga0207698_10025819 3300026142 Bacteria 4146
602 Ga0207698_10122095 3300026142 Bacteria 2207
603 Ga0209281_1000036 3300027111 Bacteria 369415
604 Ga0209281_1000047 3300027111 Bacteria 326514
605 Ga0209371_1002388 3300027312 Bacteria 10607
606 Ga0209371_1003791 3300027312 Bacteria 7034
607 Ga0209371_1008437 3300027312 Bacteria 3427
608 Ga0209371_1019645 3300027312 Bacteria 1681
609 Ga0209589_1000006 3300027357 Bacteria 436292
610 Ga0209489_100007 3300027361 Bacteria 436292
611 Ga0209700_100008 3300027363 Bacteria 436292
612 Ga0209179_1004059 3300027512 Bacteria 2176
613 Ga0209813_10010292 3300027866 Bacteria 2415
614 Ga0268266_10000827 3300028379 Bacteria 40488
615 Ga0268266_10003815 3300028379 Bacteria 14743
616 Ga0268266_10004137 3300028379 Bacteria 14015
617 Ga0268266_10033854 3300028379 Bacteria 4342
618 Ga0268266_10042793 3300028379 Bacteria 3870
619 Ga0268266_10059158 3300028379 Bacteria 3301
620 Ga0268266_10065807 3300028379 Bacteria 3133
621 Ga0268266_10580761 3300028379 Bacteria 1075
622 Ga0268265_10090428 3300028380 Bacteria 2445
623 Ga0268264_10180693 3300028381 Bacteria 1916
624 Ga0265334_10004202 3300028573 Bacteria 6432
625 Ga0307515_10023504 3300028794 Bacteria 10796
626 Ga0265338_10083833 3300028800 Bacteria 2664
627 Ga0265338_10267575 3300028800 Bacteria 1254
628 Ga0268256_1001774 3300030500 Bacteria 12176
629 Ga0268256_1003015 3300030500 Bacteria 7952
630 Ga0268256_1018567 3300030500 Bacteria 1925
631 Ga0268256_1037347 3300030500 Bacteria 1113
632 Ga0265330_10005862 3300031235 Bacteria 6089
633 Ga0265330_10055070 3300031235 Bacteria 1737
634 Ga0265330_10111691 3300031235 Bacteria 1167
635 Ga0265325_10144542 3300031241 Bacteria 1129
636 Ga0265340_10001482 3300031247 Bacteria 13464
637 Ga0265340_10002643 3300031247 Bacteria 10183
638 Ga0265340_10161431 3300031247 Bacteria 1018
639 Ga0265339_10029184 3300031249 Bacteria 3131
640 Ga0265339_10040735 3300031249 Bacteria 2581
641 Ga0265327_10000039 3300031251 Bacteria 292334
642 Ga0265327_10037340 3300031251 Bacteria 2660
643 Ga0265316_10032707 3300031344 Bacteria 4243
644 Ga0265316_10085167 3300031344 Bacteria 2419
645 Ga0265316_10116382 3300031344 Bacteria 2021
646 Ga0265316_10269303 3300031344 Bacteria 1247
647 Ga0307513_10048472 3300031456 Bacteria 4611
648 Ga0307509_10001027 3300031507 Bacteria 48002
649 Ga0307408_100028470 3300031548 Bacteria 3861
650 Ga0265313_10002155 3300031595 Bacteria 17475
651 Ga0265313_10004657 3300031595 Bacteria 10377
652 Ga0307508_10193337 3300031616 Bacteria 1636
653 Ga0265314_10020524 3300031711 Bacteria 5099
654 Ga0265314_10035472 3300031711 Bacteria 3634
655 Ga0265342_10012050 3300031712 Bacteria 5871
656 Ga0265342_10048420 3300031712 Bacteria 2548
657 Ga0307516_10007025 3300031730 Bacteria 13047
658 Ga0307516_10066047 3300031730 Bacteria 3491
659 Ga0307516_10085294 3300031730 Bacteria 2996
660 Ga0307516_10363460 3300031730 Bacteria 1111
661 Ga0307405_10121963 3300031731 Bacteria 1785
662 Ga0307413_10158066 3300031824 Bacteria 1589
663 Ga0307407_10117837 3300031903 Bacteria 1678
664 Ga0307412_10009672 3300031911 Bacteria 5535
665 Ga0307412_10088437 3300031911 Bacteria 2161
666 Ga0307412_10251708 3300031911 Bacteria 1372
667 Ga0307409_100035306 3300031995 Bacteria 3662
668 Ga0307416_100052282 3300032002 Bacteria 3270
669 Ga0307416_100726167 3300032002 Bacteria 1084
670 Ga0307414_10088963 3300032004 Bacteria 2287
671 Ga0307414_10362035 3300032004 Bacteria 1248
672 Ga0307414_10490937 3300032004 Bacteria 1085
673 Ga0307411_10131858 3300032005 Bacteria 1828
674 Ga0307510_10034816 3300033180 Bacteria 5630
675 Ga0315911_1000010 3300033442 Bacteria 322197
676 Ga0373926_0042224 3300035083 Bacteria 1631
677 Ga0373934_0039379 3300035086 Bacteria 1863
678 Ga0373923_0069453 3300035111 Bacteria 1510
679 Ga0373936_0013440 3300035113 Bacteria 3124
680 Ga0373924_0073466 3300035410 Bacteria 1445
681 Ga0373935_0016772 3300035692 Bacteria 4433
682 Ga0373935_0079801 3300035692 Bacteria 2125
683 Ga0373927_0000075 3300035695 Bacteria 72822
684 Ga0373933_0004636 3300035724 Bacteria 7529
685 Ga0373937_0005933 3300036401 Bacteria 10512
686 Ga0373925_0002684 3300037068 Bacteria 14118
687 Ga0373925_0536180 3300037068 Bacteria 962
688 Ga0395899_0006184 3300037312 Bacteria 9278
689 Ga0395899_0086840 3300037312 Bacteria 2271
690 Ga0395899_0123084 3300037312 Bacteria 1856
691 Ga0395899_0125427 3300037312 Bacteria 1836
692 Ga0395900_0022337 3300037418 Bacteria 6471
693 Ga0395900_0071479 3300037418 Bacteria 3567
694 Ga0395900_0193738 3300037418 Bacteria 2060
695 Ga0395900_0214937 3300037418 Bacteria 1940
696 Ga0395898_0011006 3300037466 Bacteria 9426
697 Ga0395898_0072686 3300037466 Bacteria 3322
698 Ga0395898_0109634 3300037466 Bacteria 2646
699 Ga0395905_0000095 3300037471 Bacteria 146714
700 Ga0395905_0051129 3300037471 Bacteria 3870
701 Ga0395905_0114802 3300037471 Bacteria 2530
702 Ga0395905_0784377 3300037471 Bacteria 856
703 Ga0436364_0660405 3300037853 Bacteria 2398
704 Ga0436364_1108064 3300037853 Bacteria 4999
705 Ga0395901_0045021 3300038443 Bacteria 4578
706 Ga0395901_0103550 3300038443 Bacteria 2986
707 Ga0395901_0122396 3300038443 Bacteria 2734
708 Ga0436365_0323393 3300039437 Bacteria 7520
709 Ga0436365_1424951 3300039437 Bacteria 6070
710 Ga0436365_1846448 3300039437 Bacteria 1305
711 Ga0436360_0253798 3300039438 Bacteria 882
712 Ga0436360_0297024 3300039438 Bacteria 1790
713 Ga0436360_0659817 3300039438 Bacteria 1141
714 Ga0436360_0726204 3300039438 Bacteria 1983
715 Ga0436360_1185545 3300039438 Bacteria 1409
716 Ga0436360_1375098 3300039438 Bacteria 13243
717 Ga0436361_0174497 3300039447 Bacteria 7261
718 Ga0436361_0334394 3300039447 Bacteria 3286
719 Ga0436361_0609700 3300039447 Bacteria 8217
720 Ga0436361_0670522 3300039447 Bacteria 3225
721 Ga0436361_0797533 3300039447 Bacteria 1436
722 Ga0436361_0816491 3300039447 Bacteria 6295
723 Ga0436361_0964227 3300039447 Bacteria 2348
724 Ga0436362_0687917 3300039453 Bacteria 3316
725 Ga0439465_0000436 3300041413 Bacteria 12197
726 Ga0451791_1416907 3300041451 Bacteria 1270
727 Ga0451795_0492382 3300041456 Bacteria 1477
728 Ga0451804_0698880 3300041463 Bacteria 1189
729 Ga0451833_0669262 3300041491 Bacteria 1769
730 Ga0451849_1014739 3300041505 Bacteria 1038
731 Ga0451843_1098918 3300041509 Bacteria 956
732 Ga0451853_0765634 3300041512 Bacteria 1129
733 Ga0466969_0047182 3300044656 Bacteria 2133
734 Ga0466972_0006944 3300044658 Bacteria 5675
735 Ga0466965_0007472 3300044683 Bacteria 5021
736 Ga0466965_0050351 3300044683 Bacteria 2065
737 Ga0466966_0001160 3300044684 Bacteria 16947
738 Ga0466966_0067641 3300044684 Bacteria 2243
739 Ga0466966_0100604 3300044684 Bacteria 1788
740 Ga0466966_0126202 3300044684 Bacteria 1569
741 Ga0466966_0226123 3300044684 Bacteria 1129
742 Ga0466961_0000067 3300044693 Bacteria 63056
743 Ga0466961_0002858 3300044693 Bacteria 10712
744 Ga0466964_0003960 3300044706 Bacteria 5445
745 Ga0466971_0007722 3300044719 Bacteria 4688
746 Ga0466971_0111613 3300044719 Bacteria 1262
747 Ga0466971_0128557 3300044719 Bacteria 1175
748 Ga0466968_0000823 3300044735 Bacteria 10800
749 Ga0466970_0000808 3300044765 Bacteria 15076
750 Ga0466970_0225226 3300044765 Bacteria 1047
751 Ga0466957_0015382 3300044842 Bacteria 4470
752 Ga0466957_0016042 3300044842 Bacteria 4379
753 Ga0466957_0030882 3300044842 Bacteria 3200
754 Ga0466959_0009672 3300045049 Bacteria 6863
755 Ga0466959_0096655 3300045049 Bacteria 2117
756 Ga0466959_0205153 3300045049 Bacteria 1371
757 Ga0466959_0219737 3300045049 Bacteria 1318
758 Ga0466958_0165109 3300045836 Bacteria 1401
759 Ga0466958_0251067 3300045836 Bacteria 1131
760 Ga0466967_0127474 3300045976 Bacteria 2359
761 Ga0495592_0022740 3300046454 Bacteria 4768
762 Ga0495603_0012796 3300046455 Bacteria 5074
763 Ga0495603_0041893 3300046455 Bacteria 2738
764 Ga0495590_0023062 3300046457 Bacteria 2200
765 Ga0495590_0104559 3300046457 Bacteria 1008
766 Ga0495629_0007400 3300046459 Bacteria 8090
767 Ga0495629_0078860 3300046459 Bacteria 2299
768 Ga0495638_0000009 3300046460 Bacteria 525345
769 Ga0495638_0018101 3300046460 Bacteria 4683
770 Ga0495638_0030763 3300046460 Bacteria 3452
771 Ga0495638_0051078 3300046460 Bacteria 2580
772 Ga0495638_0242925 3300046460 Bacteria 996
773 Ga0495641_0127451 3300046461 Bacteria 1136
774 Ga0495651_0000683 3300046462 Bacteria 26390
775 Ga0495653_0032553 3300046463 Bacteria 4137
776 Ga0495650_0000015 3300046471 Bacteria 557595
777 Ga0495650_0000075 3300046471 Bacteria 250589
778 Ga0495650_0049453 3300046471 Bacteria 1746
779 Ga0495650_0080079 3300046471 Bacteria 1262
780 Ga0495650_0089204 3300046471 Bacteria 1176
781 Ga0495580_0008693 3300046472 Bacteria 8052
782 Ga0495580_0087958 3300046472 Bacteria 2164
783 Ga0495605_0000052 3300046474 Bacteria 162723
784 Ga0495605_0023076 3300046474 Bacteria 3277
785 Ga0495639_0058142 3300046475 Bacteria 1768
786 Ga0495664_0023263 3300046477 Bacteria 3596
787 Ga0495585_0143957 3300046492 Bacteria 1247
788 Ga0495594_0067940 3300046499 Bacteria 1979
789 Ga0495607_0001263 3300046501 Bacteria 22608
790 Ga0495607_0056788 3300046501 Bacteria 2246
791 Ga0495583_0000109 3300046506 Bacteria 138768
792 Ga0495583_0004248 3300046506 Bacteria 10388
793 Ga0495583_0040030 3300046506 Bacteria 2204
794 Ga0495606_0063266 3300046507 Bacteria 2359
795 Ga0495606_0121515 3300046507 Bacteria 1563
796 Ga0495606_0131210 3300046507 Bacteria 1489
797 Ga0495608_0008405 3300046511 Bacteria 7232
798 Ga0495610_0010882 3300046512 Bacteria 5614
799 Ga0495610_0027152 3300046512 Bacteria 3048
800 Ga0495610_0039390 3300046512 Bacteria 2390
801 Ga0495610_0042568 3300046512 Bacteria 2270
802 Ga0495610_0050110 3300046512 Bacteria 2040
803 Ga0495618_0001639 3300046514 Bacteria 14929
804 Ga0495628_0051084 3300046516 Bacteria 3269
805 Ga0495630_0043322 3300046517 Bacteria 3362
806 Ga0495631_0024202 3300046518 Bacteria 2806
807 Ga0495631_0049474 3300046518 Bacteria 1840
808 Ga0495631_0090419 3300046518 Bacteria 1318
809 Ga0495632_0000635 3300046519 Bacteria 32308
810 Ga0495632_0017683 3300046519 Bacteria 3930
811 Ga0495632_0034083 3300046519 Bacteria 2608
812 Ga0495632_0057548 3300046519 Bacteria 1897
813 Ga0495632_0097990 3300046519 Bacteria 1383
814 Ga0495632_0106518 3300046519 Bacteria 1319
815 Ga0495632_0146243 3300046519 Bacteria 1094
816 Ga0495637_0002699 3300046520 Bacteria 9687
817 Ga0495637_0008057 3300046520 Bacteria 5187
818 Ga0495637_0009428 3300046520 Bacteria 4763
819 Ga0495637_0019432 3300046520 Bacteria 3141
820 Ga0495637_0027777 3300046520 Bacteria 2528
821 Ga0495648_0145620 3300046524 Bacteria 1242
822 Ga0495648_0148488 3300046524 Bacteria 1225
823 Ga0495642_0080362 3300046528 Bacteria 1372
824 Ga0495652_0009632 3300046529 Bacteria 8771
825 Ga0495654_0000121 3300046530 Bacteria 86743
826 Ga0495665_0135365 3300046531 Bacteria 1289
827 Ga0495640_0001593 3300046533 Bacteria 17910
828 Ga0495640_0035889 3300046533 Bacteria 3507
829 Ga0495587_0001278 3300046536 Bacteria 16748
830 Ga0495598_0048766 3300046537 Bacteria 1267
831 Ga0495609_0021486 3300046538 Bacteria 2977
832 Ga0495609_0078216 3300046538 Bacteria 1448
833 Ga0495621_0060165 3300046539 Bacteria 1377
834 Ga0495597_0000061 3300046542 Bacteria 92012
835 Ga0495622_0014437 3300046557 Bacteria 3666
836 Ga0495667_0001611 3300046559 Bacteria 14962
837 Ga0495668_0038969 3300046616 Bacteria 2654
838 Ga0495668_0099550 3300046616 Bacteria 1590
839 Ga0495634_0006916 3300046642 Bacteria 8573
840 Ga0495611_0009976 3300046648 Bacteria 4020
841 Ga0495611_0149054 3300046648 Bacteria 1092
842 Ga0495611_0174111 3300046648 Bacteria 1006
843 Ga0495625_0026341 3300046660 Bacteria 4395
844 Ga0495625_0093163 3300046660 Bacteria 2080
845 Ga0495625_0110236 3300046660 Bacteria 1882
846 Ga0495635_0080504 3300046663 Bacteria 2229
847 Ga0495635_0193796 3300046663 Bacteria 1379
848 Ga0495659_0083925 3300046664 Bacteria 1213
849 Ga0495661_0000144 3300046665 Bacteria 82961
850 Ga0495661_0000344 3300046665 Bacteria 50689
851 Ga0495661_0033283 3300046665 Bacteria 3252
852 Ga0495661_0196980 3300046665 Bacteria 1057
853 Ga0495588_0104592 3300046674 Bacteria 1489
854 Ga0495599_0001159 3300046678 Bacteria 14939
855 Ga0495599_0286625 3300046678 Bacteria 996
856 Ga0495669_0059080 3300046684 Bacteria 1731
857 Ga0495669_0088062 3300046684 Bacteria 1431
858 Ga0495613_0062258 3300046689 Bacteria 2731
859 Ga0495670_0127238 3300046691 Bacteria 1326
860 Ga0495649_0000676 3300046694 Bacteria 27733
861 Ga0495649_0185092 3300046694 Bacteria 1085
862 Ga0495589_0130697 3300046794 Bacteria 1206
863 Ga0495600_0002886 3300046809 Bacteria 10017
864 Ga0495660_0000072 3300046810 Bacteria 109692
865 Ga0495660_0002969 3300046810 Bacteria 10603
866 Ga0495660_0085077 3300046810 Bacteria 1653
867 Ga0495660_0139256 3300046810 Bacteria 1209
868 Ga0495581_0089191 3300047315 Bacteria 1788
869 Ga0495604_0003637 3300047317 Bacteria 12292
870 Ga0495674_0017668 3300047319 Bacteria 6641
871 Ga0495672_0003920 3300047320 Bacteria 12489
872 Ga0495672_0011899 3300047320 Bacteria 6105
873 Ga0495672_0016205 3300047320 Bacteria 5034
874 Ga0495676_0039510 3300047321 Bacteria 3907
875 Ga0495676_0054173 3300047321 Bacteria 3190
876 Ga0495680_0002984 3300047322 Bacteria 16902
877 Ga0495683_0000320 3300047323 Bacteria 40260
878 Ga0495683_0001721 3300047323 Bacteria 13875
879 Ga0495687_043352 3300047443 Bacteria 1961
880 Ga0495675_0001860 3300047444 Bacteria 12561
881 Ga0495677_0060799 3300047445 Bacteria 1401
882 Ga0495673_0000112 3300047469 Bacteria 164434
883 Ga0495673_0025561 3300047469 Bacteria 2832
884 Ga0495673_0055249 3300047469 Bacteria 1723
885 Ga0495673_0101741 3300047469 Bacteria 1160
886 Ga0495686_0021593 3300047472 Bacteria 4271
887 Ga0495686_0024626 3300047472 Bacteria 3952
888 Ga0495686_0059825 3300047472 Bacteria 2370
889 Ga0495686_0062523 3300047472 Bacteria 2309
890 Ga0495686_0063181 3300047472 Bacteria 2295
891 Ga0495593_0097054 3300047673 Bacteria 1514
892 Ga0495602_0124858 3300048088 Bacteria 2064
893 Ga0495615_0000019 3300048090 Bacteria 54462
894 Ga0495626_0006181 3300048091 Bacteria 6846
895 Ga0496100_0091918 3300048903 Bacteria 2072
896 Ga0496100_0206015 3300048903 Bacteria 1436
897 Ga0496101_0007862 3300048904 Bacteria 6938
898 Ga0496101_0012938 3300048904 Bacteria 5580
899 Ga0496101_0199400 3300048904 Bacteria 1547
900 Ga0496101_0206713 3300048904 Bacteria 1520
901 Ga0496102_0012820 3300048905 Bacteria 7258
902 Ga0496102_0015629 3300048905 Bacteria 6612
903 Ga0496102_0116528 3300048905 Bacteria 2493
904 Ga0496102_0247265 3300048905 Bacteria 1682
905 Ga0496103_0005197 3300048906 Bacteria 7831
906 Ga0496103_0199668 3300048906 Bacteria 1286
907 Ga0496104_0118467 3300048907 Bacteria 2542
908 Ga0496104_0157196 3300048907 Bacteria 2182
909 Ga0496104_0209376 3300048907 Bacteria 1862
910 Ga0496105_0002129 3300048908 Bacteria 14348
911 Ga0496105_0061342 3300048908 Bacteria 3103
912 Ga0496105_0183879 3300048908 Bacteria 1711
913 Ga0496106_0000038 3300048909 Bacteria 111983
914 Ga0496106_0005325 3300048909 Bacteria 9529
915 Ga0496106_0071978 3300048909 Bacteria 2643
916 Ga0496106_0145724 3300048909 Bacteria 1865
917 Ga0496106_0236611 3300048909 Bacteria 1459
918 Ga0496107_0079364 3300048910 Bacteria 2392
919 Ga0496107_0103060 3300048910 Bacteria 2093
920 Ga0496107_0361136 3300048910 Bacteria 1081
921 Ga0496108_0331983 3300048911 Bacteria 1326
922 Ga0496109_0001563 3300048912 Bacteria 19072
923 Ga0496109_0021635 3300048912 Bacteria 5690
924 Ga0496109_0278571 3300048912 Bacteria 1576
925 Ga0496110_0208556 3300048913 Bacteria 1776
926 Ga0496111_0312065 3300048914 Bacteria 1165
927 Ga0496111_0364273 3300048914 Bacteria 1070
928 Ga0496112_0012079 3300048915 Bacteria 7924
929 Ga0496112_0041328 3300048915 Bacteria 4511
930 Ga0496112_0187915 3300048915 Bacteria 2029
931 Ga0496112_0310368 3300048915 Bacteria 1522
932 Ga0496112_0364095 3300048915 Bacteria 1388
933 Ga0496113_0063442 3300048916 Bacteria 2792
934 Ga0496113_0291332 3300048916 Bacteria 1306
935 Ga0496115_0000354 3300048918 Bacteria 38566
936 Ga0496115_0001891 3300048918 Bacteria 14988
937 Ga0496115_0002784 3300048918 Bacteria 12569
938 Ga0496115_0035224 3300048918 Bacteria 3959
939 Ga0496115_0210181 3300048918 Bacteria 1607
940 Ga0496115_0250655 3300048918 Bacteria 1458
941 Ga0496115_0470043 3300048918 Bacteria 1014
942 Ga0496115_0513921 3300048918 Bacteria 961
943 Ga0496116_0011507 3300048919 Bacteria 7313
944 Ga0496116_0033234 3300048919 Bacteria 3663
945 Ga0496116_0057523 3300048919 Bacteria 2541
946 Ga0496116_0127353 3300048919 Bacteria 1460
947 Ga0496117_0004982 3300048920 Bacteria 14248
948 Ga0496117_0013888 3300048920 Bacteria 6982
949 Ga0496117_0017228 3300048920 Bacteria 6043
950 Ga0496117_0030168 3300048920 Bacteria 4165
951 Ga0496117_0035813 3300048920 Bacteria 3721
952 Ga0496117_0050794 3300048920 Bacteria 2938
953 Ga0496117_0087500 3300048920 Bacteria 2019
954 Ga0496117_0097680 3300048920 Bacteria 1870
955 Ga0496117_0194943 3300048920 Bacteria 1150
956 Ga0496117_0284641 3300048920 Bacteria 883
957 Ga0496118_0001729 3300048921 Bacteria 31774
958 Ga0496118_0004151 3300048921 Bacteria 17500
959 Ga0496118_0005800 3300048921 Bacteria 13850
960 Ga0496118_0005874 3300048921 Bacteria 13753
961 Ga0496118_0010226 3300048921 Bacteria 9312
962 Ga0496118_0010237 3300048921 Bacteria 9307
963 Ga0496118_0017638 3300048921 Bacteria 6484
964 Ga0496118_0056319 3300048921 Bacteria 2957
965 Ga0496118_0060289 3300048921 Bacteria 2818
966 Ga0496118_0088569 3300048921 Bacteria 2140
967 Ga0496118_0098370 3300048921 Bacteria 1987
968 Ga0496118_0129515 3300048921 Bacteria 1624
969 Ga0496118_0226947 3300048921 Bacteria 1081
970 Ga0496119_0000531 3300048922 Bacteria 51990
971 Ga0496119_0014656 3300048922 Bacteria 6109
972 Ga0496119_0017955 3300048922 Bacteria 5291
973 Ga0496119_0075998 3300048922 Bacteria 1950
974 Ga0496119_0107169 3300048922 Bacteria 1558
975 Ga0496120_0000182 3300048923 Bacteria 107094
976 Ga0496120_0034351 3300048923 Bacteria 3038
977 Ga0496120_0043278 3300048923 Bacteria 2625
978 Ga0496120_0059051 3300048923 Bacteria 2151
979 Ga0496120_0154338 3300048923 Bacteria 1151
980 Ga0496121_0000341 3300048924 Bacteria 97289
981 Ga0496121_0000571 3300048924 Bacteria 69504
982 Ga0496121_0000667 3300048924 Bacteria 64115
983 Ga0496121_0002861 3300048924 Bacteria 25436
984 Ga0496121_0003867 3300048924 Bacteria 20816
985 Ga0496121_0004961 3300048924 Bacteria 17452
986 Ga0496121_0005470 3300048924 Bacteria 16266
987 Ga0496121_0024997 3300048924 Bacteria 5688
988 Ga0496121_0030860 3300048924 Bacteria 4913
989 Ga0496121_0041642 3300048924 Bacteria 4011
990 Ga0496121_0096681 3300048924 Bacteria 2291
991 Ga0496121_0142300 3300048924 Bacteria 1777
992 Ga0496121_0159027 3300048924 Bacteria 1654
993 Ga0496121_0177884 3300048924 Bacteria 1539
994 Ga0496122_0000719 3300048925 Bacteria 64886
995 Ga0496122_0010121 3300048925 Bacteria 9782
996 Ga0496122_0013339 3300048925 Bacteria 8050
997 Ga0496122_0014830 3300048925 Bacteria 7505
998 Ga0496122_0016538 3300048925 Bacteria 6969
999 Ga0496122_0218275 3300048925 Bacteria 1097
1000 Ga0496123_0000325 3300048926 Bacteria 90905
1001 Ga0496123_0007813 3300048926 Bacteria 9957
1002 Ga0496123_0014475 3300048926 Bacteria 6535
1003 Ga0496123_0081921 3300048926 Bacteria 1958
1004 Ga0496123_0083530 3300048926 Bacteria 1931
1005 Ga0496123_0099017 3300048926 Bacteria 1703
1006 Ga0496124_0000047 3300048927 Bacteria 285554
1007 Ga0496124_0000519 3300048927 Bacteria 65692
1008 Ga0496124_0006231 3300048927 Bacteria 13068
1009 Ga0496124_0030539 3300048927 Bacteria 4781
1010 Ga0496124_0040044 3300048927 Bacteria 4056
1011 Ga0496124_0051479 3300048927 Bacteria 3504
1012 Ga0496124_0116816 3300048927 Bacteria 2138
1013 Ga0496124_0152413 3300048927 Bacteria 1811
1014 Ga0496125_0000060 3300048928 Bacteria 264143
1015 Ga0496125_0000147 3300048928 Bacteria 154731
1016 Ga0496125_0001951 3300048928 Bacteria 28177
1017 Ga0496125_0003103 3300048928 Bacteria 20706
1018 Ga0496125_0007113 3300048928 Bacteria 11943
1019 Ga0496125_0016401 3300048928 Bacteria 7117
1020 Ga0496125_0016874 3300048928 Bacteria 6992
1021 Ga0496125_0032900 3300048928 Bacteria 4598
1022 Ga0496125_0047398 3300048928 Bacteria 3594
1023 Ga0496125_0057558 3300048928 Bacteria 3147
1024 Ga0496125_0127996 3300048928 Bacteria 1795
1025 Ga0496125_0257440 3300048928 Bacteria 1096
1026 Ga0496126_0000412 3300048929 Bacteria 86638
1027 Ga0496126_0000996 3300048929 Bacteria 48318
1028 Ga0496126_0004035 3300048929 Bacteria 17860
1029 Ga0496126_0006811 3300048929 Bacteria 12676
1030 Ga0496126_0007721 3300048929 Bacteria 11736
1031 Ga0496126_0008802 3300048929 Bacteria 10828
1032 Ga0496126_0012455 3300048929 Bacteria 8710
1033 Ga0496126_0013337 3300048929 Bacteria 8367
1034 Ga0496126_0034921 3300048929 Bacteria 4716
1035 Ga0496126_0043949 3300048929 Bacteria 4118
1036 Ga0496126_0053580 3300048929 Bacteria 3659
1037 Ga0496126_0077562 3300048929 Bacteria 2945
1038 Ga0496126_0092056 3300048929 Bacteria 2665
1039 Ga0496126_0134210 3300048929 Bacteria 2136
1040 Ga0496126_0155394 3300048929 Bacteria 1958
1041 Ga0496126_0284218 3300048929 Bacteria 1369
1042 Ga0496126_0569132 3300048929 Bacteria 897
1043 Ga0496126_0617355 3300048929 Bacteria 852
1044 Ga0495682_0021191 3300049460 Bacteria 2437
1045 Ga0501032_0199471 3300049569 Bacteria 1306
1046 Ga0501033_0024051 3300049570 Bacteria 4596
1047 Ga0501033_0025341 3300049570 Bacteria 4466
1048 Ga0501033_0058238 3300049570 Bacteria 2854
1049 Ga0501034_0004805 3300049571 Bacteria 14939
1050 Ga0501034_0121216 3300049571 Bacteria 2601
1051 Ga0501034_0152998 3300049571 Bacteria 2282
1052 Ga0501034_0486849 3300049571 Bacteria 1148
1053 Ga0501034_0547310 3300049571 Bacteria 1067
1054 Ga0501036_0222596 3300049572 Bacteria 1584
1055 Ga0501036_0408284 3300049572 Bacteria 1133
1056 Ga0501037_0248019 3300049573 Bacteria 1246
1057 Ga0501040_0076211 3300049576 Bacteria 2319
1058 Ga0501043_0142602 3300049579 Bacteria 1876
1059 Ga0501043_0283284 3300049579 Bacteria 1270
1060 Ga0501043_0496302 3300049579 Bacteria 912
1061 Ga0501046_0225640 3300049580 Bacteria 1386
1062 Ga0501047_0002924 3300049581 Bacteria 16223
1063 Ga0501047_0066312 3300049581 Bacteria 3479
1064 Ga0501047_0178143 3300049581 Bacteria 1993
1065 Ga0501047_0291667 3300049581 Bacteria 1475
1066 Ga0501048_0001756 3300049582 Bacteria 16489
1067 Ga0501048_0142240 3300049582 Bacteria 1696
1068 Ga0501067_0114972 3300049583 Bacteria 1496
1069 Ga0501067_0161093 3300049583 Bacteria 1249
1070 Ga0501069_0194401 3300049585 Bacteria 1174
1071 Ga0501069_0301155 3300049585 Bacteria 940
1072 Ga0501070_0000284 3300049586 Bacteria 47435
1073 Ga0501070_0005043 3300049586 Bacteria 11263
1074 Ga0501073_0066780 3300049589 Bacteria 2507
1075 Ga0501074_0113977 3300049590 Bacteria 1934
1076 Ga0501074_0196601 3300049590 Bacteria 1437
1077 Ga0501238_017312 3300049671 Bacteria 1002
1078 Ga0501079_0213929 3300049741 Bacteria 1506
1079 Ga0501080_0000843 3300049742 Bacteria 25055
1080 Ga0501080_0508678 3300049742 Bacteria 1076
1081 Ga0501080_0707343 3300049742 Bacteria 888
1082 Ga0501083_0006163 3300049744 Bacteria 8508
1083 Ga0501035_0003018 3300049822 Bacteria 16149
1084 Ga0501035_0003062 3300049822 Bacteria 16037
1085 Ga0501035_0013181 3300049822 Bacteria 7630
1086 Ga0501035_0016883 3300049822 Bacteria 6730
1087 Ga0501044_0015668 3300049823 Bacteria 8164
1088 Ga0501044_0015688 3300049823 Bacteria 8157
1089 Ga0501044_0046990 3300049823 Bacteria 4466
1090 Ga0501044_0121116 3300049823 Bacteria 2617
1091 Ga0501044_0363130 3300049823 Bacteria 1366
1092 Ga0501045_0013913 3300049824 Bacteria 5691
1093 nmdc:mga03n38_1460_c1 3300050490 Bacteria 6789
1094 nmdc:mga03n38_27198_c1 3300050490 Bacteria 2370
1095 nmdc:mga00v17_149136_c1 3300050491 Bacteria 1502
1096 nmdc:mga00v17_200076_c1 3300050491 Bacteria 1291
1097 nmdc:mga0yw44_198650_c1 3300050492 Bacteria 1324
1098 nmdc:mga0yw44_2135_c2 3300050492 Bacteria 6932
1099 nmdc:mga0yw44_373759_c1 3300050492 Bacteria 962
1100 nmdc:mga0yw44_401645_c1 3300050492 Bacteria 927
1101 nmdc:mga0yw44_5143_c1 3300050492 Bacteria 3741
1102 nmdc:mga0yw44_61919_c1 3300050492 Bacteria 2297
1103 nmdc:mga0k408_119964_c1 3300050493 Bacteria 1557
1104 nmdc:mga0k408_353677_c1 3300050493 Bacteria 876
1105 nmdc:mga0k408_55598_c1 3300050493 Bacteria 2295
1106 nmdc:mga06z11_114010_c1 3300050494 Bacteria 1500
1107 nmdc:mga06z11_13554_c1 3300050494 Bacteria 3584
1108 nmdc:mga06z11_213198_c1 3300050494 Bacteria 1126
1109 nmdc:mga04h51_11849_c1 3300050495 Bacteria 2432
1110 nmdc:mga04h51_139194_c1 3300050495 Bacteria 919
1111 nmdc:mga07m45_2086_c1 3300050496 Bacteria 9285
1112 nmdc:mga07m45_5016_c1 3300050496 Bacteria 6536
1113 nmdc:mga0n895_512243_c1 3300050512 Bacteria 1208
1114 nmdc:mga08x19_95087_c1 3300050514 Bacteria 1971
1115 nmdc:mga0sz30_11749_c1 3300050516 Bacteria 3390
1116 nmdc:mga0sz30_41697_c1 3300050516 Bacteria 1930
1117 nmdc:mga0sz30_64442_c2 3300050516 Bacteria 1213
1118 nmdc:mga0sz30_67178_c1 3300050516 Bacteria 1539
1119 nmdc:mga0sz30_73784_c1 3300050516 Bacteria 1471
1120 Ga0495601_0001473 3300053077 Bacteria 12971
1121 Ga0495601_0040276 3300053077 Bacteria 2926
1122 Ga0495595_0000273 3300053084 Bacteria 20369
1123 Ga0495619_0001384 3300053085 Bacteria 15951
1124 Ga0500578_0061100 3300053086 Bacteria 2406
1125 Ga0500578_0197278 3300053086 Bacteria 1233
1126 Ga0500643_000015 3300053087 Bacteria 310312
1127 Ga0500643_033965 3300053087 Bacteria 1539
1128 Ga0500646_0040496 3300053090 Bacteria 1310
1129 Ga0500651_0001456 3300053093 Bacteria 11910
1130 Ga0500651_0002351 3300053093 Bacteria 9945
1131 Ga0500651_0024107 3300053093 Bacteria 3814
1132 Ga0500566_0000007 3300053094 Bacteria 144968
1133 Ga0500566_0000499 3300053094 Bacteria 21864
1134 Ga0500566_0002374 3300053094 Bacteria 11143
1135 Ga0500566_0036407 3300053094 Bacteria 2855
1136 Ga0500640_000901 3300053095 Bacteria 8290
1137 Ga0500641_0015222 3300053096 Bacteria 2850
1138 Ga0500641_0017967 3300053096 Bacteria 2654
1139 Ga0500641_0025202 3300053096 Bacteria 2299
1140 Ga0500650_0000457 3300053098 Bacteria 10189
1141 Ga0500555_001763 3300053103 Bacteria 6467
1142 Ga0500556_0005410 3300053104 Bacteria 3604
1143 Ga0500556_0015933 3300053104 Bacteria 2329
1144 Ga0500562_012381 3300053108 Bacteria 2169
1145 Ga0500562_032663 3300053108 Bacteria 1374
1146 Ga0500569_001911 3300053109 Bacteria 4024
1147 Ga0500572_000093 3300053111 Bacteria 29132
1148 Ga0500572_001776 3300053111 Bacteria 5543
1149 Ga0500591_009912 3300053115 Bacteria 4486
1150 Ga0500592_008090 3300053116 Bacteria 1667
1151 Ga0500594_0057800 3300053118 Bacteria 1110
1152 Ga0500595_002275 3300053119 Bacteria 9671
1153 Ga0500595_002383 3300053119 Bacteria 9395
1154 Ga0500595_002644 3300053119 Bacteria 8717
1155 Ga0500595_008876 3300053119 Bacteria 4084
1156 Ga0500595_018265 3300053119 Bacteria 2568
1157 Ga0500608_001344 3300053122 Bacteria 8794
1158 Ga0500608_051804 3300053122 Bacteria 1972
1159 Ga0500608_059884 3300053122 Bacteria 1821
1160 Ga0500618_000107 3300053125 Bacteria 67707
1161 Ga0500618_000171 3300053125 Bacteria 54421
1162 Ga0500618_000774 3300053125 Bacteria 18011
1163 Ga0500618_003377 3300053125 Bacteria 5502
1164 Ga0500618_012652 3300053125 Bacteria 2203
1165 Ga0500642_0000010 3300053130 Bacteria 272552
1166 Ga0500642_0009322 3300053130 Bacteria 3403
1167 Ga0500642_0010049 3300053130 Bacteria 3319
1168 Ga0500658_0024307 3300053134 Bacteria 2321
1169 Ga0500658_0050060 3300053134 Bacteria 1704
1170 Ga0500658_0054279 3300053134 Bacteria 1646
1171 Ga0500658_0078373 3300053134 Bacteria 1408
1172 Ga0500658_0174010 3300053134 Bacteria 978
1173 Ga0500559_0000242 3300053136 Bacteria 43285
1174 Ga0500559_0001322 3300053136 Bacteria 14281
1175 Ga0500559_0004374 3300053136 Bacteria 6726
1176 Ga0500559_0005444 3300053136 Bacteria 5853
1177 Ga0500559_0007675 3300053136 Bacteria 4763
1178 Ga0500559_0009365 3300053136 Bacteria 4244
1179 Ga0500559_0012928 3300053136 Bacteria 3541
1180 Ga0500559_0092836 3300053136 Bacteria 1383
1181 Ga0500568_0000280 3300053139 Bacteria 42298
1182 Ga0500568_0002443 3300053139 Bacteria 10935
1183 Ga0500568_0010135 3300053139 Bacteria 4432
1184 Ga0500568_0018704 3300053139 Bacteria 3025
1185 Ga0500568_0040159 3300053139 Bacteria 1885
1186 Ga0500573_0012261 3300053140 Bacteria 4811
1187 Ga0500573_0020981 3300053140 Bacteria 3742
1188 Ga0500577_0000170 3300053142 Bacteria 16549
1189 Ga0500577_0017103 3300053142 Bacteria 2302
1190 Ga0500577_0107746 3300053142 Bacteria 1146
1191 Ga0500586_001821 3300053145 Bacteria 4631
1192 Ga0500588_0007669 3300053146 Bacteria 2496
1193 Ga0500588_0022002 3300053146 Bacteria 1730
1194 Ga0500589_027273 3300053147 Bacteria 2650
1195 Ga0500590_084526 3300053148 Bacteria 1553
1196 Ga0500590_130848 3300053148 Bacteria 1161
1197 Ga0500603_000038 3300053150 Bacteria 31994
1198 Ga0500604_0020105 3300053151 Bacteria 1876
1199 Ga0500616_0000014 3300053153 Bacteria 637918
1200 Ga0500616_0000635 3300053153 Bacteria 42496
1201 Ga0500616_0001048 3300053153 Bacteria 29213
1202 Ga0500616_0005377 3300053153 Bacteria 8706
1203 Ga0500616_0010582 3300053153 Bacteria 5509
1204 Ga0500616_0040025 3300053153 Bacteria 2523
1205 Ga0500622_0000170 3300053156 Bacteria 70088
1206 Ga0500622_0000266 3300053156 Bacteria 53524
1207 Ga0500622_0007539 3300053156 Bacteria 6172
1208 Ga0500622_0048137 3300053156 Bacteria 2200
1209 Ga0500622_0081678 3300053156 Bacteria 1617
1210 Ga0500630_000331 3300053159 Bacteria 19734
1211 Ga0500633_0007843 3300053160 Bacteria 2715
1212 Ga0500634_0111099 3300053161 Bacteria 1352
1213 Ga0500638_000308 3300053162 Bacteria 11016
1214 Ga0500639_000013 3300053163 Bacteria 123899
1215 Ga0500639_001904 3300053163 Bacteria 10448
1216 Ga0500639_037476 3300053163 Bacteria 2555
1217 Ga0500636_0003875 3300053177 Bacteria 8444
1218 Ga0500636_0039252 3300053177 Bacteria 2799
1219 Ga0500636_0136612 3300053177 Bacteria 1361
1220 Ga0500637_0002745 3300053178 Bacteria 7897
1221 Ga0500637_0034021 3300053178 Bacteria 2850
1222 Ga0500637_0090495 3300053178 Bacteria 1772
1223 Ga0500570_052796 3300053724 Bacteria 2030
1224 Ga0500609_012076 3300053731 Bacteria 1168
1225 Ga0500596_000709 3300053735 Bacteria 6519
1226 Ga0500596_000940 3300053735 Bacteria 5807
1227 Ga0500601_000209 3300053737 Bacteria 11804
1228 Ga0501084_0164817 3300054114 Bacteria 1870
1229 Ga0501084_0173328 3300054114 Bacteria 1821
1230 Ga0501084_0401174 3300054114 Bacteria 1159
1231 Ga0500661_000113 3300055283 Bacteria 13250
1232 Ga0501082_0083388 3300060353 Bacteria 2758
1233 Ga0501082_0275649 3300060353 Bacteria 1464
1234 Ga0466962_0030728 3300061719 Bacteria 2572

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046471 Ga0495650_0089204 Ga0495650_0089204_432_1163 229
2 3300048920 Ga0496117_0050794 Ga0496117_0050794_26_757 229
3 3300046519 Ga0495632_0017683 Ga0495632_0017683_3192_3899 231
4 3300046678 Ga0495599_0001159 Ga0495599_0001159_10082_10927 232
5 iso_pu_bacteria 2585428062 2587757217 252
6 3300013104 Ga0157370_10174678 Ga0157370_101746781 255
7 3300049583 Ga0501067_0161093 Ga0501067_0161093_427_1218 257
8 3300005577 Ga0068857_100142342 Ga0068857_1001423422 261
9 3300009093 Ga0105240_10411901 Ga0105240_104119012 261
10 3300009551 Ga0105238_10045018 Ga0105238_100450182 261
11 3300025924 Ga0207694_10041683 Ga0207694_100416832 261
12 3300049823 Ga0501044_0363130 Ga0501044_0363130_549_1352 261
13 3300048905 Ga0496102_0116528 Ga0496102_0116528_794_1630 262
14 iso_pu_bacteria 2842918807 2842919255 262
15 3300013104 Ga0157370_10000008 Ga0157370_10000008183 264
16 3300031711 Ga0265314_10020524 Ga0265314_100205242 264
17 3300005335 Ga0070666_10005024 Ga0070666_100050249 265
18 3300005563 Ga0068855_100050993 Ga0068855_1000509938 265
19 3300005937 Ga0081455_10002199 Ga0081455_1000219910 265
20 3300009177 Ga0105248_10831328 Ga0105248_108313282 265
21 3300013297 Ga0157378_10039744 Ga0157378_100397445 265
22 3300025903 Ga0207680_10023183 Ga0207680_100231833 265
23 3300025949 Ga0207667_10261841 Ga0207667_102618412 265
24 3300025986 Ga0207658_10072414 Ga0207658_100724142 265
25 3300048912 Ga0496109_0021635 Ga0496109_0021635_1279_2124 265
26 3300048914 Ga0496111_0312065 Ga0496111_0312065_142_987 265
27 3300048929 Ga0496126_0284218 Ga0496126_0284218_13_852 265
28 3300053731 Ga0500609_012076 Ga0500609_012076_22_822 265
29 iso_pu_bacteria 2512875016 2512931914 265
30 iso_pu_bacteria 2599185155 2599327722 265
31 iso_pu_bacteria 2857576091 2857577113 265
32 iso_pu_bacteria 2876363079 2876368902 265
33 iso_pu_bacteria 2903448605 2903450874 265
34 iso_pu_bacteria 2903521522 2903527900 265
35 iso_pu_bacteria 2903528002 2903529788 265
36 iso_pu_bacteria 2937848649 2937852631 265
37 iso_pu_bacteria 2963644680 2963647294 265
38 iso_pu_bacteria 2968083720 2968087871 265
39 iso_pu_bacteria 2977922695 2977924958 265
40 3300005339 Ga0070660_100455926 Ga0070660_1004559261 266
41 3300013296 Ga0157374_10153909 Ga0157374_101539091 266
42 3300037471 Ga0395905_0784377 Ga0395905_0784377_11_817 266
43 iso_pu_bacteria 2821443989 2821447497 266
44 iso_pu_bacteria 2842324504 2842325387 266
45 iso_pu_bacteria 2842348783 2842349666 266
46 iso_pu_bacteria 2842454564 2842455096 266
47 3300046471 Ga0495650_0000075 Ga0495650_0000075_162553_163368 267
48 3300049569 Ga0501032_0199471 Ga0501032_0199471_333_1151 267
49 3300049586 Ga0501070_0005043 Ga0501070_0005043_8209_9027 267
50 3300049742 Ga0501080_0508678 Ga0501080_0508678_231_1049 267
51 3300049823 Ga0501044_0015668 Ga0501044_0015668_3452_4270 267
52 3300053094 Ga0500566_0000007 Ga0500566_0000007_126404_127216 267
53 3300053095 Ga0500640_000901 Ga0500640_000901_1771_2583 267
54 3300053111 Ga0500572_001776 Ga0500572_001776_1019_1831 267
55 3300053115 Ga0500591_009912 Ga0500591_009912_2894_3706 267
56 3300053122 Ga0500608_059884 Ga0500608_059884_615_1427 267
57 3300053136 Ga0500559_0005444 Ga0500559_0005444_3432_4244 267
58 3300053150 Ga0500603_000038 Ga0500603_000038_13456_14268 267
59 3300053159 Ga0500630_000331 Ga0500630_000331_12571_13383 267
60 3300053163 Ga0500639_000013 Ga0500639_000013_71944_72756 267
61 3300053178 Ga0500637_0090495 Ga0500637_0090495_859_1671 267
62 3300053735 Ga0500596_000709 Ga0500596_000709_633_1445 267
63 iso_pu_bacteria 2512875024 2512959867 267
64 iso_pu_bacteria 2513237164 2514036111 267
65 iso_pu_bacteria 2537561587 2537873511 267
66 iso_pu_bacteria 2588253730 2588517774 267
67 iso_pu_bacteria 2599185210 2599605613 267
68 iso_pu_bacteria 2904564687 2904569612 267
69 iso_pu_bacteria 2904571731 2904576923 267
70 3300005327 Ga0070658_10014112 Ga0070658_100141123 268
71 3300005563 Ga0068855_100089020 Ga0068855_1000890202 268
72 3300006177 Ga0075362_10059213 Ga0075362_100592132 268
73 3300025261 Ga0209233_1002186 Ga0209233_10021868 268
74 3300025272 Ga0209455_1005152 Ga0209455_10051523 268
75 3300025909 Ga0207705_10304147 Ga0207705_103041471 268
76 3300025913 Ga0207695_10001151 Ga0207695_1000115131 268
77 3300025924 Ga0207694_10098745 Ga0207694_100987452 268
78 3300025949 Ga0207667_10026498 Ga0207667_100264983 268
79 3300027312 Ga0209371_1019645 Ga0209371_10196451 268
80 3300030500 Ga0268256_1018567 Ga0268256_10185673 268
81 3300039447 Ga0436361_0174497 Ga0436361_0174497_2850_3659 268
82 3300046520 Ga0495637_0009428 Ga0495637_0009428_3017_3838 268
83 3300046665 Ga0495661_0000344 Ga0495661_0000344_46312_47127 268
84 3300047472 Ga0495686_0024626 Ga0495686_0024626_229_1050 268
85 3300049571 Ga0501034_0486849 Ga0501034_0486849_304_1119 268
86 3300049581 Ga0501047_0291667 Ga0501047_0291667_405_1220 268
87 3300050516 nmdc:mga0sz30_67178_c1 nmdc:mga0sz30_67178_c1_228_1055 268
88 3300053153 Ga0500616_0010582 Ga0500616_0010582_2003_2818 268
89 iso_pu_bacteria 2510917030 2511195835 268
90 iso_pu_bacteria 2582581298 2585222527 268
91 iso_pu_bacteria 2582581308 2585278633 268
92 iso_pu_bacteria 2582581315 2585325752 268
93 iso_pu_bacteria 2585427527 2585536301 268
94 iso_pu_bacteria 2585427529 2585545110 268
95 iso_pu_bacteria 2585427530 2585554175 268
96 iso_pu_bacteria 2599185169 2599409770 268
97 iso_pu_bacteria 2600255254 2601521736 268
98 iso_pu_bacteria 2600255255 2601526761 268
99 iso_pu_bacteria 2600255280 2601613591 268
100 iso_pu_bacteria 2600255281 2601618314 268
101 iso_pu_bacteria 2600255287 2601643059 268
102 iso_pu_bacteria 2600255288 2601647929 268
103 iso_pu_bacteria 2600255289 2601651739 268
104 iso_pu_bacteria 2600255290 2601657066 268
105 iso_pu_bacteria 2600255291 2601662880 268
106 iso_pu_bacteria 2600255298 2601695839 268
107 iso_pu_bacteria 2600255299 2601700513 268
108 iso_pu_bacteria 2600255300 2601704863 268
109 iso_pu_bacteria 2600255301 2601709892 268
110 iso_pu_bacteria 2600255302 2601714904 268
111 iso_pu_bacteria 2600255303 2601720864 268
112 iso_pu_bacteria 2600255304 2601725310 268
113 iso_pu_bacteria 2600255305 2601729852 268
114 iso_pu_bacteria 2600255306 2601734869 268
115 iso_pu_bacteria 2600255307 2601739554 268
116 iso_pu_bacteria 2600255309 2601750043 268
117 iso_pu_bacteria 2600255392 2602017296 268
118 iso_pu_bacteria 2602042052 2603660255 268
119 iso_pu_bacteria 2602042053 2603665530 268
120 iso_pu_bacteria 2602042103 2603837231 268
121 iso_pu_bacteria 2602042104 2603842307 268
122 iso_pu_bacteria 2602042105 2603847380 268
123 iso_pu_bacteria 2602042106 2603852451 268
124 iso_pu_bacteria 2602042110 2603870505 268
125 iso_pu_bacteria 2602042111 2603875443 268
126 iso_pu_bacteria 2603880178 2606047695 268
127 iso_pu_bacteria 2603880184 2606069961 268
128 iso_pu_bacteria 2603880202 2606145800 268
129 iso_pu_bacteria 2603880211 2606175097 268
130 iso_pu_bacteria 2615840626 2616306092 268
131 iso_pu_bacteria 2636415599 2637225707 268
132 iso_pu_bacteria 2643221547 2643755808 268
133 iso_pu_bacteria 2643221599 2644003663 268
134 iso_pu_bacteria 2675903046 2676406919 268
135 iso_pu_bacteria 2775507074 2777023556 268
136 iso_pu_bacteria 2818991453 2819639523 268
137 iso_pu_bacteria 2856328259 2856333796 268
138 iso_pu_bacteria 2856334872 2856335001 268
139 iso_pu_bacteria 2857367948 2857368365 268
140 iso_pu_bacteria 2869249662 2869253113 268
141 iso_pu_bacteria 2869264136 2869265835 268
142 iso_pu_bacteria 2869271264 2869272061 268
143 iso_pu_bacteria 2871459585 2871460987 268
144 iso_pu_bacteria 2874109183 2874115740 268
145 iso_pu_bacteria 2874131515 2874138592 268
146 iso_pu_bacteria 2874162495 2874165178 268
147 iso_pu_bacteria 2876399893 2876404881 268
148 iso_pu_bacteria 2876406927 2876408343 268
149 iso_pu_bacteria 2878774303 2878775307 268
150 iso_pu_bacteria 2878781027 2878784480 268
151 iso_pu_bacteria 2906363423 2906364607 268
152 iso_pu_bacteria 2906370794 2906377240 268
153 iso_pu_bacteria 2906386501 2906387611 268
154 iso_pu_bacteria 2906393657 2906398674 268
155 iso_pu_bacteria 2906408224 2906413557 268
156 iso_pu_bacteria 2922151315 2922158266 268
157 iso_pu_bacteria 2922172374 2922176746 268
158 iso_pu_bacteria 2922178524 2922184049 268
159 iso_pu_bacteria 2924748358 2924752296 268
160 iso_pu_bacteria 2939607340 2939609290 268
161 iso_pu_bacteria 3005452660 3005458316 268
162 iso_pu_bacteria 8054302542 8054303324 268
163 3300003762 Ga0055542_1000401 Ga0055542_100040138 269
164 3300003763 Ga0055529_1010335 Ga0055529_10103351 269
165 3300003794 Ga0055531_10005497 Ga0055531_100054975 269
166 3300005548 Ga0070665_100005024 Ga0070665_1000050247 269
167 3300006186 Ga0075369_10147708 Ga0075369_101477082 269
168 3300006353 Ga0075370_10020985 Ga0075370_100209854 269
169 3300009036 Ga0105244_10000148 Ga0105244_1000014841 269
170 3300009148 Ga0105243_10005831 Ga0105243_100058314 269
171 3300009174 Ga0105241_10072742 Ga0105241_100727423 269
172 3300009545 Ga0105237_10181704 Ga0105237_101817043 269
173 3300010375 Ga0105239_10102690 Ga0105239_101026904 269
174 3300011119 Ga0105246_10028136 Ga0105246_100281364 269
175 3300013296 Ga0157374_10117843 Ga0157374_101178432 269
176 3300014497 Ga0182008_10055853 Ga0182008_100558532 269
177 3300015261 Ga0182006_1067312 Ga0182006_10673122 269
178 3300025254 Ga0209148_1000037 Ga0209148_1000037196 269
179 3300025272 Ga0209455_1000036 Ga0209455_1000036173 269
180 3300025298 Ga0209050_1043377 Ga0209050_10433771 269
181 3300025304 Ga0209257_1000150 Ga0209257_1000150142 269
182 3300025728 Ga0207655_1006920 Ga0207655_10069205 269
183 3300025911 Ga0207654_10201811 Ga0207654_102018111 269
184 3300025914 Ga0207671_10034499 Ga0207671_100344991 269
185 3300025935 Ga0207709_10024675 Ga0207709_100246755 269
186 3300028379 Ga0268266_10003815 Ga0268266_100038159 269
187 3300037853 Ga0436364_1108064 Ga0436364_1108064_3463_4293 269
188 3300045976 Ga0466967_0127474 Ga0466967_0127474_819_1631 269
189 3300046471 Ga0495650_0000015 Ga0495650_0000015_330557_331375 269
190 3300046512 Ga0495610_0042568 Ga0495610_0042568_111_962 269
191 3300048914 Ga0496111_0364273 Ga0496111_0364273_107_928 269
192 3300048915 Ga0496112_0012079 Ga0496112_0012079_3931_4749 269
193 3300048924 Ga0496121_0177884 Ga0496121_0177884_98_919 269
194 3300048925 Ga0496122_0218275 Ga0496122_0218275_128_958 269
195 3300048926 Ga0496123_0099017 Ga0496123_0099017_226_1062 269
196 3300048928 Ga0496125_0000060 Ga0496125_0000060_191534_192370 269
197 3300049571 Ga0501034_0004805 Ga0501034_0004805_5996_6814 269
198 3300053122 Ga0500608_051804 Ga0500608_051804_688_1518 269
199 3300053125 Ga0500618_003377 Ga0500618_003377_3026_3862 269
200 3300053134 Ga0500658_0174010 Ga0500658_0174010_112_930 269
201 3300053139 Ga0500568_0040159 Ga0500568_0040159_966_1784 269
202 3300053142 Ga0500577_0000170 Ga0500577_0000170_9490_10326 269
203 3300053177 Ga0500636_0003875 Ga0500636_0003875_3433_4263 269
204 iso_pu_bacteria 2510065059 2510315855 269
205 iso_pu_bacteria 2524023209 2524458850 269
206 iso_pu_bacteria 2738541271 2738692109 269
207 iso_pu_bacteria 2738543016 2739267767 269
208 iso_pu_bacteria 2818991466 2819714710 269
209 iso_pu_bacteria 2842298080 2842298200 269
210 iso_pu_bacteria 2842357229 2842360200 269
211 iso_pu_bacteria 2844009547 2844013310 269
212 iso_pu_bacteria 2844533157 2844533186 269
213 iso_pu_bacteria 2869169390 2869173301 269
214 iso_pu_bacteria 2869234852 2869236676 269
215 iso_pu_bacteria 2869242130 2869244678 269
216 iso_pu_bacteria 2869256925 2869263987 269
217 iso_pu_bacteria 2871435913 2871436834 269
218 iso_pu_bacteria 2871451962 2871453130 269
219 iso_pu_bacteria 2874116593 2874118100 269
220 iso_pu_bacteria 2876386047 2876388085 269
221 iso_pu_bacteria 2876808645 2876811892 269
222 iso_pu_bacteria 2879110137 2879118707 269
223 iso_pu_bacteria 2889306138 2889309666 269
224 iso_pu_bacteria 2897803580 2897807840 269
225 iso_pu_bacteria 2903513507 2903514063 269
226 iso_pu_bacteria 2904513164 2904513439 269
227 iso_pu_bacteria 2906401398 2906407207 269
228 iso_pu_bacteria 2929199973 2929203687 269
229 iso_pu_bacteria 2941531003 2941537466 269
230 iso_pu_bacteria 2969079654 2969082694 269
231 iso_pu_bacteria 2984559226 2984559768 269
232 iso_pu_bacteria 2984595703 2984597849 269
233 iso_pu_bacteria 3004211236 3004211982 269
234 iso_pu_bacteria 3004218560 3004224647 269
235 iso_pu_bacteria 637000159 637075011 269
236 iso_pu_bacteria 8055301274 8055303350 269
237 iso_pu_bacteria 8055909800 8055911125 269
238 3300001990 JGI24737J22298_10005281 JGI24737J22298_100052814 270
239 3300001990 JGI24737J22298_10013841 JGI24737J22298_100138412 270
240 3300002067 JGI24735J21928_10036537 JGI24735J21928_100365372 270
241 3300002077 JGI24744J21845_10002209 JGI24744J21845_100022094 270
242 3300002741 JGI25157J39369_1011312 JGI25157J39369_10113121 270
243 3300005327 Ga0070658_10110684 Ga0070658_101106842 270
244 3300005328 Ga0070676_10057774 Ga0070676_100577741 270
245 3300005339 Ga0070660_100032530 Ga0070660_1000325302 270
246 3300005354 Ga0070675_100018974 Ga0070675_1000189743 270
247 3300005366 Ga0070659_100022742 Ga0070659_1000227424 270
248 3300005367 Ga0070667_100000399 Ga0070667_10000039915 270
249 3300005455 Ga0070663_100000256 Ga0070663_1000002567 270
250 3300005456 Ga0070678_100011183 Ga0070678_1000111833 270
251 3300005539 Ga0068853_100054058 Ga0068853_1000540582 270
252 3300005539 Ga0068853_100642328 Ga0068853_1006423281 270
253 3300005548 Ga0070665_100127393 Ga0070665_1001273933 270
254 3300005563 Ga0068855_100029955 Ga0068855_1000299553 270
255 3300005578 Ga0068854_100101703 Ga0068854_1001017032 270
256 3300005842 Ga0068858_100029711 Ga0068858_1000297115 270
257 3300009093 Ga0105240_10389123 Ga0105240_103891232 270
258 3300009545 Ga0105237_10089479 Ga0105237_100894794 270
259 3300009553 Ga0105249_10000222 Ga0105249_1000022232 270
260 3300009553 Ga0105249_10030193 Ga0105249_100301931 270
261 3300010375 Ga0105239_10100955 Ga0105239_101009552 270
262 3300013297 Ga0157378_10082429 Ga0157378_100824292 270
263 3300013307 Ga0157372_10028961 Ga0157372_100289614 270
264 3300021358 Ga0213873_10009894 Ga0213873_100098942 270
265 3300025250 Ga0209026_1000784 Ga0209026_100078414 270
266 3300025299 Ga0209256_1030320 Ga0209256_10303202 270
267 3300025909 Ga0207705_10240169 Ga0207705_102401692 270
268 3300025914 Ga0207671_10005863 Ga0207671_100058637 270
269 3300025919 Ga0207657_10102064 Ga0207657_101020642 270
270 3300025926 Ga0207659_10011844 Ga0207659_100118443 270
271 3300025949 Ga0207667_10000035 Ga0207667_10000035226 270
272 3300025961 Ga0207712_10000248 Ga0207712_1000024822 270
273 3300025986 Ga0207658_10000006 Ga0207658_1000000625 270
274 3300025986 Ga0207658_10115763 Ga0207658_101157632 270
275 3300026035 Ga0207703_10016119 Ga0207703_100161196 270
276 3300026041 Ga0207639_10060937 Ga0207639_100609373 270
277 3300026041 Ga0207639_10312487 Ga0207639_103124872 270
278 3300026067 Ga0207678_10000081 Ga0207678_1000008129 270
279 3300026121 Ga0207683_10007822 Ga0207683_100078226 270
280 3300028379 Ga0268266_10059158 Ga0268266_100591581 270
281 3300032004 Ga0307414_10088963 Ga0307414_100889631 270
282 3300046457 Ga0495590_0104559 Ga0495590_0104559_131_967 270
283 3300046616 Ga0495668_0099550 Ga0495668_0099550_594_1430 270
284 3300046794 Ga0495589_0130697 Ga0495589_0130697_103_939 270
285 3300047323 Ga0495683_0000320 Ga0495683_0000320_32946_33773 270
286 3300048912 Ga0496109_0278571 Ga0496109_0278571_39_854 270
287 3300048924 Ga0496121_0005470 Ga0496121_0005470_13825_14643 270
288 3300048924 Ga0496121_0096681 Ga0496121_0096681_901_1740 270
289 3300048925 Ga0496122_0000719 Ga0496122_0000719_62178_62993 270
290 3300048926 Ga0496123_0000325 Ga0496123_0000325_72361_73176 270
291 3300048928 Ga0496125_0003103 Ga0496125_0003103_8206_9021 270
292 3300048929 Ga0496126_0012455 Ga0496126_0012455_4887_5702 270
293 3300048929 Ga0496126_0043949 Ga0496126_0043949_132_983 270
294 3300048929 Ga0496126_0617355 Ga0496126_0617355_25_840 270
295 3300049460 Ga0495682_0021191 Ga0495682_0021191_983_1819 270
296 3300049589 Ga0501073_0066780 Ga0501073_0066780_829_1656 270
297 3300049744 Ga0501083_0006163 Ga0501083_0006163_2499_3326 270
298 3300053108 Ga0500562_012381 Ga0500562_012381_1001_1846 270
299 3300053111 Ga0500572_000093 Ga0500572_000093_18994_19815 270
300 3300053136 Ga0500559_0000242 Ga0500559_0000242_24635_25456 270
301 3300053163 Ga0500639_001904 Ga0500639_001904_3262_4083 270
302 3300060353 Ga0501082_0083388 Ga0501082_0083388_937_1764 270
303 iso_pu_bacteria 2509276033 2509446750 270
304 iso_pu_bacteria 2519103095 2519461058 270
305 iso_pu_bacteria 2582581311 2585289954 270
306 iso_pu_bacteria 2599185240 2599743633 270
307 iso_pu_bacteria 2599185355 2600209181 270
308 iso_pu_bacteria 2643221577 2643894332 270
309 iso_pu_bacteria 2643221685 2644476536 270
310 iso_pu_bacteria 2675903129 2676742581 270
311 iso_pu_bacteria 2758568016 2758640617 270
312 iso_pu_bacteria 2791355259 2793312571 270
313 iso_pu_bacteria 2816332253 2817259099 270
314 iso_pu_bacteria 2816332256 2817280483 270
315 iso_pu_bacteria 2816332286 2817452326 270
316 iso_pu_bacteria 2824617872 2824625248 270
317 iso_pu_bacteria 2824617872 2824625312 270
318 iso_pu_bacteria 2824626560 2824634031 270
319 iso_pu_bacteria 2824626560 2824634111 270
320 iso_pu_bacteria 2824635225 2824641152 270
321 iso_pu_bacteria 2824635225 2824641279 270
322 iso_pu_bacteria 2824644064 2824648331 270
323 iso_pu_bacteria 2824644064 2824648459 270
324 iso_pu_bacteria 2824714736 2824718243 270
325 iso_pu_bacteria 2824714736 2824718313 270
326 iso_pu_bacteria 2824723954 2824728513 270
327 iso_pu_bacteria 2824723954 2824728585 270
328 iso_pu_bacteria 2870068957 2870074676 270
329 iso_pu_bacteria 2884338543 2884342612 270
330 iso_pu_bacteria 2894817345 2894820857 270
331 iso_pu_bacteria 2919085039 2919086516 270
332 iso_pu_bacteria 2928157003 2928157865 270
333 iso_pu_bacteria 2928163908 2928165636 270
334 iso_pu_bacteria 2928526807 2928529216 270
335 iso_pu_bacteria 2928536128 2928536986 270
336 iso_pu_bacteria 2928968154 2928968756 270
337 iso_pu_bacteria 2932794094 2932797550 270
338 iso_pu_bacteria 2932801729 2932802864 270
339 iso_pu_bacteria 2935883170 2935885206 270
340 iso_pu_bacteria 2936375103 2936380896 270
341 iso_pu_bacteria 2941471342 2941474858 270
342 iso_pu_bacteria 2981990288 2981990881 270
343 iso_pu_bacteria 3005718088 3005722254 270
344 iso_pu_bacteria 641736154 642419474 270
345 iso_pu_bacteria 8005395548 8005396361 270
346 iso_pu_bacteria 8020807995 8020812873 270
347 iso_pu_bacteria 8020938398 8020940696 270
348 iso_pu_bacteria 8020945358 8020952961 270
349 iso_pu_bacteria 8020953355 8020954277 270
350 iso_pu_bacteria 8024479707 8024483121 270
351 iso_pu_bacteria 8040167225 8040167885 270
352 iso_pu_bacteria 8040173305 8040173522 270
353 iso_pu_bacteria 8056967851 8056967957 270
354 3300002739 JGI25158J39367_1007151 JGI25158J39367_10071512 271
355 3300002773 JGI25152J39213_1010330 JGI25152J39213_10103302 271
356 3300002987 JGI25159J45721_1012472 JGI25159J45721_10124722 271
357 3300003214 JGI25165J46597_1000046 JGI25165J46597_100004661 271
358 3300003215 JGI25153J46596_10006842 JGI25153J46596_100068427 271
359 3300003215 JGI25153J46596_10006854 JGI25153J46596_100068545 271
360 3300003354 JGI25160J50197_1002284 JGI25160J50197_10022844 271
361 3300003354 JGI25160J50197_1002762 JGI25160J50197_10027627 271
362 3300003374 JGI25161J50226_1000107 JGI25161J50226_100010761 271
363 3300003752 Ga0055539_1003008 Ga0055539_10030083 271
364 3300003775 Ga0055524_1022643 Ga0055524_10226431 271
365 3300003781 Ga0055536_1001559 Ga0055536_100155910 271
366 3300003792 Ga0055540_1012566 Ga0055540_10125662 271
367 3300003794 Ga0055531_10002792 Ga0055531_100027921 271
368 3300004625 Ga0055543_1000074 Ga0055543_100007418 271
369 3300005262 Ga0065165_1000498 Ga0065165_100049850 271
370 3300005262 Ga0065165_1000844 Ga0065165_100084430 271
371 3300005347 Ga0070668_100437194 Ga0070668_1004371941 271
372 3300005353 Ga0070669_100205599 Ga0070669_1002055991 271
373 3300005436 Ga0070713_100111382 Ga0070713_1001113822 271
374 3300005436 Ga0070713_100140491 Ga0070713_1001404912 271
375 3300005436 Ga0070713_100382496 Ga0070713_1003824962 271
376 3300005444 Ga0070694_100177183 Ga0070694_1001771831 271
377 3300005455 Ga0070663_100319099 Ga0070663_1003190992 271
378 3300005467 Ga0070706_100183019 Ga0070706_1001830192 271
379 3300005539 Ga0068853_100208524 Ga0068853_1002085241 271
380 3300005545 Ga0070695_100136944 Ga0070695_1001369442 271
381 3300005546 Ga0070696_100148712 Ga0070696_1001487122 271
382 3300005548 Ga0070665_100037434 Ga0070665_1000374343 271
383 3300005548 Ga0070665_100084166 Ga0070665_1000841662 271
384 3300005564 Ga0070664_100286306 Ga0070664_1002863062 271
385 3300005614 Ga0068856_100000020 Ga0068856_10000002027 271
386 3300005614 Ga0068856_100532570 Ga0068856_1005325701 271
387 3300005985 Ga0081539_10010606 Ga0081539_100106067 271
388 3300006038 Ga0075365_10046196 Ga0075365_100461962 271
389 3300006038 Ga0075365_10203926 Ga0075365_102039262 271
390 3300006048 Ga0075363_100108390 Ga0075363_1001083902 271
391 3300006051 Ga0075364_10047382 Ga0075364_100473822 271
392 3300006186 Ga0075369_10000740 Ga0075369_1000074011 271
393 3300006195 Ga0075366_10185202 Ga0075366_101852021 271
394 3300006358 Ga0068871_100289518 Ga0068871_1002895182 271
395 3300006871 Ga0075434_100238505 Ga0075434_1002385052 271
396 3300007788 Ga0099795_10021718 Ga0099795_100217182 271
397 3300009093 Ga0105240_10435929 Ga0105240_104359292 271
398 3300009098 Ga0105245_10619440 Ga0105245_106194401 271
399 3300009177 Ga0105248_10145012 Ga0105248_101450122 271
400 3300009545 Ga0105237_10164047 Ga0105237_101640472 271
401 3300009551 Ga0105238_10285544 Ga0105238_102855442 271
402 3300009986 Ga0105033_101161 Ga0105033_1011612 271
403 3300010375 Ga0105239_10493794 Ga0105239_104937942 271
404 3300013102 Ga0157371_10000010 Ga0157371_10000010213 271
405 3300014325 Ga0163163_10053473 Ga0163163_100534733 271
406 3300021361 Ga0213872_10084237 Ga0213872_100842371 271
407 3300025208 Ga0209436_100011 Ga0209436_10001186 271
408 3300025230 Ga0209563_101810 Ga0209563_1018102 271
409 3300025253 Ga0209677_104791 Ga0209677_1047914 271
410 3300025258 Ga0209129_1000642 Ga0209129_100064215 271
411 3300025261 Ga0209233_1000013 Ga0209233_1000013152 271
412 3300025261 Ga0209233_1015772 Ga0209233_10157722 271
413 3300025272 Ga0209455_1004319 Ga0209455_10043195 271
414 3300025273 Ga0209673_1014579 Ga0209673_10145792 271
415 3300025284 Ga0209130_1000081 Ga0209130_1000081160 271
416 3300025284 Ga0209130_1000793 Ga0209130_100079318 271
417 3300025292 Ga0209676_1004295 Ga0209676_10042956 271
418 3300025295 Ga0209564_1004005 Ga0209564_10040055 271
419 3300025297 Ga0209758_1000520 Ga0209758_10005202 271
420 3300025297 Ga0209758_1002435 Ga0209758_10024356 271
421 3300025297 Ga0209758_1006338 Ga0209758_10063385 271
422 3300025298 Ga0209050_1002088 Ga0209050_100208812 271
423 3300025299 Ga0209256_1022486 Ga0209256_10224862 271
424 3300025302 Ga0207426_1000008 Ga0207426_1000008640 271
425 3300025302 Ga0207426_1000179 Ga0207426_100017974 271
426 3300025302 Ga0207426_1000599 Ga0207426_100059910 271
427 3300025303 Ga0209051_1001738 Ga0209051_100173817 271
428 3300025304 Ga0209257_1001490 Ga0209257_100149020 271
429 3300025304 Ga0209257_1014953 Ga0209257_10149532 271
430 3300025904 Ga0207647_10231554 Ga0207647_102315542 271
431 3300025906 Ga0207699_10102512 Ga0207699_101025123 271
432 3300025919 Ga0207657_10040869 Ga0207657_100408694 271
433 3300025928 Ga0207700_10029340 Ga0207700_100293402 271
434 3300025928 Ga0207700_10538338 Ga0207700_105383381 271
435 3300025949 Ga0207667_10370058 Ga0207667_103700582 271
436 3300025972 Ga0207668_10209922 Ga0207668_102099221 271
437 3300026035 Ga0207703_10417654 Ga0207703_104176542 271
438 3300026067 Ga0207678_10007546 Ga0207678_100075464 271
439 3300026067 Ga0207678_10342881 Ga0207678_103428812 271
440 3300026078 Ga0207702_10000748 Ga0207702_1000074830 271
441 3300026078 Ga0207702_10457287 Ga0207702_104572872 271
442 3300026095 Ga0207676_10253520 Ga0207676_102535201 271
443 3300026121 Ga0207683_10642106 Ga0207683_106421061 271
444 3300026121 Ga0207683_10716830 Ga0207683_107168301 271
445 3300026142 Ga0207698_10122095 Ga0207698_101220953 271
446 3300027512 Ga0209179_1004059 Ga0209179_10040592 271
447 3300028379 Ga0268266_10033854 Ga0268266_100338543 271
448 3300028379 Ga0268266_10042793 Ga0268266_100427934 271
449 3300028573 Ga0265334_10004202 Ga0265334_100042025 271
450 3300028800 Ga0265338_10083833 Ga0265338_100838333 271
451 3300031235 Ga0265330_10005862 Ga0265330_100058623 271
452 3300031235 Ga0265330_10111691 Ga0265330_101116912 271
453 3300031241 Ga0265325_10144542 Ga0265325_101445421 271
454 3300031247 Ga0265340_10002643 Ga0265340_100026434 271
455 3300031247 Ga0265340_10161431 Ga0265340_101614311 271
456 3300031344 Ga0265316_10085167 Ga0265316_100851673 271
457 3300031344 Ga0265316_10116382 Ga0265316_101163822 271
458 3300031507 Ga0307509_10001027 Ga0307509_1000102712 271
459 3300031616 Ga0307508_10193337 Ga0307508_101933372 271
460 3300035083 Ga0373926_0042224 Ga0373926_0042224_306_1292 271
461 3300035086 Ga0373934_0039379 Ga0373934_0039379_879_1853 271
462 3300035111 Ga0373923_0069453 Ga0373923_0069453_272_1246 271
463 3300035410 Ga0373924_0073466 Ga0373924_0073466_345_1319 271
464 3300035692 Ga0373935_0016772 Ga0373935_0016772_1404_2378 271
465 3300035724 Ga0373933_0004636 Ga0373933_0004636_3255_4229 271
466 3300036401 Ga0373937_0005933 Ga0373937_0005933_6148_7122 271
467 3300037068 Ga0373925_0536180 Ga0373925_0536180_11_844 271
468 3300037471 Ga0395905_0000095 Ga0395905_0000095_90636_91475 271
469 3300039447 Ga0436361_0334394 Ga0436361_0334394_69_893 271
470 3300044656 Ga0466969_0047182 Ga0466969_0047182_629_1453 271
471 3300044684 Ga0466966_0001160 Ga0466966_0001160_6498_7334 271
472 3300044693 Ga0466961_0000067 Ga0466961_0000067_10363_11199 271
473 3300044842 Ga0466957_0016042 Ga0466957_0016042_3372_4196 271
474 3300045049 Ga0466959_0009672 Ga0466959_0009672_2425_3261 271
475 3300045049 Ga0466959_0219737 Ga0466959_0219737_141_974 271
476 3300046454 Ga0495592_0022740 Ga0495592_0022740_201_1175 271
477 3300046459 Ga0495629_0007400 Ga0495629_0007400_1097_2071 271
478 3300046460 Ga0495638_0030763 Ga0495638_0030763_1603_2439 271
479 3300046462 Ga0495651_0000683 Ga0495651_0000683_6368_7342 271
480 3300046463 Ga0495653_0032553 Ga0495653_0032553_2011_2985 271
481 3300046471 Ga0495650_0049453 Ga0495650_0049453_171_1007 271
482 3300046472 Ga0495580_0087958 Ga0495580_0087958_365_1339 271
483 3300046477 Ga0495664_0023263 Ga0495664_0023263_2305_3279 271
484 3300046506 Ga0495583_0040030 Ga0495583_0040030_655_1503 271
485 3300046507 Ga0495606_0131210 Ga0495606_0131210_408_1247 271
486 3300046511 Ga0495608_0008405 Ga0495608_0008405_5980_6954 271
487 3300046512 Ga0495610_0010882 Ga0495610_0010882_2198_3031 271
488 3300046514 Ga0495618_0001639 Ga0495618_0001639_2825_3799 271
489 3300046516 Ga0495628_0051084 Ga0495628_0051084_990_1964 271
490 3300046517 Ga0495630_0043322 Ga0495630_0043322_2106_3080 271
491 3300046524 Ga0495648_0148488 Ga0495648_0148488_296_1132 271
492 3300046529 Ga0495652_0009632 Ga0495652_0009632_1469_2443 271
493 3300046531 Ga0495665_0135365 Ga0495665_0135365_20_853 271
494 3300046533 Ga0495640_0001593 Ga0495640_0001593_5339_6313 271
495 3300046536 Ga0495587_0001278 Ga0495587_0001278_1792_2766 271
496 3300046559 Ga0495667_0001611 Ga0495667_0001611_4320_5294 271
497 3300046642 Ga0495634_0006916 Ga0495634_0006916_611_1585 271
498 3300046648 Ga0495611_0009976 Ga0495611_0009976_1250_2104 271
499 3300046660 Ga0495625_0110236 Ga0495625_0110236_842_1684 271
500 3300046663 Ga0495635_0080504 Ga0495635_0080504_179_1153 271
501 3300046674 Ga0495588_0104592 Ga0495588_0104592_62_901 271
502 3300046689 Ga0495613_0062258 Ga0495613_0062258_1388_2362 271
503 3300046694 Ga0495649_0000676 Ga0495649_0000676_6812_7651 271
504 3300046809 Ga0495600_0002886 Ga0495600_0002886_8736_9710 271
505 3300047315 Ga0495581_0089191 Ga0495581_0089191_595_1569 271
506 3300047317 Ga0495604_0003637 Ga0495604_0003637_3676_4650 271
507 3300047319 Ga0495674_0017668 Ga0495674_0017668_870_1844 271
508 3300047320 Ga0495672_0016205 Ga0495672_0016205_580_1428 271
509 3300047321 Ga0495676_0039510 Ga0495676_0039510_202_1176 271
510 3300047322 Ga0495680_0002984 Ga0495680_0002984_6298_7272 271
511 3300047323 Ga0495683_0001721 Ga0495683_0001721_4147_4986 271
512 3300047443 Ga0495687_043352 Ga0495687_043352_794_1630 271
513 3300047444 Ga0495675_0001860 Ga0495675_0001860_5272_6246 271
514 3300047469 Ga0495673_0055249 Ga0495673_0055249_751_1611 271
515 3300047469 Ga0495673_0101741 Ga0495673_0101741_248_1096 271
516 3300048091 Ga0495626_0006181 Ga0495626_0006181_784_1623 271
517 3300048903 Ga0496100_0206015 Ga0496100_0206015_119_958 271
518 3300048905 Ga0496102_0247265 Ga0496102_0247265_570_1397 271
519 3300048909 Ga0496106_0000038 Ga0496106_0000038_76750_77568 271
520 3300048910 Ga0496107_0103060 Ga0496107_0103060_216_1055 271
521 3300048916 Ga0496113_0291332 Ga0496113_0291332_79_915 271
522 3300048918 Ga0496115_0210181 Ga0496115_0210181_192_1028 271
523 3300048918 Ga0496115_0513921 Ga0496115_0513921_54_881 271
524 3300048920 Ga0496117_0284641 Ga0496117_0284641_17_853 271
525 3300048921 Ga0496118_0056319 Ga0496118_0056319_1098_1937 271
526 3300048924 Ga0496121_0030860 Ga0496121_0030860_2027_2863 271
527 3300048925 Ga0496122_0010121 Ga0496122_0010121_3676_4524 271
528 3300048927 Ga0496124_0006231 Ga0496124_0006231_9194_10060 271
529 3300048928 Ga0496125_0000147 Ga0496125_0000147_136398_137273 271
530 3300048928 Ga0496125_0047398 Ga0496125_0047398_1600_2436 271
531 3300048929 Ga0496126_0007721 Ga0496126_0007721_8607_9455 271
532 3300048929 Ga0496126_0008802 Ga0496126_0008802_3534_4382 271
533 3300049581 Ga0501047_0178143 Ga0501047_0178143_116_976 271
534 3300050490 nmdc:mga03n38_27198_c1 nmdc:mga03n38_27198_c1_565_1386 271
535 3300050491 nmdc:mga00v17_149136_c1 nmdc:mga00v17_149136_c1_280_1107 271
536 3300050492 nmdc:mga0yw44_198650_c1 nmdc:mga0yw44_198650_c1_119_955 271
537 3300050492 nmdc:mga0yw44_401645_c1 nmdc:mga0yw44_401645_c1_11_838 271
538 3300050492 nmdc:mga0yw44_61919_c1 nmdc:mga0yw44_61919_c1_214_1053 271
539 3300050494 nmdc:mga06z11_213198_c1 nmdc:mga06z11_213198_c1_273_1109 271
540 3300050516 nmdc:mga0sz30_64442_c2 nmdc:mga0sz30_64442_c2_198_1034 271
541 3300053077 Ga0495601_0001473 Ga0495601_0001473_5464_6438 271
542 3300053084 Ga0495595_0000273 Ga0495595_0000273_7407_8381 271
543 3300053085 Ga0495619_0001384 Ga0495619_0001384_1648_2622 271
544 3300053086 Ga0500578_0061100 Ga0500578_0061100_1025_1861 271
545 3300053087 Ga0500643_000015 Ga0500643_000015_100616_101452 271
546 3300053093 Ga0500651_0024107 Ga0500651_0024107_633_1451 271
547 3300053094 Ga0500566_0002374 Ga0500566_0002374_3059_3895 271
548 3300053104 Ga0500556_0005410 Ga0500556_0005410_798_1634 271
549 3300053134 Ga0500658_0024307 Ga0500658_0024307_654_1490 271
550 3300053134 Ga0500658_0054279 Ga0500658_0054279_607_1425 271
551 3300053139 Ga0500568_0000280 Ga0500568_0000280_34322_35140 271
552 3300053148 Ga0500590_084526 Ga0500590_084526_611_1447 271
553 3300053148 Ga0500590_130848 Ga0500590_130848_217_1053 271
554 3300053153 Ga0500616_0001048 Ga0500616_0001048_21903_22742 271
555 3300053153 Ga0500616_0005377 Ga0500616_0005377_1382_2224 271
556 3300053153 Ga0500616_0040025 Ga0500616_0040025_627_1463 271
557 3300053156 Ga0500622_0081678 Ga0500622_0081678_544_1380 271
558 3300053160 Ga0500633_0007843 Ga0500633_0007843_748_1584 271
559 3300053737 Ga0500601_000209 Ga0500601_000209_5129_5965 271
560 iso_pu_bacteria 2510917026 2511170756 271
561 iso_pu_bacteria 2511231028 2511394970 271
562 iso_pu_bacteria 2513237090 2513607878 271
563 iso_pu_bacteria 2513237095 2513645922 271
564 iso_pu_bacteria 2517093001 2517108339 271
565 iso_pu_bacteria 2528768022 2528851175 271
566 iso_pu_bacteria 2599185301 2599939469 271
567 iso_pu_bacteria 2602042107 2603859178 271
568 iso_pu_bacteria 2791355196 2793062476 271
569 iso_pu_bacteria 2816332527 2818238990 271
570 iso_pu_bacteria 2818991435 2819537966 271
571 iso_pu_bacteria 2818991454 2819648473 271
572 iso_pu_bacteria 2821123053 2821129408 271
573 iso_pu_bacteria 2824661429 2824670358 271
574 iso_pu_bacteria 2838736955 2838738559 271
575 iso_pu_bacteria 2841840854 2841841072 271
576 iso_pu_bacteria 2842140634 2842140850 271
577 iso_pu_bacteria 2849076700 2849079393 271
578 iso_pu_bacteria 2857524615 2857527769 271
579 iso_pu_bacteria 2857531043 2857535211 271
580 iso_pu_bacteria 2871495908 2871497031 271
581 iso_pu_bacteria 2874628541 2874631770 271
582 iso_pu_bacteria 2876392853 2876393559 271
583 iso_pu_bacteria 2876761206 2876767037 271
584 iso_pu_bacteria 2878760144 2878761231 271
585 iso_pu_bacteria 2878767105 2878768218 271
586 iso_pu_bacteria 2885305155 2885312355 271
587 iso_pu_bacteria 2885334103 2885340953 271
588 iso_pu_bacteria 2885383462 2885389262 271
589 iso_pu_bacteria 2888378607 2888383983 271
590 iso_pu_bacteria 2893066018 2893066510 271
591 iso_pu_bacteria 2903540706 2903541826 271
592 iso_pu_bacteria 2904659560 2904660067 271
593 iso_pu_bacteria 2919073203 2919079455 271
594 iso_pu_bacteria 2919171160 2919175411 271
595 iso_pu_bacteria 2922368715 2922374304 271
596 iso_pu_bacteria 2929615660 2929617978 271
597 iso_pu_bacteria 2929624759 2929627659 271
598 iso_pu_bacteria 2932784394 2932788240 271
599 iso_pu_bacteria 2932828146 2932831237 271
600 iso_pu_bacteria 2933577622 2933579906 271
601 iso_pu_bacteria 2935616580 2935622967 271
602 iso_pu_bacteria 2935638405 2935642327 271
603 iso_pu_bacteria 2935665750 2935668370 271
604 iso_pu_bacteria 2935675223 2935680503 271
605 iso_pu_bacteria 2935684952 2935692827 271
606 iso_pu_bacteria 2935694250 2935700996 271
607 iso_pu_bacteria 2935703347 2935706225 271
608 iso_pu_bacteria 2935713505 2935721448 271
609 iso_pu_bacteria 2935722832 2935730366 271
610 iso_pu_bacteria 2935732158 2935740379 271
611 iso_pu_bacteria 2935741537 2935749643 271
612 iso_pu_bacteria 2935750917 2935759044 271
613 iso_pu_bacteria 2935777560 2935778463 271
614 iso_pu_bacteria 2935801545 2935803225 271
615 iso_pu_bacteria 2935810662 2935814545 271
616 iso_pu_bacteria 2935827899 2935831683 271
617 iso_pu_bacteria 2935837841 2935838551 271
618 iso_pu_bacteria 2935855204 2935861215 271
619 iso_pu_bacteria 2935864058 2935865753 271
620 iso_pu_bacteria 2935873716 2935878254 271
621 iso_pu_bacteria 2935992306 2935994567 271
622 iso_pu_bacteria 2936002035 2936007633 271
623 iso_pu_bacteria 2936037263 2936040102 271
624 iso_pu_bacteria 2937994558 2937995659 271
625 iso_pu_bacteria 2940556831 2940564951 271
626 iso_pu_bacteria 2941538514 2941538781 271
627 iso_pu_bacteria 2958165035 2958166155 271
628 iso_pu_bacteria 2961114664 2961115392 271
629 iso_pu_bacteria 2961163497 2961164617 271
630 iso_pu_bacteria 2965018300 2965019045 271
631 iso_pu_bacteria 2968110612 2968111123 271
632 iso_pu_bacteria 2968171901 2968172997 271
633 iso_pu_bacteria 2970554993 2970556090 271
634 iso_pu_bacteria 2977864932 2977868032 271
635 iso_pu_bacteria 2987636660 2987643194 271
636 iso_pu_bacteria 2987659509 2987660604 271
637 iso_pu_bacteria 3004188549 3004189652 271
638 iso_pu_bacteria 3004203850 3004206742 271
639 iso_pu_bacteria 8016511872 8016522426 271
640 iso_pu_bacteria 8016522445 8016529690 271
641 iso_pu_bacteria 8016530956 8016534911 271
642 iso_pu_bacteria 8016539877 8016548119 271
643 iso_pu_bacteria 8016548790 8016554004 271
644 iso_pu_bacteria 8016557553 8016562380 271
645 iso_pu_bacteria 8016566248 8016573255 271
646 iso_pu_bacteria 8016575299 8016577397 271
647 iso_pu_bacteria 8016595262 8016600180 271
648 iso_pu_bacteria 8016603502 8016610571 271
649 iso_pu_bacteria 8016622563 8016626627 271
650 iso_pu_bacteria 8017057580 8017063136 271
651 iso_pu_bacteria 8019530166 8019534671 271
652 iso_pu_bacteria 8019547302 8019553736 271
653 iso_pu_bacteria 8019576017 8019582570 271
654 iso_pu_bacteria 8019586578 8019590359 271
655 iso_pu_bacteria 8019597564 8019600993 271
656 iso_pu_bacteria 8019608314 8019617560 271
657 iso_pu_bacteria 8055742211 8055746433 271
658 iso_pu_bacteria 8056681323 8056686832 271
659 3300002067 JGI24735J21928_10002093 JGI24735J21928_100020936 272
660 3300002773 JGI25152J39213_1001392 JGI25152J39213_10013925 272
661 3300002773 JGI25152J39213_1002012 JGI25152J39213_10020128 272
662 3300002773 JGI25152J39213_1003675 JGI25152J39213_10036753 272
663 3300003214 JGI25165J46597_1007037 JGI25165J46597_10070372 272
664 3300003215 JGI25153J46596_10002531 JGI25153J46596_100025319 272
665 3300003215 JGI25153J46596_10003111 JGI25153J46596_100031118 272
666 3300003790 Ga0055528_1008010 Ga0055528_10080102 272
667 3300003790 Ga0055528_1008628 Ga0055528_10086282 272
668 3300003856 Ga0058692_1017924 Ga0058692_10179242 272
669 3300005548 Ga0070665_100033014 Ga0070665_1000330148 272
670 3300005563 Ga0068855_100131256 Ga0068855_1001312563 272
671 3300005578 Ga0068854_100013817 Ga0068854_1000138174 272
672 3300005616 Ga0068852_100059793 Ga0068852_1000597934 272
673 3300005618 Ga0068864_100420637 Ga0068864_1004206372 272
674 3300009093 Ga0105240_10000027 Ga0105240_10000027136 272
675 3300009545 Ga0105237_10003395 Ga0105237_1000339514 272
676 3300009551 Ga0105238_10021242 Ga0105238_100212423 272
677 3300010375 Ga0105239_10422011 Ga0105239_104220112 272
678 3300013104 Ga0157370_10000048 Ga0157370_10000048116 272
679 3300013105 Ga0157369_10072699 Ga0157369_100726995 272
680 3300014497 Ga0182008_10007814 Ga0182008_100078147 272
681 3300015262 Ga0182007_10004419 Ga0182007_100044192 272
682 3300015265 Ga0182005_1006489 Ga0182005_10064893 272
683 3300021384 Ga0213876_10002722 Ga0213876_100027222 272
684 3300025233 Ga0209437_106410 Ga0209437_1064103 272
685 3300025245 Ga0207425_1000695 Ga0207425_10006955 272
686 3300025253 Ga0209677_100188 Ga0209677_10018812 272
687 3300025256 Ga0209759_1013026 Ga0209759_10130262 272
688 3300025258 Ga0209129_1000244 Ga0209129_100024426 272
689 3300025258 Ga0209129_1000495 Ga0209129_10004954 272
690 3300025258 Ga0209129_1001683 Ga0209129_10016838 272
691 3300025261 Ga0209233_1000271 Ga0209233_100027141 272
692 3300025261 Ga0209233_1012104 Ga0209233_10121042 272
693 3300025273 Ga0209673_1005691 Ga0209673_10056914 272
694 3300025294 Ga0209025_1004158 Ga0209025_10041585 272
695 3300025294 Ga0209025_1006069 Ga0209025_10060694 272
696 3300025295 Ga0209564_1000225 Ga0209564_100022550 272
697 3300025295 Ga0209564_1009175 Ga0209564_10091754 272
698 3300025297 Ga0209758_1000463 Ga0209758_100046362 272
699 3300025297 Ga0209758_1005696 Ga0209758_10056965 272
700 3300025298 Ga0209050_1003257 Ga0209050_10032573 272
701 3300025299 Ga0209256_1003935 Ga0209256_10039354 272
702 3300025304 Ga0209257_1000504 Ga0209257_100050438 272
703 3300025909 Ga0207705_10121717 Ga0207705_101217172 272
704 3300025913 Ga0207695_10000024 Ga0207695_10000024494 272
705 3300025914 Ga0207671_10001033 Ga0207671_1000103322 272
706 3300025923 Ga0207681_10281232 Ga0207681_102812322 272
707 3300026142 Ga0207698_10025819 Ga0207698_100258194 272
708 3300027312 Ga0209371_1002388 Ga0209371_10023885 272
709 3300028794 Ga0307515_10023504 Ga0307515_1002350412 272
710 3300030500 Ga0268256_1001774 Ga0268256_10017745 272
711 3300031247 Ga0265340_10001482 Ga0265340_1000148215 272
712 3300031548 Ga0307408_100028470 Ga0307408_1000284702 272
713 3300031730 Ga0307516_10007025 Ga0307516_1000702512 272
714 3300031730 Ga0307516_10363460 Ga0307516_103634602 272
715 3300031731 Ga0307405_10121963 Ga0307405_101219632 272
716 3300032002 Ga0307416_100052282 Ga0307416_1000522821 272
717 3300032004 Ga0307414_10362035 Ga0307414_103620351 272
718 3300032005 Ga0307411_10131858 Ga0307411_101318582 272
719 3300035692 Ga0373935_0079801 Ga0373935_0079801_1146_1988 272
720 3300035695 Ga0373927_0000075 Ga0373927_0000075_56006_56848 272
721 3300037068 Ga0373925_0002684 Ga0373925_0002684_5609_6451 272
722 3300039437 Ga0436365_0323393 Ga0436365_0323393_923_1744 272
723 3300041456 Ga0451795_0492382 Ga0451795_0492382_508_1344 272
724 3300041463 Ga0451804_0698880 Ga0451804_0698880_217_1053 272
725 3300041491 Ga0451833_0669262 Ga0451833_0669262_119_955 272
726 3300041509 Ga0451843_1098918 Ga0451843_1098918_103_939 272
727 3300041512 Ga0451853_0765634 Ga0451853_0765634_59_895 272
728 3300044684 Ga0466966_0067641 Ga0466966_0067641_621_1457 272
729 3300044684 Ga0466966_0226123 Ga0466966_0226123_72_911 272
730 3300044719 Ga0466971_0111613 Ga0466971_0111613_347_1174 272
731 3300045836 Ga0466958_0165109 Ga0466958_0165109_300_1133 272
732 3300046472 Ga0495580_0008693 Ga0495580_0008693_4151_5005 272
733 3300046512 Ga0495610_0027152 Ga0495610_0027152_621_1451 272
734 3300046512 Ga0495610_0050110 Ga0495610_0050110_938_1774 272
735 3300046530 Ga0495654_0000121 Ga0495654_0000121_48911_49735 272
736 3300046538 Ga0495609_0078216 Ga0495609_0078216_197_1030 272
737 3300046539 Ga0495621_0060165 Ga0495621_0060165_446_1309 272
738 3300046660 Ga0495625_0026341 Ga0495625_0026341_1969_2805 272
739 3300047472 Ga0495686_0062523 Ga0495686_0062523_912_1748 272
740 3300048090 Ga0495615_0000019 Ga0495615_0000019_5625_6467 272
741 3300048903 Ga0496100_0091918 Ga0496100_0091918_921_1745 272
742 3300048904 Ga0496101_0012938 Ga0496101_0012938_657_1526 272
743 3300048904 Ga0496101_0199400 Ga0496101_0199400_710_1534 272
744 3300048905 Ga0496102_0015629 Ga0496102_0015629_4095_4919 272
745 3300048906 Ga0496103_0005197 Ga0496103_0005197_1588_2412 272
746 3300048909 Ga0496106_0071978 Ga0496106_0071978_255_1079 272
747 3300048916 Ga0496113_0063442 Ga0496113_0063442_1463_2287 272
748 3300048919 Ga0496116_0057523 Ga0496116_0057523_1363_2187 272
749 3300048919 Ga0496116_0127353 Ga0496116_0127353_380_1210 272
750 3300048920 Ga0496117_0004982 Ga0496117_0004982_7945_8769 272
751 3300048921 Ga0496118_0001729 Ga0496118_0001729_11928_12752 272
752 3300048921 Ga0496118_0088569 Ga0496118_0088569_847_1707 272
753 3300048922 Ga0496119_0017955 Ga0496119_0017955_4070_4894 272
754 3300048924 Ga0496121_0003867 Ga0496121_0003867_5392_6216 272
755 3300048925 Ga0496122_0014830 Ga0496122_0014830_2310_3134 272
756 3300048926 Ga0496123_0007813 Ga0496123_0007813_5161_5985 272
757 3300048926 Ga0496123_0014475 Ga0496123_0014475_215_1075 272
758 3300048927 Ga0496124_0030539 Ga0496124_0030539_3337_4161 272
759 3300048927 Ga0496124_0152413 Ga0496124_0152413_42_869 272
760 3300048928 Ga0496125_0016874 Ga0496125_0016874_4026_4850 272
761 3300048928 Ga0496125_0032900 Ga0496125_0032900_3604_4464 272
762 3300048929 Ga0496126_0134210 Ga0496126_0134210_710_1534 272
763 3300048929 Ga0496126_0155394 Ga0496126_0155394_941_1789 272
764 3300049579 Ga0501043_0496302 Ga0501043_0496302_40_870 272
765 3300049671 Ga0501238_017312 Ga0501238_017312_170_991 272
766 3300049822 Ga0501035_0003062 Ga0501035_0003062_9176_10015 272
767 3300049822 Ga0501035_0013181 Ga0501035_0013181_673_1503 272
768 3300049823 Ga0501044_0015688 Ga0501044_0015688_5737_6567 272
769 3300050493 nmdc:mga0k408_353677_c1 nmdc:mga0k408_353677_c1_12_848 272
770 3300050516 nmdc:mga0sz30_41697_c1 nmdc:mga0sz30_41697_c1_300_1160 272
771 3300053086 Ga0500578_0197278 Ga0500578_0197278_75_917 272
772 3300053093 Ga0500651_0001456 Ga0500651_0001456_9581_10423 272
773 3300053103 Ga0500555_001763 Ga0500555_001763_1062_1904 272
774 3300053125 Ga0500618_000171 Ga0500618_000171_3205_4041 272
775 3300053142 Ga0500577_0017103 Ga0500577_0017103_911_1753 272
776 3300053146 Ga0500588_0022002 Ga0500588_0022002_743_1585 272
777 3300053156 Ga0500622_0000170 Ga0500622_0000170_23916_24746 272
778 iso_pu_bacteria 2513237096 2513654915 272
779 iso_pu_bacteria 2513237137 2513861287 272
780 iso_pu_bacteria 2513237145 2513916062 272
781 iso_pu_bacteria 2517572143 2517894634 272
782 iso_pu_bacteria 2667528174 2671115849 272
783 iso_pu_bacteria 2818991448 2819608891 272
784 iso_pu_bacteria 2842918807 2842919112 272
785 iso_pu_bacteria 2904690495 2904697021 272
786 iso_pu_bacteria 2906635258 2906641599 272
787 iso_pu_bacteria 2906660503 2906661303 272
788 iso_pu_bacteria 2908739725 2908744953 272
789 iso_pu_bacteria 2908756301 2908762710 272
790 iso_pu_bacteria 2909042592 2909046893 272
791 iso_pu_bacteria 2909399089 2909400142 272
792 iso_pu_bacteria 2919408235 2919408317 272
793 iso_pu_bacteria 2935630451 2935632078 272
794 iso_pu_bacteria 2936367885 2936372299 272
795 iso_pu_bacteria 2941507105 2941508026 272
796 iso_pu_bacteria 2941515067 2941515469 272
797 iso_pu_bacteria 2941523033 2941523956 272
798 iso_pu_bacteria 2953994433 2953994614 272
799 iso_pu_bacteria 3005474847 3005477704 272
800 iso_pu_bacteria 8005376324 8005379624 272
801 iso_pu_bacteria 8005682033 8005687470 272
802 iso_pu_bacteria 8056689827 8056695064 272
803 3300002773 JGI25152J39213_1016124 JGI25152J39213_10161241 273
804 3300003187 JGI25151J46595_10004403 JGI25151J46595_100044037 273
805 3300003187 JGI25151J46595_10009539 JGI25151J46595_100095396 273
806 3300003215 JGI25153J46596_10013191 JGI25153J46596_100131912 273
807 3300003775 Ga0055524_1002658 Ga0055524_10026589 273
808 3300003790 Ga0055528_1000035 Ga0055528_1000035118 273
809 3300003790 Ga0055528_1000275 Ga0055528_100027527 273
810 3300005327 Ga0070658_10117893 Ga0070658_101178933 273
811 3300005330 Ga0070690_100222032 Ga0070690_1002220322 273
812 3300005331 Ga0070670_100000479 Ga0070670_10000047916 273
813 3300005336 Ga0070680_100015594 Ga0070680_1000155941 273
814 3300005338 Ga0068868_100573556 Ga0068868_1005735561 273
815 3300005340 Ga0070689_100432490 Ga0070689_1004324901 273
816 3300005341 Ga0070691_10095922 Ga0070691_100959221 273
817 3300005347 Ga0070668_100015545 Ga0070668_1000155452 273
818 3300005366 Ga0070659_100072498 Ga0070659_1000724982 273
819 3300005366 Ga0070659_100164653 Ga0070659_1001646532 273
820 3300005445 Ga0070708_100129949 Ga0070708_1001299491 273
821 3300005455 Ga0070663_100021715 Ga0070663_1000217153 273
822 3300005455 Ga0070663_100103027 Ga0070663_1001030271 273
823 3300005457 Ga0070662_100072927 Ga0070662_1000729272 273
824 3300005458 Ga0070681_10156768 Ga0070681_101567683 273
825 3300005467 Ga0070706_100124398 Ga0070706_1001243981 273
826 3300005471 Ga0070698_100030563 Ga0070698_1000305636 273
827 3300005518 Ga0070699_100299920 Ga0070699_1002999202 273
828 3300005530 Ga0070679_100174001 Ga0070679_1001740013 273
829 3300005539 Ga0068853_100065900 Ga0068853_1000659003 273
830 3300005539 Ga0068853_100093034 Ga0068853_1000930342 273
831 3300005546 Ga0070696_100270512 Ga0070696_1002705121 273
832 3300005547 Ga0070693_100065767 Ga0070693_1000657672 273
833 3300005548 Ga0070665_100109511 Ga0070665_1001095112 273
834 3300005548 Ga0070665_100180272 Ga0070665_1001802723 273
835 3300005563 Ga0068855_100050530 Ga0068855_1000505303 273
836 3300005564 Ga0070664_100149901 Ga0070664_1001499012 273
837 3300005614 Ga0068856_100134835 Ga0068856_1001348352 273
838 3300005614 Ga0068856_100216000 Ga0068856_1002160002 273
839 3300005616 Ga0068852_100001260 Ga0068852_1000012608 273
840 3300005616 Ga0068852_100225697 Ga0068852_1002256972 273
841 3300005617 Ga0068859_100216998 Ga0068859_1002169983 273
842 3300005618 Ga0068864_100017585 Ga0068864_1000175853 273
843 3300005718 Ga0068866_10067313 Ga0068866_100673135 273
844 3300005719 Ga0068861_100023482 Ga0068861_1000234826 273
845 3300005841 Ga0068863_100105367 Ga0068863_1001053675 273
846 3300005843 Ga0068860_100111840 Ga0068860_1001118403 273
847 3300005844 Ga0068862_100144624 Ga0068862_1001446243 273
848 3300005937 Ga0081455_10001542 Ga0081455_1000154214 273
849 3300005937 Ga0081455_10014958 Ga0081455_100149582 273
850 3300005983 Ga0081540_1019535 Ga0081540_10195354 273
851 3300006038 Ga0075365_10004790 Ga0075365_100047907 273
852 3300006048 Ga0075363_100065509 Ga0075363_1000655093 273
853 3300006051 Ga0075364_10029999 Ga0075364_100299992 273
854 3300006178 Ga0075367_10065559 Ga0075367_100655593 273
855 3300006178 Ga0075367_10137743 Ga0075367_101377432 273
856 3300006186 Ga0075369_10146409 Ga0075369_101464091 273
857 3300006195 Ga0075366_10031394 Ga0075366_100313942 273
858 3300006195 Ga0075366_10033710 Ga0075366_100337103 273
859 3300006237 Ga0097621_100064859 Ga0097621_1000648593 273
860 3300006353 Ga0075370_10056883 Ga0075370_100568832 273
861 3300006844 Ga0075428_100025112 Ga0075428_1000251122 273
862 3300006871 Ga0075434_100125782 Ga0075434_1001257823 273
863 3300006931 Ga0097620_100217015 Ga0097620_1002170153 273
864 3300007265 Ga0099794_10072951 Ga0099794_100729512 273
865 3300007788 Ga0099795_10071435 Ga0099795_100714352 273
866 3300009011 Ga0105251_10000251 Ga0105251_1000025120 273
867 3300009036 Ga0105244_10005524 Ga0105244_100055246 273
868 3300009092 Ga0105250_10000070 Ga0105250_1000007058 273
869 3300009092 Ga0105250_10001351 Ga0105250_100013512 273
870 3300009093 Ga0105240_10427502 Ga0105240_104275022 273
871 3300009094 Ga0111539_10105643 Ga0111539_101056433 273
872 3300009098 Ga0105245_10105248 Ga0105245_101052483 273
873 3300009101 Ga0105247_10201048 Ga0105247_102010481 273
874 3300009147 Ga0114129_10043432 Ga0114129_100434325 273
875 3300009148 Ga0105243_10124180 Ga0105243_101241801 273
876 3300009176 Ga0105242_10449428 Ga0105242_104494282 273
877 3300009177 Ga0105248_10317850 Ga0105248_103178502 273
878 3300009551 Ga0105238_10037001 Ga0105238_100370014 273
879 3300009551 Ga0105238_10152479 Ga0105238_101524792 273
880 3300009553 Ga0105249_10138742 Ga0105249_101387422 273
881 3300009553 Ga0105249_10265162 Ga0105249_102651623 273
882 3300010159 Ga0099796_10024312 Ga0099796_100243122 273
883 3300010375 Ga0105239_10303153 Ga0105239_103031532 273
884 3300011119 Ga0105246_10171803 Ga0105246_101718032 273
885 3300013104 Ga0157370_10143174 Ga0157370_101431743 273
886 3300013105 Ga0157369_10353584 Ga0157369_103535842 273
887 3300013297 Ga0157378_10092130 Ga0157378_100921304 273
888 3300013306 Ga0163162_10293531 Ga0163162_102935313 273
889 3300014325 Ga0163163_10414364 Ga0163163_104143643 273
890 3300014326 Ga0157380_10055433 Ga0157380_100554333 273
891 3300014326 Ga0157380_10222114 Ga0157380_102221142 273
892 3300014326 Ga0157380_10241406 Ga0157380_102414062 273
893 3300014968 Ga0157379_10136497 Ga0157379_101364973 273
894 3300017792 Ga0163161_10315766 Ga0163161_103157662 273
895 3300021361 Ga0213872_10005848 Ga0213872_100058485 273
896 3300021388 Ga0213875_10114015 Ga0213875_101140152 273
897 3300021441 Ga0213871_10035227 Ga0213871_100352271 273
898 3300025254 Ga0209148_1000947 Ga0209148_10009474 273
899 3300025258 Ga0209129_1000019 Ga0209129_1000019134 273
900 3300025272 Ga0209455_1001778 Ga0209455_10017786 273
901 3300025273 Ga0209673_1000132 Ga0209673_1000132152 273
902 3300025292 Ga0209676_1019408 Ga0209676_10194082 273
903 3300025294 Ga0209025_1000186 Ga0209025_10001865 273
904 3300025294 Ga0209025_1006600 Ga0209025_10066007 273
905 3300025295 Ga0209564_1015129 Ga0209564_10151294 273
906 3300025297 Ga0209758_1005502 Ga0209758_10055022 273
907 3300025299 Ga0209256_1000805 Ga0209256_100080519 273
908 3300025303 Ga0209051_1025340 Ga0209051_10253401 273
909 3300025303 Ga0209051_1036923 Ga0209051_10369232 273
910 3300025315 Ga0207697_10065277 Ga0207697_100652771 273
911 3300025711 Ga0207696_1000038 Ga0207696_100003899 273
912 3300025735 Ga0207713_1000002 Ga0207713_1000002189 273
913 3300025900 Ga0207710_10116799 Ga0207710_101167991 273
914 3300025901 Ga0207688_10025501 Ga0207688_100255012 273
915 3300025904 Ga0207647_10006363 Ga0207647_100063638 273
916 3300025909 Ga0207705_10000003 Ga0207705_10000003578 273
917 3300025909 Ga0207705_10022777 Ga0207705_100227773 273
918 3300025912 Ga0207707_10011916 Ga0207707_1001191612 273
919 3300025913 Ga0207695_10034241 Ga0207695_100342414 273
920 3300025915 Ga0207693_10463115 Ga0207693_104631151 273
921 3300025917 Ga0207660_10006535 Ga0207660_1000653512 273
922 3300025919 Ga0207657_10010100 Ga0207657_100101005 273
923 3300025920 Ga0207649_10001056 Ga0207649_100010563 273
924 3300025921 Ga0207652_10007891 Ga0207652_1000789114 273
925 3300025925 Ga0207650_10000896 Ga0207650_1000089612 273
926 3300025927 Ga0207687_10004421 Ga0207687_100044216 273
927 3300025932 Ga0207690_10010704 Ga0207690_100107042 273
928 3300025933 Ga0207706_10144278 Ga0207706_101442782 273
929 3300025936 Ga0207670_10366519 Ga0207670_103665191 273
930 3300025941 Ga0207711_10117033 Ga0207711_101170332 273
931 3300025942 Ga0207689_10045302 Ga0207689_100453024 273
932 3300025949 Ga0207667_10039559 Ga0207667_100395594 273
933 3300025949 Ga0207667_10135401 Ga0207667_101354014 273
934 3300025972 Ga0207668_10191932 Ga0207668_101919322 273
935 3300026023 Ga0207677_10044580 Ga0207677_100445803 273
936 3300026035 Ga0207703_10059069 Ga0207703_100590694 273
937 3300026041 Ga0207639_10106558 Ga0207639_101065582 273
938 3300026041 Ga0207639_10145583 Ga0207639_101455831 273
939 3300026067 Ga0207678_10002336 Ga0207678_1000233610 273
940 3300026067 Ga0207678_10018195 Ga0207678_100181953 273
941 3300026078 Ga0207702_10061728 Ga0207702_100617282 273
942 3300026078 Ga0207702_10075516 Ga0207702_100755164 273
943 3300026078 Ga0207702_10177897 Ga0207702_101778972 273
944 3300026089 Ga0207648_10021205 Ga0207648_100212052 273
945 3300026118 Ga0207675_100058584 Ga0207675_1000585843 273
946 3300026121 Ga0207683_10285599 Ga0207683_102855992 273
947 3300026142 Ga0207698_10001361 Ga0207698_100013617 273
948 3300026142 Ga0207698_10021118 Ga0207698_100211184 273
949 3300028379 Ga0268266_10065807 Ga0268266_100658074 273
950 3300028379 Ga0268266_10580761 Ga0268266_105807612 273
951 3300028380 Ga0268265_10090428 Ga0268265_100904283 273
952 3300031251 Ga0265327_10037340 Ga0265327_100373402 273
953 3300031344 Ga0265316_10032707 Ga0265316_100327074 273
954 3300031456 Ga0307513_10048472 Ga0307513_100484724 273
955 3300031595 Ga0265313_10004657 Ga0265313_100046579 273
956 3300031711 Ga0265314_10035472 Ga0265314_100354724 273
957 3300031712 Ga0265342_10048420 Ga0265342_100484203 273
958 3300031730 Ga0307516_10085294 Ga0307516_100852942 273
959 3300031824 Ga0307413_10158066 Ga0307413_101580663 273
960 3300031911 Ga0307412_10251708 Ga0307412_102517082 273
961 3300031995 Ga0307409_100035306 Ga0307409_1000353064 273
962 3300032002 Ga0307416_100726167 Ga0307416_1007261671 273
963 3300032004 Ga0307414_10490937 Ga0307414_104909371 273
964 3300037312 Ga0395899_0006184 Ga0395899_0006184_7764_8645 273
965 3300037312 Ga0395899_0086840 Ga0395899_0086840_895_1722 273
966 3300037418 Ga0395900_0071479 Ga0395900_0071479_2198_3043 273
967 3300037418 Ga0395900_0214937 Ga0395900_0214937_1006_1887 273
968 3300037466 Ga0395898_0011006 Ga0395898_0011006_1302_2129 273
969 3300037471 Ga0395905_0051129 Ga0395905_0051129_2171_3016 273
970 3300037471 Ga0395905_0114802 Ga0395905_0114802_1575_2450 273
971 3300037853 Ga0436364_0660405 Ga0436364_0660405_1211_2050 273
972 3300038443 Ga0395901_0103550 Ga0395901_0103550_97_942 273
973 3300038443 Ga0395901_0122396 Ga0395901_0122396_1345_2172 273
974 3300039438 Ga0436360_0297024 Ga0436360_0297024_792_1646 273
975 3300039438 Ga0436360_0726204 Ga0436360_0726204_1004_1834 273
976 3300039438 Ga0436360_1185545 Ga0436360_1185545_264_1127 273
977 3300039447 Ga0436361_0670522 Ga0436361_0670522_1947_2810 273
978 3300039447 Ga0436361_0797533 Ga0436361_0797533_124_978 273
979 3300039447 Ga0436361_0964227 Ga0436361_0964227_401_1279 273
980 3300041451 Ga0451791_1416907 Ga0451791_1416907_69_941 273
981 3300041505 Ga0451849_1014739 Ga0451849_1014739_16_888 273
982 3300044658 Ga0466972_0006944 Ga0466972_0006944_3066_3920 273
983 3300044683 Ga0466965_0007472 Ga0466965_0007472_2972_3826 273
984 3300044684 Ga0466966_0100604 Ga0466966_0100604_867_1721 273
985 3300044706 Ga0466964_0003960 Ga0466964_0003960_853_1707 273
986 3300044735 Ga0466968_0000823 Ga0466968_0000823_5767_6621 273
987 3300044765 Ga0466970_0225226 Ga0466970_0225226_70_951 273
988 3300044842 Ga0466957_0015382 Ga0466957_0015382_2632_3486 273
989 3300045049 Ga0466959_0096655 Ga0466959_0096655_392_1246 273
990 3300046455 Ga0495603_0041893 Ga0495603_0041893_459_1295 273
991 3300046457 Ga0495590_0023062 Ga0495590_0023062_26_862 273
992 3300046460 Ga0495638_0018101 Ga0495638_0018101_2610_3473 273
993 3300046460 Ga0495638_0242925 Ga0495638_0242925_106_960 273
994 3300046474 Ga0495605_0000052 Ga0495605_0000052_94776_95618 273
995 3300046474 Ga0495605_0023076 Ga0495605_0023076_1599_2441 273
996 3300046475 Ga0495639_0058142 Ga0495639_0058142_328_1164 273
997 3300046501 Ga0495607_0001263 Ga0495607_0001263_5353_6198 273
998 3300046501 Ga0495607_0056788 Ga0495607_0056788_917_1768 273
999 3300046506 Ga0495583_0004248 Ga0495583_0004248_7686_8528 273
1000 3300046512 Ga0495610_0039390 Ga0495610_0039390_499_1344 273
1001 3300046518 Ga0495631_0024202 Ga0495631_0024202_814_1677 273
1002 3300046518 Ga0495631_0049474 Ga0495631_0049474_638_1474 273
1003 3300046519 Ga0495632_0034083 Ga0495632_0034083_500_1363 273
1004 3300046519 Ga0495632_0146243 Ga0495632_0146243_59_895 273
1005 3300046520 Ga0495637_0008057 Ga0495637_0008057_2029_2874 273
1006 3300046520 Ga0495637_0019432 Ga0495637_0019432_775_1611 273
1007 3300046524 Ga0495648_0145620 Ga0495648_0145620_344_1180 273
1008 3300046537 Ga0495598_0048766 Ga0495598_0048766_294_1130 273
1009 3300046538 Ga0495609_0021486 Ga0495609_0021486_80_973 273
1010 3300046542 Ga0495597_0000061 Ga0495597_0000061_2301_3146 273
1011 3300046616 Ga0495668_0038969 Ga0495668_0038969_69_911 273
1012 3300046648 Ga0495611_0149054 Ga0495611_0149054_165_1028 273
1013 3300046660 Ga0495625_0093163 Ga0495625_0093163_856_1719 273
1014 3300046664 Ga0495659_0083925 Ga0495659_0083925_71_943 273
1015 3300046665 Ga0495661_0196980 Ga0495661_0196980_65_937 273
1016 3300046684 Ga0495669_0059080 Ga0495669_0059080_870_1706 273
1017 3300046810 Ga0495660_0000072 Ga0495660_0000072_25070_25912 273
1018 3300046810 Ga0495660_0002969 Ga0495660_0002969_7804_8649 273
1019 3300046810 Ga0495660_0139256 Ga0495660_0139256_76_921 273
1020 3300047320 Ga0495672_0003920 Ga0495672_0003920_8094_8945 273
1021 3300047320 Ga0495672_0011899 Ga0495672_0011899_2341_3174 273
1022 3300047321 Ga0495676_0054173 Ga0495676_0054173_2280_3116 273
1023 3300047469 Ga0495673_0000112 Ga0495673_0000112_18322_19167 273
1024 3300047472 Ga0495686_0063181 Ga0495686_0063181_227_1087 273
1025 3300048904 Ga0496101_0206713 Ga0496101_0206713_189_1025 273
1026 3300048907 Ga0496104_0209376 Ga0496104_0209376_257_1093 273
1027 3300048909 Ga0496106_0236611 Ga0496106_0236611_182_1006 273
1028 3300048921 Ga0496118_0226947 Ga0496118_0226947_196_1059 273
1029 3300048924 Ga0496121_0000571 Ga0496121_0000571_10639_11502 273
1030 3300048927 Ga0496124_0000047 Ga0496124_0000047_76930_77823 273
1031 3300048927 Ga0496124_0051479 Ga0496124_0051479_182_1045 273
1032 3300048928 Ga0496125_0016401 Ga0496125_0016401_3925_4788 273
1033 3300048928 Ga0496125_0257440 Ga0496125_0257440_77_928 273
1034 3300048929 Ga0496126_0569132 Ga0496126_0569132_15_878 273
1035 3300049570 Ga0501033_0024051 Ga0501033_0024051_3373_4197 273
1036 3300049571 Ga0501034_0152998 Ga0501034_0152998_371_1195 273
1037 3300049572 Ga0501036_0408284 Ga0501036_0408284_194_1018 273
1038 3300049579 Ga0501043_0283284 Ga0501043_0283284_121_945 273
1039 3300049581 Ga0501047_0002924 Ga0501047_0002924_2576_3400 273
1040 3300049583 Ga0501067_0114972 Ga0501067_0114972_92_928 273
1041 3300049585 Ga0501069_0194401 Ga0501069_0194401_304_1140 273
1042 3300049585 Ga0501069_0301155 Ga0501069_0301155_82_906 273
1043 3300049586 Ga0501070_0000284 Ga0501070_0000284_10224_11048 273
1044 3300049590 Ga0501074_0196601 Ga0501074_0196601_227_1051 273
1045 3300049742 Ga0501080_0000843 Ga0501080_0000843_9913_10737 273
1046 3300049822 Ga0501035_0003018 Ga0501035_0003018_14858_15682 273
1047 3300049823 Ga0501044_0121116 Ga0501044_0121116_250_1074 273
1048 3300050492 nmdc:mga0yw44_2135_c2 nmdc:mga0yw44_2135_c2_4479_5315 273
1049 3300050493 nmdc:mga0k408_55598_c1 nmdc:mga0k408_55598_c1_909_1745 273
1050 3300050495 nmdc:mga04h51_11849_c1 nmdc:mga04h51_11849_c1_1379_2215 273
1051 3300050496 nmdc:mga07m45_5016_c1 nmdc:mga07m45_5016_c1_844_1671 273
1052 3300053096 Ga0500641_0015222 Ga0500641_0015222_1095_1931 273
1053 3300053104 Ga0500556_0015933 Ga0500556_0015933_259_1122 273
1054 3300053108 Ga0500562_032663 Ga0500562_032663_458_1285 273
1055 3300053119 Ga0500595_002383 Ga0500595_002383_4546_5409 273
1056 3300053125 Ga0500618_000107 Ga0500618_000107_30742_31584 273
1057 3300053125 Ga0500618_000774 Ga0500618_000774_8446_9282 273
1058 3300053136 Ga0500559_0001322 Ga0500559_0001322_240_1073 273
1059 3300053136 Ga0500559_0009365 Ga0500559_0009365_3187_4011 273
1060 3300053139 Ga0500568_0018704 Ga0500568_0018704_2109_2942 273
1061 3300053140 Ga0500573_0020981 Ga0500573_0020981_230_1063 273
1062 3300053156 Ga0500622_0048137 Ga0500622_0048137_268_1101 273
1063 3300053724 Ga0500570_052796 Ga0500570_052796_82_948 273
1064 3300054114 Ga0501084_0164817 Ga0501084_0164817_303_1148 273
1065 3300054114 Ga0501084_0173328 Ga0501084_0173328_182_1027 273
1066 3300060353 Ga0501082_0275649 Ga0501082_0275649_346_1191 273
1067 iso_pu_bacteria 2513237151 2513959063 273
1068 iso_pu_bacteria 2526164713 2527076362 273
1069 iso_pu_bacteria 2599185354 2600202852 273
1070 iso_pu_bacteria 2617270742 2617380731 273
1071 iso_pu_bacteria 2842482326 2842487266 273
1072 iso_pu_bacteria 2855730933 2855732351 273
1073 iso_pu_bacteria 2855767633 2855769059 273
1074 iso_pu_bacteria 2881412998 2881415064 273
1075 iso_pu_bacteria 2919404418 2919405550 273
1076 3300001989 JGI24739J22299_10062697 JGI24739J22299_100626971 274
1077 3300003761 Ga0055535_1001904 Ga0055535_10019048 274
1078 3300003762 Ga0055542_1001119 Ga0055542_10011198 274
1079 3300003763 Ga0055529_1000247 Ga0055529_100024736 274
1080 3300003771 Ga0055526_1007264 Ga0055526_10072645 274
1081 3300003771 Ga0055526_1024832 Ga0055526_10248322 274
1082 3300003775 Ga0055524_1035328 Ga0055524_10353281 274
1083 3300003856 Ga0058692_1017822 Ga0058692_10178221 274
1084 3300005262 Ga0065165_1000979 Ga0065165_100097912 274
1085 3300005334 Ga0068869_100156270 Ga0068869_1001562703 274
1086 3300005339 Ga0070660_100000315 Ga0070660_1000003151 274
1087 3300005344 Ga0070661_100219031 Ga0070661_1002190311 274
1088 3300005353 Ga0070669_100127687 Ga0070669_1001276872 274
1089 3300005355 Ga0070671_100180736 Ga0070671_1001807362 274
1090 3300005366 Ga0070659_100000858 Ga0070659_1000008582 274
1091 3300005444 Ga0070694_100264525 Ga0070694_1002645252 274
1092 3300005445 Ga0070708_100119305 Ga0070708_1001193051 274
1093 3300005455 Ga0070663_100009112 Ga0070663_1000091124 274
1094 3300005455 Ga0070663_100077640 Ga0070663_1000776402 274
1095 3300005467 Ga0070706_100051569 Ga0070706_1000515694 274
1096 3300005471 Ga0070698_100276563 Ga0070698_1002765632 274
1097 3300005518 Ga0070699_100435538 Ga0070699_1004355382 274
1098 3300005535 Ga0070684_100340743 Ga0070684_1003407431 274
1099 3300005536 Ga0070697_100429408 Ga0070697_1004294082 274
1100 3300005539 Ga0068853_100115707 Ga0068853_1001157072 274
1101 3300005546 Ga0070696_100038682 Ga0070696_1000386824 274
1102 3300005547 Ga0070693_100291419 Ga0070693_1002914191 274
1103 3300005548 Ga0070665_100030501 Ga0070665_1000305013 274
1104 3300005549 Ga0070704_100204943 Ga0070704_1002049432 274
1105 3300005563 Ga0068855_100413514 Ga0068855_1004135141 274
1106 3300005564 Ga0070664_100174906 Ga0070664_1001749063 274
1107 3300005614 Ga0068856_100296184 Ga0068856_1002961842 274
1108 3300005618 Ga0068864_100494737 Ga0068864_1004947372 274
1109 3300005719 Ga0068861_100043310 Ga0068861_1000433103 274
1110 3300005840 Ga0068870_10341595 Ga0068870_103415951 274
1111 3300005841 Ga0068863_100238374 Ga0068863_1002383741 274
1112 3300005842 Ga0068858_100378317 Ga0068858_1003783171 274
1113 3300005985 Ga0081539_10003744 Ga0081539_1000374421 274
1114 3300006038 Ga0075365_10116444 Ga0075365_101164442 274
1115 3300006042 Ga0075368_10023818 Ga0075368_100238183 274
1116 3300006042 Ga0075368_10168858 Ga0075368_101688581 274
1117 3300006048 Ga0075363_100006810 Ga0075363_1000068104 274
1118 3300006186 Ga0075369_10030499 Ga0075369_100304992 274
1119 3300006195 Ga0075366_10031045 Ga0075366_100310454 274
1120 3300006195 Ga0075366_10205551 Ga0075366_102055512 274
1121 3300006353 Ga0075370_10013990 Ga0075370_100139903 274
1122 3300006353 Ga0075370_10083054 Ga0075370_100830542 274
1123 3300006353 Ga0075370_10228067 Ga0075370_102280672 274
1124 3300006914 Ga0075436_100021452 Ga0075436_1000214522 274
1125 3300006946 Ga0079104_1000129 Ga0079104_100012957 274
1126 3300009093 Ga0105240_10000244 Ga0105240_1000024459 274
1127 3300009093 Ga0105240_10000333 Ga0105240_1000033370 274
1128 3300009093 Ga0105240_10002439 Ga0105240_1000243910 274
1129 3300009093 Ga0105240_10271630 Ga0105240_102716301 274
1130 3300009147 Ga0114129_10440338 Ga0114129_104403382 274
1131 3300009545 Ga0105237_10001533 Ga0105237_1000153319 274
1132 3300009545 Ga0105237_10127412 Ga0105237_101274123 274
1133 3300009551 Ga0105238_10140111 Ga0105238_101401112 274
1134 3300009765 Ga0123341_1002866 Ga0123341_10028666 274
1135 3300009766 Ga0123342_1019294 Ga0123342_10192944 274
1136 3300010375 Ga0105239_10000043 Ga0105239_1000004386 274
1137 3300010375 Ga0105239_10031365 Ga0105239_100313655 274
1138 3300013100 Ga0157373_10074765 Ga0157373_100747653 274
1139 3300013105 Ga0157369_10222361 Ga0157369_102223611 274
1140 3300013306 Ga0163162_10721983 Ga0163162_107219832 274
1141 3300014968 Ga0157379_10438532 Ga0157379_104385321 274
1142 3300025228 Ga0209672_100058 Ga0209672_10005874 274
1143 3300025242 Ga0209258_100164 Ga0209258_10016480 274
1144 3300025250 Ga0209026_1000231 Ga0209026_100023124 274
1145 3300025254 Ga0209148_1000039 Ga0209148_1000039151 274
1146 3300025256 Ga0209759_1000249 Ga0209759_100024968 274
1147 3300025261 Ga0209233_1015577 Ga0209233_10155772 274
1148 3300025272 Ga0209455_1000034 Ga0209455_1000034152 274
1149 3300025295 Ga0209564_1001247 Ga0209564_100124727 274
1150 3300025295 Ga0209564_1005262 Ga0209564_10052622 274
1151 3300025299 Ga0209256_1001833 Ga0209256_10018332 274
1152 3300025304 Ga0209257_1000350 Ga0209257_100035073 274
1153 3300025900 Ga0207710_10065256 Ga0207710_100652562 274
1154 3300025909 Ga0207705_10357598 Ga0207705_103575981 274
1155 3300025910 Ga0207684_10355458 Ga0207684_103554582 274
1156 3300025913 Ga0207695_10000171 Ga0207695_10000171135 274
1157 3300025913 Ga0207695_10000262 Ga0207695_1000026262 274
1158 3300025913 Ga0207695_10000623 Ga0207695_1000062323 274
1159 3300025914 Ga0207671_10001214 Ga0207671_1000121419 274
1160 3300025914 Ga0207671_10037705 Ga0207671_100377053 274
1161 3300025919 Ga0207657_10000002 Ga0207657_10000002203 274
1162 3300025920 Ga0207649_10241665 Ga0207649_102416651 274
1163 3300025922 Ga0207646_10044616 Ga0207646_100446165 274
1164 3300025932 Ga0207690_10000011 Ga0207690_1000001123 274
1165 3300025945 Ga0207679_10187937 Ga0207679_101879372 274
1166 3300026023 Ga0207677_10551624 Ga0207677_105516241 274
1167 3300026067 Ga0207678_10000677 Ga0207678_1000067723 274
1168 3300026067 Ga0207678_10007573 Ga0207678_100075733 274
1169 3300026078 Ga0207702_10286567 Ga0207702_102865672 274
1170 3300026089 Ga0207648_10280466 Ga0207648_102804662 274
1171 3300026095 Ga0207676_10109348 Ga0207676_101093482 274
1172 3300026118 Ga0207675_100076984 Ga0207675_1000769843 274
1173 3300027111 Ga0209281_1000036 Ga0209281_1000036192 274
1174 3300027111 Ga0209281_1000047 Ga0209281_1000047134 274
1175 3300027312 Ga0209371_1008437 Ga0209371_10084374 274
1176 3300027866 Ga0209813_10010292 Ga0209813_100102922 274
1177 3300028379 Ga0268266_10000827 Ga0268266_1000082736 274
1178 3300030500 Ga0268256_1037347 Ga0268256_10373472 274
1179 3300031235 Ga0265330_10055070 Ga0265330_100550701 274
1180 3300031249 Ga0265339_10029184 Ga0265339_100291842 274
1181 3300031344 Ga0265316_10269303 Ga0265316_102693032 274
1182 3300031595 Ga0265313_10002155 Ga0265313_1000215517 274
1183 3300031911 Ga0307412_10009672 Ga0307412_100096723 274
1184 3300033180 Ga0307510_10034816 Ga0307510_100348163 274
1185 3300037312 Ga0395899_0123084 Ga0395899_0123084_344_1171 274
1186 3300039437 Ga0436365_1424951 Ga0436365_1424951_1720_2547 274
1187 3300039438 Ga0436360_0253798 Ga0436360_0253798_26_859 274
1188 3300039447 Ga0436361_0609700 Ga0436361_0609700_3873_4700 274
1189 3300044683 Ga0466965_0050351 Ga0466965_0050351_148_987 274
1190 3300044693 Ga0466961_0002858 Ga0466961_0002858_5133_5972 274
1191 3300044719 Ga0466971_0007722 Ga0466971_0007722_13_852 274
1192 3300044842 Ga0466957_0030882 Ga0466957_0030882_949_1788 274
1193 3300045836 Ga0466958_0251067 Ga0466958_0251067_180_1019 274
1194 3300046455 Ga0495603_0012796 Ga0495603_0012796_2995_3843 274
1195 3300046460 Ga0495638_0000009 Ga0495638_0000009_284175_285011 274
1196 3300046460 Ga0495638_0051078 Ga0495638_0051078_1437_2339 274
1197 3300046461 Ga0495641_0127451 Ga0495641_0127451_255_1103 274
1198 3300046499 Ga0495594_0067940 Ga0495594_0067940_1005_1853 274
1199 3300046507 Ga0495606_0063266 Ga0495606_0063266_390_1229 274
1200 3300046507 Ga0495606_0121515 Ga0495606_0121515_187_1062 274
1201 3300046519 Ga0495632_0057548 Ga0495632_0057548_734_1609 274
1202 3300046557 Ga0495622_0014437 Ga0495622_0014437_1282_2130 274
1203 3300046648 Ga0495611_0174111 Ga0495611_0174111_34_909 274
1204 3300046684 Ga0495669_0088062 Ga0495669_0088062_308_1144 274
1205 3300046694 Ga0495649_0185092 Ga0495649_0185092_68_961 274
1206 3300047469 Ga0495673_0025561 Ga0495673_0025561_942_1784 274
1207 3300047472 Ga0495686_0021593 Ga0495686_0021593_1189_2064 274
1208 3300048904 Ga0496101_0007862 Ga0496101_0007862_3898_4764 274
1209 3300048906 Ga0496103_0199668 Ga0496103_0199668_277_1152 274
1210 3300048907 Ga0496104_0118467 Ga0496104_0118467_1184_2038 274
1211 3300048908 Ga0496105_0002129 Ga0496105_0002129_7147_8007 274
1212 3300048908 Ga0496105_0061342 Ga0496105_0061342_792_1646 274
1213 3300048910 Ga0496107_0079364 Ga0496107_0079364_901_1749 274
1214 3300048918 Ga0496115_0000354 Ga0496115_0000354_35791_36618 274
1215 3300048918 Ga0496115_0002784 Ga0496115_0002784_3909_4775 274
1216 3300048918 Ga0496115_0250655 Ga0496115_0250655_142_981 274
1217 3300048918 Ga0496115_0470043 Ga0496115_0470043_11_838 274
1218 3300048919 Ga0496116_0033234 Ga0496116_0033234_1643_2503 274
1219 3300048920 Ga0496117_0013888 Ga0496117_0013888_3696_4562 274
1220 3300048920 Ga0496117_0097680 Ga0496117_0097680_686_1534 274
1221 3300048920 Ga0496117_0194943 Ga0496117_0194943_98_991 274
1222 3300048921 Ga0496118_0004151 Ga0496118_0004151_11410_12276 274
1223 3300048921 Ga0496118_0010226 Ga0496118_0010226_5111_5971 274
1224 3300048921 Ga0496118_0098370 Ga0496118_0098370_1020_1868 274
1225 3300048922 Ga0496119_0000531 Ga0496119_0000531_43947_44807 274
1226 3300048922 Ga0496119_0075998 Ga0496119_0075998_871_1695 274
1227 3300048923 Ga0496120_0000182 Ga0496120_0000182_62248_63108 274
1228 3300048923 Ga0496120_0034351 Ga0496120_0034351_625_1473 274
1229 3300048923 Ga0496120_0059051 Ga0496120_0059051_216_1040 274
1230 3300048923 Ga0496120_0154338 Ga0496120_0154338_102_977 274
1231 3300048924 Ga0496121_0000341 Ga0496121_0000341_31170_32018 274
1232 3300048924 Ga0496121_0024997 Ga0496121_0024997_2751_3602 274
1233 3300048924 Ga0496121_0159027 Ga0496121_0159027_585_1436 274
1234 3300048927 Ga0496124_0000519 Ga0496124_0000519_10263_11090 274
1235 3300048928 Ga0496125_0057558 Ga0496125_0057558_34_861 274
1236 3300048928 Ga0496125_0127996 Ga0496125_0127996_603_1478 274
1237 3300048929 Ga0496126_0000412 Ga0496126_0000412_11776_12603 274
1238 3300048929 Ga0496126_0000996 Ga0496126_0000996_18038_18904 274
1239 3300048929 Ga0496126_0004035 Ga0496126_0004035_1332_2171 274
1240 3300048929 Ga0496126_0034921 Ga0496126_0034921_2855_3703 274
1241 3300048929 Ga0496126_0092056 Ga0496126_0092056_1182_2009 274
1242 3300049570 Ga0501033_0058238 Ga0501033_0058238_1664_2491 274
1243 3300049571 Ga0501034_0547310 Ga0501034_0547310_43_870 274
1244 3300049579 Ga0501043_0142602 Ga0501043_0142602_251_1078 274
1245 3300049582 Ga0501048_0001756 Ga0501048_0001756_14408_15244 274
1246 3300049742 Ga0501080_0707343 Ga0501080_0707343_40_867 274
1247 3300050490 nmdc:mga03n38_1460_c1 nmdc:mga03n38_1460_c1_1115_1969 274
1248 3300050493 nmdc:mga0k408_119964_c1 nmdc:mga0k408_119964_c1_321_1175 274
1249 3300050494 nmdc:mga06z11_13554_c1 nmdc:mga06z11_13554_c1_373_1227 274
1250 3300050495 nmdc:mga04h51_139194_c1 nmdc:mga04h51_139194_c1_23_871 274
1251 3300050496 nmdc:mga07m45_2086_c1 nmdc:mga07m45_2086_c1_5361_6215 274
1252 3300050512 nmdc:mga0n895_512243_c1 nmdc:mga0n895_512243_c1_142_993 274
1253 3300050514 nmdc:mga08x19_95087_c1 nmdc:mga08x19_95087_c1_1024_1875 274
1254 3300050516 nmdc:mga0sz30_73784_c1 nmdc:mga0sz30_73784_c1_486_1328 274
1255 3300053094 Ga0500566_0036407 Ga0500566_0036407_508_1368 274
1256 3300053119 Ga0500595_002644 Ga0500595_002644_3186_4046 274
1257 3300053119 Ga0500595_008876 Ga0500595_008876_2366_3214 274
1258 3300053130 Ga0500642_0009322 Ga0500642_0009322_2421_3254 274
1259 3300053130 Ga0500642_0010049 Ga0500642_0010049_1623_2462 274
1260 3300053134 Ga0500658_0050060 Ga0500658_0050060_826_1680 274
1261 3300053136 Ga0500559_0012928 Ga0500559_0012928_1183_2010 274
1262 3300053136 Ga0500559_0092836 Ga0500559_0092836_498_1364 274
1263 3300053162 Ga0500638_000308 Ga0500638_000308_4841_5701 274
1264 3300053177 Ga0500636_0136612 Ga0500636_0136612_123_986 274
1265 3300053178 Ga0500637_0002745 Ga0500637_0002745_604_1464 274
1266 3300055283 Ga0500661_000113 Ga0500661_000113_534_1394 274
1267 3300061719 Ga0466962_0030728 Ga0466962_0030728_1368_2207 274
1268 iso_pu_bacteria 2936381700 2936386734 274
1269 3300002987 JGI25159J45721_1000905 JGI25159J45721_10009059 275
1270 3300003215 JGI25153J46596_10027768 JGI25153J46596_100277682 275
1271 3300003354 JGI25160J50197_1000040 JGI25160J50197_1000040135 275
1272 3300003374 JGI25161J50226_1000023 JGI25161J50226_1000023135 275
1273 3300003773 Ga0055537_1001993 Ga0055537_10019932 275
1274 3300004625 Ga0055543_1000475 Ga0055543_100047524 275
1275 3300005262 Ga0065165_1000484 Ga0065165_100048451 275
1276 3300005335 Ga0070666_10393887 Ga0070666_103938871 275
1277 3300005347 Ga0070668_100115768 Ga0070668_1001157682 275
1278 3300005355 Ga0070671_100275443 Ga0070671_1002754432 275
1279 3300005617 Ga0068859_100342410 Ga0068859_1003424102 275
1280 3300005842 Ga0068858_100121251 Ga0068858_1001212512 275
1281 3300005983 Ga0081540_1012326 Ga0081540_10123264 275
1282 3300006051 Ga0075364_10014894 Ga0075364_100148942 275
1283 3300006177 Ga0075362_10050490 Ga0075362_100504902 275
1284 3300006931 Ga0097620_100342427 Ga0097620_1003424272 275
1285 3300009101 Ga0105247_10173540 Ga0105247_101735402 275
1286 3300009551 Ga0105238_10132971 Ga0105238_101329714 275
1287 3300009553 Ga0105249_10198558 Ga0105249_101985582 275
1288 3300013308 Ga0157375_10648729 Ga0157375_106487292 275
1289 3300014968 Ga0157379_10116279 Ga0157379_101162792 275
1290 3300014969 Ga0157376_10398976 Ga0157376_103989762 275
1291 3300021358 Ga0213873_10003441 Ga0213873_100034412 275
1292 3300025261 Ga0209233_1028404 Ga0209233_10284042 275
1293 3300025273 Ga0209673_1004907 Ga0209673_10049076 275
1294 3300025273 Ga0209673_1006226 Ga0209673_10062263 275
1295 3300025284 Ga0209130_1000142 Ga0209130_100014299 275
1296 3300025295 Ga0209564_1000021 Ga0209564_1000021170 275
1297 3300025297 Ga0209758_1002555 Ga0209758_100255514 275
1298 3300025302 Ga0207426_1000076 Ga0207426_1000076285 275
1299 3300025924 Ga0207694_10351902 Ga0207694_103519022 275
1300 3300025931 Ga0207644_10305534 Ga0207644_103055341 275
1301 3300025936 Ga0207670_10091957 Ga0207670_100919572 275
1302 3300026035 Ga0207703_10072639 Ga0207703_100726393 275
1303 3300026067 Ga0207678_10098500 Ga0207678_100985003 275
1304 3300031903 Ga0307407_10117837 Ga0307407_101178372 275
1305 3300031911 Ga0307412_10088437 Ga0307412_100884372 275
1306 3300037312 Ga0395899_0125427 Ga0395899_0125427_322_1194 275
1307 3300037418 Ga0395900_0193738 Ga0395900_0193738_529_1401 275
1308 3300037466 Ga0395898_0072686 Ga0395898_0072686_621_1493 275
1309 3300038443 Ga0395901_0045021 Ga0395901_0045021_2095_2967 275
1310 3300039438 Ga0436360_1375098 Ga0436360_1375098_10474_11304 275
1311 3300039447 Ga0436361_0816491 Ga0436361_0816491_748_1578 275
1312 3300039453 Ga0436362_0687917 Ga0436362_0687917_2020_2850 275
1313 3300046459 Ga0495629_0078860 Ga0495629_0078860_1207_2061 275
1314 3300046471 Ga0495650_0080079 Ga0495650_0080079_294_1148 275
1315 3300046492 Ga0495585_0143957 Ga0495585_0143957_334_1182 275
1316 3300046506 Ga0495583_0000109 Ga0495583_0000109_124949_125821 275
1317 3300046518 Ga0495631_0090419 Ga0495631_0090419_187_1038 275
1318 3300046519 Ga0495632_0000635 Ga0495632_0000635_18419_19291 275
1319 3300046519 Ga0495632_0097990 Ga0495632_0097990_163_1008 275
1320 3300046519 Ga0495632_0106518 Ga0495632_0106518_357_1205 275
1321 3300046520 Ga0495637_0002699 Ga0495637_0002699_3182_4042 275
1322 3300046520 Ga0495637_0027777 Ga0495637_0027777_312_1184 275
1323 3300046533 Ga0495640_0035889 Ga0495640_0035889_103_1029 275
1324 3300046663 Ga0495635_0193796 Ga0495635_0193796_133_987 275
1325 3300046665 Ga0495661_0000144 Ga0495661_0000144_74157_75029 275
1326 3300046665 Ga0495661_0033283 Ga0495661_0033283_1085_1936 275
1327 3300046691 Ga0495670_0127238 Ga0495670_0127238_367_1218 275
1328 3300046810 Ga0495660_0085077 Ga0495660_0085077_679_1527 275
1329 3300047472 Ga0495686_0059825 Ga0495686_0059825_1234_2082 275
1330 3300047673 Ga0495593_0097054 Ga0495593_0097054_545_1399 275
1331 3300048088 Ga0495602_0124858 Ga0495602_0124858_596_1444 275
1332 3300048907 Ga0496104_0157196 Ga0496104_0157196_781_1635 275
1333 3300048910 Ga0496107_0361136 Ga0496107_0361136_46_894 275
1334 3300048911 Ga0496108_0331983 Ga0496108_0331983_340_1194 275
1335 3300048913 Ga0496110_0208556 Ga0496110_0208556_768_1622 275
1336 3300048915 Ga0496112_0364095 Ga0496112_0364095_362_1216 275
1337 3300048918 Ga0496115_0001891 Ga0496115_0001891_2715_3557 275
1338 3300048918 Ga0496115_0035224 Ga0496115_0035224_2001_2846 275
1339 3300048919 Ga0496116_0011507 Ga0496116_0011507_4277_5122 275
1340 3300048920 Ga0496117_0030168 Ga0496117_0030168_2487_3374 275
1341 3300048920 Ga0496117_0087500 Ga0496117_0087500_454_1302 275
1342 3300048921 Ga0496118_0010237 Ga0496118_0010237_1442_2311 275
1343 3300048921 Ga0496118_0017638 Ga0496118_0017638_924_1775 275
1344 3300048921 Ga0496118_0060289 Ga0496118_0060289_1323_2210 275
1345 3300048922 Ga0496119_0107169 Ga0496119_0107169_298_1143 275
1346 3300048924 Ga0496121_0002861 Ga0496121_0002861_19878_20765 275
1347 3300048924 Ga0496121_0041642 Ga0496121_0041642_2840_3688 275
1348 3300048924 Ga0496121_0142300 Ga0496121_0142300_284_1129 275
1349 3300048925 Ga0496122_0016538 Ga0496122_0016538_265_1116 275
1350 3300048926 Ga0496123_0081921 Ga0496123_0081921_953_1798 275
1351 3300048927 Ga0496124_0116816 Ga0496124_0116816_439_1284 275
1352 3300048928 Ga0496125_0001951 Ga0496125_0001951_15937_16782 275
1353 3300048928 Ga0496125_0007113 Ga0496125_0007113_4264_5109 275
1354 3300048929 Ga0496126_0077562 Ga0496126_0077562_107_952 275
1355 3300049580 Ga0501046_0225640 Ga0501046_0225640_191_1027 275
1356 3300050491 nmdc:mga00v17_200076_c1 nmdc:mga00v17_200076_c1_307_1152 275
1357 3300050492 nmdc:mga0yw44_373759_c1 nmdc:mga0yw44_373759_c1_18_908 275
1358 3300050492 nmdc:mga0yw44_5143_c1 nmdc:mga0yw44_5143_c1_1178_2023 275
1359 3300050494 nmdc:mga06z11_114010_c1 nmdc:mga06z11_114010_c1_325_1215 275
1360 3300053077 Ga0495601_0040276 Ga0495601_0040276_705_1631 275
1361 3300053087 Ga0500643_033965 Ga0500643_033965_394_1245 275
1362 3300053090 Ga0500646_0040496 Ga0500646_0040496_191_1042 275
1363 3300053093 Ga0500651_0002351 Ga0500651_0002351_5297_6148 275
1364 3300053094 Ga0500566_0000499 Ga0500566_0000499_1913_2761 275
1365 3300053096 Ga0500641_0017967 Ga0500641_0017967_644_1498 275
1366 3300053096 Ga0500641_0025202 Ga0500641_0025202_58_906 275
1367 3300053098 Ga0500650_0000457 Ga0500650_0000457_1840_2688 275
1368 3300053109 Ga0500569_001911 Ga0500569_001911_1241_2086 275
1369 3300053116 Ga0500592_008090 Ga0500592_008090_460_1308 275
1370 3300053118 Ga0500594_0057800 Ga0500594_0057800_73_927 275
1371 3300053119 Ga0500595_002275 Ga0500595_002275_6378_7217 275
1372 3300053119 Ga0500595_018265 Ga0500595_018265_1246_2127 275
1373 3300053122 Ga0500608_001344 Ga0500608_001344_6635_7483 275
1374 3300053130 Ga0500642_0000010 Ga0500642_0000010_150911_151759 275
1375 3300053134 Ga0500658_0078373 Ga0500658_0078373_169_1023 275
1376 3300053136 Ga0500559_0004374 Ga0500559_0004374_3653_4501 275
1377 3300053139 Ga0500568_0002443 Ga0500568_0002443_4727_5662 275
1378 3300053142 Ga0500577_0107746 Ga0500577_0107746_153_1007 275
1379 3300053145 Ga0500586_001821 Ga0500586_001821_1456_2313 275
1380 3300053147 Ga0500589_027273 Ga0500589_027273_447_1301 275
1381 3300053151 Ga0500604_0020105 Ga0500604_0020105_862_1716 275
1382 3300053153 Ga0500616_0000014 Ga0500616_0000014_75172_76017 275
1383 3300053156 Ga0500622_0000266 Ga0500622_0000266_38558_39406 275
1384 3300053156 Ga0500622_0007539 Ga0500622_0007539_3530_4432 275
1385 3300053161 Ga0500634_0111099 Ga0500634_0111099_153_1007 275
1386 3300053178 Ga0500637_0034021 Ga0500637_0034021_366_1214 275
1387 iso_pu_bacteria 2524023228 2524534375 275
1388 iso_pu_bacteria 2831864461 2831867807 275
1389 iso_pu_bacteria 2904699407 2904705668 275
1390 iso_pu_bacteria 8055431914 8055434644 275
1391 iso_pu_bacteria 8057575449 8057579340 275
1392 3300001979 JGI24740J21852_10012680 JGI24740J21852_100126803 276
1393 3300002737 JGI25162J39368_1000353 JGI25162J39368_10003534 276
1394 3300003214 JGI25165J46597_1000390 JGI25165J46597_100039021 276
1395 3300003322 rootL2_10007895 rootL2_100078959 276
1396 3300003578 Ga0006562J51391_1101058 Ga0006562J51391_11010583 276
1397 3300003578 Ga0006562J51391_1101059 Ga0006562J51391_11010592 276
1398 3300003790 Ga0055528_1000044 Ga0055528_100004490 276
1399 3300003791 Ga0055530_10003087 Ga0055530_100030873 276
1400 3300005262 Ga0065165_1000041 Ga0065165_100004153 276
1401 3300005355 Ga0070671_100083820 Ga0070671_1000838202 276
1402 3300006186 Ga0075369_10021344 Ga0075369_100213442 276
1403 3300006186 Ga0075369_10049490 Ga0075369_100494902 276
1404 3300006941 Ga0099825_1037378 Ga0099825_10373782 276
1405 3300006942 Ga0099824_1004900 Ga0099824_100490010 276
1406 3300006943 Ga0099822_1000677 Ga0099822_100067722 276
1407 3300009093 Ga0105240_10506060 Ga0105240_105060602 276
1408 3300009177 Ga0105248_10113603 Ga0105248_101136033 276
1409 3300009545 Ga0105237_10306545 Ga0105237_103065452 276
1410 3300009551 Ga0105238_10005661 Ga0105238_100056616 276
1411 3300009551 Ga0105238_10274011 Ga0105238_102740112 276
1412 3300010375 Ga0105239_10305988 Ga0105239_103059882 276
1413 3300013307 Ga0157372_10336585 Ga0157372_103365852 276
1414 3300014325 Ga0163163_10395967 Ga0163163_103959671 276
1415 3300014968 Ga0157379_10033678 Ga0157379_100336782 276
1416 3300025233 Ga0209437_100050 Ga0209437_10005064 276
1417 3300025261 Ga0209233_1000037 Ga0209233_1000037106 276
1418 3300025272 Ga0209455_1025050 Ga0209455_10250501 276
1419 3300025273 Ga0209673_1000013 Ga0209673_100001321 276
1420 3300025295 Ga0209564_1000167 Ga0209564_100016779 276
1421 3300025297 Ga0209758_1000908 Ga0209758_100090828 276
1422 3300025298 Ga0209050_1000034 Ga0209050_1000034259 276
1423 3300025299 Ga0209256_1001227 Ga0209256_100122720 276
1424 3300025304 Ga0209257_1000052 Ga0209257_1000052151 276
1425 3300025304 Ga0209257_1000100 Ga0209257_100010016 276
1426 3300025913 Ga0207695_10468866 Ga0207695_104688662 276
1427 3300025914 Ga0207671_10068898 Ga0207671_100688982 276
1428 3300025914 Ga0207671_10085199 Ga0207671_100851991 276
1429 3300027312 Ga0209371_1003791 Ga0209371_10037913 276
1430 3300027357 Ga0209589_1000006 Ga0209589_1000006273 276
1431 3300027361 Ga0209489_100007 Ga0209489_100007273 276
1432 3300027363 Ga0209700_100008 Ga0209700_100008273 276
1433 3300028379 Ga0268266_10004137 Ga0268266_1000413710 276
1434 3300028800 Ga0265338_10267575 Ga0265338_102675752 276
1435 3300030500 Ga0268256_1003015 Ga0268256_10030157 276
1436 3300031249 Ga0265339_10040735 Ga0265339_100407353 276
1437 3300031251 Ga0265327_10000039 Ga0265327_10000039109 276
1438 3300031712 Ga0265342_10012050 Ga0265342_100120502 276
1439 3300031730 Ga0307516_10066047 Ga0307516_100660473 276
1440 3300033442 Ga0315911_1000010 Ga0315911_1000010268 276
1441 3300037418 Ga0395900_0022337 Ga0395900_0022337_4662_5561 276
1442 3300037466 Ga0395898_0109634 Ga0395898_0109634_738_1637 276
1443 3300039438 Ga0436360_0659817 Ga0436360_0659817_217_1065 276
1444 3300041413 Ga0439465_0000436 Ga0439465_0000436_11222_12058 276
1445 3300044684 Ga0466966_0126202 Ga0466966_0126202_377_1210 276
1446 3300044719 Ga0466971_0128557 Ga0466971_0128557_242_1075 276
1447 3300044765 Ga0466970_0000808 Ga0466970_0000808_8416_9249 276
1448 3300045049 Ga0466959_0205153 Ga0466959_0205153_178_1011 276
1449 3300046528 Ga0495642_0080362 Ga0495642_0080362_220_1062 276
1450 3300046678 Ga0495599_0286625 Ga0495599_0286625_88_927 276
1451 3300047445 Ga0495677_0060799 Ga0495677_0060799_414_1256 276
1452 3300048909 Ga0496106_0005325 Ga0496106_0005325_3538_4377 276
1453 3300048915 Ga0496112_0310368 Ga0496112_0310368_16_858 276
1454 3300048920 Ga0496117_0017228 Ga0496117_0017228_1333_2172 276
1455 3300048920 Ga0496117_0035813 Ga0496117_0035813_2067_2900 276
1456 3300048921 Ga0496118_0005800 Ga0496118_0005800_10289_11119 276
1457 3300048921 Ga0496118_0005874 Ga0496118_0005874_2062_2901 276
1458 3300048922 Ga0496119_0014656 Ga0496119_0014656_745_1578 276
1459 3300048923 Ga0496120_0043278 Ga0496120_0043278_1605_2438 276
1460 3300048924 Ga0496121_0000667 Ga0496121_0000667_24336_25175 276
1461 3300048925 Ga0496122_0013339 Ga0496122_0013339_2463_3296 276
1462 3300048926 Ga0496123_0083530 Ga0496123_0083530_293_1126 276
1463 3300048927 Ga0496124_0040044 Ga0496124_0040044_2951_3784 276
1464 3300048929 Ga0496126_0006811 Ga0496126_0006811_6208_7047 276
1465 3300048929 Ga0496126_0053580 Ga0496126_0053580_2369_3226 276
1466 3300049570 Ga0501033_0025341 Ga0501033_0025341_1588_2436 276
1467 3300049571 Ga0501034_0121216 Ga0501034_0121216_443_1291 276
1468 3300049572 Ga0501036_0222596 Ga0501036_0222596_294_1142 276
1469 3300049573 Ga0501037_0248019 Ga0501037_0248019_109_957 276
1470 3300049576 Ga0501040_0076211 Ga0501040_0076211_541_1389 276
1471 3300049581 Ga0501047_0066312 Ga0501047_0066312_862_1710 276
1472 3300049582 Ga0501048_0142240 Ga0501048_0142240_509_1357 276
1473 3300049590 Ga0501074_0113977 Ga0501074_0113977_230_1078 276
1474 3300049741 Ga0501079_0213929 Ga0501079_0213929_110_958 276
1475 3300049822 Ga0501035_0016883 Ga0501035_0016883_1593_2441 276
1476 3300049823 Ga0501044_0046990 Ga0501044_0046990_2031_2879 276
1477 3300049824 Ga0501045_0013913 Ga0501045_0013913_2580_3428 276
1478 3300050516 nmdc:mga0sz30_11749_c1 nmdc:mga0sz30_11749_c1_335_1198 276
1479 3300053136 Ga0500559_0007675 Ga0500559_0007675_3649_4488 276
1480 3300053139 Ga0500568_0010135 Ga0500568_0010135_3030_3884 276
1481 3300053140 Ga0500573_0012261 Ga0500573_0012261_855_1694 276
1482 3300053146 Ga0500588_0007669 Ga0500588_0007669_988_1824 276
1483 3300053153 Ga0500616_0000635 Ga0500616_0000635_32584_33438 276
1484 3300053163 Ga0500639_037476 Ga0500639_037476_1427_2266 276
1485 3300053177 Ga0500636_0039252 Ga0500636_0039252_1476_2315 276
1486 3300053735 Ga0500596_000940 Ga0500596_000940_1760_2599 276
1487 3300054114 Ga0501084_0401174 Ga0501084_0401174_161_1009 276
1488 iso_pu_bacteria 2884411467 2884414197 276
1489 iso_pu_bacteria 8019555841 8019559428 276
1490 3300001979 JGI24740J21852_10000570 JGI24740J21852_100005709 277
1491 3300003214 JGI25165J46597_1001069 JGI25165J46597_100106915 277
1492 3300003756 Ga0055533_1002720 Ga0055533_10027205 277
1493 3300005355 Ga0070671_100063246 Ga0070671_1000632461 277
1494 3300005435 Ga0070714_100026154 Ga0070714_1000261542 277
1495 3300005436 Ga0070713_100048994 Ga0070713_1000489942 277
1496 3300005456 Ga0070678_100028137 Ga0070678_1000281372 277
1497 3300005539 Ga0068853_100010248 Ga0068853_1000102482 277
1498 3300005563 Ga0068855_100021449 Ga0068855_1000214493 277
1499 3300005564 Ga0070664_100091297 Ga0070664_1000912972 277
1500 3300005577 Ga0068857_100017788 Ga0068857_1000177884 277
1501 3300005578 Ga0068854_100013343 Ga0068854_1000133432 277
1502 3300005614 Ga0068856_100002838 Ga0068856_1000028386 277
1503 3300005616 Ga0068852_100023118 Ga0068852_1000231184 277
1504 3300005617 Ga0068859_100614424 Ga0068859_1006144242 277
1505 3300005618 Ga0068864_100061876 Ga0068864_1000618762 277
1506 3300005834 Ga0068851_10000402 Ga0068851_100004027 277
1507 3300005841 Ga0068863_100093973 Ga0068863_1000939732 277
1508 3300005843 Ga0068860_100250103 Ga0068860_1002501031 277
1509 3300006028 Ga0070717_10038335 Ga0070717_100383353 277
1510 3300006931 Ga0097620_100614444 Ga0097620_1006144442 277
1511 3300009093 Ga0105240_10000301 Ga0105240_1000030185 277
1512 3300009093 Ga0105240_10004430 Ga0105240_1000443010 277
1513 3300009093 Ga0105240_10076156 Ga0105240_100761563 277
1514 3300009174 Ga0105241_10001668 Ga0105241_100016683 277
1515 3300009176 Ga0105242_10087007 Ga0105242_100870072 277
1516 3300009545 Ga0105237_10023955 Ga0105237_100239554 277
1517 3300009551 Ga0105238_10009609 Ga0105238_100096097 277
1518 3300010375 Ga0105239_10000769 Ga0105239_1000076938 277
1519 3300010375 Ga0105239_10015010 Ga0105239_100150107 277
1520 3300010375 Ga0105239_10213229 Ga0105239_102132293 277
1521 3300021384 Ga0213876_10144265 Ga0213876_101442651 277
1522 3300025226 Ga0209674_100048 Ga0209674_100048247 277
1523 3300025233 Ga0209437_100205 Ga0209437_10020568 277
1524 3300025256 Ga0209759_1000032 Ga0209759_100003294 277
1525 3300025261 Ga0209233_1000187 Ga0209233_100018788 277
1526 3300025321 Ga0207656_10005096 Ga0207656_100050963 277
1527 3300025903 Ga0207680_10093612 Ga0207680_100936123 277
1528 3300025911 Ga0207654_10000058 Ga0207654_1000005818 277
1529 3300025913 Ga0207695_10000399 Ga0207695_1000039984 277
1530 3300025913 Ga0207695_10000453 Ga0207695_100004534 277
1531 3300025913 Ga0207695_10117754 Ga0207695_101177543 277
1532 3300025914 Ga0207671_10003232 Ga0207671_1000323210 277
1533 3300025924 Ga0207694_10000564 Ga0207694_1000056415 277
1534 3300025929 Ga0207664_10008230 Ga0207664_100082303 277
1535 3300025931 Ga0207644_10031439 Ga0207644_100314394 277
1536 3300025933 Ga0207706_10035523 Ga0207706_100355232 277
1537 3300025934 Ga0207686_10051132 Ga0207686_100511322 277
1538 3300025945 Ga0207679_10086271 Ga0207679_100862712 277
1539 3300025949 Ga0207667_10009339 Ga0207667_100093398 277
1540 3300026023 Ga0207677_10050505 Ga0207677_100505052 277
1541 3300026041 Ga0207639_10001424 Ga0207639_1000142411 277
1542 3300026078 Ga0207702_10000004 Ga0207702_10000004201 277
1543 3300026088 Ga0207641_10087690 Ga0207641_100876902 277
1544 3300026095 Ga0207676_10000732 Ga0207676_100007322 277
1545 3300026116 Ga0207674_10005590 Ga0207674_100055904 277
1546 3300028381 Ga0268264_10180693 Ga0268264_101806932 277
1547 3300035113 Ga0373936_0013440 Ga0373936_0013440_467_1315 277
1548 3300039437 Ga0436365_1846448 Ga0436365_1846448_156_1025 277
1549 3300048905 Ga0496102_0012820 Ga0496102_0012820_2243_3145 277
1550 3300048908 Ga0496105_0183879 Ga0496105_0183879_695_1597 277
1551 3300048909 Ga0496106_0145724 Ga0496106_0145724_486_1388 277
1552 3300048912 Ga0496109_0001563 Ga0496109_0001563_13652_14554 277
1553 3300048915 Ga0496112_0041328 Ga0496112_0041328_1997_2899 277
1554 3300048915 Ga0496112_0187915 Ga0496112_0187915_714_1571 277
1555 3300048921 Ga0496118_0129515 Ga0496118_0129515_26_859 277
1556 3300048924 Ga0496121_0004961 Ga0496121_0004961_2999_3832 277
1557 3300048929 Ga0496126_0013337 Ga0496126_0013337_1901_2734 277
1558 3300053125 Ga0500618_012652 Ga0500618_012652_188_1054 277

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17765

MLTR_LBD

MmyB-like transcription regulator ligand binding domain

111

276

0.98

PF13560

HTH_31

Helix-turn-helix domain

14

92

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ltz-assembly1.cif.gz_A induced dna bending by unique dimerization of higa antitoxin 0.8331 39 80
1y7y-assembly1.cif.gz_B high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.8258 8 85
1y7y-assembly1.cif.gz_A high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.821 3 85
3zkc-assembly1.cif.gz_B crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.8178 11 81
7ewe-assembly3.cif.gz_E mycobacterium tuberculosis higa2 (form iii) 0.8084 39 79
ID Description Score Start End Superfamily
1y7yB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8258 8 85 1.10.260.40
1y7yA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.821 3 85 1.10.260.40
1adrA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8197 11 89 1.10.260.40
3zkcB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8178 11 81 1.10.260.40
2ofyB01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8038 1 85 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A3A3H3R9-F1-model_v4 XRE family transcriptional regulator 0.9768 9 276 GO:0003677
AF-A0A6P1ZK00-F1-model_v4 Transcriptional regulator 0.9603 1 275 GO:0003677
AF-A0A807LGQ6-F1-model_v4 Transcriptional regulator 0.9591 6 277 GO:0003677
AF-A0A353U7Q5-F1-model_v4 deleted 0.9543 65 276
AF-A0A2W4REA5-F1-model_v4 Transcriptional regulator 0.954 5 91 GO:0003677

Feature Viewer

pLDDT pTM Quality
89.33 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map