F494751
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1558 | 812 | 1234 | 280 |
Family's Representative Sequence
| Representative Sequence | 3300035083|Ga0373926_0042224|Ga0373926_0042224_306_1292 |
| Length | 328 |
| Sequence | MVNRTDERVTPENRLGTYLKDRRTKLDPAALGFPAQRRRTPGLRREEVAQRANISATWYTWLEQGRGGAPSADVLERIARALMLTDVEREHLFLLGLGRPPDVRYQTSEGVTPRLQRVLDALEFSPAVVSTVTWDIVAWNRAAAAVLTDYSALAPEQRNVLRLIFCDPRVRAAQLDWEAVARFVVGAFRADAARAGAAAEVAALVDELCRLSPEFEAMWRDNDVRGYGGGVKHLRHPIAGPIAFEYSAFAVDGRPDLRMVVYNPATVADAERIRSLIKLPTRKTVGLTVAAPTTAGQVARLGSARPDKSRPNRKGFSSASAKRARAHR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 2 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 3 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 4 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 7 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 8 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 9 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 10 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 11 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 12 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 13 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 14 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 15 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 16 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 17 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 18 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 19 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 20 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 21 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 22 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 23 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 24 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 25 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 26 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 27 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 28 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 29 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 30 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 31 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 32 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 33 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 34 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 35 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 36 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 37 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 38 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 39 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 40 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 41 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 42 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 43 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 44 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 45 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 46 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 47 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 48 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 49 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 50 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 51 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 52 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 53 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 54 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 55 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 56 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 57 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 58 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 59 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 60 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 61 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 62 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 63 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 64 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 65 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 66 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 67 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 68 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 69 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 70 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 71 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 72 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 73 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 74 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 75 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 76 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 77 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 78 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 79 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 80 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 81 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 82 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 83 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 84 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 85 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 86 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 87 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 88 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 89 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 90 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 91 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 92 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 93 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 94 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 95 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 96 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 97 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 98 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 99 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 100 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 101 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 102 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 103 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 104 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 105 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 106 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 107 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 108 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 109 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 110 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 111 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 112 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 113 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 114 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 115 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 116 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 117 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 118 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 119 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 120 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 121 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 122 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 123 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 124 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 125 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 126 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 127 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 128 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 129 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 130 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 131 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 132 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 133 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 134 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 135 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 136 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 137 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 138 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 139 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 140 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 141 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 142 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 143 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 144 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 145 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 146 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 147 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 148 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 149 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 150 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 151 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 152 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 153 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 154 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 155 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 156 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 157 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 158 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 159 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 160 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 161 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 162 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 163 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 164 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 165 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 166 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 167 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 168 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 169 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 170 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 171 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 172 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 173 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 174 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 175 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 176 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 177 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 178 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 179 | 2904699407 | |||
| 180 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 181 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 182 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 183 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 184 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 185 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 186 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 187 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 188 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 189 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 190 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 191 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 192 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 193 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 194 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 195 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 196 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 197 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 198 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 199 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 200 | 2922368715 | |||
| 201 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 202 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 203 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 204 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 205 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 206 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 207 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 208 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 209 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 210 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 211 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 212 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 213 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 214 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 215 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 216 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 217 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 218 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 219 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 220 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 221 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 222 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 223 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 224 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 225 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 226 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 227 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 228 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 229 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 230 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 231 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 232 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 233 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 234 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 235 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 236 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 237 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 238 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 239 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 240 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 241 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 242 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 243 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 244 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 245 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 246 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 247 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 248 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 249 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 250 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 251 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 252 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 253 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 254 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 255 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 256 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 257 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 258 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 259 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 260 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 261 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 262 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 263 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 264 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 265 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 266 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 267 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 268 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 269 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 270 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 271 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 272 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 273 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 274 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 275 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 276 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 277 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 278 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 279 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 280 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 281 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 282 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 283 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 284 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 285 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 286 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 287 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 288 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 289 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 290 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 291 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 292 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 293 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 294 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 295 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 296 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 297 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 298 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 299 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 300 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 301 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 302 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 303 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 304 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 305 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 306 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 307 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 308 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 309 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 310 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 311 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 312 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 313 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 314 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 315 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 316 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 317 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 318 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 319 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 320 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 321 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 322 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 323 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 324 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 325 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 326 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 327 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 328 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 329 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 330 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 331 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 332 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 333 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 334 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 335 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 336 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 337 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 338 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 339 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 340 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 341 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 342 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 343 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 344 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 345 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 346 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 347 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 348 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 349 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 350 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 351 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 352 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 353 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 354 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 355 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 356 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 357 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 358 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 359 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 360 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 361 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 362 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 363 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 364 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 365 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 366 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 367 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 368 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 369 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 370 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 371 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 372 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 373 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 374 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 375 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 376 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 377 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 379 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 380 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 381 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 382 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 383 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 385 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 386 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 387 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 388 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 389 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 390 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 391 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 392 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 393 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 394 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 396 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 397 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 399 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 400 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 401 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 402 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 403 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 404 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 405 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 406 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 407 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 408 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 409 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 410 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 411 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 412 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 413 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 414 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 415 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 416 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 417 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 418 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 419 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 420 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 421 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 422 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 423 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 424 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 425 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 426 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 427 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 428 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 429 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 430 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 431 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 432 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 433 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 434 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 435 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 436 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 437 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 438 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 439 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 440 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 441 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 442 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 443 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 444 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 445 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 446 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 447 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 448 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 449 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 450 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 451 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 452 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 453 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 454 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 455 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 456 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 457 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 458 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 459 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 460 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 461 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 462 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 463 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 464 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 466 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 467 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 468 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 469 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 471 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 472 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 474 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 475 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 476 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 477 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 478 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 479 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 480 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 481 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 482 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 483 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 484 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 485 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 486 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 487 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 488 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 489 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 490 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 491 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 492 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 493 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 494 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 495 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 496 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 497 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 498 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 499 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 500 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 501 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 502 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 503 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 504 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 505 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 506 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 507 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 508 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 509 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 510 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 511 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 512 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 513 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 514 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 515 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 516 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 517 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 518 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 519 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 520 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 521 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 522 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 523 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 524 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 525 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 526 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 527 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 528 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 529 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 530 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 531 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 532 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 533 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 534 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 535 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 536 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 537 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 538 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 539 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 540 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 541 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 542 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 543 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 544 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 545 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 546 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 547 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 548 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 549 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 550 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 551 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 552 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 553 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 554 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 555 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 556 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 557 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 558 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 559 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 560 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 561 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 562 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 563 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 564 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 565 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 566 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 567 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 568 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 569 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 570 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 571 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 572 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 573 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 574 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 575 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 576 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 577 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 578 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 579 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 580 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 581 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 582 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 583 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 584 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 585 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 586 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 587 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 588 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 589 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 590 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 591 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 592 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 653 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 654 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 655 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 656 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 657 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 658 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 659 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 660 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 661 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 662 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 663 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 664 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 665 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 666 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 667 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 668 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 669 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 670 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 671 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 672 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 673 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 674 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 675 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 676 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 677 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 678 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 679 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 680 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 681 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 682 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 683 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 684 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 685 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 686 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 687 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 688 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 689 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 690 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 691 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 692 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 693 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 694 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 695 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 696 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 697 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 698 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 699 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 700 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 701 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 702 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 703 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 704 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 705 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 706 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 707 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 708 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 709 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 710 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 711 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 712 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 713 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 714 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 715 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 716 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 717 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 718 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 719 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 720 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 721 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 722 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 723 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 724 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 725 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 726 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 727 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 728 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 729 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 730 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 731 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 732 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 733 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 734 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 735 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 736 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 737 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 738 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 739 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 740 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 741 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 742 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 743 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 744 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 745 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 746 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 747 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 748 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 749 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 750 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 751 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 752 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 753 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 754 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 755 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 756 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 757 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 758 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 759 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 760 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 761 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 762 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 763 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 764 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 765 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 766 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 767 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 768 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 769 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 770 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 771 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 772 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 773 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 774 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 775 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 776 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 777 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 778 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 779 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 780 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 781 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 782 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 783 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 784 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 785 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 786 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 787 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 788 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 789 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 790 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 791 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 792 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 793 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 794 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 795 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 796 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 797 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 798 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 799 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 800 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 801 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 802 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 803 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 804 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 805 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 806 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 807 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 808 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 809 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 810 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 811 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 812 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.18 |
| Metatranscriptomes | 0.13 |
| Isolates | 20.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.13 |
| Bulb | 0 |
| Endosphere | 19.77 |
| Nodule | 11.81 |
| Rhizoplane | 6.1 |
| Rhizosphere | 48.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000570 | 3300001979 | Bacteria | 15869 |
| 2 | JGI24740J21852_10012680 | 3300001979 | Bacteria | 3170 |
| 3 | JGI24739J22299_10062697 | 3300001989 | Bacteria | 1172 |
| 4 | JGI24737J22298_10005281 | 3300001990 | Bacteria | 4466 |
| 5 | JGI24737J22298_10013841 | 3300001990 | Bacteria | 2624 |
| 6 | JGI24735J21928_10002093 | 3300002067 | Bacteria | 7026 |
| 7 | JGI24735J21928_10036537 | 3300002067 | Bacteria | 1441 |
| 8 | JGI24744J21845_10002209 | 3300002077 | Bacteria | 3956 |
| 9 | JGI25162J39368_1000353 | 3300002737 | Bacteria | 39445 |
| 10 | JGI25158J39367_1007151 | 3300002739 | Bacteria | 1580 |
| 11 | JGI25157J39369_1011312 | 3300002741 | Bacteria | 1157 |
| 12 | JGI25152J39213_1001392 | 3300002773 | Bacteria | 10475 |
| 13 | JGI25152J39213_1002012 | 3300002773 | Bacteria | 8016 |
| 14 | JGI25152J39213_1003675 | 3300002773 | Bacteria | 5156 |
| 15 | JGI25152J39213_1010330 | 3300002773 | Bacteria | 2145 |
| 16 | JGI25152J39213_1016124 | 3300002773 | Bacteria | 1451 |
| 17 | JGI25159J45721_1000905 | 3300002987 | Bacteria | 12899 |
| 18 | JGI25159J45721_1012472 | 3300002987 | Bacteria | 2025 |
| 19 | JGI25151J46595_10004403 | 3300003187 | Bacteria | 7460 |
| 20 | JGI25151J46595_10009539 | 3300003187 | Bacteria | 4583 |
| 21 | JGI25165J46597_1000046 | 3300003214 | Bacteria | 255996 |
| 22 | JGI25165J46597_1000390 | 3300003214 | Bacteria | 46779 |
| 23 | JGI25165J46597_1001069 | 3300003214 | Bacteria | 17583 |
| 24 | JGI25165J46597_1007037 | 3300003214 | Bacteria | 1917 |
| 25 | JGI25153J46596_10002531 | 3300003215 | Bacteria | 10475 |
| 26 | JGI25153J46596_10003111 | 3300003215 | Bacteria | 9359 |
| 27 | JGI25153J46596_10006842 | 3300003215 | Bacteria | 5698 |
| 28 | JGI25153J46596_10006854 | 3300003215 | Bacteria | 5693 |
| 29 | JGI25153J46596_10013191 | 3300003215 | Bacteria | 3511 |
| 30 | JGI25153J46596_10027768 | 3300003215 | Bacteria | 1976 |
| 31 | rootL2_10007895 | 3300003322 | Bacteria | 11929 |
| 32 | JGI25160J50197_1000040 | 3300003354 | Bacteria | 154507 |
| 33 | JGI25160J50197_1002284 | 3300003354 | Bacteria | 8980 |
| 34 | JGI25160J50197_1002762 | 3300003354 | Bacteria | 8047 |
| 35 | JGI25161J50226_1000023 | 3300003374 | Bacteria | 154507 |
| 36 | JGI25161J50226_1000107 | 3300003374 | Bacteria | 65408 |
| 37 | Ga0006562J51391_1101058 | 3300003578 | Bacteria | 2470 |
| 38 | Ga0006562J51391_1101059 | 3300003578 | Bacteria | 1200 |
| 39 | Ga0055539_1003008 | 3300003752 | Bacteria | 2430 |
| 40 | Ga0055533_1002720 | 3300003756 | Bacteria | 3888 |
| 41 | Ga0055535_1001904 | 3300003761 | Bacteria | 8784 |
| 42 | Ga0055542_1000401 | 3300003762 | Bacteria | 42708 |
| 43 | Ga0055542_1001119 | 3300003762 | Bacteria | 15952 |
| 44 | Ga0055529_1000247 | 3300003763 | Bacteria | 66795 |
| 45 | Ga0055529_1010335 | 3300003763 | Bacteria | 1214 |
| 46 | Ga0055526_1007264 | 3300003771 | Bacteria | 5805 |
| 47 | Ga0055526_1024832 | 3300003771 | Bacteria | 1944 |
| 48 | Ga0055537_1001993 | 3300003773 | Bacteria | 7282 |
| 49 | Ga0055524_1002658 | 3300003775 | Bacteria | 9066 |
| 50 | Ga0055524_1022643 | 3300003775 | Bacteria | 2046 |
| 51 | Ga0055524_1035328 | 3300003775 | Bacteria | 1364 |
| 52 | Ga0055536_1001559 | 3300003781 | Bacteria | 13742 |
| 53 | Ga0055528_1000035 | 3300003790 | Bacteria | 117498 |
| 54 | Ga0055528_1000044 | 3300003790 | Bacteria | 102325 |
| 55 | Ga0055528_1000275 | 3300003790 | Bacteria | 43696 |
| 56 | Ga0055528_1008010 | 3300003790 | Bacteria | 4591 |
| 57 | Ga0055528_1008628 | 3300003790 | Bacteria | 4338 |
| 58 | Ga0055530_10003087 | 3300003791 | Bacteria | 9896 |
| 59 | Ga0055540_1012566 | 3300003792 | Bacteria | 2648 |
| 60 | Ga0055531_10002792 | 3300003794 | Bacteria | 11453 |
| 61 | Ga0055531_10005497 | 3300003794 | Bacteria | 7408 |
| 62 | Ga0058692_1017822 | 3300003856 | Bacteria | 1549 |
| 63 | Ga0058692_1017924 | 3300003856 | Bacteria | 1542 |
| 64 | Ga0055543_1000074 | 3300004625 | Bacteria | 88424 |
| 65 | Ga0055543_1000475 | 3300004625 | Bacteria | 23556 |
| 66 | Ga0065165_1000041 | 3300005262 | Bacteria | 203876 |
| 67 | Ga0065165_1000484 | 3300005262 | Bacteria | 61542 |
| 68 | Ga0065165_1000498 | 3300005262 | Bacteria | 60773 |
| 69 | Ga0065165_1000844 | 3300005262 | Bacteria | 40173 |
| 70 | Ga0065165_1000979 | 3300005262 | Bacteria | 35374 |
| 71 | Ga0070658_10014112 | 3300005327 | Bacteria | 6414 |
| 72 | Ga0070658_10110684 | 3300005327 | Bacteria | 2275 |
| 73 | Ga0070658_10117893 | 3300005327 | Bacteria | 2204 |
| 74 | Ga0070676_10057774 | 3300005328 | Bacteria | 2297 |
| 75 | Ga0070690_100222032 | 3300005330 | Bacteria | 1324 |
| 76 | Ga0070670_100000479 | 3300005331 | Bacteria | 32154 |
| 77 | Ga0068869_100156270 | 3300005334 | Bacteria | 1772 |
| 78 | Ga0070666_10005024 | 3300005335 | Bacteria | 8089 |
| 79 | Ga0070666_10393887 | 3300005335 | Bacteria | 995 |
| 80 | Ga0070680_100015594 | 3300005336 | Bacteria | 5963 |
| 81 | Ga0068868_100573556 | 3300005338 | Bacteria | 997 |
| 82 | Ga0070660_100000315 | 3300005339 | Bacteria | 32211 |
| 83 | Ga0070660_100032530 | 3300005339 | Bacteria | 3926 |
| 84 | Ga0070660_100455926 | 3300005339 | Bacteria | 1061 |
| 85 | Ga0070689_100432490 | 3300005340 | Bacteria | 1117 |
| 86 | Ga0070691_10095922 | 3300005341 | Bacteria | 1468 |
| 87 | Ga0070661_100219031 | 3300005344 | Bacteria | 1459 |
| 88 | Ga0070668_100015545 | 3300005347 | Bacteria | 5690 |
| 89 | Ga0070668_100115768 | 3300005347 | Bacteria | 2137 |
| 90 | Ga0070668_100437194 | 3300005347 | Bacteria | 1122 |
| 91 | Ga0070669_100127687 | 3300005353 | Bacteria | 1947 |
| 92 | Ga0070669_100205599 | 3300005353 | Bacteria | 1551 |
| 93 | Ga0070675_100018974 | 3300005354 | Bacteria | 5479 |
| 94 | Ga0070671_100063246 | 3300005355 | Bacteria | 3081 |
| 95 | Ga0070671_100083820 | 3300005355 | Bacteria | 2666 |
| 96 | Ga0070671_100180736 | 3300005355 | Bacteria | 1786 |
| 97 | Ga0070671_100275443 | 3300005355 | Bacteria | 1430 |
| 98 | Ga0070659_100000858 | 3300005366 | Bacteria | 22204 |
| 99 | Ga0070659_100022742 | 3300005366 | Bacteria | 4789 |
| 100 | Ga0070659_100072498 | 3300005366 | Bacteria | 2741 |
| 101 | Ga0070659_100164653 | 3300005366 | Bacteria | 1814 |
| 102 | Ga0070667_100000399 | 3300005367 | Bacteria | 46943 |
| 103 | Ga0070714_100026154 | 3300005435 | Bacteria | 4821 |
| 104 | Ga0070713_100048994 | 3300005436 | Bacteria | 3483 |
| 105 | Ga0070713_100111382 | 3300005436 | Bacteria | 2387 |
| 106 | Ga0070713_100140491 | 3300005436 | Bacteria | 2139 |
| 107 | Ga0070713_100382496 | 3300005436 | Bacteria | 1311 |
| 108 | Ga0070694_100177183 | 3300005444 | Bacteria | 1574 |
| 109 | Ga0070694_100264525 | 3300005444 | Bacteria | 1306 |
| 110 | Ga0070708_100119305 | 3300005445 | Bacteria | 2431 |
| 111 | Ga0070708_100129949 | 3300005445 | Bacteria | 2330 |
| 112 | Ga0070663_100000256 | 3300005455 | Bacteria | 26565 |
| 113 | Ga0070663_100009112 | 3300005455 | Bacteria | 6135 |
| 114 | Ga0070663_100021715 | 3300005455 | Bacteria | 4275 |
| 115 | Ga0070663_100077640 | 3300005455 | Bacteria | 2432 |
| 116 | Ga0070663_100103027 | 3300005455 | Bacteria | 2132 |
| 117 | Ga0070663_100319099 | 3300005455 | Bacteria | 1249 |
| 118 | Ga0070678_100011183 | 3300005456 | Bacteria | 5525 |
| 119 | Ga0070678_100028137 | 3300005456 | Bacteria | 3828 |
| 120 | Ga0070662_100072927 | 3300005457 | Bacteria | 2536 |
| 121 | Ga0070681_10156768 | 3300005458 | Bacteria | 2201 |
| 122 | Ga0070706_100051569 | 3300005467 | Bacteria | 3797 |
| 123 | Ga0070706_100124398 | 3300005467 | Bacteria | 2404 |
| 124 | Ga0070706_100183019 | 3300005467 | Bacteria | 1957 |
| 125 | Ga0070698_100030563 | 3300005471 | Bacteria | 5584 |
| 126 | Ga0070698_100276563 | 3300005471 | Bacteria | 1611 |
| 127 | Ga0070699_100299920 | 3300005518 | Bacteria | 1441 |
| 128 | Ga0070699_100435538 | 3300005518 | Bacteria | 1188 |
| 129 | Ga0070679_100174001 | 3300005530 | Bacteria | 2125 |
| 130 | Ga0070684_100340743 | 3300005535 | Bacteria | 1378 |
| 131 | Ga0070697_100429408 | 3300005536 | Bacteria | 1149 |
| 132 | Ga0068853_100010248 | 3300005539 | Bacteria | 7580 |
| 133 | Ga0068853_100054058 | 3300005539 | Bacteria | 3460 |
| 134 | Ga0068853_100065900 | 3300005539 | Bacteria | 3143 |
| 135 | Ga0068853_100093034 | 3300005539 | Bacteria | 2653 |
| 136 | Ga0068853_100115707 | 3300005539 | Bacteria | 2387 |
| 137 | Ga0068853_100208524 | 3300005539 | Bacteria | 1780 |
| 138 | Ga0068853_100642328 | 3300005539 | Bacteria | 1010 |
| 139 | Ga0070695_100136944 | 3300005545 | Bacteria | 1693 |
| 140 | Ga0070696_100038682 | 3300005546 | Bacteria | 3293 |
| 141 | Ga0070696_100148712 | 3300005546 | Bacteria | 1717 |
| 142 | Ga0070696_100270512 | 3300005546 | Bacteria | 1292 |
| 143 | Ga0070693_100065767 | 3300005547 | Bacteria | 2120 |
| 144 | Ga0070693_100291419 | 3300005547 | Bacteria | 1097 |
| 145 | Ga0070665_100005024 | 3300005548 | Bacteria | 13724 |
| 146 | Ga0070665_100030501 | 3300005548 | Bacteria | 5424 |
| 147 | Ga0070665_100033014 | 3300005548 | Bacteria | 5208 |
| 148 | Ga0070665_100037434 | 3300005548 | Bacteria | 4879 |
| 149 | Ga0070665_100084166 | 3300005548 | Bacteria | 3186 |
| 150 | Ga0070665_100109511 | 3300005548 | Bacteria | 2764 |
| 151 | Ga0070665_100127393 | 3300005548 | Bacteria | 2548 |
| 152 | Ga0070665_100180272 | 3300005548 | Bacteria | 2113 |
| 153 | Ga0070704_100204943 | 3300005549 | Bacteria | 1595 |
| 154 | Ga0068855_100021449 | 3300005563 | Bacteria | 7746 |
| 155 | Ga0068855_100029955 | 3300005563 | Bacteria | 6508 |
| 156 | Ga0068855_100050530 | 3300005563 | Bacteria | 4899 |
| 157 | Ga0068855_100050993 | 3300005563 | Bacteria | 4875 |
| 158 | Ga0068855_100089020 | 3300005563 | Bacteria | 3565 |
| 159 | Ga0068855_100131256 | 3300005563 | Bacteria | 2861 |
| 160 | Ga0068855_100413514 | 3300005563 | Bacteria | 1476 |
| 161 | Ga0070664_100091297 | 3300005564 | Bacteria | 2636 |
| 162 | Ga0070664_100149901 | 3300005564 | Bacteria | 2058 |
| 163 | Ga0070664_100174906 | 3300005564 | Bacteria | 1906 |
| 164 | Ga0070664_100286306 | 3300005564 | Bacteria | 1487 |
| 165 | Ga0068857_100017788 | 3300005577 | Bacteria | 6232 |
| 166 | Ga0068857_100142342 | 3300005577 | Bacteria | 2168 |
| 167 | Ga0068854_100013343 | 3300005578 | Bacteria | 5390 |
| 168 | Ga0068854_100013817 | 3300005578 | Bacteria | 5310 |
| 169 | Ga0068854_100101703 | 3300005578 | Bacteria | 2155 |
| 170 | Ga0068856_100000020 | 3300005614 | Bacteria | 146775 |
| 171 | Ga0068856_100002838 | 3300005614 | Bacteria | 17741 |
| 172 | Ga0068856_100134835 | 3300005614 | Bacteria | 2474 |
| 173 | Ga0068856_100216000 | 3300005614 | Bacteria | 1933 |
| 174 | Ga0068856_100296184 | 3300005614 | Bacteria | 1635 |
| 175 | Ga0068856_100532570 | 3300005614 | Bacteria | 1196 |
| 176 | Ga0068852_100001260 | 3300005616 | Bacteria | 16879 |
| 177 | Ga0068852_100023118 | 3300005616 | Bacteria | 4997 |
| 178 | Ga0068852_100059793 | 3300005616 | Bacteria | 3306 |
| 179 | Ga0068852_100225697 | 3300005616 | Bacteria | 1783 |
| 180 | Ga0068859_100216998 | 3300005617 | Bacteria | 2000 |
| 181 | Ga0068859_100342410 | 3300005617 | Bacteria | 1589 |
| 182 | Ga0068859_100614424 | 3300005617 | Bacteria | 1180 |
| 183 | Ga0068864_100017585 | 3300005618 | Bacteria | 5960 |
| 184 | Ga0068864_100061876 | 3300005618 | Bacteria | 3242 |
| 185 | Ga0068864_100420637 | 3300005618 | Bacteria | 1273 |
| 186 | Ga0068864_100494737 | 3300005618 | Bacteria | 1175 |
| 187 | Ga0068866_10067313 | 3300005718 | Bacteria | 1880 |
| 188 | Ga0068861_100023482 | 3300005719 | Bacteria | 4448 |
| 189 | Ga0068861_100043310 | 3300005719 | Bacteria | 3378 |
| 190 | Ga0068851_10000402 | 3300005834 | Bacteria | 19592 |
| 191 | Ga0068870_10341595 | 3300005840 | Bacteria | 958 |
| 192 | Ga0068863_100093973 | 3300005841 | Bacteria | 2846 |
| 193 | Ga0068863_100105367 | 3300005841 | Bacteria | 2682 |
| 194 | Ga0068863_100238374 | 3300005841 | Bacteria | 1756 |
| 195 | Ga0068858_100029711 | 3300005842 | Bacteria | 5077 |
| 196 | Ga0068858_100121251 | 3300005842 | Bacteria | 2445 |
| 197 | Ga0068858_100378317 | 3300005842 | Bacteria | 1358 |
| 198 | Ga0068860_100111840 | 3300005843 | Bacteria | 2611 |
| 199 | Ga0068860_100250103 | 3300005843 | Bacteria | 1726 |
| 200 | Ga0068862_100144624 | 3300005844 | Bacteria | 2112 |
| 201 | Ga0081455_10001542 | 3300005937 | Bacteria | 28381 |
| 202 | Ga0081455_10002199 | 3300005937 | Bacteria | 23230 |
| 203 | Ga0081455_10014958 | 3300005937 | Bacteria | 7559 |
| 204 | Ga0081540_1012326 | 3300005983 | Bacteria | 5641 |
| 205 | Ga0081540_1019535 | 3300005983 | Bacteria | 4111 |
| 206 | Ga0081539_10003744 | 3300005985 | Bacteria | 18082 |
| 207 | Ga0081539_10010606 | 3300005985 | Bacteria | 7443 |
| 208 | Ga0070717_10038335 | 3300006028 | Bacteria | 3896 |
| 209 | Ga0075365_10004790 | 3300006038 | Bacteria | 7222 |
| 210 | Ga0075365_10046196 | 3300006038 | Bacteria | 2859 |
| 211 | Ga0075365_10116444 | 3300006038 | Bacteria | 1840 |
| 212 | Ga0075365_10203926 | 3300006038 | Bacteria | 1386 |
| 213 | Ga0075368_10023818 | 3300006042 | Bacteria | 2342 |
| 214 | Ga0075368_10168858 | 3300006042 | Bacteria | 919 |
| 215 | Ga0075363_100006810 | 3300006048 | Bacteria | 5222 |
| 216 | Ga0075363_100065509 | 3300006048 | Bacteria | 1964 |
| 217 | Ga0075363_100108390 | 3300006048 | Bacteria | 1542 |
| 218 | Ga0075364_10014894 | 3300006051 | Bacteria | 4812 |
| 219 | Ga0075364_10029999 | 3300006051 | Bacteria | 3489 |
| 220 | Ga0075364_10047382 | 3300006051 | Bacteria | 2799 |
| 221 | Ga0075362_10050490 | 3300006177 | Bacteria | 1860 |
| 222 | Ga0075362_10059213 | 3300006177 | Bacteria | 1729 |
| 223 | Ga0075367_10065559 | 3300006178 | Bacteria | 2175 |
| 224 | Ga0075367_10137743 | 3300006178 | Bacteria | 1511 |
| 225 | Ga0075369_10000740 | 3300006186 | Bacteria | 10584 |
| 226 | Ga0075369_10021344 | 3300006186 | Bacteria | 2660 |
| 227 | Ga0075369_10030499 | 3300006186 | Bacteria | 2271 |
| 228 | Ga0075369_10049490 | 3300006186 | Bacteria | 1815 |
| 229 | Ga0075369_10146409 | 3300006186 | Bacteria | 1078 |
| 230 | Ga0075369_10147708 | 3300006186 | Bacteria | 1074 |
| 231 | Ga0075366_10031045 | 3300006195 | Bacteria | 3143 |
| 232 | Ga0075366_10031394 | 3300006195 | Bacteria | 3126 |
| 233 | Ga0075366_10033710 | 3300006195 | Bacteria | 3017 |
| 234 | Ga0075366_10185202 | 3300006195 | Bacteria | 1265 |
| 235 | Ga0075366_10205551 | 3300006195 | Bacteria | 1198 |
| 236 | Ga0097621_100064859 | 3300006237 | Bacteria | 3004 |
| 237 | Ga0075370_10013990 | 3300006353 | Bacteria | 4272 |
| 238 | Ga0075370_10020985 | 3300006353 | Bacteria | 3576 |
| 239 | Ga0075370_10056883 | 3300006353 | Bacteria | 2223 |
| 240 | Ga0075370_10083054 | 3300006353 | Bacteria | 1842 |
| 241 | Ga0075370_10228067 | 3300006353 | Bacteria | 1102 |
| 242 | Ga0068871_100289518 | 3300006358 | Bacteria | 1435 |
| 243 | Ga0075428_100025112 | 3300006844 | Bacteria | 6592 |
| 244 | Ga0075434_100125782 | 3300006871 | Bacteria | 2580 |
| 245 | Ga0075434_100238505 | 3300006871 | Bacteria | 1838 |
| 246 | Ga0075436_100021452 | 3300006914 | Bacteria | 4435 |
| 247 | Ga0097620_100217015 | 3300006931 | Bacteria | 2000 |
| 248 | Ga0097620_100342427 | 3300006931 | Bacteria | 1589 |
| 249 | Ga0097620_100614444 | 3300006931 | Bacteria | 1180 |
| 250 | Ga0099825_1037378 | 3300006941 | Bacteria | 1609 |
| 251 | Ga0099824_1004900 | 3300006942 | Bacteria | 19056 |
| 252 | Ga0099822_1000677 | 3300006943 | Bacteria | 34391 |
| 253 | Ga0079104_1000129 | 3300006946 | Bacteria | 108427 |
| 254 | Ga0099794_10072951 | 3300007265 | Bacteria | 1684 |
| 255 | Ga0099795_10021718 | 3300007788 | Bacteria | 2109 |
| 256 | Ga0099795_10071435 | 3300007788 | Bacteria | 1310 |
| 257 | Ga0105251_10000251 | 3300009011 | Bacteria | 53888 |
| 258 | Ga0105244_10000148 | 3300009036 | Bacteria | 73416 |
| 259 | Ga0105244_10005524 | 3300009036 | Bacteria | 8388 |
| 260 | Ga0105250_10000070 | 3300009092 | Bacteria | 96227 |
| 261 | Ga0105250_10001351 | 3300009092 | Bacteria | 13352 |
| 262 | Ga0105240_10000027 | 3300009093 | Bacteria | 348486 |
| 263 | Ga0105240_10000244 | 3300009093 | Bacteria | 107739 |
| 264 | Ga0105240_10000301 | 3300009093 | Bacteria | 96340 |
| 265 | Ga0105240_10000333 | 3300009093 | Bacteria | 88420 |
| 266 | Ga0105240_10002439 | 3300009093 | Bacteria | 29909 |
| 267 | Ga0105240_10004430 | 3300009093 | Bacteria | 21410 |
| 268 | Ga0105240_10076156 | 3300009093 | Bacteria | 4137 |
| 269 | Ga0105240_10271630 | 3300009093 | Bacteria | 1952 |
| 270 | Ga0105240_10389123 | 3300009093 | Bacteria | 1573 |
| 271 | Ga0105240_10411901 | 3300009093 | Bacteria | 1520 |
| 272 | Ga0105240_10427502 | 3300009093 | Bacteria | 1487 |
| 273 | Ga0105240_10435929 | 3300009093 | Bacteria | 1469 |
| 274 | Ga0105240_10506060 | 3300009093 | Bacteria | 1342 |
| 275 | Ga0111539_10105643 | 3300009094 | Bacteria | 3303 |
| 276 | Ga0105245_10105248 | 3300009098 | Bacteria | 2617 |
| 277 | Ga0105245_10619440 | 3300009098 | Bacteria | 1110 |
| 278 | Ga0105247_10173540 | 3300009101 | Bacteria | 1435 |
| 279 | Ga0105247_10201048 | 3300009101 | Bacteria | 1339 |
| 280 | Ga0114129_10043432 | 3300009147 | Bacteria | 6324 |
| 281 | Ga0114129_10440338 | 3300009147 | Bacteria | 1711 |
| 282 | Ga0105243_10005831 | 3300009148 | Bacteria | 9549 |
| 283 | Ga0105243_10124180 | 3300009148 | Bacteria | 2181 |
| 284 | Ga0105241_10001668 | 3300009174 | Bacteria | 16913 |
| 285 | Ga0105241_10072742 | 3300009174 | Bacteria | 2673 |
| 286 | Ga0105242_10087007 | 3300009176 | Bacteria | 2623 |
| 287 | Ga0105242_10449428 | 3300009176 | Bacteria | 1214 |
| 288 | Ga0105248_10113603 | 3300009177 | Bacteria | 3054 |
| 289 | Ga0105248_10145012 | 3300009177 | Bacteria | 2679 |
| 290 | Ga0105248_10317850 | 3300009177 | Bacteria | 1754 |
| 291 | Ga0105248_10831328 | 3300009177 | Bacteria | 1042 |
| 292 | Ga0105237_10001533 | 3300009545 | Bacteria | 30234 |
| 293 | Ga0105237_10003395 | 3300009545 | Bacteria | 18937 |
| 294 | Ga0105237_10023955 | 3300009545 | Bacteria | 6247 |
| 295 | Ga0105237_10089479 | 3300009545 | Bacteria | 3068 |
| 296 | Ga0105237_10127412 | 3300009545 | Bacteria | 2540 |
| 297 | Ga0105237_10164047 | 3300009545 | Bacteria | 2221 |
| 298 | Ga0105237_10181704 | 3300009545 | Bacteria | 2104 |
| 299 | Ga0105237_10306545 | 3300009545 | Bacteria | 1591 |
| 300 | Ga0105238_10005661 | 3300009551 | Bacteria | 12351 |
| 301 | Ga0105238_10009609 | 3300009551 | Bacteria | 9677 |
| 302 | Ga0105238_10021242 | 3300009551 | Bacteria | 6615 |
| 303 | Ga0105238_10037001 | 3300009551 | Bacteria | 4962 |
| 304 | Ga0105238_10045018 | 3300009551 | Bacteria | 4458 |
| 305 | Ga0105238_10132971 | 3300009551 | Bacteria | 2466 |
| 306 | Ga0105238_10140111 | 3300009551 | Bacteria | 2395 |
| 307 | Ga0105238_10152479 | 3300009551 | Bacteria | 2286 |
| 308 | Ga0105238_10274011 | 3300009551 | Bacteria | 1668 |
| 309 | Ga0105238_10285544 | 3300009551 | Bacteria | 1632 |
| 310 | Ga0105249_10000222 | 3300009553 | Bacteria | 64888 |
| 311 | Ga0105249_10030193 | 3300009553 | Bacteria | 4899 |
| 312 | Ga0105249_10138742 | 3300009553 | Bacteria | 2329 |
| 313 | Ga0105249_10198558 | 3300009553 | Bacteria | 1962 |
| 314 | Ga0105249_10265162 | 3300009553 | Bacteria | 1708 |
| 315 | Ga0123341_1002866 | 3300009765 | Bacteria | 14487 |
| 316 | Ga0123342_1019294 | 3300009766 | Bacteria | 5238 |
| 317 | Ga0105033_101161 | 3300009986 | Bacteria | 2132 |
| 318 | Ga0099796_10024312 | 3300010159 | Bacteria | 1901 |
| 319 | Ga0105239_10000043 | 3300010375 | Bacteria | 196600 |
| 320 | Ga0105239_10000769 | 3300010375 | Bacteria | 45350 |
| 321 | Ga0105239_10015010 | 3300010375 | Bacteria | 8587 |
| 322 | Ga0105239_10031365 | 3300010375 | Bacteria | 5846 |
| 323 | Ga0105239_10100955 | 3300010375 | Bacteria | 3192 |
| 324 | Ga0105239_10102690 | 3300010375 | Bacteria | 3164 |
| 325 | Ga0105239_10213229 | 3300010375 | Bacteria | 2165 |
| 326 | Ga0105239_10303153 | 3300010375 | Bacteria | 1799 |
| 327 | Ga0105239_10305988 | 3300010375 | Bacteria | 1790 |
| 328 | Ga0105239_10422011 | 3300010375 | Bacteria | 1511 |
| 329 | Ga0105239_10493794 | 3300010375 | Bacteria | 1391 |
| 330 | Ga0105246_10028136 | 3300011119 | Bacteria | 3691 |
| 331 | Ga0105246_10171803 | 3300011119 | Bacteria | 1661 |
| 332 | Ga0157373_10074765 | 3300013100 | Bacteria | 2390 |
| 333 | Ga0157371_10000010 | 3300013102 | Bacteria | 384921 |
| 334 | Ga0157370_10000008 | 3300013104 | Bacteria | 240668 |
| 335 | Ga0157370_10000048 | 3300013104 | Bacteria | 124683 |
| 336 | Ga0157370_10143174 | 3300013104 | Bacteria | 2227 |
| 337 | Ga0157370_10174678 | 3300013104 | Bacteria | 1997 |
| 338 | Ga0157369_10072699 | 3300013105 | Bacteria | 3691 |
| 339 | Ga0157369_10222361 | 3300013105 | Bacteria | 1976 |
| 340 | Ga0157369_10353584 | 3300013105 | Bacteria | 1526 |
| 341 | Ga0157374_10117843 | 3300013296 | Bacteria | 2560 |
| 342 | Ga0157374_10153909 | 3300013296 | Bacteria | 2237 |
| 343 | Ga0157378_10039744 | 3300013297 | Bacteria | 4173 |
| 344 | Ga0157378_10082429 | 3300013297 | Bacteria | 2908 |
| 345 | Ga0157378_10092130 | 3300013297 | Bacteria | 2757 |
| 346 | Ga0163162_10293531 | 3300013306 | Bacteria | 1757 |
| 347 | Ga0163162_10721983 | 3300013306 | Bacteria | 1117 |
| 348 | Ga0157372_10028961 | 3300013307 | Bacteria | 6043 |
| 349 | Ga0157372_10336585 | 3300013307 | Bacteria | 1758 |
| 350 | Ga0157375_10648729 | 3300013308 | Bacteria | 1212 |
| 351 | Ga0163163_10053473 | 3300014325 | Bacteria | 3986 |
| 352 | Ga0163163_10395967 | 3300014325 | Bacteria | 1439 |
| 353 | Ga0163163_10414364 | 3300014325 | Bacteria | 1406 |
| 354 | Ga0157380_10055433 | 3300014326 | Bacteria | 3148 |
| 355 | Ga0157380_10222114 | 3300014326 | Bacteria | 1691 |
| 356 | Ga0157380_10241406 | 3300014326 | Bacteria | 1629 |
| 357 | Ga0182008_10007814 | 3300014497 | Bacteria | 5882 |
| 358 | Ga0182008_10055853 | 3300014497 | Bacteria | 1952 |
| 359 | Ga0157379_10033678 | 3300014968 | Bacteria | 4569 |
| 360 | Ga0157379_10116279 | 3300014968 | Bacteria | 2405 |
| 361 | Ga0157379_10136497 | 3300014968 | Bacteria | 2210 |
| 362 | Ga0157379_10438532 | 3300014968 | Bacteria | 1204 |
| 363 | Ga0157376_10398976 | 3300014969 | Bacteria | 1329 |
| 364 | Ga0182006_1067312 | 3300015261 | Bacteria | 1337 |
| 365 | Ga0182007_10004419 | 3300015262 | Bacteria | 6372 |
| 366 | Ga0182005_1006489 | 3300015265 | Bacteria | 3569 |
| 367 | Ga0163161_10315766 | 3300017792 | Bacteria | 1234 |
| 368 | Ga0213873_10003441 | 3300021358 | Bacteria | 2850 |
| 369 | Ga0213873_10009894 | 3300021358 | Bacteria | 1994 |
| 370 | Ga0213872_10005848 | 3300021361 | Bacteria | 6245 |
| 371 | Ga0213872_10084237 | 3300021361 | Bacteria | 1426 |
| 372 | Ga0213876_10002722 | 3300021384 | Bacteria | 10297 |
| 373 | Ga0213876_10144265 | 3300021384 | Bacteria | 1266 |
| 374 | Ga0213875_10114015 | 3300021388 | Bacteria | 1263 |
| 375 | Ga0213871_10035227 | 3300021441 | Bacteria | 1323 |
| 376 | Ga0209436_100011 | 3300025208 | Bacteria | 139405 |
| 377 | Ga0209674_100048 | 3300025226 | Bacteria | 353032 |
| 378 | Ga0209672_100058 | 3300025228 | Bacteria | 211992 |
| 379 | Ga0209563_101810 | 3300025230 | Bacteria | 5293 |
| 380 | Ga0209437_100050 | 3300025233 | Bacteria | 394010 |
| 381 | Ga0209437_100205 | 3300025233 | Bacteria | 115669 |
| 382 | Ga0209437_106410 | 3300025233 | Bacteria | 1960 |
| 383 | Ga0209258_100164 | 3300025242 | Bacteria | 148838 |
| 384 | Ga0207425_1000695 | 3300025245 | Bacteria | 18209 |
| 385 | Ga0209026_1000231 | 3300025250 | Bacteria | 75789 |
| 386 | Ga0209026_1000784 | 3300025250 | Bacteria | 17581 |
| 387 | Ga0209677_100188 | 3300025253 | Bacteria | 50341 |
| 388 | Ga0209677_104791 | 3300025253 | Bacteria | 3757 |
| 389 | Ga0209148_1000037 | 3300025254 | Bacteria | 494767 |
| 390 | Ga0209148_1000039 | 3300025254 | Bacteria | 482479 |
| 391 | Ga0209148_1000947 | 3300025254 | Bacteria | 19052 |
| 392 | Ga0209759_1000032 | 3300025256 | Bacteria | 278697 |
| 393 | Ga0209759_1000249 | 3300025256 | Bacteria | 80341 |
| 394 | Ga0209759_1013026 | 3300025256 | Bacteria | 2271 |
| 395 | Ga0209129_1000019 | 3300025258 | Bacteria | 460802 |
| 396 | Ga0209129_1000244 | 3300025258 | Bacteria | 57688 |
| 397 | Ga0209129_1000495 | 3300025258 | Bacteria | 28665 |
| 398 | Ga0209129_1000642 | 3300025258 | Bacteria | 23416 |
| 399 | Ga0209129_1001683 | 3300025258 | Bacteria | 11965 |
| 400 | Ga0209233_1000013 | 3300025261 | Bacteria | 1013785 |
| 401 | Ga0209233_1000037 | 3300025261 | Bacteria | 554620 |
| 402 | Ga0209233_1000187 | 3300025261 | Bacteria | 133091 |
| 403 | Ga0209233_1000271 | 3300025261 | Bacteria | 73658 |
| 404 | Ga0209233_1002186 | 3300025261 | Bacteria | 7322 |
| 405 | Ga0209233_1012104 | 3300025261 | Bacteria | 2514 |
| 406 | Ga0209233_1015577 | 3300025261 | Bacteria | 2114 |
| 407 | Ga0209233_1015772 | 3300025261 | Bacteria | 2095 |
| 408 | Ga0209233_1028404 | 3300025261 | Bacteria | 1342 |
| 409 | Ga0209455_1000034 | 3300025272 | Bacteria | 483129 |
| 410 | Ga0209455_1000036 | 3300025272 | Bacteria | 473309 |
| 411 | Ga0209455_1001778 | 3300025272 | Bacteria | 9111 |
| 412 | Ga0209455_1004319 | 3300025272 | Bacteria | 4697 |
| 413 | Ga0209455_1005152 | 3300025272 | Bacteria | 4109 |
| 414 | Ga0209455_1025050 | 3300025272 | Bacteria | 1093 |
| 415 | Ga0209673_1000013 | 3300025273 | Bacteria | 571633 |
| 416 | Ga0209673_1000132 | 3300025273 | Bacteria | 162349 |
| 417 | Ga0209673_1004907 | 3300025273 | Bacteria | 6967 |
| 418 | Ga0209673_1005691 | 3300025273 | Bacteria | 6216 |
| 419 | Ga0209673_1006226 | 3300025273 | Bacteria | 5822 |
| 420 | Ga0209673_1014579 | 3300025273 | Bacteria | 3034 |
| 421 | Ga0209130_1000081 | 3300025284 | Bacteria | 166440 |
| 422 | Ga0209130_1000142 | 3300025284 | Bacteria | 114724 |
| 423 | Ga0209130_1000793 | 3300025284 | Bacteria | 27090 |
| 424 | Ga0209676_1004295 | 3300025292 | Bacteria | 8032 |
| 425 | Ga0209676_1019408 | 3300025292 | Bacteria | 2340 |
| 426 | Ga0209025_1000186 | 3300025294 | Bacteria | 155131 |
| 427 | Ga0209025_1004158 | 3300025294 | Bacteria | 12821 |
| 428 | Ga0209025_1006069 | 3300025294 | Bacteria | 9553 |
| 429 | Ga0209025_1006600 | 3300025294 | Bacteria | 8942 |
| 430 | Ga0209564_1000021 | 3300025295 | Bacteria | 571316 |
| 431 | Ga0209564_1000167 | 3300025295 | Bacteria | 159653 |
| 432 | Ga0209564_1000225 | 3300025295 | Bacteria | 126209 |
| 433 | Ga0209564_1001247 | 3300025295 | Bacteria | 28312 |
| 434 | Ga0209564_1004005 | 3300025295 | Bacteria | 9335 |
| 435 | Ga0209564_1005262 | 3300025295 | Bacteria | 7468 |
| 436 | Ga0209564_1009175 | 3300025295 | Bacteria | 4753 |
| 437 | Ga0209564_1015129 | 3300025295 | Bacteria | 3158 |
| 438 | Ga0209758_1000463 | 3300025297 | Bacteria | 67158 |
| 439 | Ga0209758_1000520 | 3300025297 | Bacteria | 61722 |
| 440 | Ga0209758_1000908 | 3300025297 | Bacteria | 40149 |
| 441 | Ga0209758_1002435 | 3300025297 | Bacteria | 18992 |
| 442 | Ga0209758_1002555 | 3300025297 | Bacteria | 18327 |
| 443 | Ga0209758_1005502 | 3300025297 | Bacteria | 9701 |
| 444 | Ga0209758_1005696 | 3300025297 | Bacteria | 9411 |
| 445 | Ga0209758_1006338 | 3300025297 | Bacteria | 8570 |
| 446 | Ga0209050_1000034 | 3300025298 | Bacteria | 433906 |
| 447 | Ga0209050_1002088 | 3300025298 | Bacteria | 18308 |
| 448 | Ga0209050_1003257 | 3300025298 | Bacteria | 12215 |
| 449 | Ga0209050_1043377 | 3300025298 | Bacteria | 1216 |
| 450 | Ga0209256_1000805 | 3300025299 | Bacteria | 40172 |
| 451 | Ga0209256_1001227 | 3300025299 | Bacteria | 28538 |
| 452 | Ga0209256_1001833 | 3300025299 | Bacteria | 19808 |
| 453 | Ga0209256_1003935 | 3300025299 | Bacteria | 9784 |
| 454 | Ga0209256_1022486 | 3300025299 | Bacteria | 1907 |
| 455 | Ga0209256_1030320 | 3300025299 | Bacteria | 1494 |
| 456 | Ga0207426_1000008 | 3300025302 | Bacteria | 848730 |
| 457 | Ga0207426_1000076 | 3300025302 | Bacteria | 320851 |
| 458 | Ga0207426_1000179 | 3300025302 | Bacteria | 158635 |
| 459 | Ga0207426_1000599 | 3300025302 | Bacteria | 47456 |
| 460 | Ga0209051_1001738 | 3300025303 | Bacteria | 17362 |
| 461 | Ga0209051_1025340 | 3300025303 | Bacteria | 2416 |
| 462 | Ga0209051_1036923 | 3300025303 | Bacteria | 1798 |
| 463 | Ga0209257_1000052 | 3300025304 | Bacteria | 430947 |
| 464 | Ga0209257_1000100 | 3300025304 | Bacteria | 253399 |
| 465 | Ga0209257_1000150 | 3300025304 | Bacteria | 191487 |
| 466 | Ga0209257_1000350 | 3300025304 | Bacteria | 95008 |
| 467 | Ga0209257_1000504 | 3300025304 | Bacteria | 68999 |
| 468 | Ga0209257_1001490 | 3300025304 | Bacteria | 27487 |
| 469 | Ga0209257_1014953 | 3300025304 | Bacteria | 3278 |
| 470 | Ga0207697_10065277 | 3300025315 | Bacteria | 1519 |
| 471 | Ga0207656_10005096 | 3300025321 | Bacteria | 4620 |
| 472 | Ga0207696_1000038 | 3300025711 | Bacteria | 328221 |
| 473 | Ga0207655_1006920 | 3300025728 | Bacteria | 7439 |
| 474 | Ga0207713_1000002 | 3300025735 | Bacteria | 1061749 |
| 475 | Ga0207710_10065256 | 3300025900 | Bacteria | 1659 |
| 476 | Ga0207710_10116799 | 3300025900 | Bacteria | 1271 |
| 477 | Ga0207688_10025501 | 3300025901 | Bacteria | 3247 |
| 478 | Ga0207680_10023183 | 3300025903 | Bacteria | 3386 |
| 479 | Ga0207680_10093612 | 3300025903 | Bacteria | 1917 |
| 480 | Ga0207647_10006363 | 3300025904 | Bacteria | 8586 |
| 481 | Ga0207647_10231554 | 3300025904 | Bacteria | 1063 |
| 482 | Ga0207699_10102512 | 3300025906 | Bacteria | 1819 |
| 483 | Ga0207705_10000003 | 3300025909 | Bacteria | 709270 |
| 484 | Ga0207705_10022777 | 3300025909 | Bacteria | 4467 |
| 485 | Ga0207705_10121717 | 3300025909 | Bacteria | 1937 |
| 486 | Ga0207705_10240169 | 3300025909 | Bacteria | 1380 |
| 487 | Ga0207705_10304147 | 3300025909 | Bacteria | 1223 |
| 488 | Ga0207705_10357598 | 3300025909 | Bacteria | 1126 |
| 489 | Ga0207684_10355458 | 3300025910 | Bacteria | 1261 |
| 490 | Ga0207654_10000058 | 3300025911 | Bacteria | 75628 |
| 491 | Ga0207654_10201811 | 3300025911 | Bacteria | 1310 |
| 492 | Ga0207707_10011916 | 3300025912 | Bacteria | 7566 |
| 493 | Ga0207695_10000024 | 3300025913 | Bacteria | 632311 |
| 494 | Ga0207695_10000171 | 3300025913 | Bacteria | 191448 |
| 495 | Ga0207695_10000262 | 3300025913 | Bacteria | 133005 |
| 496 | Ga0207695_10000399 | 3300025913 | Bacteria | 97109 |
| 497 | Ga0207695_10000453 | 3300025913 | Bacteria | 89314 |
| 498 | Ga0207695_10000623 | 3300025913 | Bacteria | 71205 |
| 499 | Ga0207695_10001151 | 3300025913 | Bacteria | 45829 |
| 500 | Ga0207695_10034241 | 3300025913 | Bacteria | 5528 |
| 501 | Ga0207695_10117754 | 3300025913 | Bacteria | 2628 |
| 502 | Ga0207695_10468866 | 3300025913 | Bacteria | 1142 |
| 503 | Ga0207671_10001033 | 3300025914 | Bacteria | 33897 |
| 504 | Ga0207671_10001214 | 3300025914 | Bacteria | 30625 |
| 505 | Ga0207671_10003232 | 3300025914 | Bacteria | 16391 |
| 506 | Ga0207671_10005863 | 3300025914 | Bacteria | 11155 |
| 507 | Ga0207671_10034499 | 3300025914 | Bacteria | 3758 |
| 508 | Ga0207671_10037705 | 3300025914 | Bacteria | 3584 |
| 509 | Ga0207671_10068898 | 3300025914 | Bacteria | 2637 |
| 510 | Ga0207671_10085199 | 3300025914 | Bacteria | 2374 |
| 511 | Ga0207693_10463115 | 3300025915 | Bacteria | 990 |
| 512 | Ga0207660_10006535 | 3300025917 | Bacteria | 7564 |
| 513 | Ga0207657_10000002 | 3300025919 | Bacteria | 444378 |
| 514 | Ga0207657_10010100 | 3300025919 | Bacteria | 9439 |
| 515 | Ga0207657_10040869 | 3300025919 | Bacteria | 4106 |
| 516 | Ga0207657_10102064 | 3300025919 | Bacteria | 2380 |
| 517 | Ga0207649_10001056 | 3300025920 | Bacteria | 16892 |
| 518 | Ga0207649_10241665 | 3300025920 | Bacteria | 1296 |
| 519 | Ga0207652_10007891 | 3300025921 | Bacteria | 8542 |
| 520 | Ga0207646_10044616 | 3300025922 | Bacteria | 3979 |
| 521 | Ga0207681_10281232 | 3300025923 | Bacteria | 1310 |
| 522 | Ga0207694_10000564 | 3300025924 | Bacteria | 33580 |
| 523 | Ga0207694_10041683 | 3300025924 | Bacteria | 3538 |
| 524 | Ga0207694_10098745 | 3300025924 | Bacteria | 2312 |
| 525 | Ga0207694_10351902 | 3300025924 | Bacteria | 1219 |
| 526 | Ga0207650_10000896 | 3300025925 | Bacteria | 22492 |
| 527 | Ga0207659_10011844 | 3300025926 | Bacteria | 5523 |
| 528 | Ga0207687_10004421 | 3300025927 | Bacteria | 9375 |
| 529 | Ga0207700_10029340 | 3300025928 | Bacteria | 3880 |
| 530 | Ga0207700_10538338 | 3300025928 | Bacteria | 1036 |
| 531 | Ga0207664_10008230 | 3300025929 | Bacteria | 7260 |
| 532 | Ga0207644_10031439 | 3300025931 | Bacteria | 3698 |
| 533 | Ga0207644_10305534 | 3300025931 | Bacteria | 1283 |
| 534 | Ga0207690_10000011 | 3300025932 | Bacteria | 295252 |
| 535 | Ga0207690_10010704 | 3300025932 | Bacteria | 5466 |
| 536 | Ga0207706_10035523 | 3300025933 | Bacteria | 4430 |
| 537 | Ga0207706_10144278 | 3300025933 | Bacteria | 2095 |
| 538 | Ga0207686_10051132 | 3300025934 | Bacteria | 2573 |
| 539 | Ga0207709_10024675 | 3300025935 | Bacteria | 3436 |
| 540 | Ga0207670_10091957 | 3300025936 | Bacteria | 2146 |
| 541 | Ga0207670_10366519 | 3300025936 | Bacteria | 1144 |
| 542 | Ga0207711_10117033 | 3300025941 | Bacteria | 2376 |
| 543 | Ga0207689_10045302 | 3300025942 | Bacteria | 3638 |
| 544 | Ga0207679_10086271 | 3300025945 | Bacteria | 2414 |
| 545 | Ga0207679_10187937 | 3300025945 | Bacteria | 1715 |
| 546 | Ga0207667_10000035 | 3300025949 | Bacteria | 301056 |
| 547 | Ga0207667_10009339 | 3300025949 | Bacteria | 11566 |
| 548 | Ga0207667_10026498 | 3300025949 | Bacteria | 6333 |
| 549 | Ga0207667_10039559 | 3300025949 | Bacteria | 5025 |
| 550 | Ga0207667_10135401 | 3300025949 | Bacteria | 2537 |
| 551 | Ga0207667_10261841 | 3300025949 | Bacteria | 1768 |
| 552 | Ga0207667_10370058 | 3300025949 | Bacteria | 1460 |
| 553 | Ga0207712_10000248 | 3300025961 | Bacteria | 52803 |
| 554 | Ga0207668_10191932 | 3300025972 | Bacteria | 1619 |
| 555 | Ga0207668_10209922 | 3300025972 | Bacteria | 1557 |
| 556 | Ga0207658_10000006 | 3300025986 | Bacteria | 392309 |
| 557 | Ga0207658_10072414 | 3300025986 | Bacteria | 2612 |
| 558 | Ga0207658_10115763 | 3300025986 | Bacteria | 2128 |
| 559 | Ga0207677_10044580 | 3300026023 | Bacteria | 2956 |
| 560 | Ga0207677_10050505 | 3300026023 | Bacteria | 2814 |
| 561 | Ga0207677_10551624 | 3300026023 | Bacteria | 1004 |
| 562 | Ga0207703_10016119 | 3300026035 | Bacteria | 5826 |
| 563 | Ga0207703_10059069 | 3300026035 | Bacteria | 3132 |
| 564 | Ga0207703_10072639 | 3300026035 | Bacteria | 2844 |
| 565 | Ga0207703_10417654 | 3300026035 | Bacteria | 1248 |
| 566 | Ga0207639_10001424 | 3300026041 | Bacteria | 16178 |
| 567 | Ga0207639_10060937 | 3300026041 | Bacteria | 2912 |
| 568 | Ga0207639_10106558 | 3300026041 | Bacteria | 2275 |
| 569 | Ga0207639_10145583 | 3300026041 | Bacteria | 1979 |
| 570 | Ga0207639_10312487 | 3300026041 | Bacteria | 1392 |
| 571 | Ga0207678_10000081 | 3300026067 | Bacteria | 77634 |
| 572 | Ga0207678_10000677 | 3300026067 | Bacteria | 31159 |
| 573 | Ga0207678_10002336 | 3300026067 | Bacteria | 17192 |
| 574 | Ga0207678_10007546 | 3300026067 | Bacteria | 9614 |
| 575 | Ga0207678_10007573 | 3300026067 | Bacteria | 9597 |
| 576 | Ga0207678_10018195 | 3300026067 | Bacteria | 6170 |
| 577 | Ga0207678_10098500 | 3300026067 | Bacteria | 2498 |
| 578 | Ga0207678_10342881 | 3300026067 | Bacteria | 1288 |
| 579 | Ga0207702_10000004 | 3300026078 | Bacteria | 422182 |
| 580 | Ga0207702_10000748 | 3300026078 | Bacteria | 34672 |
| 581 | Ga0207702_10061728 | 3300026078 | Bacteria | 3198 |
| 582 | Ga0207702_10075516 | 3300026078 | Bacteria | 2912 |
| 583 | Ga0207702_10177897 | 3300026078 | Bacteria | 1957 |
| 584 | Ga0207702_10286567 | 3300026078 | Bacteria | 1559 |
| 585 | Ga0207702_10457287 | 3300026078 | Bacteria | 1239 |
| 586 | Ga0207641_10087690 | 3300026088 | Bacteria | 2715 |
| 587 | Ga0207648_10021205 | 3300026089 | Bacteria | 5841 |
| 588 | Ga0207648_10280466 | 3300026089 | Bacteria | 1490 |
| 589 | Ga0207676_10000732 | 3300026095 | Bacteria | 25736 |
| 590 | Ga0207676_10109348 | 3300026095 | Bacteria | 2310 |
| 591 | Ga0207676_10253520 | 3300026095 | Bacteria | 1585 |
| 592 | Ga0207674_10005590 | 3300026116 | Bacteria | 14903 |
| 593 | Ga0207675_100058584 | 3300026118 | Bacteria | 3594 |
| 594 | Ga0207675_100076984 | 3300026118 | Bacteria | 3124 |
| 595 | Ga0207683_10007822 | 3300026121 | Bacteria | 9149 |
| 596 | Ga0207683_10285599 | 3300026121 | Bacteria | 1508 |
| 597 | Ga0207683_10642106 | 3300026121 | Bacteria | 983 |
| 598 | Ga0207683_10716830 | 3300026121 | Bacteria | 928 |
| 599 | Ga0207698_10001361 | 3300026142 | Bacteria | 14242 |
| 600 | Ga0207698_10021118 | 3300026142 | Bacteria | 4496 |
| 601 | Ga0207698_10025819 | 3300026142 | Bacteria | 4146 |
| 602 | Ga0207698_10122095 | 3300026142 | Bacteria | 2207 |
| 603 | Ga0209281_1000036 | 3300027111 | Bacteria | 369415 |
| 604 | Ga0209281_1000047 | 3300027111 | Bacteria | 326514 |
| 605 | Ga0209371_1002388 | 3300027312 | Bacteria | 10607 |
| 606 | Ga0209371_1003791 | 3300027312 | Bacteria | 7034 |
| 607 | Ga0209371_1008437 | 3300027312 | Bacteria | 3427 |
| 608 | Ga0209371_1019645 | 3300027312 | Bacteria | 1681 |
| 609 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 610 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 611 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 612 | Ga0209179_1004059 | 3300027512 | Bacteria | 2176 |
| 613 | Ga0209813_10010292 | 3300027866 | Bacteria | 2415 |
| 614 | Ga0268266_10000827 | 3300028379 | Bacteria | 40488 |
| 615 | Ga0268266_10003815 | 3300028379 | Bacteria | 14743 |
| 616 | Ga0268266_10004137 | 3300028379 | Bacteria | 14015 |
| 617 | Ga0268266_10033854 | 3300028379 | Bacteria | 4342 |
| 618 | Ga0268266_10042793 | 3300028379 | Bacteria | 3870 |
| 619 | Ga0268266_10059158 | 3300028379 | Bacteria | 3301 |
| 620 | Ga0268266_10065807 | 3300028379 | Bacteria | 3133 |
| 621 | Ga0268266_10580761 | 3300028379 | Bacteria | 1075 |
| 622 | Ga0268265_10090428 | 3300028380 | Bacteria | 2445 |
| 623 | Ga0268264_10180693 | 3300028381 | Bacteria | 1916 |
| 624 | Ga0265334_10004202 | 3300028573 | Bacteria | 6432 |
| 625 | Ga0307515_10023504 | 3300028794 | Bacteria | 10796 |
| 626 | Ga0265338_10083833 | 3300028800 | Bacteria | 2664 |
| 627 | Ga0265338_10267575 | 3300028800 | Bacteria | 1254 |
| 628 | Ga0268256_1001774 | 3300030500 | Bacteria | 12176 |
| 629 | Ga0268256_1003015 | 3300030500 | Bacteria | 7952 |
| 630 | Ga0268256_1018567 | 3300030500 | Bacteria | 1925 |
| 631 | Ga0268256_1037347 | 3300030500 | Bacteria | 1113 |
| 632 | Ga0265330_10005862 | 3300031235 | Bacteria | 6089 |
| 633 | Ga0265330_10055070 | 3300031235 | Bacteria | 1737 |
| 634 | Ga0265330_10111691 | 3300031235 | Bacteria | 1167 |
| 635 | Ga0265325_10144542 | 3300031241 | Bacteria | 1129 |
| 636 | Ga0265340_10001482 | 3300031247 | Bacteria | 13464 |
| 637 | Ga0265340_10002643 | 3300031247 | Bacteria | 10183 |
| 638 | Ga0265340_10161431 | 3300031247 | Bacteria | 1018 |
| 639 | Ga0265339_10029184 | 3300031249 | Bacteria | 3131 |
| 640 | Ga0265339_10040735 | 3300031249 | Bacteria | 2581 |
| 641 | Ga0265327_10000039 | 3300031251 | Bacteria | 292334 |
| 642 | Ga0265327_10037340 | 3300031251 | Bacteria | 2660 |
| 643 | Ga0265316_10032707 | 3300031344 | Bacteria | 4243 |
| 644 | Ga0265316_10085167 | 3300031344 | Bacteria | 2419 |
| 645 | Ga0265316_10116382 | 3300031344 | Bacteria | 2021 |
| 646 | Ga0265316_10269303 | 3300031344 | Bacteria | 1247 |
| 647 | Ga0307513_10048472 | 3300031456 | Bacteria | 4611 |
| 648 | Ga0307509_10001027 | 3300031507 | Bacteria | 48002 |
| 649 | Ga0307408_100028470 | 3300031548 | Bacteria | 3861 |
| 650 | Ga0265313_10002155 | 3300031595 | Bacteria | 17475 |
| 651 | Ga0265313_10004657 | 3300031595 | Bacteria | 10377 |
| 652 | Ga0307508_10193337 | 3300031616 | Bacteria | 1636 |
| 653 | Ga0265314_10020524 | 3300031711 | Bacteria | 5099 |
| 654 | Ga0265314_10035472 | 3300031711 | Bacteria | 3634 |
| 655 | Ga0265342_10012050 | 3300031712 | Bacteria | 5871 |
| 656 | Ga0265342_10048420 | 3300031712 | Bacteria | 2548 |
| 657 | Ga0307516_10007025 | 3300031730 | Bacteria | 13047 |
| 658 | Ga0307516_10066047 | 3300031730 | Bacteria | 3491 |
| 659 | Ga0307516_10085294 | 3300031730 | Bacteria | 2996 |
| 660 | Ga0307516_10363460 | 3300031730 | Bacteria | 1111 |
| 661 | Ga0307405_10121963 | 3300031731 | Bacteria | 1785 |
| 662 | Ga0307413_10158066 | 3300031824 | Bacteria | 1589 |
| 663 | Ga0307407_10117837 | 3300031903 | Bacteria | 1678 |
| 664 | Ga0307412_10009672 | 3300031911 | Bacteria | 5535 |
| 665 | Ga0307412_10088437 | 3300031911 | Bacteria | 2161 |
| 666 | Ga0307412_10251708 | 3300031911 | Bacteria | 1372 |
| 667 | Ga0307409_100035306 | 3300031995 | Bacteria | 3662 |
| 668 | Ga0307416_100052282 | 3300032002 | Bacteria | 3270 |
| 669 | Ga0307416_100726167 | 3300032002 | Bacteria | 1084 |
| 670 | Ga0307414_10088963 | 3300032004 | Bacteria | 2287 |
| 671 | Ga0307414_10362035 | 3300032004 | Bacteria | 1248 |
| 672 | Ga0307414_10490937 | 3300032004 | Bacteria | 1085 |
| 673 | Ga0307411_10131858 | 3300032005 | Bacteria | 1828 |
| 674 | Ga0307510_10034816 | 3300033180 | Bacteria | 5630 |
| 675 | Ga0315911_1000010 | 3300033442 | Bacteria | 322197 |
| 676 | Ga0373926_0042224 | 3300035083 | Bacteria | 1631 |
| 677 | Ga0373934_0039379 | 3300035086 | Bacteria | 1863 |
| 678 | Ga0373923_0069453 | 3300035111 | Bacteria | 1510 |
| 679 | Ga0373936_0013440 | 3300035113 | Bacteria | 3124 |
| 680 | Ga0373924_0073466 | 3300035410 | Bacteria | 1445 |
| 681 | Ga0373935_0016772 | 3300035692 | Bacteria | 4433 |
| 682 | Ga0373935_0079801 | 3300035692 | Bacteria | 2125 |
| 683 | Ga0373927_0000075 | 3300035695 | Bacteria | 72822 |
| 684 | Ga0373933_0004636 | 3300035724 | Bacteria | 7529 |
| 685 | Ga0373937_0005933 | 3300036401 | Bacteria | 10512 |
| 686 | Ga0373925_0002684 | 3300037068 | Bacteria | 14118 |
| 687 | Ga0373925_0536180 | 3300037068 | Bacteria | 962 |
| 688 | Ga0395899_0006184 | 3300037312 | Bacteria | 9278 |
| 689 | Ga0395899_0086840 | 3300037312 | Bacteria | 2271 |
| 690 | Ga0395899_0123084 | 3300037312 | Bacteria | 1856 |
| 691 | Ga0395899_0125427 | 3300037312 | Bacteria | 1836 |
| 692 | Ga0395900_0022337 | 3300037418 | Bacteria | 6471 |
| 693 | Ga0395900_0071479 | 3300037418 | Bacteria | 3567 |
| 694 | Ga0395900_0193738 | 3300037418 | Bacteria | 2060 |
| 695 | Ga0395900_0214937 | 3300037418 | Bacteria | 1940 |
| 696 | Ga0395898_0011006 | 3300037466 | Bacteria | 9426 |
| 697 | Ga0395898_0072686 | 3300037466 | Bacteria | 3322 |
| 698 | Ga0395898_0109634 | 3300037466 | Bacteria | 2646 |
| 699 | Ga0395905_0000095 | 3300037471 | Bacteria | 146714 |
| 700 | Ga0395905_0051129 | 3300037471 | Bacteria | 3870 |
| 701 | Ga0395905_0114802 | 3300037471 | Bacteria | 2530 |
| 702 | Ga0395905_0784377 | 3300037471 | Bacteria | 856 |
| 703 | Ga0436364_0660405 | 3300037853 | Bacteria | 2398 |
| 704 | Ga0436364_1108064 | 3300037853 | Bacteria | 4999 |
| 705 | Ga0395901_0045021 | 3300038443 | Bacteria | 4578 |
| 706 | Ga0395901_0103550 | 3300038443 | Bacteria | 2986 |
| 707 | Ga0395901_0122396 | 3300038443 | Bacteria | 2734 |
| 708 | Ga0436365_0323393 | 3300039437 | Bacteria | 7520 |
| 709 | Ga0436365_1424951 | 3300039437 | Bacteria | 6070 |
| 710 | Ga0436365_1846448 | 3300039437 | Bacteria | 1305 |
| 711 | Ga0436360_0253798 | 3300039438 | Bacteria | 882 |
| 712 | Ga0436360_0297024 | 3300039438 | Bacteria | 1790 |
| 713 | Ga0436360_0659817 | 3300039438 | Bacteria | 1141 |
| 714 | Ga0436360_0726204 | 3300039438 | Bacteria | 1983 |
| 715 | Ga0436360_1185545 | 3300039438 | Bacteria | 1409 |
| 716 | Ga0436360_1375098 | 3300039438 | Bacteria | 13243 |
| 717 | Ga0436361_0174497 | 3300039447 | Bacteria | 7261 |
| 718 | Ga0436361_0334394 | 3300039447 | Bacteria | 3286 |
| 719 | Ga0436361_0609700 | 3300039447 | Bacteria | 8217 |
| 720 | Ga0436361_0670522 | 3300039447 | Bacteria | 3225 |
| 721 | Ga0436361_0797533 | 3300039447 | Bacteria | 1436 |
| 722 | Ga0436361_0816491 | 3300039447 | Bacteria | 6295 |
| 723 | Ga0436361_0964227 | 3300039447 | Bacteria | 2348 |
| 724 | Ga0436362_0687917 | 3300039453 | Bacteria | 3316 |
| 725 | Ga0439465_0000436 | 3300041413 | Bacteria | 12197 |
| 726 | Ga0451791_1416907 | 3300041451 | Bacteria | 1270 |
| 727 | Ga0451795_0492382 | 3300041456 | Bacteria | 1477 |
| 728 | Ga0451804_0698880 | 3300041463 | Bacteria | 1189 |
| 729 | Ga0451833_0669262 | 3300041491 | Bacteria | 1769 |
| 730 | Ga0451849_1014739 | 3300041505 | Bacteria | 1038 |
| 731 | Ga0451843_1098918 | 3300041509 | Bacteria | 956 |
| 732 | Ga0451853_0765634 | 3300041512 | Bacteria | 1129 |
| 733 | Ga0466969_0047182 | 3300044656 | Bacteria | 2133 |
| 734 | Ga0466972_0006944 | 3300044658 | Bacteria | 5675 |
| 735 | Ga0466965_0007472 | 3300044683 | Bacteria | 5021 |
| 736 | Ga0466965_0050351 | 3300044683 | Bacteria | 2065 |
| 737 | Ga0466966_0001160 | 3300044684 | Bacteria | 16947 |
| 738 | Ga0466966_0067641 | 3300044684 | Bacteria | 2243 |
| 739 | Ga0466966_0100604 | 3300044684 | Bacteria | 1788 |
| 740 | Ga0466966_0126202 | 3300044684 | Bacteria | 1569 |
| 741 | Ga0466966_0226123 | 3300044684 | Bacteria | 1129 |
| 742 | Ga0466961_0000067 | 3300044693 | Bacteria | 63056 |
| 743 | Ga0466961_0002858 | 3300044693 | Bacteria | 10712 |
| 744 | Ga0466964_0003960 | 3300044706 | Bacteria | 5445 |
| 745 | Ga0466971_0007722 | 3300044719 | Bacteria | 4688 |
| 746 | Ga0466971_0111613 | 3300044719 | Bacteria | 1262 |
| 747 | Ga0466971_0128557 | 3300044719 | Bacteria | 1175 |
| 748 | Ga0466968_0000823 | 3300044735 | Bacteria | 10800 |
| 749 | Ga0466970_0000808 | 3300044765 | Bacteria | 15076 |
| 750 | Ga0466970_0225226 | 3300044765 | Bacteria | 1047 |
| 751 | Ga0466957_0015382 | 3300044842 | Bacteria | 4470 |
| 752 | Ga0466957_0016042 | 3300044842 | Bacteria | 4379 |
| 753 | Ga0466957_0030882 | 3300044842 | Bacteria | 3200 |
| 754 | Ga0466959_0009672 | 3300045049 | Bacteria | 6863 |
| 755 | Ga0466959_0096655 | 3300045049 | Bacteria | 2117 |
| 756 | Ga0466959_0205153 | 3300045049 | Bacteria | 1371 |
| 757 | Ga0466959_0219737 | 3300045049 | Bacteria | 1318 |
| 758 | Ga0466958_0165109 | 3300045836 | Bacteria | 1401 |
| 759 | Ga0466958_0251067 | 3300045836 | Bacteria | 1131 |
| 760 | Ga0466967_0127474 | 3300045976 | Bacteria | 2359 |
| 761 | Ga0495592_0022740 | 3300046454 | Bacteria | 4768 |
| 762 | Ga0495603_0012796 | 3300046455 | Bacteria | 5074 |
| 763 | Ga0495603_0041893 | 3300046455 | Bacteria | 2738 |
| 764 | Ga0495590_0023062 | 3300046457 | Bacteria | 2200 |
| 765 | Ga0495590_0104559 | 3300046457 | Bacteria | 1008 |
| 766 | Ga0495629_0007400 | 3300046459 | Bacteria | 8090 |
| 767 | Ga0495629_0078860 | 3300046459 | Bacteria | 2299 |
| 768 | Ga0495638_0000009 | 3300046460 | Bacteria | 525345 |
| 769 | Ga0495638_0018101 | 3300046460 | Bacteria | 4683 |
| 770 | Ga0495638_0030763 | 3300046460 | Bacteria | 3452 |
| 771 | Ga0495638_0051078 | 3300046460 | Bacteria | 2580 |
| 772 | Ga0495638_0242925 | 3300046460 | Bacteria | 996 |
| 773 | Ga0495641_0127451 | 3300046461 | Bacteria | 1136 |
| 774 | Ga0495651_0000683 | 3300046462 | Bacteria | 26390 |
| 775 | Ga0495653_0032553 | 3300046463 | Bacteria | 4137 |
| 776 | Ga0495650_0000015 | 3300046471 | Bacteria | 557595 |
| 777 | Ga0495650_0000075 | 3300046471 | Bacteria | 250589 |
| 778 | Ga0495650_0049453 | 3300046471 | Bacteria | 1746 |
| 779 | Ga0495650_0080079 | 3300046471 | Bacteria | 1262 |
| 780 | Ga0495650_0089204 | 3300046471 | Bacteria | 1176 |
| 781 | Ga0495580_0008693 | 3300046472 | Bacteria | 8052 |
| 782 | Ga0495580_0087958 | 3300046472 | Bacteria | 2164 |
| 783 | Ga0495605_0000052 | 3300046474 | Bacteria | 162723 |
| 784 | Ga0495605_0023076 | 3300046474 | Bacteria | 3277 |
| 785 | Ga0495639_0058142 | 3300046475 | Bacteria | 1768 |
| 786 | Ga0495664_0023263 | 3300046477 | Bacteria | 3596 |
| 787 | Ga0495585_0143957 | 3300046492 | Bacteria | 1247 |
| 788 | Ga0495594_0067940 | 3300046499 | Bacteria | 1979 |
| 789 | Ga0495607_0001263 | 3300046501 | Bacteria | 22608 |
| 790 | Ga0495607_0056788 | 3300046501 | Bacteria | 2246 |
| 791 | Ga0495583_0000109 | 3300046506 | Bacteria | 138768 |
| 792 | Ga0495583_0004248 | 3300046506 | Bacteria | 10388 |
| 793 | Ga0495583_0040030 | 3300046506 | Bacteria | 2204 |
| 794 | Ga0495606_0063266 | 3300046507 | Bacteria | 2359 |
| 795 | Ga0495606_0121515 | 3300046507 | Bacteria | 1563 |
| 796 | Ga0495606_0131210 | 3300046507 | Bacteria | 1489 |
| 797 | Ga0495608_0008405 | 3300046511 | Bacteria | 7232 |
| 798 | Ga0495610_0010882 | 3300046512 | Bacteria | 5614 |
| 799 | Ga0495610_0027152 | 3300046512 | Bacteria | 3048 |
| 800 | Ga0495610_0039390 | 3300046512 | Bacteria | 2390 |
| 801 | Ga0495610_0042568 | 3300046512 | Bacteria | 2270 |
| 802 | Ga0495610_0050110 | 3300046512 | Bacteria | 2040 |
| 803 | Ga0495618_0001639 | 3300046514 | Bacteria | 14929 |
| 804 | Ga0495628_0051084 | 3300046516 | Bacteria | 3269 |
| 805 | Ga0495630_0043322 | 3300046517 | Bacteria | 3362 |
| 806 | Ga0495631_0024202 | 3300046518 | Bacteria | 2806 |
| 807 | Ga0495631_0049474 | 3300046518 | Bacteria | 1840 |
| 808 | Ga0495631_0090419 | 3300046518 | Bacteria | 1318 |
| 809 | Ga0495632_0000635 | 3300046519 | Bacteria | 32308 |
| 810 | Ga0495632_0017683 | 3300046519 | Bacteria | 3930 |
| 811 | Ga0495632_0034083 | 3300046519 | Bacteria | 2608 |
| 812 | Ga0495632_0057548 | 3300046519 | Bacteria | 1897 |
| 813 | Ga0495632_0097990 | 3300046519 | Bacteria | 1383 |
| 814 | Ga0495632_0106518 | 3300046519 | Bacteria | 1319 |
| 815 | Ga0495632_0146243 | 3300046519 | Bacteria | 1094 |
| 816 | Ga0495637_0002699 | 3300046520 | Bacteria | 9687 |
| 817 | Ga0495637_0008057 | 3300046520 | Bacteria | 5187 |
| 818 | Ga0495637_0009428 | 3300046520 | Bacteria | 4763 |
| 819 | Ga0495637_0019432 | 3300046520 | Bacteria | 3141 |
| 820 | Ga0495637_0027777 | 3300046520 | Bacteria | 2528 |
| 821 | Ga0495648_0145620 | 3300046524 | Bacteria | 1242 |
| 822 | Ga0495648_0148488 | 3300046524 | Bacteria | 1225 |
| 823 | Ga0495642_0080362 | 3300046528 | Bacteria | 1372 |
| 824 | Ga0495652_0009632 | 3300046529 | Bacteria | 8771 |
| 825 | Ga0495654_0000121 | 3300046530 | Bacteria | 86743 |
| 826 | Ga0495665_0135365 | 3300046531 | Bacteria | 1289 |
| 827 | Ga0495640_0001593 | 3300046533 | Bacteria | 17910 |
| 828 | Ga0495640_0035889 | 3300046533 | Bacteria | 3507 |
| 829 | Ga0495587_0001278 | 3300046536 | Bacteria | 16748 |
| 830 | Ga0495598_0048766 | 3300046537 | Bacteria | 1267 |
| 831 | Ga0495609_0021486 | 3300046538 | Bacteria | 2977 |
| 832 | Ga0495609_0078216 | 3300046538 | Bacteria | 1448 |
| 833 | Ga0495621_0060165 | 3300046539 | Bacteria | 1377 |
| 834 | Ga0495597_0000061 | 3300046542 | Bacteria | 92012 |
| 835 | Ga0495622_0014437 | 3300046557 | Bacteria | 3666 |
| 836 | Ga0495667_0001611 | 3300046559 | Bacteria | 14962 |
| 837 | Ga0495668_0038969 | 3300046616 | Bacteria | 2654 |
| 838 | Ga0495668_0099550 | 3300046616 | Bacteria | 1590 |
| 839 | Ga0495634_0006916 | 3300046642 | Bacteria | 8573 |
| 840 | Ga0495611_0009976 | 3300046648 | Bacteria | 4020 |
| 841 | Ga0495611_0149054 | 3300046648 | Bacteria | 1092 |
| 842 | Ga0495611_0174111 | 3300046648 | Bacteria | 1006 |
| 843 | Ga0495625_0026341 | 3300046660 | Bacteria | 4395 |
| 844 | Ga0495625_0093163 | 3300046660 | Bacteria | 2080 |
| 845 | Ga0495625_0110236 | 3300046660 | Bacteria | 1882 |
| 846 | Ga0495635_0080504 | 3300046663 | Bacteria | 2229 |
| 847 | Ga0495635_0193796 | 3300046663 | Bacteria | 1379 |
| 848 | Ga0495659_0083925 | 3300046664 | Bacteria | 1213 |
| 849 | Ga0495661_0000144 | 3300046665 | Bacteria | 82961 |
| 850 | Ga0495661_0000344 | 3300046665 | Bacteria | 50689 |
| 851 | Ga0495661_0033283 | 3300046665 | Bacteria | 3252 |
| 852 | Ga0495661_0196980 | 3300046665 | Bacteria | 1057 |
| 853 | Ga0495588_0104592 | 3300046674 | Bacteria | 1489 |
| 854 | Ga0495599_0001159 | 3300046678 | Bacteria | 14939 |
| 855 | Ga0495599_0286625 | 3300046678 | Bacteria | 996 |
| 856 | Ga0495669_0059080 | 3300046684 | Bacteria | 1731 |
| 857 | Ga0495669_0088062 | 3300046684 | Bacteria | 1431 |
| 858 | Ga0495613_0062258 | 3300046689 | Bacteria | 2731 |
| 859 | Ga0495670_0127238 | 3300046691 | Bacteria | 1326 |
| 860 | Ga0495649_0000676 | 3300046694 | Bacteria | 27733 |
| 861 | Ga0495649_0185092 | 3300046694 | Bacteria | 1085 |
| 862 | Ga0495589_0130697 | 3300046794 | Bacteria | 1206 |
| 863 | Ga0495600_0002886 | 3300046809 | Bacteria | 10017 |
| 864 | Ga0495660_0000072 | 3300046810 | Bacteria | 109692 |
| 865 | Ga0495660_0002969 | 3300046810 | Bacteria | 10603 |
| 866 | Ga0495660_0085077 | 3300046810 | Bacteria | 1653 |
| 867 | Ga0495660_0139256 | 3300046810 | Bacteria | 1209 |
| 868 | Ga0495581_0089191 | 3300047315 | Bacteria | 1788 |
| 869 | Ga0495604_0003637 | 3300047317 | Bacteria | 12292 |
| 870 | Ga0495674_0017668 | 3300047319 | Bacteria | 6641 |
| 871 | Ga0495672_0003920 | 3300047320 | Bacteria | 12489 |
| 872 | Ga0495672_0011899 | 3300047320 | Bacteria | 6105 |
| 873 | Ga0495672_0016205 | 3300047320 | Bacteria | 5034 |
| 874 | Ga0495676_0039510 | 3300047321 | Bacteria | 3907 |
| 875 | Ga0495676_0054173 | 3300047321 | Bacteria | 3190 |
| 876 | Ga0495680_0002984 | 3300047322 | Bacteria | 16902 |
| 877 | Ga0495683_0000320 | 3300047323 | Bacteria | 40260 |
| 878 | Ga0495683_0001721 | 3300047323 | Bacteria | 13875 |
| 879 | Ga0495687_043352 | 3300047443 | Bacteria | 1961 |
| 880 | Ga0495675_0001860 | 3300047444 | Bacteria | 12561 |
| 881 | Ga0495677_0060799 | 3300047445 | Bacteria | 1401 |
| 882 | Ga0495673_0000112 | 3300047469 | Bacteria | 164434 |
| 883 | Ga0495673_0025561 | 3300047469 | Bacteria | 2832 |
| 884 | Ga0495673_0055249 | 3300047469 | Bacteria | 1723 |
| 885 | Ga0495673_0101741 | 3300047469 | Bacteria | 1160 |
| 886 | Ga0495686_0021593 | 3300047472 | Bacteria | 4271 |
| 887 | Ga0495686_0024626 | 3300047472 | Bacteria | 3952 |
| 888 | Ga0495686_0059825 | 3300047472 | Bacteria | 2370 |
| 889 | Ga0495686_0062523 | 3300047472 | Bacteria | 2309 |
| 890 | Ga0495686_0063181 | 3300047472 | Bacteria | 2295 |
| 891 | Ga0495593_0097054 | 3300047673 | Bacteria | 1514 |
| 892 | Ga0495602_0124858 | 3300048088 | Bacteria | 2064 |
| 893 | Ga0495615_0000019 | 3300048090 | Bacteria | 54462 |
| 894 | Ga0495626_0006181 | 3300048091 | Bacteria | 6846 |
| 895 | Ga0496100_0091918 | 3300048903 | Bacteria | 2072 |
| 896 | Ga0496100_0206015 | 3300048903 | Bacteria | 1436 |
| 897 | Ga0496101_0007862 | 3300048904 | Bacteria | 6938 |
| 898 | Ga0496101_0012938 | 3300048904 | Bacteria | 5580 |
| 899 | Ga0496101_0199400 | 3300048904 | Bacteria | 1547 |
| 900 | Ga0496101_0206713 | 3300048904 | Bacteria | 1520 |
| 901 | Ga0496102_0012820 | 3300048905 | Bacteria | 7258 |
| 902 | Ga0496102_0015629 | 3300048905 | Bacteria | 6612 |
| 903 | Ga0496102_0116528 | 3300048905 | Bacteria | 2493 |
| 904 | Ga0496102_0247265 | 3300048905 | Bacteria | 1682 |
| 905 | Ga0496103_0005197 | 3300048906 | Bacteria | 7831 |
| 906 | Ga0496103_0199668 | 3300048906 | Bacteria | 1286 |
| 907 | Ga0496104_0118467 | 3300048907 | Bacteria | 2542 |
| 908 | Ga0496104_0157196 | 3300048907 | Bacteria | 2182 |
| 909 | Ga0496104_0209376 | 3300048907 | Bacteria | 1862 |
| 910 | Ga0496105_0002129 | 3300048908 | Bacteria | 14348 |
| 911 | Ga0496105_0061342 | 3300048908 | Bacteria | 3103 |
| 912 | Ga0496105_0183879 | 3300048908 | Bacteria | 1711 |
| 913 | Ga0496106_0000038 | 3300048909 | Bacteria | 111983 |
| 914 | Ga0496106_0005325 | 3300048909 | Bacteria | 9529 |
| 915 | Ga0496106_0071978 | 3300048909 | Bacteria | 2643 |
| 916 | Ga0496106_0145724 | 3300048909 | Bacteria | 1865 |
| 917 | Ga0496106_0236611 | 3300048909 | Bacteria | 1459 |
| 918 | Ga0496107_0079364 | 3300048910 | Bacteria | 2392 |
| 919 | Ga0496107_0103060 | 3300048910 | Bacteria | 2093 |
| 920 | Ga0496107_0361136 | 3300048910 | Bacteria | 1081 |
| 921 | Ga0496108_0331983 | 3300048911 | Bacteria | 1326 |
| 922 | Ga0496109_0001563 | 3300048912 | Bacteria | 19072 |
| 923 | Ga0496109_0021635 | 3300048912 | Bacteria | 5690 |
| 924 | Ga0496109_0278571 | 3300048912 | Bacteria | 1576 |
| 925 | Ga0496110_0208556 | 3300048913 | Bacteria | 1776 |
| 926 | Ga0496111_0312065 | 3300048914 | Bacteria | 1165 |
| 927 | Ga0496111_0364273 | 3300048914 | Bacteria | 1070 |
| 928 | Ga0496112_0012079 | 3300048915 | Bacteria | 7924 |
| 929 | Ga0496112_0041328 | 3300048915 | Bacteria | 4511 |
| 930 | Ga0496112_0187915 | 3300048915 | Bacteria | 2029 |
| 931 | Ga0496112_0310368 | 3300048915 | Bacteria | 1522 |
| 932 | Ga0496112_0364095 | 3300048915 | Bacteria | 1388 |
| 933 | Ga0496113_0063442 | 3300048916 | Bacteria | 2792 |
| 934 | Ga0496113_0291332 | 3300048916 | Bacteria | 1306 |
| 935 | Ga0496115_0000354 | 3300048918 | Bacteria | 38566 |
| 936 | Ga0496115_0001891 | 3300048918 | Bacteria | 14988 |
| 937 | Ga0496115_0002784 | 3300048918 | Bacteria | 12569 |
| 938 | Ga0496115_0035224 | 3300048918 | Bacteria | 3959 |
| 939 | Ga0496115_0210181 | 3300048918 | Bacteria | 1607 |
| 940 | Ga0496115_0250655 | 3300048918 | Bacteria | 1458 |
| 941 | Ga0496115_0470043 | 3300048918 | Bacteria | 1014 |
| 942 | Ga0496115_0513921 | 3300048918 | Bacteria | 961 |
| 943 | Ga0496116_0011507 | 3300048919 | Bacteria | 7313 |
| 944 | Ga0496116_0033234 | 3300048919 | Bacteria | 3663 |
| 945 | Ga0496116_0057523 | 3300048919 | Bacteria | 2541 |
| 946 | Ga0496116_0127353 | 3300048919 | Bacteria | 1460 |
| 947 | Ga0496117_0004982 | 3300048920 | Bacteria | 14248 |
| 948 | Ga0496117_0013888 | 3300048920 | Bacteria | 6982 |
| 949 | Ga0496117_0017228 | 3300048920 | Bacteria | 6043 |
| 950 | Ga0496117_0030168 | 3300048920 | Bacteria | 4165 |
| 951 | Ga0496117_0035813 | 3300048920 | Bacteria | 3721 |
| 952 | Ga0496117_0050794 | 3300048920 | Bacteria | 2938 |
| 953 | Ga0496117_0087500 | 3300048920 | Bacteria | 2019 |
| 954 | Ga0496117_0097680 | 3300048920 | Bacteria | 1870 |
| 955 | Ga0496117_0194943 | 3300048920 | Bacteria | 1150 |
| 956 | Ga0496117_0284641 | 3300048920 | Bacteria | 883 |
| 957 | Ga0496118_0001729 | 3300048921 | Bacteria | 31774 |
| 958 | Ga0496118_0004151 | 3300048921 | Bacteria | 17500 |
| 959 | Ga0496118_0005800 | 3300048921 | Bacteria | 13850 |
| 960 | Ga0496118_0005874 | 3300048921 | Bacteria | 13753 |
| 961 | Ga0496118_0010226 | 3300048921 | Bacteria | 9312 |
| 962 | Ga0496118_0010237 | 3300048921 | Bacteria | 9307 |
| 963 | Ga0496118_0017638 | 3300048921 | Bacteria | 6484 |
| 964 | Ga0496118_0056319 | 3300048921 | Bacteria | 2957 |
| 965 | Ga0496118_0060289 | 3300048921 | Bacteria | 2818 |
| 966 | Ga0496118_0088569 | 3300048921 | Bacteria | 2140 |
| 967 | Ga0496118_0098370 | 3300048921 | Bacteria | 1987 |
| 968 | Ga0496118_0129515 | 3300048921 | Bacteria | 1624 |
| 969 | Ga0496118_0226947 | 3300048921 | Bacteria | 1081 |
| 970 | Ga0496119_0000531 | 3300048922 | Bacteria | 51990 |
| 971 | Ga0496119_0014656 | 3300048922 | Bacteria | 6109 |
| 972 | Ga0496119_0017955 | 3300048922 | Bacteria | 5291 |
| 973 | Ga0496119_0075998 | 3300048922 | Bacteria | 1950 |
| 974 | Ga0496119_0107169 | 3300048922 | Bacteria | 1558 |
| 975 | Ga0496120_0000182 | 3300048923 | Bacteria | 107094 |
| 976 | Ga0496120_0034351 | 3300048923 | Bacteria | 3038 |
| 977 | Ga0496120_0043278 | 3300048923 | Bacteria | 2625 |
| 978 | Ga0496120_0059051 | 3300048923 | Bacteria | 2151 |
| 979 | Ga0496120_0154338 | 3300048923 | Bacteria | 1151 |
| 980 | Ga0496121_0000341 | 3300048924 | Bacteria | 97289 |
| 981 | Ga0496121_0000571 | 3300048924 | Bacteria | 69504 |
| 982 | Ga0496121_0000667 | 3300048924 | Bacteria | 64115 |
| 983 | Ga0496121_0002861 | 3300048924 | Bacteria | 25436 |
| 984 | Ga0496121_0003867 | 3300048924 | Bacteria | 20816 |
| 985 | Ga0496121_0004961 | 3300048924 | Bacteria | 17452 |
| 986 | Ga0496121_0005470 | 3300048924 | Bacteria | 16266 |
| 987 | Ga0496121_0024997 | 3300048924 | Bacteria | 5688 |
| 988 | Ga0496121_0030860 | 3300048924 | Bacteria | 4913 |
| 989 | Ga0496121_0041642 | 3300048924 | Bacteria | 4011 |
| 990 | Ga0496121_0096681 | 3300048924 | Bacteria | 2291 |
| 991 | Ga0496121_0142300 | 3300048924 | Bacteria | 1777 |
| 992 | Ga0496121_0159027 | 3300048924 | Bacteria | 1654 |
| 993 | Ga0496121_0177884 | 3300048924 | Bacteria | 1539 |
| 994 | Ga0496122_0000719 | 3300048925 | Bacteria | 64886 |
| 995 | Ga0496122_0010121 | 3300048925 | Bacteria | 9782 |
| 996 | Ga0496122_0013339 | 3300048925 | Bacteria | 8050 |
| 997 | Ga0496122_0014830 | 3300048925 | Bacteria | 7505 |
| 998 | Ga0496122_0016538 | 3300048925 | Bacteria | 6969 |
| 999 | Ga0496122_0218275 | 3300048925 | Bacteria | 1097 |
| 1000 | Ga0496123_0000325 | 3300048926 | Bacteria | 90905 |
| 1001 | Ga0496123_0007813 | 3300048926 | Bacteria | 9957 |
| 1002 | Ga0496123_0014475 | 3300048926 | Bacteria | 6535 |
| 1003 | Ga0496123_0081921 | 3300048926 | Bacteria | 1958 |
| 1004 | Ga0496123_0083530 | 3300048926 | Bacteria | 1931 |
| 1005 | Ga0496123_0099017 | 3300048926 | Bacteria | 1703 |
| 1006 | Ga0496124_0000047 | 3300048927 | Bacteria | 285554 |
| 1007 | Ga0496124_0000519 | 3300048927 | Bacteria | 65692 |
| 1008 | Ga0496124_0006231 | 3300048927 | Bacteria | 13068 |
| 1009 | Ga0496124_0030539 | 3300048927 | Bacteria | 4781 |
| 1010 | Ga0496124_0040044 | 3300048927 | Bacteria | 4056 |
| 1011 | Ga0496124_0051479 | 3300048927 | Bacteria | 3504 |
| 1012 | Ga0496124_0116816 | 3300048927 | Bacteria | 2138 |
| 1013 | Ga0496124_0152413 | 3300048927 | Bacteria | 1811 |
| 1014 | Ga0496125_0000060 | 3300048928 | Bacteria | 264143 |
| 1015 | Ga0496125_0000147 | 3300048928 | Bacteria | 154731 |
| 1016 | Ga0496125_0001951 | 3300048928 | Bacteria | 28177 |
| 1017 | Ga0496125_0003103 | 3300048928 | Bacteria | 20706 |
| 1018 | Ga0496125_0007113 | 3300048928 | Bacteria | 11943 |
| 1019 | Ga0496125_0016401 | 3300048928 | Bacteria | 7117 |
| 1020 | Ga0496125_0016874 | 3300048928 | Bacteria | 6992 |
| 1021 | Ga0496125_0032900 | 3300048928 | Bacteria | 4598 |
| 1022 | Ga0496125_0047398 | 3300048928 | Bacteria | 3594 |
| 1023 | Ga0496125_0057558 | 3300048928 | Bacteria | 3147 |
| 1024 | Ga0496125_0127996 | 3300048928 | Bacteria | 1795 |
| 1025 | Ga0496125_0257440 | 3300048928 | Bacteria | 1096 |
| 1026 | Ga0496126_0000412 | 3300048929 | Bacteria | 86638 |
| 1027 | Ga0496126_0000996 | 3300048929 | Bacteria | 48318 |
| 1028 | Ga0496126_0004035 | 3300048929 | Bacteria | 17860 |
| 1029 | Ga0496126_0006811 | 3300048929 | Bacteria | 12676 |
| 1030 | Ga0496126_0007721 | 3300048929 | Bacteria | 11736 |
| 1031 | Ga0496126_0008802 | 3300048929 | Bacteria | 10828 |
| 1032 | Ga0496126_0012455 | 3300048929 | Bacteria | 8710 |
| 1033 | Ga0496126_0013337 | 3300048929 | Bacteria | 8367 |
| 1034 | Ga0496126_0034921 | 3300048929 | Bacteria | 4716 |
| 1035 | Ga0496126_0043949 | 3300048929 | Bacteria | 4118 |
| 1036 | Ga0496126_0053580 | 3300048929 | Bacteria | 3659 |
| 1037 | Ga0496126_0077562 | 3300048929 | Bacteria | 2945 |
| 1038 | Ga0496126_0092056 | 3300048929 | Bacteria | 2665 |
| 1039 | Ga0496126_0134210 | 3300048929 | Bacteria | 2136 |
| 1040 | Ga0496126_0155394 | 3300048929 | Bacteria | 1958 |
| 1041 | Ga0496126_0284218 | 3300048929 | Bacteria | 1369 |
| 1042 | Ga0496126_0569132 | 3300048929 | Bacteria | 897 |
| 1043 | Ga0496126_0617355 | 3300048929 | Bacteria | 852 |
| 1044 | Ga0495682_0021191 | 3300049460 | Bacteria | 2437 |
| 1045 | Ga0501032_0199471 | 3300049569 | Bacteria | 1306 |
| 1046 | Ga0501033_0024051 | 3300049570 | Bacteria | 4596 |
| 1047 | Ga0501033_0025341 | 3300049570 | Bacteria | 4466 |
| 1048 | Ga0501033_0058238 | 3300049570 | Bacteria | 2854 |
| 1049 | Ga0501034_0004805 | 3300049571 | Bacteria | 14939 |
| 1050 | Ga0501034_0121216 | 3300049571 | Bacteria | 2601 |
| 1051 | Ga0501034_0152998 | 3300049571 | Bacteria | 2282 |
| 1052 | Ga0501034_0486849 | 3300049571 | Bacteria | 1148 |
| 1053 | Ga0501034_0547310 | 3300049571 | Bacteria | 1067 |
| 1054 | Ga0501036_0222596 | 3300049572 | Bacteria | 1584 |
| 1055 | Ga0501036_0408284 | 3300049572 | Bacteria | 1133 |
| 1056 | Ga0501037_0248019 | 3300049573 | Bacteria | 1246 |
| 1057 | Ga0501040_0076211 | 3300049576 | Bacteria | 2319 |
| 1058 | Ga0501043_0142602 | 3300049579 | Bacteria | 1876 |
| 1059 | Ga0501043_0283284 | 3300049579 | Bacteria | 1270 |
| 1060 | Ga0501043_0496302 | 3300049579 | Bacteria | 912 |
| 1061 | Ga0501046_0225640 | 3300049580 | Bacteria | 1386 |
| 1062 | Ga0501047_0002924 | 3300049581 | Bacteria | 16223 |
| 1063 | Ga0501047_0066312 | 3300049581 | Bacteria | 3479 |
| 1064 | Ga0501047_0178143 | 3300049581 | Bacteria | 1993 |
| 1065 | Ga0501047_0291667 | 3300049581 | Bacteria | 1475 |
| 1066 | Ga0501048_0001756 | 3300049582 | Bacteria | 16489 |
| 1067 | Ga0501048_0142240 | 3300049582 | Bacteria | 1696 |
| 1068 | Ga0501067_0114972 | 3300049583 | Bacteria | 1496 |
| 1069 | Ga0501067_0161093 | 3300049583 | Bacteria | 1249 |
| 1070 | Ga0501069_0194401 | 3300049585 | Bacteria | 1174 |
| 1071 | Ga0501069_0301155 | 3300049585 | Bacteria | 940 |
| 1072 | Ga0501070_0000284 | 3300049586 | Bacteria | 47435 |
| 1073 | Ga0501070_0005043 | 3300049586 | Bacteria | 11263 |
| 1074 | Ga0501073_0066780 | 3300049589 | Bacteria | 2507 |
| 1075 | Ga0501074_0113977 | 3300049590 | Bacteria | 1934 |
| 1076 | Ga0501074_0196601 | 3300049590 | Bacteria | 1437 |
| 1077 | Ga0501238_017312 | 3300049671 | Bacteria | 1002 |
| 1078 | Ga0501079_0213929 | 3300049741 | Bacteria | 1506 |
| 1079 | Ga0501080_0000843 | 3300049742 | Bacteria | 25055 |
| 1080 | Ga0501080_0508678 | 3300049742 | Bacteria | 1076 |
| 1081 | Ga0501080_0707343 | 3300049742 | Bacteria | 888 |
| 1082 | Ga0501083_0006163 | 3300049744 | Bacteria | 8508 |
| 1083 | Ga0501035_0003018 | 3300049822 | Bacteria | 16149 |
| 1084 | Ga0501035_0003062 | 3300049822 | Bacteria | 16037 |
| 1085 | Ga0501035_0013181 | 3300049822 | Bacteria | 7630 |
| 1086 | Ga0501035_0016883 | 3300049822 | Bacteria | 6730 |
| 1087 | Ga0501044_0015668 | 3300049823 | Bacteria | 8164 |
| 1088 | Ga0501044_0015688 | 3300049823 | Bacteria | 8157 |
| 1089 | Ga0501044_0046990 | 3300049823 | Bacteria | 4466 |
| 1090 | Ga0501044_0121116 | 3300049823 | Bacteria | 2617 |
| 1091 | Ga0501044_0363130 | 3300049823 | Bacteria | 1366 |
| 1092 | Ga0501045_0013913 | 3300049824 | Bacteria | 5691 |
| 1093 | nmdc:mga03n38_1460_c1 | 3300050490 | Bacteria | 6789 |
| 1094 | nmdc:mga03n38_27198_c1 | 3300050490 | Bacteria | 2370 |
| 1095 | nmdc:mga00v17_149136_c1 | 3300050491 | Bacteria | 1502 |
| 1096 | nmdc:mga00v17_200076_c1 | 3300050491 | Bacteria | 1291 |
| 1097 | nmdc:mga0yw44_198650_c1 | 3300050492 | Bacteria | 1324 |
| 1098 | nmdc:mga0yw44_2135_c2 | 3300050492 | Bacteria | 6932 |
| 1099 | nmdc:mga0yw44_373759_c1 | 3300050492 | Bacteria | 962 |
| 1100 | nmdc:mga0yw44_401645_c1 | 3300050492 | Bacteria | 927 |
| 1101 | nmdc:mga0yw44_5143_c1 | 3300050492 | Bacteria | 3741 |
| 1102 | nmdc:mga0yw44_61919_c1 | 3300050492 | Bacteria | 2297 |
| 1103 | nmdc:mga0k408_119964_c1 | 3300050493 | Bacteria | 1557 |
| 1104 | nmdc:mga0k408_353677_c1 | 3300050493 | Bacteria | 876 |
| 1105 | nmdc:mga0k408_55598_c1 | 3300050493 | Bacteria | 2295 |
| 1106 | nmdc:mga06z11_114010_c1 | 3300050494 | Bacteria | 1500 |
| 1107 | nmdc:mga06z11_13554_c1 | 3300050494 | Bacteria | 3584 |
| 1108 | nmdc:mga06z11_213198_c1 | 3300050494 | Bacteria | 1126 |
| 1109 | nmdc:mga04h51_11849_c1 | 3300050495 | Bacteria | 2432 |
| 1110 | nmdc:mga04h51_139194_c1 | 3300050495 | Bacteria | 919 |
| 1111 | nmdc:mga07m45_2086_c1 | 3300050496 | Bacteria | 9285 |
| 1112 | nmdc:mga07m45_5016_c1 | 3300050496 | Bacteria | 6536 |
| 1113 | nmdc:mga0n895_512243_c1 | 3300050512 | Bacteria | 1208 |
| 1114 | nmdc:mga08x19_95087_c1 | 3300050514 | Bacteria | 1971 |
| 1115 | nmdc:mga0sz30_11749_c1 | 3300050516 | Bacteria | 3390 |
| 1116 | nmdc:mga0sz30_41697_c1 | 3300050516 | Bacteria | 1930 |
| 1117 | nmdc:mga0sz30_64442_c2 | 3300050516 | Bacteria | 1213 |
| 1118 | nmdc:mga0sz30_67178_c1 | 3300050516 | Bacteria | 1539 |
| 1119 | nmdc:mga0sz30_73784_c1 | 3300050516 | Bacteria | 1471 |
| 1120 | Ga0495601_0001473 | 3300053077 | Bacteria | 12971 |
| 1121 | Ga0495601_0040276 | 3300053077 | Bacteria | 2926 |
| 1122 | Ga0495595_0000273 | 3300053084 | Bacteria | 20369 |
| 1123 | Ga0495619_0001384 | 3300053085 | Bacteria | 15951 |
| 1124 | Ga0500578_0061100 | 3300053086 | Bacteria | 2406 |
| 1125 | Ga0500578_0197278 | 3300053086 | Bacteria | 1233 |
| 1126 | Ga0500643_000015 | 3300053087 | Bacteria | 310312 |
| 1127 | Ga0500643_033965 | 3300053087 | Bacteria | 1539 |
| 1128 | Ga0500646_0040496 | 3300053090 | Bacteria | 1310 |
| 1129 | Ga0500651_0001456 | 3300053093 | Bacteria | 11910 |
| 1130 | Ga0500651_0002351 | 3300053093 | Bacteria | 9945 |
| 1131 | Ga0500651_0024107 | 3300053093 | Bacteria | 3814 |
| 1132 | Ga0500566_0000007 | 3300053094 | Bacteria | 144968 |
| 1133 | Ga0500566_0000499 | 3300053094 | Bacteria | 21864 |
| 1134 | Ga0500566_0002374 | 3300053094 | Bacteria | 11143 |
| 1135 | Ga0500566_0036407 | 3300053094 | Bacteria | 2855 |
| 1136 | Ga0500640_000901 | 3300053095 | Bacteria | 8290 |
| 1137 | Ga0500641_0015222 | 3300053096 | Bacteria | 2850 |
| 1138 | Ga0500641_0017967 | 3300053096 | Bacteria | 2654 |
| 1139 | Ga0500641_0025202 | 3300053096 | Bacteria | 2299 |
| 1140 | Ga0500650_0000457 | 3300053098 | Bacteria | 10189 |
| 1141 | Ga0500555_001763 | 3300053103 | Bacteria | 6467 |
| 1142 | Ga0500556_0005410 | 3300053104 | Bacteria | 3604 |
| 1143 | Ga0500556_0015933 | 3300053104 | Bacteria | 2329 |
| 1144 | Ga0500562_012381 | 3300053108 | Bacteria | 2169 |
| 1145 | Ga0500562_032663 | 3300053108 | Bacteria | 1374 |
| 1146 | Ga0500569_001911 | 3300053109 | Bacteria | 4024 |
| 1147 | Ga0500572_000093 | 3300053111 | Bacteria | 29132 |
| 1148 | Ga0500572_001776 | 3300053111 | Bacteria | 5543 |
| 1149 | Ga0500591_009912 | 3300053115 | Bacteria | 4486 |
| 1150 | Ga0500592_008090 | 3300053116 | Bacteria | 1667 |
| 1151 | Ga0500594_0057800 | 3300053118 | Bacteria | 1110 |
| 1152 | Ga0500595_002275 | 3300053119 | Bacteria | 9671 |
| 1153 | Ga0500595_002383 | 3300053119 | Bacteria | 9395 |
| 1154 | Ga0500595_002644 | 3300053119 | Bacteria | 8717 |
| 1155 | Ga0500595_008876 | 3300053119 | Bacteria | 4084 |
| 1156 | Ga0500595_018265 | 3300053119 | Bacteria | 2568 |
| 1157 | Ga0500608_001344 | 3300053122 | Bacteria | 8794 |
| 1158 | Ga0500608_051804 | 3300053122 | Bacteria | 1972 |
| 1159 | Ga0500608_059884 | 3300053122 | Bacteria | 1821 |
| 1160 | Ga0500618_000107 | 3300053125 | Bacteria | 67707 |
| 1161 | Ga0500618_000171 | 3300053125 | Bacteria | 54421 |
| 1162 | Ga0500618_000774 | 3300053125 | Bacteria | 18011 |
| 1163 | Ga0500618_003377 | 3300053125 | Bacteria | 5502 |
| 1164 | Ga0500618_012652 | 3300053125 | Bacteria | 2203 |
| 1165 | Ga0500642_0000010 | 3300053130 | Bacteria | 272552 |
| 1166 | Ga0500642_0009322 | 3300053130 | Bacteria | 3403 |
| 1167 | Ga0500642_0010049 | 3300053130 | Bacteria | 3319 |
| 1168 | Ga0500658_0024307 | 3300053134 | Bacteria | 2321 |
| 1169 | Ga0500658_0050060 | 3300053134 | Bacteria | 1704 |
| 1170 | Ga0500658_0054279 | 3300053134 | Bacteria | 1646 |
| 1171 | Ga0500658_0078373 | 3300053134 | Bacteria | 1408 |
| 1172 | Ga0500658_0174010 | 3300053134 | Bacteria | 978 |
| 1173 | Ga0500559_0000242 | 3300053136 | Bacteria | 43285 |
| 1174 | Ga0500559_0001322 | 3300053136 | Bacteria | 14281 |
| 1175 | Ga0500559_0004374 | 3300053136 | Bacteria | 6726 |
| 1176 | Ga0500559_0005444 | 3300053136 | Bacteria | 5853 |
| 1177 | Ga0500559_0007675 | 3300053136 | Bacteria | 4763 |
| 1178 | Ga0500559_0009365 | 3300053136 | Bacteria | 4244 |
| 1179 | Ga0500559_0012928 | 3300053136 | Bacteria | 3541 |
| 1180 | Ga0500559_0092836 | 3300053136 | Bacteria | 1383 |
| 1181 | Ga0500568_0000280 | 3300053139 | Bacteria | 42298 |
| 1182 | Ga0500568_0002443 | 3300053139 | Bacteria | 10935 |
| 1183 | Ga0500568_0010135 | 3300053139 | Bacteria | 4432 |
| 1184 | Ga0500568_0018704 | 3300053139 | Bacteria | 3025 |
| 1185 | Ga0500568_0040159 | 3300053139 | Bacteria | 1885 |
| 1186 | Ga0500573_0012261 | 3300053140 | Bacteria | 4811 |
| 1187 | Ga0500573_0020981 | 3300053140 | Bacteria | 3742 |
| 1188 | Ga0500577_0000170 | 3300053142 | Bacteria | 16549 |
| 1189 | Ga0500577_0017103 | 3300053142 | Bacteria | 2302 |
| 1190 | Ga0500577_0107746 | 3300053142 | Bacteria | 1146 |
| 1191 | Ga0500586_001821 | 3300053145 | Bacteria | 4631 |
| 1192 | Ga0500588_0007669 | 3300053146 | Bacteria | 2496 |
| 1193 | Ga0500588_0022002 | 3300053146 | Bacteria | 1730 |
| 1194 | Ga0500589_027273 | 3300053147 | Bacteria | 2650 |
| 1195 | Ga0500590_084526 | 3300053148 | Bacteria | 1553 |
| 1196 | Ga0500590_130848 | 3300053148 | Bacteria | 1161 |
| 1197 | Ga0500603_000038 | 3300053150 | Bacteria | 31994 |
| 1198 | Ga0500604_0020105 | 3300053151 | Bacteria | 1876 |
| 1199 | Ga0500616_0000014 | 3300053153 | Bacteria | 637918 |
| 1200 | Ga0500616_0000635 | 3300053153 | Bacteria | 42496 |
| 1201 | Ga0500616_0001048 | 3300053153 | Bacteria | 29213 |
| 1202 | Ga0500616_0005377 | 3300053153 | Bacteria | 8706 |
| 1203 | Ga0500616_0010582 | 3300053153 | Bacteria | 5509 |
| 1204 | Ga0500616_0040025 | 3300053153 | Bacteria | 2523 |
| 1205 | Ga0500622_0000170 | 3300053156 | Bacteria | 70088 |
| 1206 | Ga0500622_0000266 | 3300053156 | Bacteria | 53524 |
| 1207 | Ga0500622_0007539 | 3300053156 | Bacteria | 6172 |
| 1208 | Ga0500622_0048137 | 3300053156 | Bacteria | 2200 |
| 1209 | Ga0500622_0081678 | 3300053156 | Bacteria | 1617 |
| 1210 | Ga0500630_000331 | 3300053159 | Bacteria | 19734 |
| 1211 | Ga0500633_0007843 | 3300053160 | Bacteria | 2715 |
| 1212 | Ga0500634_0111099 | 3300053161 | Bacteria | 1352 |
| 1213 | Ga0500638_000308 | 3300053162 | Bacteria | 11016 |
| 1214 | Ga0500639_000013 | 3300053163 | Bacteria | 123899 |
| 1215 | Ga0500639_001904 | 3300053163 | Bacteria | 10448 |
| 1216 | Ga0500639_037476 | 3300053163 | Bacteria | 2555 |
| 1217 | Ga0500636_0003875 | 3300053177 | Bacteria | 8444 |
| 1218 | Ga0500636_0039252 | 3300053177 | Bacteria | 2799 |
| 1219 | Ga0500636_0136612 | 3300053177 | Bacteria | 1361 |
| 1220 | Ga0500637_0002745 | 3300053178 | Bacteria | 7897 |
| 1221 | Ga0500637_0034021 | 3300053178 | Bacteria | 2850 |
| 1222 | Ga0500637_0090495 | 3300053178 | Bacteria | 1772 |
| 1223 | Ga0500570_052796 | 3300053724 | Bacteria | 2030 |
| 1224 | Ga0500609_012076 | 3300053731 | Bacteria | 1168 |
| 1225 | Ga0500596_000709 | 3300053735 | Bacteria | 6519 |
| 1226 | Ga0500596_000940 | 3300053735 | Bacteria | 5807 |
| 1227 | Ga0500601_000209 | 3300053737 | Bacteria | 11804 |
| 1228 | Ga0501084_0164817 | 3300054114 | Bacteria | 1870 |
| 1229 | Ga0501084_0173328 | 3300054114 | Bacteria | 1821 |
| 1230 | Ga0501084_0401174 | 3300054114 | Bacteria | 1159 |
| 1231 | Ga0500661_000113 | 3300055283 | Bacteria | 13250 |
| 1232 | Ga0501082_0083388 | 3300060353 | Bacteria | 2758 |
| 1233 | Ga0501082_0275649 | 3300060353 | Bacteria | 1464 |
| 1234 | Ga0466962_0030728 | 3300061719 | Bacteria | 2572 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046471 | Ga0495650_0089204 | Ga0495650_0089204_432_1163 | 229 |
| 2 | 3300048920 | Ga0496117_0050794 | Ga0496117_0050794_26_757 | 229 |
| 3 | 3300046519 | Ga0495632_0017683 | Ga0495632_0017683_3192_3899 | 231 |
| 4 | 3300046678 | Ga0495599_0001159 | Ga0495599_0001159_10082_10927 | 232 |
| 5 | iso_pu_bacteria | 2585428062 | 2587757217 | 252 |
| 6 | 3300013104 | Ga0157370_10174678 | Ga0157370_101746781 | 255 |
| 7 | 3300049583 | Ga0501067_0161093 | Ga0501067_0161093_427_1218 | 257 |
| 8 | 3300005577 | Ga0068857_100142342 | Ga0068857_1001423422 | 261 |
| 9 | 3300009093 | Ga0105240_10411901 | Ga0105240_104119012 | 261 |
| 10 | 3300009551 | Ga0105238_10045018 | Ga0105238_100450182 | 261 |
| 11 | 3300025924 | Ga0207694_10041683 | Ga0207694_100416832 | 261 |
| 12 | 3300049823 | Ga0501044_0363130 | Ga0501044_0363130_549_1352 | 261 |
| 13 | 3300048905 | Ga0496102_0116528 | Ga0496102_0116528_794_1630 | 262 |
| 14 | iso_pu_bacteria | 2842918807 | 2842919255 | 262 |
| 15 | 3300013104 | Ga0157370_10000008 | Ga0157370_10000008183 | 264 |
| 16 | 3300031711 | Ga0265314_10020524 | Ga0265314_100205242 | 264 |
| 17 | 3300005335 | Ga0070666_10005024 | Ga0070666_100050249 | 265 |
| 18 | 3300005563 | Ga0068855_100050993 | Ga0068855_1000509938 | 265 |
| 19 | 3300005937 | Ga0081455_10002199 | Ga0081455_1000219910 | 265 |
| 20 | 3300009177 | Ga0105248_10831328 | Ga0105248_108313282 | 265 |
| 21 | 3300013297 | Ga0157378_10039744 | Ga0157378_100397445 | 265 |
| 22 | 3300025903 | Ga0207680_10023183 | Ga0207680_100231833 | 265 |
| 23 | 3300025949 | Ga0207667_10261841 | Ga0207667_102618412 | 265 |
| 24 | 3300025986 | Ga0207658_10072414 | Ga0207658_100724142 | 265 |
| 25 | 3300048912 | Ga0496109_0021635 | Ga0496109_0021635_1279_2124 | 265 |
| 26 | 3300048914 | Ga0496111_0312065 | Ga0496111_0312065_142_987 | 265 |
| 27 | 3300048929 | Ga0496126_0284218 | Ga0496126_0284218_13_852 | 265 |
| 28 | 3300053731 | Ga0500609_012076 | Ga0500609_012076_22_822 | 265 |
| 29 | iso_pu_bacteria | 2512875016 | 2512931914 | 265 |
| 30 | iso_pu_bacteria | 2599185155 | 2599327722 | 265 |
| 31 | iso_pu_bacteria | 2857576091 | 2857577113 | 265 |
| 32 | iso_pu_bacteria | 2876363079 | 2876368902 | 265 |
| 33 | iso_pu_bacteria | 2903448605 | 2903450874 | 265 |
| 34 | iso_pu_bacteria | 2903521522 | 2903527900 | 265 |
| 35 | iso_pu_bacteria | 2903528002 | 2903529788 | 265 |
| 36 | iso_pu_bacteria | 2937848649 | 2937852631 | 265 |
| 37 | iso_pu_bacteria | 2963644680 | 2963647294 | 265 |
| 38 | iso_pu_bacteria | 2968083720 | 2968087871 | 265 |
| 39 | iso_pu_bacteria | 2977922695 | 2977924958 | 265 |
| 40 | 3300005339 | Ga0070660_100455926 | Ga0070660_1004559261 | 266 |
| 41 | 3300013296 | Ga0157374_10153909 | Ga0157374_101539091 | 266 |
| 42 | 3300037471 | Ga0395905_0784377 | Ga0395905_0784377_11_817 | 266 |
| 43 | iso_pu_bacteria | 2821443989 | 2821447497 | 266 |
| 44 | iso_pu_bacteria | 2842324504 | 2842325387 | 266 |
| 45 | iso_pu_bacteria | 2842348783 | 2842349666 | 266 |
| 46 | iso_pu_bacteria | 2842454564 | 2842455096 | 266 |
| 47 | 3300046471 | Ga0495650_0000075 | Ga0495650_0000075_162553_163368 | 267 |
| 48 | 3300049569 | Ga0501032_0199471 | Ga0501032_0199471_333_1151 | 267 |
| 49 | 3300049586 | Ga0501070_0005043 | Ga0501070_0005043_8209_9027 | 267 |
| 50 | 3300049742 | Ga0501080_0508678 | Ga0501080_0508678_231_1049 | 267 |
| 51 | 3300049823 | Ga0501044_0015668 | Ga0501044_0015668_3452_4270 | 267 |
| 52 | 3300053094 | Ga0500566_0000007 | Ga0500566_0000007_126404_127216 | 267 |
| 53 | 3300053095 | Ga0500640_000901 | Ga0500640_000901_1771_2583 | 267 |
| 54 | 3300053111 | Ga0500572_001776 | Ga0500572_001776_1019_1831 | 267 |
| 55 | 3300053115 | Ga0500591_009912 | Ga0500591_009912_2894_3706 | 267 |
| 56 | 3300053122 | Ga0500608_059884 | Ga0500608_059884_615_1427 | 267 |
| 57 | 3300053136 | Ga0500559_0005444 | Ga0500559_0005444_3432_4244 | 267 |
| 58 | 3300053150 | Ga0500603_000038 | Ga0500603_000038_13456_14268 | 267 |
| 59 | 3300053159 | Ga0500630_000331 | Ga0500630_000331_12571_13383 | 267 |
| 60 | 3300053163 | Ga0500639_000013 | Ga0500639_000013_71944_72756 | 267 |
| 61 | 3300053178 | Ga0500637_0090495 | Ga0500637_0090495_859_1671 | 267 |
| 62 | 3300053735 | Ga0500596_000709 | Ga0500596_000709_633_1445 | 267 |
| 63 | iso_pu_bacteria | 2512875024 | 2512959867 | 267 |
| 64 | iso_pu_bacteria | 2513237164 | 2514036111 | 267 |
| 65 | iso_pu_bacteria | 2537561587 | 2537873511 | 267 |
| 66 | iso_pu_bacteria | 2588253730 | 2588517774 | 267 |
| 67 | iso_pu_bacteria | 2599185210 | 2599605613 | 267 |
| 68 | iso_pu_bacteria | 2904564687 | 2904569612 | 267 |
| 69 | iso_pu_bacteria | 2904571731 | 2904576923 | 267 |
| 70 | 3300005327 | Ga0070658_10014112 | Ga0070658_100141123 | 268 |
| 71 | 3300005563 | Ga0068855_100089020 | Ga0068855_1000890202 | 268 |
| 72 | 3300006177 | Ga0075362_10059213 | Ga0075362_100592132 | 268 |
| 73 | 3300025261 | Ga0209233_1002186 | Ga0209233_10021868 | 268 |
| 74 | 3300025272 | Ga0209455_1005152 | Ga0209455_10051523 | 268 |
| 75 | 3300025909 | Ga0207705_10304147 | Ga0207705_103041471 | 268 |
| 76 | 3300025913 | Ga0207695_10001151 | Ga0207695_1000115131 | 268 |
| 77 | 3300025924 | Ga0207694_10098745 | Ga0207694_100987452 | 268 |
| 78 | 3300025949 | Ga0207667_10026498 | Ga0207667_100264983 | 268 |
| 79 | 3300027312 | Ga0209371_1019645 | Ga0209371_10196451 | 268 |
| 80 | 3300030500 | Ga0268256_1018567 | Ga0268256_10185673 | 268 |
| 81 | 3300039447 | Ga0436361_0174497 | Ga0436361_0174497_2850_3659 | 268 |
| 82 | 3300046520 | Ga0495637_0009428 | Ga0495637_0009428_3017_3838 | 268 |
| 83 | 3300046665 | Ga0495661_0000344 | Ga0495661_0000344_46312_47127 | 268 |
| 84 | 3300047472 | Ga0495686_0024626 | Ga0495686_0024626_229_1050 | 268 |
| 85 | 3300049571 | Ga0501034_0486849 | Ga0501034_0486849_304_1119 | 268 |
| 86 | 3300049581 | Ga0501047_0291667 | Ga0501047_0291667_405_1220 | 268 |
| 87 | 3300050516 | nmdc:mga0sz30_67178_c1 | nmdc:mga0sz30_67178_c1_228_1055 | 268 |
| 88 | 3300053153 | Ga0500616_0010582 | Ga0500616_0010582_2003_2818 | 268 |
| 89 | iso_pu_bacteria | 2510917030 | 2511195835 | 268 |
| 90 | iso_pu_bacteria | 2582581298 | 2585222527 | 268 |
| 91 | iso_pu_bacteria | 2582581308 | 2585278633 | 268 |
| 92 | iso_pu_bacteria | 2582581315 | 2585325752 | 268 |
| 93 | iso_pu_bacteria | 2585427527 | 2585536301 | 268 |
| 94 | iso_pu_bacteria | 2585427529 | 2585545110 | 268 |
| 95 | iso_pu_bacteria | 2585427530 | 2585554175 | 268 |
| 96 | iso_pu_bacteria | 2599185169 | 2599409770 | 268 |
| 97 | iso_pu_bacteria | 2600255254 | 2601521736 | 268 |
| 98 | iso_pu_bacteria | 2600255255 | 2601526761 | 268 |
| 99 | iso_pu_bacteria | 2600255280 | 2601613591 | 268 |
| 100 | iso_pu_bacteria | 2600255281 | 2601618314 | 268 |
| 101 | iso_pu_bacteria | 2600255287 | 2601643059 | 268 |
| 102 | iso_pu_bacteria | 2600255288 | 2601647929 | 268 |
| 103 | iso_pu_bacteria | 2600255289 | 2601651739 | 268 |
| 104 | iso_pu_bacteria | 2600255290 | 2601657066 | 268 |
| 105 | iso_pu_bacteria | 2600255291 | 2601662880 | 268 |
| 106 | iso_pu_bacteria | 2600255298 | 2601695839 | 268 |
| 107 | iso_pu_bacteria | 2600255299 | 2601700513 | 268 |
| 108 | iso_pu_bacteria | 2600255300 | 2601704863 | 268 |
| 109 | iso_pu_bacteria | 2600255301 | 2601709892 | 268 |
| 110 | iso_pu_bacteria | 2600255302 | 2601714904 | 268 |
| 111 | iso_pu_bacteria | 2600255303 | 2601720864 | 268 |
| 112 | iso_pu_bacteria | 2600255304 | 2601725310 | 268 |
| 113 | iso_pu_bacteria | 2600255305 | 2601729852 | 268 |
| 114 | iso_pu_bacteria | 2600255306 | 2601734869 | 268 |
| 115 | iso_pu_bacteria | 2600255307 | 2601739554 | 268 |
| 116 | iso_pu_bacteria | 2600255309 | 2601750043 | 268 |
| 117 | iso_pu_bacteria | 2600255392 | 2602017296 | 268 |
| 118 | iso_pu_bacteria | 2602042052 | 2603660255 | 268 |
| 119 | iso_pu_bacteria | 2602042053 | 2603665530 | 268 |
| 120 | iso_pu_bacteria | 2602042103 | 2603837231 | 268 |
| 121 | iso_pu_bacteria | 2602042104 | 2603842307 | 268 |
| 122 | iso_pu_bacteria | 2602042105 | 2603847380 | 268 |
| 123 | iso_pu_bacteria | 2602042106 | 2603852451 | 268 |
| 124 | iso_pu_bacteria | 2602042110 | 2603870505 | 268 |
| 125 | iso_pu_bacteria | 2602042111 | 2603875443 | 268 |
| 126 | iso_pu_bacteria | 2603880178 | 2606047695 | 268 |
| 127 | iso_pu_bacteria | 2603880184 | 2606069961 | 268 |
| 128 | iso_pu_bacteria | 2603880202 | 2606145800 | 268 |
| 129 | iso_pu_bacteria | 2603880211 | 2606175097 | 268 |
| 130 | iso_pu_bacteria | 2615840626 | 2616306092 | 268 |
| 131 | iso_pu_bacteria | 2636415599 | 2637225707 | 268 |
| 132 | iso_pu_bacteria | 2643221547 | 2643755808 | 268 |
| 133 | iso_pu_bacteria | 2643221599 | 2644003663 | 268 |
| 134 | iso_pu_bacteria | 2675903046 | 2676406919 | 268 |
| 135 | iso_pu_bacteria | 2775507074 | 2777023556 | 268 |
| 136 | iso_pu_bacteria | 2818991453 | 2819639523 | 268 |
| 137 | iso_pu_bacteria | 2856328259 | 2856333796 | 268 |
| 138 | iso_pu_bacteria | 2856334872 | 2856335001 | 268 |
| 139 | iso_pu_bacteria | 2857367948 | 2857368365 | 268 |
| 140 | iso_pu_bacteria | 2869249662 | 2869253113 | 268 |
| 141 | iso_pu_bacteria | 2869264136 | 2869265835 | 268 |
| 142 | iso_pu_bacteria | 2869271264 | 2869272061 | 268 |
| 143 | iso_pu_bacteria | 2871459585 | 2871460987 | 268 |
| 144 | iso_pu_bacteria | 2874109183 | 2874115740 | 268 |
| 145 | iso_pu_bacteria | 2874131515 | 2874138592 | 268 |
| 146 | iso_pu_bacteria | 2874162495 | 2874165178 | 268 |
| 147 | iso_pu_bacteria | 2876399893 | 2876404881 | 268 |
| 148 | iso_pu_bacteria | 2876406927 | 2876408343 | 268 |
| 149 | iso_pu_bacteria | 2878774303 | 2878775307 | 268 |
| 150 | iso_pu_bacteria | 2878781027 | 2878784480 | 268 |
| 151 | iso_pu_bacteria | 2906363423 | 2906364607 | 268 |
| 152 | iso_pu_bacteria | 2906370794 | 2906377240 | 268 |
| 153 | iso_pu_bacteria | 2906386501 | 2906387611 | 268 |
| 154 | iso_pu_bacteria | 2906393657 | 2906398674 | 268 |
| 155 | iso_pu_bacteria | 2906408224 | 2906413557 | 268 |
| 156 | iso_pu_bacteria | 2922151315 | 2922158266 | 268 |
| 157 | iso_pu_bacteria | 2922172374 | 2922176746 | 268 |
| 158 | iso_pu_bacteria | 2922178524 | 2922184049 | 268 |
| 159 | iso_pu_bacteria | 2924748358 | 2924752296 | 268 |
| 160 | iso_pu_bacteria | 2939607340 | 2939609290 | 268 |
| 161 | iso_pu_bacteria | 3005452660 | 3005458316 | 268 |
| 162 | iso_pu_bacteria | 8054302542 | 8054303324 | 268 |
| 163 | 3300003762 | Ga0055542_1000401 | Ga0055542_100040138 | 269 |
| 164 | 3300003763 | Ga0055529_1010335 | Ga0055529_10103351 | 269 |
| 165 | 3300003794 | Ga0055531_10005497 | Ga0055531_100054975 | 269 |
| 166 | 3300005548 | Ga0070665_100005024 | Ga0070665_1000050247 | 269 |
| 167 | 3300006186 | Ga0075369_10147708 | Ga0075369_101477082 | 269 |
| 168 | 3300006353 | Ga0075370_10020985 | Ga0075370_100209854 | 269 |
| 169 | 3300009036 | Ga0105244_10000148 | Ga0105244_1000014841 | 269 |
| 170 | 3300009148 | Ga0105243_10005831 | Ga0105243_100058314 | 269 |
| 171 | 3300009174 | Ga0105241_10072742 | Ga0105241_100727423 | 269 |
| 172 | 3300009545 | Ga0105237_10181704 | Ga0105237_101817043 | 269 |
| 173 | 3300010375 | Ga0105239_10102690 | Ga0105239_101026904 | 269 |
| 174 | 3300011119 | Ga0105246_10028136 | Ga0105246_100281364 | 269 |
| 175 | 3300013296 | Ga0157374_10117843 | Ga0157374_101178432 | 269 |
| 176 | 3300014497 | Ga0182008_10055853 | Ga0182008_100558532 | 269 |
| 177 | 3300015261 | Ga0182006_1067312 | Ga0182006_10673122 | 269 |
| 178 | 3300025254 | Ga0209148_1000037 | Ga0209148_1000037196 | 269 |
| 179 | 3300025272 | Ga0209455_1000036 | Ga0209455_1000036173 | 269 |
| 180 | 3300025298 | Ga0209050_1043377 | Ga0209050_10433771 | 269 |
| 181 | 3300025304 | Ga0209257_1000150 | Ga0209257_1000150142 | 269 |
| 182 | 3300025728 | Ga0207655_1006920 | Ga0207655_10069205 | 269 |
| 183 | 3300025911 | Ga0207654_10201811 | Ga0207654_102018111 | 269 |
| 184 | 3300025914 | Ga0207671_10034499 | Ga0207671_100344991 | 269 |
| 185 | 3300025935 | Ga0207709_10024675 | Ga0207709_100246755 | 269 |
| 186 | 3300028379 | Ga0268266_10003815 | Ga0268266_100038159 | 269 |
| 187 | 3300037853 | Ga0436364_1108064 | Ga0436364_1108064_3463_4293 | 269 |
| 188 | 3300045976 | Ga0466967_0127474 | Ga0466967_0127474_819_1631 | 269 |
| 189 | 3300046471 | Ga0495650_0000015 | Ga0495650_0000015_330557_331375 | 269 |
| 190 | 3300046512 | Ga0495610_0042568 | Ga0495610_0042568_111_962 | 269 |
| 191 | 3300048914 | Ga0496111_0364273 | Ga0496111_0364273_107_928 | 269 |
| 192 | 3300048915 | Ga0496112_0012079 | Ga0496112_0012079_3931_4749 | 269 |
| 193 | 3300048924 | Ga0496121_0177884 | Ga0496121_0177884_98_919 | 269 |
| 194 | 3300048925 | Ga0496122_0218275 | Ga0496122_0218275_128_958 | 269 |
| 195 | 3300048926 | Ga0496123_0099017 | Ga0496123_0099017_226_1062 | 269 |
| 196 | 3300048928 | Ga0496125_0000060 | Ga0496125_0000060_191534_192370 | 269 |
| 197 | 3300049571 | Ga0501034_0004805 | Ga0501034_0004805_5996_6814 | 269 |
| 198 | 3300053122 | Ga0500608_051804 | Ga0500608_051804_688_1518 | 269 |
| 199 | 3300053125 | Ga0500618_003377 | Ga0500618_003377_3026_3862 | 269 |
| 200 | 3300053134 | Ga0500658_0174010 | Ga0500658_0174010_112_930 | 269 |
| 201 | 3300053139 | Ga0500568_0040159 | Ga0500568_0040159_966_1784 | 269 |
| 202 | 3300053142 | Ga0500577_0000170 | Ga0500577_0000170_9490_10326 | 269 |
| 203 | 3300053177 | Ga0500636_0003875 | Ga0500636_0003875_3433_4263 | 269 |
| 204 | iso_pu_bacteria | 2510065059 | 2510315855 | 269 |
| 205 | iso_pu_bacteria | 2524023209 | 2524458850 | 269 |
| 206 | iso_pu_bacteria | 2738541271 | 2738692109 | 269 |
| 207 | iso_pu_bacteria | 2738543016 | 2739267767 | 269 |
| 208 | iso_pu_bacteria | 2818991466 | 2819714710 | 269 |
| 209 | iso_pu_bacteria | 2842298080 | 2842298200 | 269 |
| 210 | iso_pu_bacteria | 2842357229 | 2842360200 | 269 |
| 211 | iso_pu_bacteria | 2844009547 | 2844013310 | 269 |
| 212 | iso_pu_bacteria | 2844533157 | 2844533186 | 269 |
| 213 | iso_pu_bacteria | 2869169390 | 2869173301 | 269 |
| 214 | iso_pu_bacteria | 2869234852 | 2869236676 | 269 |
| 215 | iso_pu_bacteria | 2869242130 | 2869244678 | 269 |
| 216 | iso_pu_bacteria | 2869256925 | 2869263987 | 269 |
| 217 | iso_pu_bacteria | 2871435913 | 2871436834 | 269 |
| 218 | iso_pu_bacteria | 2871451962 | 2871453130 | 269 |
| 219 | iso_pu_bacteria | 2874116593 | 2874118100 | 269 |
| 220 | iso_pu_bacteria | 2876386047 | 2876388085 | 269 |
| 221 | iso_pu_bacteria | 2876808645 | 2876811892 | 269 |
| 222 | iso_pu_bacteria | 2879110137 | 2879118707 | 269 |
| 223 | iso_pu_bacteria | 2889306138 | 2889309666 | 269 |
| 224 | iso_pu_bacteria | 2897803580 | 2897807840 | 269 |
| 225 | iso_pu_bacteria | 2903513507 | 2903514063 | 269 |
| 226 | iso_pu_bacteria | 2904513164 | 2904513439 | 269 |
| 227 | iso_pu_bacteria | 2906401398 | 2906407207 | 269 |
| 228 | iso_pu_bacteria | 2929199973 | 2929203687 | 269 |
| 229 | iso_pu_bacteria | 2941531003 | 2941537466 | 269 |
| 230 | iso_pu_bacteria | 2969079654 | 2969082694 | 269 |
| 231 | iso_pu_bacteria | 2984559226 | 2984559768 | 269 |
| 232 | iso_pu_bacteria | 2984595703 | 2984597849 | 269 |
| 233 | iso_pu_bacteria | 3004211236 | 3004211982 | 269 |
| 234 | iso_pu_bacteria | 3004218560 | 3004224647 | 269 |
| 235 | iso_pu_bacteria | 637000159 | 637075011 | 269 |
| 236 | iso_pu_bacteria | 8055301274 | 8055303350 | 269 |
| 237 | iso_pu_bacteria | 8055909800 | 8055911125 | 269 |
| 238 | 3300001990 | JGI24737J22298_10005281 | JGI24737J22298_100052814 | 270 |
| 239 | 3300001990 | JGI24737J22298_10013841 | JGI24737J22298_100138412 | 270 |
| 240 | 3300002067 | JGI24735J21928_10036537 | JGI24735J21928_100365372 | 270 |
| 241 | 3300002077 | JGI24744J21845_10002209 | JGI24744J21845_100022094 | 270 |
| 242 | 3300002741 | JGI25157J39369_1011312 | JGI25157J39369_10113121 | 270 |
| 243 | 3300005327 | Ga0070658_10110684 | Ga0070658_101106842 | 270 |
| 244 | 3300005328 | Ga0070676_10057774 | Ga0070676_100577741 | 270 |
| 245 | 3300005339 | Ga0070660_100032530 | Ga0070660_1000325302 | 270 |
| 246 | 3300005354 | Ga0070675_100018974 | Ga0070675_1000189743 | 270 |
| 247 | 3300005366 | Ga0070659_100022742 | Ga0070659_1000227424 | 270 |
| 248 | 3300005367 | Ga0070667_100000399 | Ga0070667_10000039915 | 270 |
| 249 | 3300005455 | Ga0070663_100000256 | Ga0070663_1000002567 | 270 |
| 250 | 3300005456 | Ga0070678_100011183 | Ga0070678_1000111833 | 270 |
| 251 | 3300005539 | Ga0068853_100054058 | Ga0068853_1000540582 | 270 |
| 252 | 3300005539 | Ga0068853_100642328 | Ga0068853_1006423281 | 270 |
| 253 | 3300005548 | Ga0070665_100127393 | Ga0070665_1001273933 | 270 |
| 254 | 3300005563 | Ga0068855_100029955 | Ga0068855_1000299553 | 270 |
| 255 | 3300005578 | Ga0068854_100101703 | Ga0068854_1001017032 | 270 |
| 256 | 3300005842 | Ga0068858_100029711 | Ga0068858_1000297115 | 270 |
| 257 | 3300009093 | Ga0105240_10389123 | Ga0105240_103891232 | 270 |
| 258 | 3300009545 | Ga0105237_10089479 | Ga0105237_100894794 | 270 |
| 259 | 3300009553 | Ga0105249_10000222 | Ga0105249_1000022232 | 270 |
| 260 | 3300009553 | Ga0105249_10030193 | Ga0105249_100301931 | 270 |
| 261 | 3300010375 | Ga0105239_10100955 | Ga0105239_101009552 | 270 |
| 262 | 3300013297 | Ga0157378_10082429 | Ga0157378_100824292 | 270 |
| 263 | 3300013307 | Ga0157372_10028961 | Ga0157372_100289614 | 270 |
| 264 | 3300021358 | Ga0213873_10009894 | Ga0213873_100098942 | 270 |
| 265 | 3300025250 | Ga0209026_1000784 | Ga0209026_100078414 | 270 |
| 266 | 3300025299 | Ga0209256_1030320 | Ga0209256_10303202 | 270 |
| 267 | 3300025909 | Ga0207705_10240169 | Ga0207705_102401692 | 270 |
| 268 | 3300025914 | Ga0207671_10005863 | Ga0207671_100058637 | 270 |
| 269 | 3300025919 | Ga0207657_10102064 | Ga0207657_101020642 | 270 |
| 270 | 3300025926 | Ga0207659_10011844 | Ga0207659_100118443 | 270 |
| 271 | 3300025949 | Ga0207667_10000035 | Ga0207667_10000035226 | 270 |
| 272 | 3300025961 | Ga0207712_10000248 | Ga0207712_1000024822 | 270 |
| 273 | 3300025986 | Ga0207658_10000006 | Ga0207658_1000000625 | 270 |
| 274 | 3300025986 | Ga0207658_10115763 | Ga0207658_101157632 | 270 |
| 275 | 3300026035 | Ga0207703_10016119 | Ga0207703_100161196 | 270 |
| 276 | 3300026041 | Ga0207639_10060937 | Ga0207639_100609373 | 270 |
| 277 | 3300026041 | Ga0207639_10312487 | Ga0207639_103124872 | 270 |
| 278 | 3300026067 | Ga0207678_10000081 | Ga0207678_1000008129 | 270 |
| 279 | 3300026121 | Ga0207683_10007822 | Ga0207683_100078226 | 270 |
| 280 | 3300028379 | Ga0268266_10059158 | Ga0268266_100591581 | 270 |
| 281 | 3300032004 | Ga0307414_10088963 | Ga0307414_100889631 | 270 |
| 282 | 3300046457 | Ga0495590_0104559 | Ga0495590_0104559_131_967 | 270 |
| 283 | 3300046616 | Ga0495668_0099550 | Ga0495668_0099550_594_1430 | 270 |
| 284 | 3300046794 | Ga0495589_0130697 | Ga0495589_0130697_103_939 | 270 |
| 285 | 3300047323 | Ga0495683_0000320 | Ga0495683_0000320_32946_33773 | 270 |
| 286 | 3300048912 | Ga0496109_0278571 | Ga0496109_0278571_39_854 | 270 |
| 287 | 3300048924 | Ga0496121_0005470 | Ga0496121_0005470_13825_14643 | 270 |
| 288 | 3300048924 | Ga0496121_0096681 | Ga0496121_0096681_901_1740 | 270 |
| 289 | 3300048925 | Ga0496122_0000719 | Ga0496122_0000719_62178_62993 | 270 |
| 290 | 3300048926 | Ga0496123_0000325 | Ga0496123_0000325_72361_73176 | 270 |
| 291 | 3300048928 | Ga0496125_0003103 | Ga0496125_0003103_8206_9021 | 270 |
| 292 | 3300048929 | Ga0496126_0012455 | Ga0496126_0012455_4887_5702 | 270 |
| 293 | 3300048929 | Ga0496126_0043949 | Ga0496126_0043949_132_983 | 270 |
| 294 | 3300048929 | Ga0496126_0617355 | Ga0496126_0617355_25_840 | 270 |
| 295 | 3300049460 | Ga0495682_0021191 | Ga0495682_0021191_983_1819 | 270 |
| 296 | 3300049589 | Ga0501073_0066780 | Ga0501073_0066780_829_1656 | 270 |
| 297 | 3300049744 | Ga0501083_0006163 | Ga0501083_0006163_2499_3326 | 270 |
| 298 | 3300053108 | Ga0500562_012381 | Ga0500562_012381_1001_1846 | 270 |
| 299 | 3300053111 | Ga0500572_000093 | Ga0500572_000093_18994_19815 | 270 |
| 300 | 3300053136 | Ga0500559_0000242 | Ga0500559_0000242_24635_25456 | 270 |
| 301 | 3300053163 | Ga0500639_001904 | Ga0500639_001904_3262_4083 | 270 |
| 302 | 3300060353 | Ga0501082_0083388 | Ga0501082_0083388_937_1764 | 270 |
| 303 | iso_pu_bacteria | 2509276033 | 2509446750 | 270 |
| 304 | iso_pu_bacteria | 2519103095 | 2519461058 | 270 |
| 305 | iso_pu_bacteria | 2582581311 | 2585289954 | 270 |
| 306 | iso_pu_bacteria | 2599185240 | 2599743633 | 270 |
| 307 | iso_pu_bacteria | 2599185355 | 2600209181 | 270 |
| 308 | iso_pu_bacteria | 2643221577 | 2643894332 | 270 |
| 309 | iso_pu_bacteria | 2643221685 | 2644476536 | 270 |
| 310 | iso_pu_bacteria | 2675903129 | 2676742581 | 270 |
| 311 | iso_pu_bacteria | 2758568016 | 2758640617 | 270 |
| 312 | iso_pu_bacteria | 2791355259 | 2793312571 | 270 |
| 313 | iso_pu_bacteria | 2816332253 | 2817259099 | 270 |
| 314 | iso_pu_bacteria | 2816332256 | 2817280483 | 270 |
| 315 | iso_pu_bacteria | 2816332286 | 2817452326 | 270 |
| 316 | iso_pu_bacteria | 2824617872 | 2824625248 | 270 |
| 317 | iso_pu_bacteria | 2824617872 | 2824625312 | 270 |
| 318 | iso_pu_bacteria | 2824626560 | 2824634031 | 270 |
| 319 | iso_pu_bacteria | 2824626560 | 2824634111 | 270 |
| 320 | iso_pu_bacteria | 2824635225 | 2824641152 | 270 |
| 321 | iso_pu_bacteria | 2824635225 | 2824641279 | 270 |
| 322 | iso_pu_bacteria | 2824644064 | 2824648331 | 270 |
| 323 | iso_pu_bacteria | 2824644064 | 2824648459 | 270 |
| 324 | iso_pu_bacteria | 2824714736 | 2824718243 | 270 |
| 325 | iso_pu_bacteria | 2824714736 | 2824718313 | 270 |
| 326 | iso_pu_bacteria | 2824723954 | 2824728513 | 270 |
| 327 | iso_pu_bacteria | 2824723954 | 2824728585 | 270 |
| 328 | iso_pu_bacteria | 2870068957 | 2870074676 | 270 |
| 329 | iso_pu_bacteria | 2884338543 | 2884342612 | 270 |
| 330 | iso_pu_bacteria | 2894817345 | 2894820857 | 270 |
| 331 | iso_pu_bacteria | 2919085039 | 2919086516 | 270 |
| 332 | iso_pu_bacteria | 2928157003 | 2928157865 | 270 |
| 333 | iso_pu_bacteria | 2928163908 | 2928165636 | 270 |
| 334 | iso_pu_bacteria | 2928526807 | 2928529216 | 270 |
| 335 | iso_pu_bacteria | 2928536128 | 2928536986 | 270 |
| 336 | iso_pu_bacteria | 2928968154 | 2928968756 | 270 |
| 337 | iso_pu_bacteria | 2932794094 | 2932797550 | 270 |
| 338 | iso_pu_bacteria | 2932801729 | 2932802864 | 270 |
| 339 | iso_pu_bacteria | 2935883170 | 2935885206 | 270 |
| 340 | iso_pu_bacteria | 2936375103 | 2936380896 | 270 |
| 341 | iso_pu_bacteria | 2941471342 | 2941474858 | 270 |
| 342 | iso_pu_bacteria | 2981990288 | 2981990881 | 270 |
| 343 | iso_pu_bacteria | 3005718088 | 3005722254 | 270 |
| 344 | iso_pu_bacteria | 641736154 | 642419474 | 270 |
| 345 | iso_pu_bacteria | 8005395548 | 8005396361 | 270 |
| 346 | iso_pu_bacteria | 8020807995 | 8020812873 | 270 |
| 347 | iso_pu_bacteria | 8020938398 | 8020940696 | 270 |
| 348 | iso_pu_bacteria | 8020945358 | 8020952961 | 270 |
| 349 | iso_pu_bacteria | 8020953355 | 8020954277 | 270 |
| 350 | iso_pu_bacteria | 8024479707 | 8024483121 | 270 |
| 351 | iso_pu_bacteria | 8040167225 | 8040167885 | 270 |
| 352 | iso_pu_bacteria | 8040173305 | 8040173522 | 270 |
| 353 | iso_pu_bacteria | 8056967851 | 8056967957 | 270 |
| 354 | 3300002739 | JGI25158J39367_1007151 | JGI25158J39367_10071512 | 271 |
| 355 | 3300002773 | JGI25152J39213_1010330 | JGI25152J39213_10103302 | 271 |
| 356 | 3300002987 | JGI25159J45721_1012472 | JGI25159J45721_10124722 | 271 |
| 357 | 3300003214 | JGI25165J46597_1000046 | JGI25165J46597_100004661 | 271 |
| 358 | 3300003215 | JGI25153J46596_10006842 | JGI25153J46596_100068427 | 271 |
| 359 | 3300003215 | JGI25153J46596_10006854 | JGI25153J46596_100068545 | 271 |
| 360 | 3300003354 | JGI25160J50197_1002284 | JGI25160J50197_10022844 | 271 |
| 361 | 3300003354 | JGI25160J50197_1002762 | JGI25160J50197_10027627 | 271 |
| 362 | 3300003374 | JGI25161J50226_1000107 | JGI25161J50226_100010761 | 271 |
| 363 | 3300003752 | Ga0055539_1003008 | Ga0055539_10030083 | 271 |
| 364 | 3300003775 | Ga0055524_1022643 | Ga0055524_10226431 | 271 |
| 365 | 3300003781 | Ga0055536_1001559 | Ga0055536_100155910 | 271 |
| 366 | 3300003792 | Ga0055540_1012566 | Ga0055540_10125662 | 271 |
| 367 | 3300003794 | Ga0055531_10002792 | Ga0055531_100027921 | 271 |
| 368 | 3300004625 | Ga0055543_1000074 | Ga0055543_100007418 | 271 |
| 369 | 3300005262 | Ga0065165_1000498 | Ga0065165_100049850 | 271 |
| 370 | 3300005262 | Ga0065165_1000844 | Ga0065165_100084430 | 271 |
| 371 | 3300005347 | Ga0070668_100437194 | Ga0070668_1004371941 | 271 |
| 372 | 3300005353 | Ga0070669_100205599 | Ga0070669_1002055991 | 271 |
| 373 | 3300005436 | Ga0070713_100111382 | Ga0070713_1001113822 | 271 |
| 374 | 3300005436 | Ga0070713_100140491 | Ga0070713_1001404912 | 271 |
| 375 | 3300005436 | Ga0070713_100382496 | Ga0070713_1003824962 | 271 |
| 376 | 3300005444 | Ga0070694_100177183 | Ga0070694_1001771831 | 271 |
| 377 | 3300005455 | Ga0070663_100319099 | Ga0070663_1003190992 | 271 |
| 378 | 3300005467 | Ga0070706_100183019 | Ga0070706_1001830192 | 271 |
| 379 | 3300005539 | Ga0068853_100208524 | Ga0068853_1002085241 | 271 |
| 380 | 3300005545 | Ga0070695_100136944 | Ga0070695_1001369442 | 271 |
| 381 | 3300005546 | Ga0070696_100148712 | Ga0070696_1001487122 | 271 |
| 382 | 3300005548 | Ga0070665_100037434 | Ga0070665_1000374343 | 271 |
| 383 | 3300005548 | Ga0070665_100084166 | Ga0070665_1000841662 | 271 |
| 384 | 3300005564 | Ga0070664_100286306 | Ga0070664_1002863062 | 271 |
| 385 | 3300005614 | Ga0068856_100000020 | Ga0068856_10000002027 | 271 |
| 386 | 3300005614 | Ga0068856_100532570 | Ga0068856_1005325701 | 271 |
| 387 | 3300005985 | Ga0081539_10010606 | Ga0081539_100106067 | 271 |
| 388 | 3300006038 | Ga0075365_10046196 | Ga0075365_100461962 | 271 |
| 389 | 3300006038 | Ga0075365_10203926 | Ga0075365_102039262 | 271 |
| 390 | 3300006048 | Ga0075363_100108390 | Ga0075363_1001083902 | 271 |
| 391 | 3300006051 | Ga0075364_10047382 | Ga0075364_100473822 | 271 |
| 392 | 3300006186 | Ga0075369_10000740 | Ga0075369_1000074011 | 271 |
| 393 | 3300006195 | Ga0075366_10185202 | Ga0075366_101852021 | 271 |
| 394 | 3300006358 | Ga0068871_100289518 | Ga0068871_1002895182 | 271 |
| 395 | 3300006871 | Ga0075434_100238505 | Ga0075434_1002385052 | 271 |
| 396 | 3300007788 | Ga0099795_10021718 | Ga0099795_100217182 | 271 |
| 397 | 3300009093 | Ga0105240_10435929 | Ga0105240_104359292 | 271 |
| 398 | 3300009098 | Ga0105245_10619440 | Ga0105245_106194401 | 271 |
| 399 | 3300009177 | Ga0105248_10145012 | Ga0105248_101450122 | 271 |
| 400 | 3300009545 | Ga0105237_10164047 | Ga0105237_101640472 | 271 |
| 401 | 3300009551 | Ga0105238_10285544 | Ga0105238_102855442 | 271 |
| 402 | 3300009986 | Ga0105033_101161 | Ga0105033_1011612 | 271 |
| 403 | 3300010375 | Ga0105239_10493794 | Ga0105239_104937942 | 271 |
| 404 | 3300013102 | Ga0157371_10000010 | Ga0157371_10000010213 | 271 |
| 405 | 3300014325 | Ga0163163_10053473 | Ga0163163_100534733 | 271 |
| 406 | 3300021361 | Ga0213872_10084237 | Ga0213872_100842371 | 271 |
| 407 | 3300025208 | Ga0209436_100011 | Ga0209436_10001186 | 271 |
| 408 | 3300025230 | Ga0209563_101810 | Ga0209563_1018102 | 271 |
| 409 | 3300025253 | Ga0209677_104791 | Ga0209677_1047914 | 271 |
| 410 | 3300025258 | Ga0209129_1000642 | Ga0209129_100064215 | 271 |
| 411 | 3300025261 | Ga0209233_1000013 | Ga0209233_1000013152 | 271 |
| 412 | 3300025261 | Ga0209233_1015772 | Ga0209233_10157722 | 271 |
| 413 | 3300025272 | Ga0209455_1004319 | Ga0209455_10043195 | 271 |
| 414 | 3300025273 | Ga0209673_1014579 | Ga0209673_10145792 | 271 |
| 415 | 3300025284 | Ga0209130_1000081 | Ga0209130_1000081160 | 271 |
| 416 | 3300025284 | Ga0209130_1000793 | Ga0209130_100079318 | 271 |
| 417 | 3300025292 | Ga0209676_1004295 | Ga0209676_10042956 | 271 |
| 418 | 3300025295 | Ga0209564_1004005 | Ga0209564_10040055 | 271 |
| 419 | 3300025297 | Ga0209758_1000520 | Ga0209758_10005202 | 271 |
| 420 | 3300025297 | Ga0209758_1002435 | Ga0209758_10024356 | 271 |
| 421 | 3300025297 | Ga0209758_1006338 | Ga0209758_10063385 | 271 |
| 422 | 3300025298 | Ga0209050_1002088 | Ga0209050_100208812 | 271 |
| 423 | 3300025299 | Ga0209256_1022486 | Ga0209256_10224862 | 271 |
| 424 | 3300025302 | Ga0207426_1000008 | Ga0207426_1000008640 | 271 |
| 425 | 3300025302 | Ga0207426_1000179 | Ga0207426_100017974 | 271 |
| 426 | 3300025302 | Ga0207426_1000599 | Ga0207426_100059910 | 271 |
| 427 | 3300025303 | Ga0209051_1001738 | Ga0209051_100173817 | 271 |
| 428 | 3300025304 | Ga0209257_1001490 | Ga0209257_100149020 | 271 |
| 429 | 3300025304 | Ga0209257_1014953 | Ga0209257_10149532 | 271 |
| 430 | 3300025904 | Ga0207647_10231554 | Ga0207647_102315542 | 271 |
| 431 | 3300025906 | Ga0207699_10102512 | Ga0207699_101025123 | 271 |
| 432 | 3300025919 | Ga0207657_10040869 | Ga0207657_100408694 | 271 |
| 433 | 3300025928 | Ga0207700_10029340 | Ga0207700_100293402 | 271 |
| 434 | 3300025928 | Ga0207700_10538338 | Ga0207700_105383381 | 271 |
| 435 | 3300025949 | Ga0207667_10370058 | Ga0207667_103700582 | 271 |
| 436 | 3300025972 | Ga0207668_10209922 | Ga0207668_102099221 | 271 |
| 437 | 3300026035 | Ga0207703_10417654 | Ga0207703_104176542 | 271 |
| 438 | 3300026067 | Ga0207678_10007546 | Ga0207678_100075464 | 271 |
| 439 | 3300026067 | Ga0207678_10342881 | Ga0207678_103428812 | 271 |
| 440 | 3300026078 | Ga0207702_10000748 | Ga0207702_1000074830 | 271 |
| 441 | 3300026078 | Ga0207702_10457287 | Ga0207702_104572872 | 271 |
| 442 | 3300026095 | Ga0207676_10253520 | Ga0207676_102535201 | 271 |
| 443 | 3300026121 | Ga0207683_10642106 | Ga0207683_106421061 | 271 |
| 444 | 3300026121 | Ga0207683_10716830 | Ga0207683_107168301 | 271 |
| 445 | 3300026142 | Ga0207698_10122095 | Ga0207698_101220953 | 271 |
| 446 | 3300027512 | Ga0209179_1004059 | Ga0209179_10040592 | 271 |
| 447 | 3300028379 | Ga0268266_10033854 | Ga0268266_100338543 | 271 |
| 448 | 3300028379 | Ga0268266_10042793 | Ga0268266_100427934 | 271 |
| 449 | 3300028573 | Ga0265334_10004202 | Ga0265334_100042025 | 271 |
| 450 | 3300028800 | Ga0265338_10083833 | Ga0265338_100838333 | 271 |
| 451 | 3300031235 | Ga0265330_10005862 | Ga0265330_100058623 | 271 |
| 452 | 3300031235 | Ga0265330_10111691 | Ga0265330_101116912 | 271 |
| 453 | 3300031241 | Ga0265325_10144542 | Ga0265325_101445421 | 271 |
| 454 | 3300031247 | Ga0265340_10002643 | Ga0265340_100026434 | 271 |
| 455 | 3300031247 | Ga0265340_10161431 | Ga0265340_101614311 | 271 |
| 456 | 3300031344 | Ga0265316_10085167 | Ga0265316_100851673 | 271 |
| 457 | 3300031344 | Ga0265316_10116382 | Ga0265316_101163822 | 271 |
| 458 | 3300031507 | Ga0307509_10001027 | Ga0307509_1000102712 | 271 |
| 459 | 3300031616 | Ga0307508_10193337 | Ga0307508_101933372 | 271 |
| 460 | 3300035083 | Ga0373926_0042224 | Ga0373926_0042224_306_1292 | 271 |
| 461 | 3300035086 | Ga0373934_0039379 | Ga0373934_0039379_879_1853 | 271 |
| 462 | 3300035111 | Ga0373923_0069453 | Ga0373923_0069453_272_1246 | 271 |
| 463 | 3300035410 | Ga0373924_0073466 | Ga0373924_0073466_345_1319 | 271 |
| 464 | 3300035692 | Ga0373935_0016772 | Ga0373935_0016772_1404_2378 | 271 |
| 465 | 3300035724 | Ga0373933_0004636 | Ga0373933_0004636_3255_4229 | 271 |
| 466 | 3300036401 | Ga0373937_0005933 | Ga0373937_0005933_6148_7122 | 271 |
| 467 | 3300037068 | Ga0373925_0536180 | Ga0373925_0536180_11_844 | 271 |
| 468 | 3300037471 | Ga0395905_0000095 | Ga0395905_0000095_90636_91475 | 271 |
| 469 | 3300039447 | Ga0436361_0334394 | Ga0436361_0334394_69_893 | 271 |
| 470 | 3300044656 | Ga0466969_0047182 | Ga0466969_0047182_629_1453 | 271 |
| 471 | 3300044684 | Ga0466966_0001160 | Ga0466966_0001160_6498_7334 | 271 |
| 472 | 3300044693 | Ga0466961_0000067 | Ga0466961_0000067_10363_11199 | 271 |
| 473 | 3300044842 | Ga0466957_0016042 | Ga0466957_0016042_3372_4196 | 271 |
| 474 | 3300045049 | Ga0466959_0009672 | Ga0466959_0009672_2425_3261 | 271 |
| 475 | 3300045049 | Ga0466959_0219737 | Ga0466959_0219737_141_974 | 271 |
| 476 | 3300046454 | Ga0495592_0022740 | Ga0495592_0022740_201_1175 | 271 |
| 477 | 3300046459 | Ga0495629_0007400 | Ga0495629_0007400_1097_2071 | 271 |
| 478 | 3300046460 | Ga0495638_0030763 | Ga0495638_0030763_1603_2439 | 271 |
| 479 | 3300046462 | Ga0495651_0000683 | Ga0495651_0000683_6368_7342 | 271 |
| 480 | 3300046463 | Ga0495653_0032553 | Ga0495653_0032553_2011_2985 | 271 |
| 481 | 3300046471 | Ga0495650_0049453 | Ga0495650_0049453_171_1007 | 271 |
| 482 | 3300046472 | Ga0495580_0087958 | Ga0495580_0087958_365_1339 | 271 |
| 483 | 3300046477 | Ga0495664_0023263 | Ga0495664_0023263_2305_3279 | 271 |
| 484 | 3300046506 | Ga0495583_0040030 | Ga0495583_0040030_655_1503 | 271 |
| 485 | 3300046507 | Ga0495606_0131210 | Ga0495606_0131210_408_1247 | 271 |
| 486 | 3300046511 | Ga0495608_0008405 | Ga0495608_0008405_5980_6954 | 271 |
| 487 | 3300046512 | Ga0495610_0010882 | Ga0495610_0010882_2198_3031 | 271 |
| 488 | 3300046514 | Ga0495618_0001639 | Ga0495618_0001639_2825_3799 | 271 |
| 489 | 3300046516 | Ga0495628_0051084 | Ga0495628_0051084_990_1964 | 271 |
| 490 | 3300046517 | Ga0495630_0043322 | Ga0495630_0043322_2106_3080 | 271 |
| 491 | 3300046524 | Ga0495648_0148488 | Ga0495648_0148488_296_1132 | 271 |
| 492 | 3300046529 | Ga0495652_0009632 | Ga0495652_0009632_1469_2443 | 271 |
| 493 | 3300046531 | Ga0495665_0135365 | Ga0495665_0135365_20_853 | 271 |
| 494 | 3300046533 | Ga0495640_0001593 | Ga0495640_0001593_5339_6313 | 271 |
| 495 | 3300046536 | Ga0495587_0001278 | Ga0495587_0001278_1792_2766 | 271 |
| 496 | 3300046559 | Ga0495667_0001611 | Ga0495667_0001611_4320_5294 | 271 |
| 497 | 3300046642 | Ga0495634_0006916 | Ga0495634_0006916_611_1585 | 271 |
| 498 | 3300046648 | Ga0495611_0009976 | Ga0495611_0009976_1250_2104 | 271 |
| 499 | 3300046660 | Ga0495625_0110236 | Ga0495625_0110236_842_1684 | 271 |
| 500 | 3300046663 | Ga0495635_0080504 | Ga0495635_0080504_179_1153 | 271 |
| 501 | 3300046674 | Ga0495588_0104592 | Ga0495588_0104592_62_901 | 271 |
| 502 | 3300046689 | Ga0495613_0062258 | Ga0495613_0062258_1388_2362 | 271 |
| 503 | 3300046694 | Ga0495649_0000676 | Ga0495649_0000676_6812_7651 | 271 |
| 504 | 3300046809 | Ga0495600_0002886 | Ga0495600_0002886_8736_9710 | 271 |
| 505 | 3300047315 | Ga0495581_0089191 | Ga0495581_0089191_595_1569 | 271 |
| 506 | 3300047317 | Ga0495604_0003637 | Ga0495604_0003637_3676_4650 | 271 |
| 507 | 3300047319 | Ga0495674_0017668 | Ga0495674_0017668_870_1844 | 271 |
| 508 | 3300047320 | Ga0495672_0016205 | Ga0495672_0016205_580_1428 | 271 |
| 509 | 3300047321 | Ga0495676_0039510 | Ga0495676_0039510_202_1176 | 271 |
| 510 | 3300047322 | Ga0495680_0002984 | Ga0495680_0002984_6298_7272 | 271 |
| 511 | 3300047323 | Ga0495683_0001721 | Ga0495683_0001721_4147_4986 | 271 |
| 512 | 3300047443 | Ga0495687_043352 | Ga0495687_043352_794_1630 | 271 |
| 513 | 3300047444 | Ga0495675_0001860 | Ga0495675_0001860_5272_6246 | 271 |
| 514 | 3300047469 | Ga0495673_0055249 | Ga0495673_0055249_751_1611 | 271 |
| 515 | 3300047469 | Ga0495673_0101741 | Ga0495673_0101741_248_1096 | 271 |
| 516 | 3300048091 | Ga0495626_0006181 | Ga0495626_0006181_784_1623 | 271 |
| 517 | 3300048903 | Ga0496100_0206015 | Ga0496100_0206015_119_958 | 271 |
| 518 | 3300048905 | Ga0496102_0247265 | Ga0496102_0247265_570_1397 | 271 |
| 519 | 3300048909 | Ga0496106_0000038 | Ga0496106_0000038_76750_77568 | 271 |
| 520 | 3300048910 | Ga0496107_0103060 | Ga0496107_0103060_216_1055 | 271 |
| 521 | 3300048916 | Ga0496113_0291332 | Ga0496113_0291332_79_915 | 271 |
| 522 | 3300048918 | Ga0496115_0210181 | Ga0496115_0210181_192_1028 | 271 |
| 523 | 3300048918 | Ga0496115_0513921 | Ga0496115_0513921_54_881 | 271 |
| 524 | 3300048920 | Ga0496117_0284641 | Ga0496117_0284641_17_853 | 271 |
| 525 | 3300048921 | Ga0496118_0056319 | Ga0496118_0056319_1098_1937 | 271 |
| 526 | 3300048924 | Ga0496121_0030860 | Ga0496121_0030860_2027_2863 | 271 |
| 527 | 3300048925 | Ga0496122_0010121 | Ga0496122_0010121_3676_4524 | 271 |
| 528 | 3300048927 | Ga0496124_0006231 | Ga0496124_0006231_9194_10060 | 271 |
| 529 | 3300048928 | Ga0496125_0000147 | Ga0496125_0000147_136398_137273 | 271 |
| 530 | 3300048928 | Ga0496125_0047398 | Ga0496125_0047398_1600_2436 | 271 |
| 531 | 3300048929 | Ga0496126_0007721 | Ga0496126_0007721_8607_9455 | 271 |
| 532 | 3300048929 | Ga0496126_0008802 | Ga0496126_0008802_3534_4382 | 271 |
| 533 | 3300049581 | Ga0501047_0178143 | Ga0501047_0178143_116_976 | 271 |
| 534 | 3300050490 | nmdc:mga03n38_27198_c1 | nmdc:mga03n38_27198_c1_565_1386 | 271 |
| 535 | 3300050491 | nmdc:mga00v17_149136_c1 | nmdc:mga00v17_149136_c1_280_1107 | 271 |
| 536 | 3300050492 | nmdc:mga0yw44_198650_c1 | nmdc:mga0yw44_198650_c1_119_955 | 271 |
| 537 | 3300050492 | nmdc:mga0yw44_401645_c1 | nmdc:mga0yw44_401645_c1_11_838 | 271 |
| 538 | 3300050492 | nmdc:mga0yw44_61919_c1 | nmdc:mga0yw44_61919_c1_214_1053 | 271 |
| 539 | 3300050494 | nmdc:mga06z11_213198_c1 | nmdc:mga06z11_213198_c1_273_1109 | 271 |
| 540 | 3300050516 | nmdc:mga0sz30_64442_c2 | nmdc:mga0sz30_64442_c2_198_1034 | 271 |
| 541 | 3300053077 | Ga0495601_0001473 | Ga0495601_0001473_5464_6438 | 271 |
| 542 | 3300053084 | Ga0495595_0000273 | Ga0495595_0000273_7407_8381 | 271 |
| 543 | 3300053085 | Ga0495619_0001384 | Ga0495619_0001384_1648_2622 | 271 |
| 544 | 3300053086 | Ga0500578_0061100 | Ga0500578_0061100_1025_1861 | 271 |
| 545 | 3300053087 | Ga0500643_000015 | Ga0500643_000015_100616_101452 | 271 |
| 546 | 3300053093 | Ga0500651_0024107 | Ga0500651_0024107_633_1451 | 271 |
| 547 | 3300053094 | Ga0500566_0002374 | Ga0500566_0002374_3059_3895 | 271 |
| 548 | 3300053104 | Ga0500556_0005410 | Ga0500556_0005410_798_1634 | 271 |
| 549 | 3300053134 | Ga0500658_0024307 | Ga0500658_0024307_654_1490 | 271 |
| 550 | 3300053134 | Ga0500658_0054279 | Ga0500658_0054279_607_1425 | 271 |
| 551 | 3300053139 | Ga0500568_0000280 | Ga0500568_0000280_34322_35140 | 271 |
| 552 | 3300053148 | Ga0500590_084526 | Ga0500590_084526_611_1447 | 271 |
| 553 | 3300053148 | Ga0500590_130848 | Ga0500590_130848_217_1053 | 271 |
| 554 | 3300053153 | Ga0500616_0001048 | Ga0500616_0001048_21903_22742 | 271 |
| 555 | 3300053153 | Ga0500616_0005377 | Ga0500616_0005377_1382_2224 | 271 |
| 556 | 3300053153 | Ga0500616_0040025 | Ga0500616_0040025_627_1463 | 271 |
| 557 | 3300053156 | Ga0500622_0081678 | Ga0500622_0081678_544_1380 | 271 |
| 558 | 3300053160 | Ga0500633_0007843 | Ga0500633_0007843_748_1584 | 271 |
| 559 | 3300053737 | Ga0500601_000209 | Ga0500601_000209_5129_5965 | 271 |
| 560 | iso_pu_bacteria | 2510917026 | 2511170756 | 271 |
| 561 | iso_pu_bacteria | 2511231028 | 2511394970 | 271 |
| 562 | iso_pu_bacteria | 2513237090 | 2513607878 | 271 |
| 563 | iso_pu_bacteria | 2513237095 | 2513645922 | 271 |
| 564 | iso_pu_bacteria | 2517093001 | 2517108339 | 271 |
| 565 | iso_pu_bacteria | 2528768022 | 2528851175 | 271 |
| 566 | iso_pu_bacteria | 2599185301 | 2599939469 | 271 |
| 567 | iso_pu_bacteria | 2602042107 | 2603859178 | 271 |
| 568 | iso_pu_bacteria | 2791355196 | 2793062476 | 271 |
| 569 | iso_pu_bacteria | 2816332527 | 2818238990 | 271 |
| 570 | iso_pu_bacteria | 2818991435 | 2819537966 | 271 |
| 571 | iso_pu_bacteria | 2818991454 | 2819648473 | 271 |
| 572 | iso_pu_bacteria | 2821123053 | 2821129408 | 271 |
| 573 | iso_pu_bacteria | 2824661429 | 2824670358 | 271 |
| 574 | iso_pu_bacteria | 2838736955 | 2838738559 | 271 |
| 575 | iso_pu_bacteria | 2841840854 | 2841841072 | 271 |
| 576 | iso_pu_bacteria | 2842140634 | 2842140850 | 271 |
| 577 | iso_pu_bacteria | 2849076700 | 2849079393 | 271 |
| 578 | iso_pu_bacteria | 2857524615 | 2857527769 | 271 |
| 579 | iso_pu_bacteria | 2857531043 | 2857535211 | 271 |
| 580 | iso_pu_bacteria | 2871495908 | 2871497031 | 271 |
| 581 | iso_pu_bacteria | 2874628541 | 2874631770 | 271 |
| 582 | iso_pu_bacteria | 2876392853 | 2876393559 | 271 |
| 583 | iso_pu_bacteria | 2876761206 | 2876767037 | 271 |
| 584 | iso_pu_bacteria | 2878760144 | 2878761231 | 271 |
| 585 | iso_pu_bacteria | 2878767105 | 2878768218 | 271 |
| 586 | iso_pu_bacteria | 2885305155 | 2885312355 | 271 |
| 587 | iso_pu_bacteria | 2885334103 | 2885340953 | 271 |
| 588 | iso_pu_bacteria | 2885383462 | 2885389262 | 271 |
| 589 | iso_pu_bacteria | 2888378607 | 2888383983 | 271 |
| 590 | iso_pu_bacteria | 2893066018 | 2893066510 | 271 |
| 591 | iso_pu_bacteria | 2903540706 | 2903541826 | 271 |
| 592 | iso_pu_bacteria | 2904659560 | 2904660067 | 271 |
| 593 | iso_pu_bacteria | 2919073203 | 2919079455 | 271 |
| 594 | iso_pu_bacteria | 2919171160 | 2919175411 | 271 |
| 595 | iso_pu_bacteria | 2922368715 | 2922374304 | 271 |
| 596 | iso_pu_bacteria | 2929615660 | 2929617978 | 271 |
| 597 | iso_pu_bacteria | 2929624759 | 2929627659 | 271 |
| 598 | iso_pu_bacteria | 2932784394 | 2932788240 | 271 |
| 599 | iso_pu_bacteria | 2932828146 | 2932831237 | 271 |
| 600 | iso_pu_bacteria | 2933577622 | 2933579906 | 271 |
| 601 | iso_pu_bacteria | 2935616580 | 2935622967 | 271 |
| 602 | iso_pu_bacteria | 2935638405 | 2935642327 | 271 |
| 603 | iso_pu_bacteria | 2935665750 | 2935668370 | 271 |
| 604 | iso_pu_bacteria | 2935675223 | 2935680503 | 271 |
| 605 | iso_pu_bacteria | 2935684952 | 2935692827 | 271 |
| 606 | iso_pu_bacteria | 2935694250 | 2935700996 | 271 |
| 607 | iso_pu_bacteria | 2935703347 | 2935706225 | 271 |
| 608 | iso_pu_bacteria | 2935713505 | 2935721448 | 271 |
| 609 | iso_pu_bacteria | 2935722832 | 2935730366 | 271 |
| 610 | iso_pu_bacteria | 2935732158 | 2935740379 | 271 |
| 611 | iso_pu_bacteria | 2935741537 | 2935749643 | 271 |
| 612 | iso_pu_bacteria | 2935750917 | 2935759044 | 271 |
| 613 | iso_pu_bacteria | 2935777560 | 2935778463 | 271 |
| 614 | iso_pu_bacteria | 2935801545 | 2935803225 | 271 |
| 615 | iso_pu_bacteria | 2935810662 | 2935814545 | 271 |
| 616 | iso_pu_bacteria | 2935827899 | 2935831683 | 271 |
| 617 | iso_pu_bacteria | 2935837841 | 2935838551 | 271 |
| 618 | iso_pu_bacteria | 2935855204 | 2935861215 | 271 |
| 619 | iso_pu_bacteria | 2935864058 | 2935865753 | 271 |
| 620 | iso_pu_bacteria | 2935873716 | 2935878254 | 271 |
| 621 | iso_pu_bacteria | 2935992306 | 2935994567 | 271 |
| 622 | iso_pu_bacteria | 2936002035 | 2936007633 | 271 |
| 623 | iso_pu_bacteria | 2936037263 | 2936040102 | 271 |
| 624 | iso_pu_bacteria | 2937994558 | 2937995659 | 271 |
| 625 | iso_pu_bacteria | 2940556831 | 2940564951 | 271 |
| 626 | iso_pu_bacteria | 2941538514 | 2941538781 | 271 |
| 627 | iso_pu_bacteria | 2958165035 | 2958166155 | 271 |
| 628 | iso_pu_bacteria | 2961114664 | 2961115392 | 271 |
| 629 | iso_pu_bacteria | 2961163497 | 2961164617 | 271 |
| 630 | iso_pu_bacteria | 2965018300 | 2965019045 | 271 |
| 631 | iso_pu_bacteria | 2968110612 | 2968111123 | 271 |
| 632 | iso_pu_bacteria | 2968171901 | 2968172997 | 271 |
| 633 | iso_pu_bacteria | 2970554993 | 2970556090 | 271 |
| 634 | iso_pu_bacteria | 2977864932 | 2977868032 | 271 |
| 635 | iso_pu_bacteria | 2987636660 | 2987643194 | 271 |
| 636 | iso_pu_bacteria | 2987659509 | 2987660604 | 271 |
| 637 | iso_pu_bacteria | 3004188549 | 3004189652 | 271 |
| 638 | iso_pu_bacteria | 3004203850 | 3004206742 | 271 |
| 639 | iso_pu_bacteria | 8016511872 | 8016522426 | 271 |
| 640 | iso_pu_bacteria | 8016522445 | 8016529690 | 271 |
| 641 | iso_pu_bacteria | 8016530956 | 8016534911 | 271 |
| 642 | iso_pu_bacteria | 8016539877 | 8016548119 | 271 |
| 643 | iso_pu_bacteria | 8016548790 | 8016554004 | 271 |
| 644 | iso_pu_bacteria | 8016557553 | 8016562380 | 271 |
| 645 | iso_pu_bacteria | 8016566248 | 8016573255 | 271 |
| 646 | iso_pu_bacteria | 8016575299 | 8016577397 | 271 |
| 647 | iso_pu_bacteria | 8016595262 | 8016600180 | 271 |
| 648 | iso_pu_bacteria | 8016603502 | 8016610571 | 271 |
| 649 | iso_pu_bacteria | 8016622563 | 8016626627 | 271 |
| 650 | iso_pu_bacteria | 8017057580 | 8017063136 | 271 |
| 651 | iso_pu_bacteria | 8019530166 | 8019534671 | 271 |
| 652 | iso_pu_bacteria | 8019547302 | 8019553736 | 271 |
| 653 | iso_pu_bacteria | 8019576017 | 8019582570 | 271 |
| 654 | iso_pu_bacteria | 8019586578 | 8019590359 | 271 |
| 655 | iso_pu_bacteria | 8019597564 | 8019600993 | 271 |
| 656 | iso_pu_bacteria | 8019608314 | 8019617560 | 271 |
| 657 | iso_pu_bacteria | 8055742211 | 8055746433 | 271 |
| 658 | iso_pu_bacteria | 8056681323 | 8056686832 | 271 |
| 659 | 3300002067 | JGI24735J21928_10002093 | JGI24735J21928_100020936 | 272 |
| 660 | 3300002773 | JGI25152J39213_1001392 | JGI25152J39213_10013925 | 272 |
| 661 | 3300002773 | JGI25152J39213_1002012 | JGI25152J39213_10020128 | 272 |
| 662 | 3300002773 | JGI25152J39213_1003675 | JGI25152J39213_10036753 | 272 |
| 663 | 3300003214 | JGI25165J46597_1007037 | JGI25165J46597_10070372 | 272 |
| 664 | 3300003215 | JGI25153J46596_10002531 | JGI25153J46596_100025319 | 272 |
| 665 | 3300003215 | JGI25153J46596_10003111 | JGI25153J46596_100031118 | 272 |
| 666 | 3300003790 | Ga0055528_1008010 | Ga0055528_10080102 | 272 |
| 667 | 3300003790 | Ga0055528_1008628 | Ga0055528_10086282 | 272 |
| 668 | 3300003856 | Ga0058692_1017924 | Ga0058692_10179242 | 272 |
| 669 | 3300005548 | Ga0070665_100033014 | Ga0070665_1000330148 | 272 |
| 670 | 3300005563 | Ga0068855_100131256 | Ga0068855_1001312563 | 272 |
| 671 | 3300005578 | Ga0068854_100013817 | Ga0068854_1000138174 | 272 |
| 672 | 3300005616 | Ga0068852_100059793 | Ga0068852_1000597934 | 272 |
| 673 | 3300005618 | Ga0068864_100420637 | Ga0068864_1004206372 | 272 |
| 674 | 3300009093 | Ga0105240_10000027 | Ga0105240_10000027136 | 272 |
| 675 | 3300009545 | Ga0105237_10003395 | Ga0105237_1000339514 | 272 |
| 676 | 3300009551 | Ga0105238_10021242 | Ga0105238_100212423 | 272 |
| 677 | 3300010375 | Ga0105239_10422011 | Ga0105239_104220112 | 272 |
| 678 | 3300013104 | Ga0157370_10000048 | Ga0157370_10000048116 | 272 |
| 679 | 3300013105 | Ga0157369_10072699 | Ga0157369_100726995 | 272 |
| 680 | 3300014497 | Ga0182008_10007814 | Ga0182008_100078147 | 272 |
| 681 | 3300015262 | Ga0182007_10004419 | Ga0182007_100044192 | 272 |
| 682 | 3300015265 | Ga0182005_1006489 | Ga0182005_10064893 | 272 |
| 683 | 3300021384 | Ga0213876_10002722 | Ga0213876_100027222 | 272 |
| 684 | 3300025233 | Ga0209437_106410 | Ga0209437_1064103 | 272 |
| 685 | 3300025245 | Ga0207425_1000695 | Ga0207425_10006955 | 272 |
| 686 | 3300025253 | Ga0209677_100188 | Ga0209677_10018812 | 272 |
| 687 | 3300025256 | Ga0209759_1013026 | Ga0209759_10130262 | 272 |
| 688 | 3300025258 | Ga0209129_1000244 | Ga0209129_100024426 | 272 |
| 689 | 3300025258 | Ga0209129_1000495 | Ga0209129_10004954 | 272 |
| 690 | 3300025258 | Ga0209129_1001683 | Ga0209129_10016838 | 272 |
| 691 | 3300025261 | Ga0209233_1000271 | Ga0209233_100027141 | 272 |
| 692 | 3300025261 | Ga0209233_1012104 | Ga0209233_10121042 | 272 |
| 693 | 3300025273 | Ga0209673_1005691 | Ga0209673_10056914 | 272 |
| 694 | 3300025294 | Ga0209025_1004158 | Ga0209025_10041585 | 272 |
| 695 | 3300025294 | Ga0209025_1006069 | Ga0209025_10060694 | 272 |
| 696 | 3300025295 | Ga0209564_1000225 | Ga0209564_100022550 | 272 |
| 697 | 3300025295 | Ga0209564_1009175 | Ga0209564_10091754 | 272 |
| 698 | 3300025297 | Ga0209758_1000463 | Ga0209758_100046362 | 272 |
| 699 | 3300025297 | Ga0209758_1005696 | Ga0209758_10056965 | 272 |
| 700 | 3300025298 | Ga0209050_1003257 | Ga0209050_10032573 | 272 |
| 701 | 3300025299 | Ga0209256_1003935 | Ga0209256_10039354 | 272 |
| 702 | 3300025304 | Ga0209257_1000504 | Ga0209257_100050438 | 272 |
| 703 | 3300025909 | Ga0207705_10121717 | Ga0207705_101217172 | 272 |
| 704 | 3300025913 | Ga0207695_10000024 | Ga0207695_10000024494 | 272 |
| 705 | 3300025914 | Ga0207671_10001033 | Ga0207671_1000103322 | 272 |
| 706 | 3300025923 | Ga0207681_10281232 | Ga0207681_102812322 | 272 |
| 707 | 3300026142 | Ga0207698_10025819 | Ga0207698_100258194 | 272 |
| 708 | 3300027312 | Ga0209371_1002388 | Ga0209371_10023885 | 272 |
| 709 | 3300028794 | Ga0307515_10023504 | Ga0307515_1002350412 | 272 |
| 710 | 3300030500 | Ga0268256_1001774 | Ga0268256_10017745 | 272 |
| 711 | 3300031247 | Ga0265340_10001482 | Ga0265340_1000148215 | 272 |
| 712 | 3300031548 | Ga0307408_100028470 | Ga0307408_1000284702 | 272 |
| 713 | 3300031730 | Ga0307516_10007025 | Ga0307516_1000702512 | 272 |
| 714 | 3300031730 | Ga0307516_10363460 | Ga0307516_103634602 | 272 |
| 715 | 3300031731 | Ga0307405_10121963 | Ga0307405_101219632 | 272 |
| 716 | 3300032002 | Ga0307416_100052282 | Ga0307416_1000522821 | 272 |
| 717 | 3300032004 | Ga0307414_10362035 | Ga0307414_103620351 | 272 |
| 718 | 3300032005 | Ga0307411_10131858 | Ga0307411_101318582 | 272 |
| 719 | 3300035692 | Ga0373935_0079801 | Ga0373935_0079801_1146_1988 | 272 |
| 720 | 3300035695 | Ga0373927_0000075 | Ga0373927_0000075_56006_56848 | 272 |
| 721 | 3300037068 | Ga0373925_0002684 | Ga0373925_0002684_5609_6451 | 272 |
| 722 | 3300039437 | Ga0436365_0323393 | Ga0436365_0323393_923_1744 | 272 |
| 723 | 3300041456 | Ga0451795_0492382 | Ga0451795_0492382_508_1344 | 272 |
| 724 | 3300041463 | Ga0451804_0698880 | Ga0451804_0698880_217_1053 | 272 |
| 725 | 3300041491 | Ga0451833_0669262 | Ga0451833_0669262_119_955 | 272 |
| 726 | 3300041509 | Ga0451843_1098918 | Ga0451843_1098918_103_939 | 272 |
| 727 | 3300041512 | Ga0451853_0765634 | Ga0451853_0765634_59_895 | 272 |
| 728 | 3300044684 | Ga0466966_0067641 | Ga0466966_0067641_621_1457 | 272 |
| 729 | 3300044684 | Ga0466966_0226123 | Ga0466966_0226123_72_911 | 272 |
| 730 | 3300044719 | Ga0466971_0111613 | Ga0466971_0111613_347_1174 | 272 |
| 731 | 3300045836 | Ga0466958_0165109 | Ga0466958_0165109_300_1133 | 272 |
| 732 | 3300046472 | Ga0495580_0008693 | Ga0495580_0008693_4151_5005 | 272 |
| 733 | 3300046512 | Ga0495610_0027152 | Ga0495610_0027152_621_1451 | 272 |
| 734 | 3300046512 | Ga0495610_0050110 | Ga0495610_0050110_938_1774 | 272 |
| 735 | 3300046530 | Ga0495654_0000121 | Ga0495654_0000121_48911_49735 | 272 |
| 736 | 3300046538 | Ga0495609_0078216 | Ga0495609_0078216_197_1030 | 272 |
| 737 | 3300046539 | Ga0495621_0060165 | Ga0495621_0060165_446_1309 | 272 |
| 738 | 3300046660 | Ga0495625_0026341 | Ga0495625_0026341_1969_2805 | 272 |
| 739 | 3300047472 | Ga0495686_0062523 | Ga0495686_0062523_912_1748 | 272 |
| 740 | 3300048090 | Ga0495615_0000019 | Ga0495615_0000019_5625_6467 | 272 |
| 741 | 3300048903 | Ga0496100_0091918 | Ga0496100_0091918_921_1745 | 272 |
| 742 | 3300048904 | Ga0496101_0012938 | Ga0496101_0012938_657_1526 | 272 |
| 743 | 3300048904 | Ga0496101_0199400 | Ga0496101_0199400_710_1534 | 272 |
| 744 | 3300048905 | Ga0496102_0015629 | Ga0496102_0015629_4095_4919 | 272 |
| 745 | 3300048906 | Ga0496103_0005197 | Ga0496103_0005197_1588_2412 | 272 |
| 746 | 3300048909 | Ga0496106_0071978 | Ga0496106_0071978_255_1079 | 272 |
| 747 | 3300048916 | Ga0496113_0063442 | Ga0496113_0063442_1463_2287 | 272 |
| 748 | 3300048919 | Ga0496116_0057523 | Ga0496116_0057523_1363_2187 | 272 |
| 749 | 3300048919 | Ga0496116_0127353 | Ga0496116_0127353_380_1210 | 272 |
| 750 | 3300048920 | Ga0496117_0004982 | Ga0496117_0004982_7945_8769 | 272 |
| 751 | 3300048921 | Ga0496118_0001729 | Ga0496118_0001729_11928_12752 | 272 |
| 752 | 3300048921 | Ga0496118_0088569 | Ga0496118_0088569_847_1707 | 272 |
| 753 | 3300048922 | Ga0496119_0017955 | Ga0496119_0017955_4070_4894 | 272 |
| 754 | 3300048924 | Ga0496121_0003867 | Ga0496121_0003867_5392_6216 | 272 |
| 755 | 3300048925 | Ga0496122_0014830 | Ga0496122_0014830_2310_3134 | 272 |
| 756 | 3300048926 | Ga0496123_0007813 | Ga0496123_0007813_5161_5985 | 272 |
| 757 | 3300048926 | Ga0496123_0014475 | Ga0496123_0014475_215_1075 | 272 |
| 758 | 3300048927 | Ga0496124_0030539 | Ga0496124_0030539_3337_4161 | 272 |
| 759 | 3300048927 | Ga0496124_0152413 | Ga0496124_0152413_42_869 | 272 |
| 760 | 3300048928 | Ga0496125_0016874 | Ga0496125_0016874_4026_4850 | 272 |
| 761 | 3300048928 | Ga0496125_0032900 | Ga0496125_0032900_3604_4464 | 272 |
| 762 | 3300048929 | Ga0496126_0134210 | Ga0496126_0134210_710_1534 | 272 |
| 763 | 3300048929 | Ga0496126_0155394 | Ga0496126_0155394_941_1789 | 272 |
| 764 | 3300049579 | Ga0501043_0496302 | Ga0501043_0496302_40_870 | 272 |
| 765 | 3300049671 | Ga0501238_017312 | Ga0501238_017312_170_991 | 272 |
| 766 | 3300049822 | Ga0501035_0003062 | Ga0501035_0003062_9176_10015 | 272 |
| 767 | 3300049822 | Ga0501035_0013181 | Ga0501035_0013181_673_1503 | 272 |
| 768 | 3300049823 | Ga0501044_0015688 | Ga0501044_0015688_5737_6567 | 272 |
| 769 | 3300050493 | nmdc:mga0k408_353677_c1 | nmdc:mga0k408_353677_c1_12_848 | 272 |
| 770 | 3300050516 | nmdc:mga0sz30_41697_c1 | nmdc:mga0sz30_41697_c1_300_1160 | 272 |
| 771 | 3300053086 | Ga0500578_0197278 | Ga0500578_0197278_75_917 | 272 |
| 772 | 3300053093 | Ga0500651_0001456 | Ga0500651_0001456_9581_10423 | 272 |
| 773 | 3300053103 | Ga0500555_001763 | Ga0500555_001763_1062_1904 | 272 |
| 774 | 3300053125 | Ga0500618_000171 | Ga0500618_000171_3205_4041 | 272 |
| 775 | 3300053142 | Ga0500577_0017103 | Ga0500577_0017103_911_1753 | 272 |
| 776 | 3300053146 | Ga0500588_0022002 | Ga0500588_0022002_743_1585 | 272 |
| 777 | 3300053156 | Ga0500622_0000170 | Ga0500622_0000170_23916_24746 | 272 |
| 778 | iso_pu_bacteria | 2513237096 | 2513654915 | 272 |
| 779 | iso_pu_bacteria | 2513237137 | 2513861287 | 272 |
| 780 | iso_pu_bacteria | 2513237145 | 2513916062 | 272 |
| 781 | iso_pu_bacteria | 2517572143 | 2517894634 | 272 |
| 782 | iso_pu_bacteria | 2667528174 | 2671115849 | 272 |
| 783 | iso_pu_bacteria | 2818991448 | 2819608891 | 272 |
| 784 | iso_pu_bacteria | 2842918807 | 2842919112 | 272 |
| 785 | iso_pu_bacteria | 2904690495 | 2904697021 | 272 |
| 786 | iso_pu_bacteria | 2906635258 | 2906641599 | 272 |
| 787 | iso_pu_bacteria | 2906660503 | 2906661303 | 272 |
| 788 | iso_pu_bacteria | 2908739725 | 2908744953 | 272 |
| 789 | iso_pu_bacteria | 2908756301 | 2908762710 | 272 |
| 790 | iso_pu_bacteria | 2909042592 | 2909046893 | 272 |
| 791 | iso_pu_bacteria | 2909399089 | 2909400142 | 272 |
| 792 | iso_pu_bacteria | 2919408235 | 2919408317 | 272 |
| 793 | iso_pu_bacteria | 2935630451 | 2935632078 | 272 |
| 794 | iso_pu_bacteria | 2936367885 | 2936372299 | 272 |
| 795 | iso_pu_bacteria | 2941507105 | 2941508026 | 272 |
| 796 | iso_pu_bacteria | 2941515067 | 2941515469 | 272 |
| 797 | iso_pu_bacteria | 2941523033 | 2941523956 | 272 |
| 798 | iso_pu_bacteria | 2953994433 | 2953994614 | 272 |
| 799 | iso_pu_bacteria | 3005474847 | 3005477704 | 272 |
| 800 | iso_pu_bacteria | 8005376324 | 8005379624 | 272 |
| 801 | iso_pu_bacteria | 8005682033 | 8005687470 | 272 |
| 802 | iso_pu_bacteria | 8056689827 | 8056695064 | 272 |
| 803 | 3300002773 | JGI25152J39213_1016124 | JGI25152J39213_10161241 | 273 |
| 804 | 3300003187 | JGI25151J46595_10004403 | JGI25151J46595_100044037 | 273 |
| 805 | 3300003187 | JGI25151J46595_10009539 | JGI25151J46595_100095396 | 273 |
| 806 | 3300003215 | JGI25153J46596_10013191 | JGI25153J46596_100131912 | 273 |
| 807 | 3300003775 | Ga0055524_1002658 | Ga0055524_10026589 | 273 |
| 808 | 3300003790 | Ga0055528_1000035 | Ga0055528_1000035118 | 273 |
| 809 | 3300003790 | Ga0055528_1000275 | Ga0055528_100027527 | 273 |
| 810 | 3300005327 | Ga0070658_10117893 | Ga0070658_101178933 | 273 |
| 811 | 3300005330 | Ga0070690_100222032 | Ga0070690_1002220322 | 273 |
| 812 | 3300005331 | Ga0070670_100000479 | Ga0070670_10000047916 | 273 |
| 813 | 3300005336 | Ga0070680_100015594 | Ga0070680_1000155941 | 273 |
| 814 | 3300005338 | Ga0068868_100573556 | Ga0068868_1005735561 | 273 |
| 815 | 3300005340 | Ga0070689_100432490 | Ga0070689_1004324901 | 273 |
| 816 | 3300005341 | Ga0070691_10095922 | Ga0070691_100959221 | 273 |
| 817 | 3300005347 | Ga0070668_100015545 | Ga0070668_1000155452 | 273 |
| 818 | 3300005366 | Ga0070659_100072498 | Ga0070659_1000724982 | 273 |
| 819 | 3300005366 | Ga0070659_100164653 | Ga0070659_1001646532 | 273 |
| 820 | 3300005445 | Ga0070708_100129949 | Ga0070708_1001299491 | 273 |
| 821 | 3300005455 | Ga0070663_100021715 | Ga0070663_1000217153 | 273 |
| 822 | 3300005455 | Ga0070663_100103027 | Ga0070663_1001030271 | 273 |
| 823 | 3300005457 | Ga0070662_100072927 | Ga0070662_1000729272 | 273 |
| 824 | 3300005458 | Ga0070681_10156768 | Ga0070681_101567683 | 273 |
| 825 | 3300005467 | Ga0070706_100124398 | Ga0070706_1001243981 | 273 |
| 826 | 3300005471 | Ga0070698_100030563 | Ga0070698_1000305636 | 273 |
| 827 | 3300005518 | Ga0070699_100299920 | Ga0070699_1002999202 | 273 |
| 828 | 3300005530 | Ga0070679_100174001 | Ga0070679_1001740013 | 273 |
| 829 | 3300005539 | Ga0068853_100065900 | Ga0068853_1000659003 | 273 |
| 830 | 3300005539 | Ga0068853_100093034 | Ga0068853_1000930342 | 273 |
| 831 | 3300005546 | Ga0070696_100270512 | Ga0070696_1002705121 | 273 |
| 832 | 3300005547 | Ga0070693_100065767 | Ga0070693_1000657672 | 273 |
| 833 | 3300005548 | Ga0070665_100109511 | Ga0070665_1001095112 | 273 |
| 834 | 3300005548 | Ga0070665_100180272 | Ga0070665_1001802723 | 273 |
| 835 | 3300005563 | Ga0068855_100050530 | Ga0068855_1000505303 | 273 |
| 836 | 3300005564 | Ga0070664_100149901 | Ga0070664_1001499012 | 273 |
| 837 | 3300005614 | Ga0068856_100134835 | Ga0068856_1001348352 | 273 |
| 838 | 3300005614 | Ga0068856_100216000 | Ga0068856_1002160002 | 273 |
| 839 | 3300005616 | Ga0068852_100001260 | Ga0068852_1000012608 | 273 |
| 840 | 3300005616 | Ga0068852_100225697 | Ga0068852_1002256972 | 273 |
| 841 | 3300005617 | Ga0068859_100216998 | Ga0068859_1002169983 | 273 |
| 842 | 3300005618 | Ga0068864_100017585 | Ga0068864_1000175853 | 273 |
| 843 | 3300005718 | Ga0068866_10067313 | Ga0068866_100673135 | 273 |
| 844 | 3300005719 | Ga0068861_100023482 | Ga0068861_1000234826 | 273 |
| 845 | 3300005841 | Ga0068863_100105367 | Ga0068863_1001053675 | 273 |
| 846 | 3300005843 | Ga0068860_100111840 | Ga0068860_1001118403 | 273 |
| 847 | 3300005844 | Ga0068862_100144624 | Ga0068862_1001446243 | 273 |
| 848 | 3300005937 | Ga0081455_10001542 | Ga0081455_1000154214 | 273 |
| 849 | 3300005937 | Ga0081455_10014958 | Ga0081455_100149582 | 273 |
| 850 | 3300005983 | Ga0081540_1019535 | Ga0081540_10195354 | 273 |
| 851 | 3300006038 | Ga0075365_10004790 | Ga0075365_100047907 | 273 |
| 852 | 3300006048 | Ga0075363_100065509 | Ga0075363_1000655093 | 273 |
| 853 | 3300006051 | Ga0075364_10029999 | Ga0075364_100299992 | 273 |
| 854 | 3300006178 | Ga0075367_10065559 | Ga0075367_100655593 | 273 |
| 855 | 3300006178 | Ga0075367_10137743 | Ga0075367_101377432 | 273 |
| 856 | 3300006186 | Ga0075369_10146409 | Ga0075369_101464091 | 273 |
| 857 | 3300006195 | Ga0075366_10031394 | Ga0075366_100313942 | 273 |
| 858 | 3300006195 | Ga0075366_10033710 | Ga0075366_100337103 | 273 |
| 859 | 3300006237 | Ga0097621_100064859 | Ga0097621_1000648593 | 273 |
| 860 | 3300006353 | Ga0075370_10056883 | Ga0075370_100568832 | 273 |
| 861 | 3300006844 | Ga0075428_100025112 | Ga0075428_1000251122 | 273 |
| 862 | 3300006871 | Ga0075434_100125782 | Ga0075434_1001257823 | 273 |
| 863 | 3300006931 | Ga0097620_100217015 | Ga0097620_1002170153 | 273 |
| 864 | 3300007265 | Ga0099794_10072951 | Ga0099794_100729512 | 273 |
| 865 | 3300007788 | Ga0099795_10071435 | Ga0099795_100714352 | 273 |
| 866 | 3300009011 | Ga0105251_10000251 | Ga0105251_1000025120 | 273 |
| 867 | 3300009036 | Ga0105244_10005524 | Ga0105244_100055246 | 273 |
| 868 | 3300009092 | Ga0105250_10000070 | Ga0105250_1000007058 | 273 |
| 869 | 3300009092 | Ga0105250_10001351 | Ga0105250_100013512 | 273 |
| 870 | 3300009093 | Ga0105240_10427502 | Ga0105240_104275022 | 273 |
| 871 | 3300009094 | Ga0111539_10105643 | Ga0111539_101056433 | 273 |
| 872 | 3300009098 | Ga0105245_10105248 | Ga0105245_101052483 | 273 |
| 873 | 3300009101 | Ga0105247_10201048 | Ga0105247_102010481 | 273 |
| 874 | 3300009147 | Ga0114129_10043432 | Ga0114129_100434325 | 273 |
| 875 | 3300009148 | Ga0105243_10124180 | Ga0105243_101241801 | 273 |
| 876 | 3300009176 | Ga0105242_10449428 | Ga0105242_104494282 | 273 |
| 877 | 3300009177 | Ga0105248_10317850 | Ga0105248_103178502 | 273 |
| 878 | 3300009551 | Ga0105238_10037001 | Ga0105238_100370014 | 273 |
| 879 | 3300009551 | Ga0105238_10152479 | Ga0105238_101524792 | 273 |
| 880 | 3300009553 | Ga0105249_10138742 | Ga0105249_101387422 | 273 |
| 881 | 3300009553 | Ga0105249_10265162 | Ga0105249_102651623 | 273 |
| 882 | 3300010159 | Ga0099796_10024312 | Ga0099796_100243122 | 273 |
| 883 | 3300010375 | Ga0105239_10303153 | Ga0105239_103031532 | 273 |
| 884 | 3300011119 | Ga0105246_10171803 | Ga0105246_101718032 | 273 |
| 885 | 3300013104 | Ga0157370_10143174 | Ga0157370_101431743 | 273 |
| 886 | 3300013105 | Ga0157369_10353584 | Ga0157369_103535842 | 273 |
| 887 | 3300013297 | Ga0157378_10092130 | Ga0157378_100921304 | 273 |
| 888 | 3300013306 | Ga0163162_10293531 | Ga0163162_102935313 | 273 |
| 889 | 3300014325 | Ga0163163_10414364 | Ga0163163_104143643 | 273 |
| 890 | 3300014326 | Ga0157380_10055433 | Ga0157380_100554333 | 273 |
| 891 | 3300014326 | Ga0157380_10222114 | Ga0157380_102221142 | 273 |
| 892 | 3300014326 | Ga0157380_10241406 | Ga0157380_102414062 | 273 |
| 893 | 3300014968 | Ga0157379_10136497 | Ga0157379_101364973 | 273 |
| 894 | 3300017792 | Ga0163161_10315766 | Ga0163161_103157662 | 273 |
| 895 | 3300021361 | Ga0213872_10005848 | Ga0213872_100058485 | 273 |
| 896 | 3300021388 | Ga0213875_10114015 | Ga0213875_101140152 | 273 |
| 897 | 3300021441 | Ga0213871_10035227 | Ga0213871_100352271 | 273 |
| 898 | 3300025254 | Ga0209148_1000947 | Ga0209148_10009474 | 273 |
| 899 | 3300025258 | Ga0209129_1000019 | Ga0209129_1000019134 | 273 |
| 900 | 3300025272 | Ga0209455_1001778 | Ga0209455_10017786 | 273 |
| 901 | 3300025273 | Ga0209673_1000132 | Ga0209673_1000132152 | 273 |
| 902 | 3300025292 | Ga0209676_1019408 | Ga0209676_10194082 | 273 |
| 903 | 3300025294 | Ga0209025_1000186 | Ga0209025_10001865 | 273 |
| 904 | 3300025294 | Ga0209025_1006600 | Ga0209025_10066007 | 273 |
| 905 | 3300025295 | Ga0209564_1015129 | Ga0209564_10151294 | 273 |
| 906 | 3300025297 | Ga0209758_1005502 | Ga0209758_10055022 | 273 |
| 907 | 3300025299 | Ga0209256_1000805 | Ga0209256_100080519 | 273 |
| 908 | 3300025303 | Ga0209051_1025340 | Ga0209051_10253401 | 273 |
| 909 | 3300025303 | Ga0209051_1036923 | Ga0209051_10369232 | 273 |
| 910 | 3300025315 | Ga0207697_10065277 | Ga0207697_100652771 | 273 |
| 911 | 3300025711 | Ga0207696_1000038 | Ga0207696_100003899 | 273 |
| 912 | 3300025735 | Ga0207713_1000002 | Ga0207713_1000002189 | 273 |
| 913 | 3300025900 | Ga0207710_10116799 | Ga0207710_101167991 | 273 |
| 914 | 3300025901 | Ga0207688_10025501 | Ga0207688_100255012 | 273 |
| 915 | 3300025904 | Ga0207647_10006363 | Ga0207647_100063638 | 273 |
| 916 | 3300025909 | Ga0207705_10000003 | Ga0207705_10000003578 | 273 |
| 917 | 3300025909 | Ga0207705_10022777 | Ga0207705_100227773 | 273 |
| 918 | 3300025912 | Ga0207707_10011916 | Ga0207707_1001191612 | 273 |
| 919 | 3300025913 | Ga0207695_10034241 | Ga0207695_100342414 | 273 |
| 920 | 3300025915 | Ga0207693_10463115 | Ga0207693_104631151 | 273 |
| 921 | 3300025917 | Ga0207660_10006535 | Ga0207660_1000653512 | 273 |
| 922 | 3300025919 | Ga0207657_10010100 | Ga0207657_100101005 | 273 |
| 923 | 3300025920 | Ga0207649_10001056 | Ga0207649_100010563 | 273 |
| 924 | 3300025921 | Ga0207652_10007891 | Ga0207652_1000789114 | 273 |
| 925 | 3300025925 | Ga0207650_10000896 | Ga0207650_1000089612 | 273 |
| 926 | 3300025927 | Ga0207687_10004421 | Ga0207687_100044216 | 273 |
| 927 | 3300025932 | Ga0207690_10010704 | Ga0207690_100107042 | 273 |
| 928 | 3300025933 | Ga0207706_10144278 | Ga0207706_101442782 | 273 |
| 929 | 3300025936 | Ga0207670_10366519 | Ga0207670_103665191 | 273 |
| 930 | 3300025941 | Ga0207711_10117033 | Ga0207711_101170332 | 273 |
| 931 | 3300025942 | Ga0207689_10045302 | Ga0207689_100453024 | 273 |
| 932 | 3300025949 | Ga0207667_10039559 | Ga0207667_100395594 | 273 |
| 933 | 3300025949 | Ga0207667_10135401 | Ga0207667_101354014 | 273 |
| 934 | 3300025972 | Ga0207668_10191932 | Ga0207668_101919322 | 273 |
| 935 | 3300026023 | Ga0207677_10044580 | Ga0207677_100445803 | 273 |
| 936 | 3300026035 | Ga0207703_10059069 | Ga0207703_100590694 | 273 |
| 937 | 3300026041 | Ga0207639_10106558 | Ga0207639_101065582 | 273 |
| 938 | 3300026041 | Ga0207639_10145583 | Ga0207639_101455831 | 273 |
| 939 | 3300026067 | Ga0207678_10002336 | Ga0207678_1000233610 | 273 |
| 940 | 3300026067 | Ga0207678_10018195 | Ga0207678_100181953 | 273 |
| 941 | 3300026078 | Ga0207702_10061728 | Ga0207702_100617282 | 273 |
| 942 | 3300026078 | Ga0207702_10075516 | Ga0207702_100755164 | 273 |
| 943 | 3300026078 | Ga0207702_10177897 | Ga0207702_101778972 | 273 |
| 944 | 3300026089 | Ga0207648_10021205 | Ga0207648_100212052 | 273 |
| 945 | 3300026118 | Ga0207675_100058584 | Ga0207675_1000585843 | 273 |
| 946 | 3300026121 | Ga0207683_10285599 | Ga0207683_102855992 | 273 |
| 947 | 3300026142 | Ga0207698_10001361 | Ga0207698_100013617 | 273 |
| 948 | 3300026142 | Ga0207698_10021118 | Ga0207698_100211184 | 273 |
| 949 | 3300028379 | Ga0268266_10065807 | Ga0268266_100658074 | 273 |
| 950 | 3300028379 | Ga0268266_10580761 | Ga0268266_105807612 | 273 |
| 951 | 3300028380 | Ga0268265_10090428 | Ga0268265_100904283 | 273 |
| 952 | 3300031251 | Ga0265327_10037340 | Ga0265327_100373402 | 273 |
| 953 | 3300031344 | Ga0265316_10032707 | Ga0265316_100327074 | 273 |
| 954 | 3300031456 | Ga0307513_10048472 | Ga0307513_100484724 | 273 |
| 955 | 3300031595 | Ga0265313_10004657 | Ga0265313_100046579 | 273 |
| 956 | 3300031711 | Ga0265314_10035472 | Ga0265314_100354724 | 273 |
| 957 | 3300031712 | Ga0265342_10048420 | Ga0265342_100484203 | 273 |
| 958 | 3300031730 | Ga0307516_10085294 | Ga0307516_100852942 | 273 |
| 959 | 3300031824 | Ga0307413_10158066 | Ga0307413_101580663 | 273 |
| 960 | 3300031911 | Ga0307412_10251708 | Ga0307412_102517082 | 273 |
| 961 | 3300031995 | Ga0307409_100035306 | Ga0307409_1000353064 | 273 |
| 962 | 3300032002 | Ga0307416_100726167 | Ga0307416_1007261671 | 273 |
| 963 | 3300032004 | Ga0307414_10490937 | Ga0307414_104909371 | 273 |
| 964 | 3300037312 | Ga0395899_0006184 | Ga0395899_0006184_7764_8645 | 273 |
| 965 | 3300037312 | Ga0395899_0086840 | Ga0395899_0086840_895_1722 | 273 |
| 966 | 3300037418 | Ga0395900_0071479 | Ga0395900_0071479_2198_3043 | 273 |
| 967 | 3300037418 | Ga0395900_0214937 | Ga0395900_0214937_1006_1887 | 273 |
| 968 | 3300037466 | Ga0395898_0011006 | Ga0395898_0011006_1302_2129 | 273 |
| 969 | 3300037471 | Ga0395905_0051129 | Ga0395905_0051129_2171_3016 | 273 |
| 970 | 3300037471 | Ga0395905_0114802 | Ga0395905_0114802_1575_2450 | 273 |
| 971 | 3300037853 | Ga0436364_0660405 | Ga0436364_0660405_1211_2050 | 273 |
| 972 | 3300038443 | Ga0395901_0103550 | Ga0395901_0103550_97_942 | 273 |
| 973 | 3300038443 | Ga0395901_0122396 | Ga0395901_0122396_1345_2172 | 273 |
| 974 | 3300039438 | Ga0436360_0297024 | Ga0436360_0297024_792_1646 | 273 |
| 975 | 3300039438 | Ga0436360_0726204 | Ga0436360_0726204_1004_1834 | 273 |
| 976 | 3300039438 | Ga0436360_1185545 | Ga0436360_1185545_264_1127 | 273 |
| 977 | 3300039447 | Ga0436361_0670522 | Ga0436361_0670522_1947_2810 | 273 |
| 978 | 3300039447 | Ga0436361_0797533 | Ga0436361_0797533_124_978 | 273 |
| 979 | 3300039447 | Ga0436361_0964227 | Ga0436361_0964227_401_1279 | 273 |
| 980 | 3300041451 | Ga0451791_1416907 | Ga0451791_1416907_69_941 | 273 |
| 981 | 3300041505 | Ga0451849_1014739 | Ga0451849_1014739_16_888 | 273 |
| 982 | 3300044658 | Ga0466972_0006944 | Ga0466972_0006944_3066_3920 | 273 |
| 983 | 3300044683 | Ga0466965_0007472 | Ga0466965_0007472_2972_3826 | 273 |
| 984 | 3300044684 | Ga0466966_0100604 | Ga0466966_0100604_867_1721 | 273 |
| 985 | 3300044706 | Ga0466964_0003960 | Ga0466964_0003960_853_1707 | 273 |
| 986 | 3300044735 | Ga0466968_0000823 | Ga0466968_0000823_5767_6621 | 273 |
| 987 | 3300044765 | Ga0466970_0225226 | Ga0466970_0225226_70_951 | 273 |
| 988 | 3300044842 | Ga0466957_0015382 | Ga0466957_0015382_2632_3486 | 273 |
| 989 | 3300045049 | Ga0466959_0096655 | Ga0466959_0096655_392_1246 | 273 |
| 990 | 3300046455 | Ga0495603_0041893 | Ga0495603_0041893_459_1295 | 273 |
| 991 | 3300046457 | Ga0495590_0023062 | Ga0495590_0023062_26_862 | 273 |
| 992 | 3300046460 | Ga0495638_0018101 | Ga0495638_0018101_2610_3473 | 273 |
| 993 | 3300046460 | Ga0495638_0242925 | Ga0495638_0242925_106_960 | 273 |
| 994 | 3300046474 | Ga0495605_0000052 | Ga0495605_0000052_94776_95618 | 273 |
| 995 | 3300046474 | Ga0495605_0023076 | Ga0495605_0023076_1599_2441 | 273 |
| 996 | 3300046475 | Ga0495639_0058142 | Ga0495639_0058142_328_1164 | 273 |
| 997 | 3300046501 | Ga0495607_0001263 | Ga0495607_0001263_5353_6198 | 273 |
| 998 | 3300046501 | Ga0495607_0056788 | Ga0495607_0056788_917_1768 | 273 |
| 999 | 3300046506 | Ga0495583_0004248 | Ga0495583_0004248_7686_8528 | 273 |
| 1000 | 3300046512 | Ga0495610_0039390 | Ga0495610_0039390_499_1344 | 273 |
| 1001 | 3300046518 | Ga0495631_0024202 | Ga0495631_0024202_814_1677 | 273 |
| 1002 | 3300046518 | Ga0495631_0049474 | Ga0495631_0049474_638_1474 | 273 |
| 1003 | 3300046519 | Ga0495632_0034083 | Ga0495632_0034083_500_1363 | 273 |
| 1004 | 3300046519 | Ga0495632_0146243 | Ga0495632_0146243_59_895 | 273 |
| 1005 | 3300046520 | Ga0495637_0008057 | Ga0495637_0008057_2029_2874 | 273 |
| 1006 | 3300046520 | Ga0495637_0019432 | Ga0495637_0019432_775_1611 | 273 |
| 1007 | 3300046524 | Ga0495648_0145620 | Ga0495648_0145620_344_1180 | 273 |
| 1008 | 3300046537 | Ga0495598_0048766 | Ga0495598_0048766_294_1130 | 273 |
| 1009 | 3300046538 | Ga0495609_0021486 | Ga0495609_0021486_80_973 | 273 |
| 1010 | 3300046542 | Ga0495597_0000061 | Ga0495597_0000061_2301_3146 | 273 |
| 1011 | 3300046616 | Ga0495668_0038969 | Ga0495668_0038969_69_911 | 273 |
| 1012 | 3300046648 | Ga0495611_0149054 | Ga0495611_0149054_165_1028 | 273 |
| 1013 | 3300046660 | Ga0495625_0093163 | Ga0495625_0093163_856_1719 | 273 |
| 1014 | 3300046664 | Ga0495659_0083925 | Ga0495659_0083925_71_943 | 273 |
| 1015 | 3300046665 | Ga0495661_0196980 | Ga0495661_0196980_65_937 | 273 |
| 1016 | 3300046684 | Ga0495669_0059080 | Ga0495669_0059080_870_1706 | 273 |
| 1017 | 3300046810 | Ga0495660_0000072 | Ga0495660_0000072_25070_25912 | 273 |
| 1018 | 3300046810 | Ga0495660_0002969 | Ga0495660_0002969_7804_8649 | 273 |
| 1019 | 3300046810 | Ga0495660_0139256 | Ga0495660_0139256_76_921 | 273 |
| 1020 | 3300047320 | Ga0495672_0003920 | Ga0495672_0003920_8094_8945 | 273 |
| 1021 | 3300047320 | Ga0495672_0011899 | Ga0495672_0011899_2341_3174 | 273 |
| 1022 | 3300047321 | Ga0495676_0054173 | Ga0495676_0054173_2280_3116 | 273 |
| 1023 | 3300047469 | Ga0495673_0000112 | Ga0495673_0000112_18322_19167 | 273 |
| 1024 | 3300047472 | Ga0495686_0063181 | Ga0495686_0063181_227_1087 | 273 |
| 1025 | 3300048904 | Ga0496101_0206713 | Ga0496101_0206713_189_1025 | 273 |
| 1026 | 3300048907 | Ga0496104_0209376 | Ga0496104_0209376_257_1093 | 273 |
| 1027 | 3300048909 | Ga0496106_0236611 | Ga0496106_0236611_182_1006 | 273 |
| 1028 | 3300048921 | Ga0496118_0226947 | Ga0496118_0226947_196_1059 | 273 |
| 1029 | 3300048924 | Ga0496121_0000571 | Ga0496121_0000571_10639_11502 | 273 |
| 1030 | 3300048927 | Ga0496124_0000047 | Ga0496124_0000047_76930_77823 | 273 |
| 1031 | 3300048927 | Ga0496124_0051479 | Ga0496124_0051479_182_1045 | 273 |
| 1032 | 3300048928 | Ga0496125_0016401 | Ga0496125_0016401_3925_4788 | 273 |
| 1033 | 3300048928 | Ga0496125_0257440 | Ga0496125_0257440_77_928 | 273 |
| 1034 | 3300048929 | Ga0496126_0569132 | Ga0496126_0569132_15_878 | 273 |
| 1035 | 3300049570 | Ga0501033_0024051 | Ga0501033_0024051_3373_4197 | 273 |
| 1036 | 3300049571 | Ga0501034_0152998 | Ga0501034_0152998_371_1195 | 273 |
| 1037 | 3300049572 | Ga0501036_0408284 | Ga0501036_0408284_194_1018 | 273 |
| 1038 | 3300049579 | Ga0501043_0283284 | Ga0501043_0283284_121_945 | 273 |
| 1039 | 3300049581 | Ga0501047_0002924 | Ga0501047_0002924_2576_3400 | 273 |
| 1040 | 3300049583 | Ga0501067_0114972 | Ga0501067_0114972_92_928 | 273 |
| 1041 | 3300049585 | Ga0501069_0194401 | Ga0501069_0194401_304_1140 | 273 |
| 1042 | 3300049585 | Ga0501069_0301155 | Ga0501069_0301155_82_906 | 273 |
| 1043 | 3300049586 | Ga0501070_0000284 | Ga0501070_0000284_10224_11048 | 273 |
| 1044 | 3300049590 | Ga0501074_0196601 | Ga0501074_0196601_227_1051 | 273 |
| 1045 | 3300049742 | Ga0501080_0000843 | Ga0501080_0000843_9913_10737 | 273 |
| 1046 | 3300049822 | Ga0501035_0003018 | Ga0501035_0003018_14858_15682 | 273 |
| 1047 | 3300049823 | Ga0501044_0121116 | Ga0501044_0121116_250_1074 | 273 |
| 1048 | 3300050492 | nmdc:mga0yw44_2135_c2 | nmdc:mga0yw44_2135_c2_4479_5315 | 273 |
| 1049 | 3300050493 | nmdc:mga0k408_55598_c1 | nmdc:mga0k408_55598_c1_909_1745 | 273 |
| 1050 | 3300050495 | nmdc:mga04h51_11849_c1 | nmdc:mga04h51_11849_c1_1379_2215 | 273 |
| 1051 | 3300050496 | nmdc:mga07m45_5016_c1 | nmdc:mga07m45_5016_c1_844_1671 | 273 |
| 1052 | 3300053096 | Ga0500641_0015222 | Ga0500641_0015222_1095_1931 | 273 |
| 1053 | 3300053104 | Ga0500556_0015933 | Ga0500556_0015933_259_1122 | 273 |
| 1054 | 3300053108 | Ga0500562_032663 | Ga0500562_032663_458_1285 | 273 |
| 1055 | 3300053119 | Ga0500595_002383 | Ga0500595_002383_4546_5409 | 273 |
| 1056 | 3300053125 | Ga0500618_000107 | Ga0500618_000107_30742_31584 | 273 |
| 1057 | 3300053125 | Ga0500618_000774 | Ga0500618_000774_8446_9282 | 273 |
| 1058 | 3300053136 | Ga0500559_0001322 | Ga0500559_0001322_240_1073 | 273 |
| 1059 | 3300053136 | Ga0500559_0009365 | Ga0500559_0009365_3187_4011 | 273 |
| 1060 | 3300053139 | Ga0500568_0018704 | Ga0500568_0018704_2109_2942 | 273 |
| 1061 | 3300053140 | Ga0500573_0020981 | Ga0500573_0020981_230_1063 | 273 |
| 1062 | 3300053156 | Ga0500622_0048137 | Ga0500622_0048137_268_1101 | 273 |
| 1063 | 3300053724 | Ga0500570_052796 | Ga0500570_052796_82_948 | 273 |
| 1064 | 3300054114 | Ga0501084_0164817 | Ga0501084_0164817_303_1148 | 273 |
| 1065 | 3300054114 | Ga0501084_0173328 | Ga0501084_0173328_182_1027 | 273 |
| 1066 | 3300060353 | Ga0501082_0275649 | Ga0501082_0275649_346_1191 | 273 |
| 1067 | iso_pu_bacteria | 2513237151 | 2513959063 | 273 |
| 1068 | iso_pu_bacteria | 2526164713 | 2527076362 | 273 |
| 1069 | iso_pu_bacteria | 2599185354 | 2600202852 | 273 |
| 1070 | iso_pu_bacteria | 2617270742 | 2617380731 | 273 |
| 1071 | iso_pu_bacteria | 2842482326 | 2842487266 | 273 |
| 1072 | iso_pu_bacteria | 2855730933 | 2855732351 | 273 |
| 1073 | iso_pu_bacteria | 2855767633 | 2855769059 | 273 |
| 1074 | iso_pu_bacteria | 2881412998 | 2881415064 | 273 |
| 1075 | iso_pu_bacteria | 2919404418 | 2919405550 | 273 |
| 1076 | 3300001989 | JGI24739J22299_10062697 | JGI24739J22299_100626971 | 274 |
| 1077 | 3300003761 | Ga0055535_1001904 | Ga0055535_10019048 | 274 |
| 1078 | 3300003762 | Ga0055542_1001119 | Ga0055542_10011198 | 274 |
| 1079 | 3300003763 | Ga0055529_1000247 | Ga0055529_100024736 | 274 |
| 1080 | 3300003771 | Ga0055526_1007264 | Ga0055526_10072645 | 274 |
| 1081 | 3300003771 | Ga0055526_1024832 | Ga0055526_10248322 | 274 |
| 1082 | 3300003775 | Ga0055524_1035328 | Ga0055524_10353281 | 274 |
| 1083 | 3300003856 | Ga0058692_1017822 | Ga0058692_10178221 | 274 |
| 1084 | 3300005262 | Ga0065165_1000979 | Ga0065165_100097912 | 274 |
| 1085 | 3300005334 | Ga0068869_100156270 | Ga0068869_1001562703 | 274 |
| 1086 | 3300005339 | Ga0070660_100000315 | Ga0070660_1000003151 | 274 |
| 1087 | 3300005344 | Ga0070661_100219031 | Ga0070661_1002190311 | 274 |
| 1088 | 3300005353 | Ga0070669_100127687 | Ga0070669_1001276872 | 274 |
| 1089 | 3300005355 | Ga0070671_100180736 | Ga0070671_1001807362 | 274 |
| 1090 | 3300005366 | Ga0070659_100000858 | Ga0070659_1000008582 | 274 |
| 1091 | 3300005444 | Ga0070694_100264525 | Ga0070694_1002645252 | 274 |
| 1092 | 3300005445 | Ga0070708_100119305 | Ga0070708_1001193051 | 274 |
| 1093 | 3300005455 | Ga0070663_100009112 | Ga0070663_1000091124 | 274 |
| 1094 | 3300005455 | Ga0070663_100077640 | Ga0070663_1000776402 | 274 |
| 1095 | 3300005467 | Ga0070706_100051569 | Ga0070706_1000515694 | 274 |
| 1096 | 3300005471 | Ga0070698_100276563 | Ga0070698_1002765632 | 274 |
| 1097 | 3300005518 | Ga0070699_100435538 | Ga0070699_1004355382 | 274 |
| 1098 | 3300005535 | Ga0070684_100340743 | Ga0070684_1003407431 | 274 |
| 1099 | 3300005536 | Ga0070697_100429408 | Ga0070697_1004294082 | 274 |
| 1100 | 3300005539 | Ga0068853_100115707 | Ga0068853_1001157072 | 274 |
| 1101 | 3300005546 | Ga0070696_100038682 | Ga0070696_1000386824 | 274 |
| 1102 | 3300005547 | Ga0070693_100291419 | Ga0070693_1002914191 | 274 |
| 1103 | 3300005548 | Ga0070665_100030501 | Ga0070665_1000305013 | 274 |
| 1104 | 3300005549 | Ga0070704_100204943 | Ga0070704_1002049432 | 274 |
| 1105 | 3300005563 | Ga0068855_100413514 | Ga0068855_1004135141 | 274 |
| 1106 | 3300005564 | Ga0070664_100174906 | Ga0070664_1001749063 | 274 |
| 1107 | 3300005614 | Ga0068856_100296184 | Ga0068856_1002961842 | 274 |
| 1108 | 3300005618 | Ga0068864_100494737 | Ga0068864_1004947372 | 274 |
| 1109 | 3300005719 | Ga0068861_100043310 | Ga0068861_1000433103 | 274 |
| 1110 | 3300005840 | Ga0068870_10341595 | Ga0068870_103415951 | 274 |
| 1111 | 3300005841 | Ga0068863_100238374 | Ga0068863_1002383741 | 274 |
| 1112 | 3300005842 | Ga0068858_100378317 | Ga0068858_1003783171 | 274 |
| 1113 | 3300005985 | Ga0081539_10003744 | Ga0081539_1000374421 | 274 |
| 1114 | 3300006038 | Ga0075365_10116444 | Ga0075365_101164442 | 274 |
| 1115 | 3300006042 | Ga0075368_10023818 | Ga0075368_100238183 | 274 |
| 1116 | 3300006042 | Ga0075368_10168858 | Ga0075368_101688581 | 274 |
| 1117 | 3300006048 | Ga0075363_100006810 | Ga0075363_1000068104 | 274 |
| 1118 | 3300006186 | Ga0075369_10030499 | Ga0075369_100304992 | 274 |
| 1119 | 3300006195 | Ga0075366_10031045 | Ga0075366_100310454 | 274 |
| 1120 | 3300006195 | Ga0075366_10205551 | Ga0075366_102055512 | 274 |
| 1121 | 3300006353 | Ga0075370_10013990 | Ga0075370_100139903 | 274 |
| 1122 | 3300006353 | Ga0075370_10083054 | Ga0075370_100830542 | 274 |
| 1123 | 3300006353 | Ga0075370_10228067 | Ga0075370_102280672 | 274 |
| 1124 | 3300006914 | Ga0075436_100021452 | Ga0075436_1000214522 | 274 |
| 1125 | 3300006946 | Ga0079104_1000129 | Ga0079104_100012957 | 274 |
| 1126 | 3300009093 | Ga0105240_10000244 | Ga0105240_1000024459 | 274 |
| 1127 | 3300009093 | Ga0105240_10000333 | Ga0105240_1000033370 | 274 |
| 1128 | 3300009093 | Ga0105240_10002439 | Ga0105240_1000243910 | 274 |
| 1129 | 3300009093 | Ga0105240_10271630 | Ga0105240_102716301 | 274 |
| 1130 | 3300009147 | Ga0114129_10440338 | Ga0114129_104403382 | 274 |
| 1131 | 3300009545 | Ga0105237_10001533 | Ga0105237_1000153319 | 274 |
| 1132 | 3300009545 | Ga0105237_10127412 | Ga0105237_101274123 | 274 |
| 1133 | 3300009551 | Ga0105238_10140111 | Ga0105238_101401112 | 274 |
| 1134 | 3300009765 | Ga0123341_1002866 | Ga0123341_10028666 | 274 |
| 1135 | 3300009766 | Ga0123342_1019294 | Ga0123342_10192944 | 274 |
| 1136 | 3300010375 | Ga0105239_10000043 | Ga0105239_1000004386 | 274 |
| 1137 | 3300010375 | Ga0105239_10031365 | Ga0105239_100313655 | 274 |
| 1138 | 3300013100 | Ga0157373_10074765 | Ga0157373_100747653 | 274 |
| 1139 | 3300013105 | Ga0157369_10222361 | Ga0157369_102223611 | 274 |
| 1140 | 3300013306 | Ga0163162_10721983 | Ga0163162_107219832 | 274 |
| 1141 | 3300014968 | Ga0157379_10438532 | Ga0157379_104385321 | 274 |
| 1142 | 3300025228 | Ga0209672_100058 | Ga0209672_10005874 | 274 |
| 1143 | 3300025242 | Ga0209258_100164 | Ga0209258_10016480 | 274 |
| 1144 | 3300025250 | Ga0209026_1000231 | Ga0209026_100023124 | 274 |
| 1145 | 3300025254 | Ga0209148_1000039 | Ga0209148_1000039151 | 274 |
| 1146 | 3300025256 | Ga0209759_1000249 | Ga0209759_100024968 | 274 |
| 1147 | 3300025261 | Ga0209233_1015577 | Ga0209233_10155772 | 274 |
| 1148 | 3300025272 | Ga0209455_1000034 | Ga0209455_1000034152 | 274 |
| 1149 | 3300025295 | Ga0209564_1001247 | Ga0209564_100124727 | 274 |
| 1150 | 3300025295 | Ga0209564_1005262 | Ga0209564_10052622 | 274 |
| 1151 | 3300025299 | Ga0209256_1001833 | Ga0209256_10018332 | 274 |
| 1152 | 3300025304 | Ga0209257_1000350 | Ga0209257_100035073 | 274 |
| 1153 | 3300025900 | Ga0207710_10065256 | Ga0207710_100652562 | 274 |
| 1154 | 3300025909 | Ga0207705_10357598 | Ga0207705_103575981 | 274 |
| 1155 | 3300025910 | Ga0207684_10355458 | Ga0207684_103554582 | 274 |
| 1156 | 3300025913 | Ga0207695_10000171 | Ga0207695_10000171135 | 274 |
| 1157 | 3300025913 | Ga0207695_10000262 | Ga0207695_1000026262 | 274 |
| 1158 | 3300025913 | Ga0207695_10000623 | Ga0207695_1000062323 | 274 |
| 1159 | 3300025914 | Ga0207671_10001214 | Ga0207671_1000121419 | 274 |
| 1160 | 3300025914 | Ga0207671_10037705 | Ga0207671_100377053 | 274 |
| 1161 | 3300025919 | Ga0207657_10000002 | Ga0207657_10000002203 | 274 |
| 1162 | 3300025920 | Ga0207649_10241665 | Ga0207649_102416651 | 274 |
| 1163 | 3300025922 | Ga0207646_10044616 | Ga0207646_100446165 | 274 |
| 1164 | 3300025932 | Ga0207690_10000011 | Ga0207690_1000001123 | 274 |
| 1165 | 3300025945 | Ga0207679_10187937 | Ga0207679_101879372 | 274 |
| 1166 | 3300026023 | Ga0207677_10551624 | Ga0207677_105516241 | 274 |
| 1167 | 3300026067 | Ga0207678_10000677 | Ga0207678_1000067723 | 274 |
| 1168 | 3300026067 | Ga0207678_10007573 | Ga0207678_100075733 | 274 |
| 1169 | 3300026078 | Ga0207702_10286567 | Ga0207702_102865672 | 274 |
| 1170 | 3300026089 | Ga0207648_10280466 | Ga0207648_102804662 | 274 |
| 1171 | 3300026095 | Ga0207676_10109348 | Ga0207676_101093482 | 274 |
| 1172 | 3300026118 | Ga0207675_100076984 | Ga0207675_1000769843 | 274 |
| 1173 | 3300027111 | Ga0209281_1000036 | Ga0209281_1000036192 | 274 |
| 1174 | 3300027111 | Ga0209281_1000047 | Ga0209281_1000047134 | 274 |
| 1175 | 3300027312 | Ga0209371_1008437 | Ga0209371_10084374 | 274 |
| 1176 | 3300027866 | Ga0209813_10010292 | Ga0209813_100102922 | 274 |
| 1177 | 3300028379 | Ga0268266_10000827 | Ga0268266_1000082736 | 274 |
| 1178 | 3300030500 | Ga0268256_1037347 | Ga0268256_10373472 | 274 |
| 1179 | 3300031235 | Ga0265330_10055070 | Ga0265330_100550701 | 274 |
| 1180 | 3300031249 | Ga0265339_10029184 | Ga0265339_100291842 | 274 |
| 1181 | 3300031344 | Ga0265316_10269303 | Ga0265316_102693032 | 274 |
| 1182 | 3300031595 | Ga0265313_10002155 | Ga0265313_1000215517 | 274 |
| 1183 | 3300031911 | Ga0307412_10009672 | Ga0307412_100096723 | 274 |
| 1184 | 3300033180 | Ga0307510_10034816 | Ga0307510_100348163 | 274 |
| 1185 | 3300037312 | Ga0395899_0123084 | Ga0395899_0123084_344_1171 | 274 |
| 1186 | 3300039437 | Ga0436365_1424951 | Ga0436365_1424951_1720_2547 | 274 |
| 1187 | 3300039438 | Ga0436360_0253798 | Ga0436360_0253798_26_859 | 274 |
| 1188 | 3300039447 | Ga0436361_0609700 | Ga0436361_0609700_3873_4700 | 274 |
| 1189 | 3300044683 | Ga0466965_0050351 | Ga0466965_0050351_148_987 | 274 |
| 1190 | 3300044693 | Ga0466961_0002858 | Ga0466961_0002858_5133_5972 | 274 |
| 1191 | 3300044719 | Ga0466971_0007722 | Ga0466971_0007722_13_852 | 274 |
| 1192 | 3300044842 | Ga0466957_0030882 | Ga0466957_0030882_949_1788 | 274 |
| 1193 | 3300045836 | Ga0466958_0251067 | Ga0466958_0251067_180_1019 | 274 |
| 1194 | 3300046455 | Ga0495603_0012796 | Ga0495603_0012796_2995_3843 | 274 |
| 1195 | 3300046460 | Ga0495638_0000009 | Ga0495638_0000009_284175_285011 | 274 |
| 1196 | 3300046460 | Ga0495638_0051078 | Ga0495638_0051078_1437_2339 | 274 |
| 1197 | 3300046461 | Ga0495641_0127451 | Ga0495641_0127451_255_1103 | 274 |
| 1198 | 3300046499 | Ga0495594_0067940 | Ga0495594_0067940_1005_1853 | 274 |
| 1199 | 3300046507 | Ga0495606_0063266 | Ga0495606_0063266_390_1229 | 274 |
| 1200 | 3300046507 | Ga0495606_0121515 | Ga0495606_0121515_187_1062 | 274 |
| 1201 | 3300046519 | Ga0495632_0057548 | Ga0495632_0057548_734_1609 | 274 |
| 1202 | 3300046557 | Ga0495622_0014437 | Ga0495622_0014437_1282_2130 | 274 |
| 1203 | 3300046648 | Ga0495611_0174111 | Ga0495611_0174111_34_909 | 274 |
| 1204 | 3300046684 | Ga0495669_0088062 | Ga0495669_0088062_308_1144 | 274 |
| 1205 | 3300046694 | Ga0495649_0185092 | Ga0495649_0185092_68_961 | 274 |
| 1206 | 3300047469 | Ga0495673_0025561 | Ga0495673_0025561_942_1784 | 274 |
| 1207 | 3300047472 | Ga0495686_0021593 | Ga0495686_0021593_1189_2064 | 274 |
| 1208 | 3300048904 | Ga0496101_0007862 | Ga0496101_0007862_3898_4764 | 274 |
| 1209 | 3300048906 | Ga0496103_0199668 | Ga0496103_0199668_277_1152 | 274 |
| 1210 | 3300048907 | Ga0496104_0118467 | Ga0496104_0118467_1184_2038 | 274 |
| 1211 | 3300048908 | Ga0496105_0002129 | Ga0496105_0002129_7147_8007 | 274 |
| 1212 | 3300048908 | Ga0496105_0061342 | Ga0496105_0061342_792_1646 | 274 |
| 1213 | 3300048910 | Ga0496107_0079364 | Ga0496107_0079364_901_1749 | 274 |
| 1214 | 3300048918 | Ga0496115_0000354 | Ga0496115_0000354_35791_36618 | 274 |
| 1215 | 3300048918 | Ga0496115_0002784 | Ga0496115_0002784_3909_4775 | 274 |
| 1216 | 3300048918 | Ga0496115_0250655 | Ga0496115_0250655_142_981 | 274 |
| 1217 | 3300048918 | Ga0496115_0470043 | Ga0496115_0470043_11_838 | 274 |
| 1218 | 3300048919 | Ga0496116_0033234 | Ga0496116_0033234_1643_2503 | 274 |
| 1219 | 3300048920 | Ga0496117_0013888 | Ga0496117_0013888_3696_4562 | 274 |
| 1220 | 3300048920 | Ga0496117_0097680 | Ga0496117_0097680_686_1534 | 274 |
| 1221 | 3300048920 | Ga0496117_0194943 | Ga0496117_0194943_98_991 | 274 |
| 1222 | 3300048921 | Ga0496118_0004151 | Ga0496118_0004151_11410_12276 | 274 |
| 1223 | 3300048921 | Ga0496118_0010226 | Ga0496118_0010226_5111_5971 | 274 |
| 1224 | 3300048921 | Ga0496118_0098370 | Ga0496118_0098370_1020_1868 | 274 |
| 1225 | 3300048922 | Ga0496119_0000531 | Ga0496119_0000531_43947_44807 | 274 |
| 1226 | 3300048922 | Ga0496119_0075998 | Ga0496119_0075998_871_1695 | 274 |
| 1227 | 3300048923 | Ga0496120_0000182 | Ga0496120_0000182_62248_63108 | 274 |
| 1228 | 3300048923 | Ga0496120_0034351 | Ga0496120_0034351_625_1473 | 274 |
| 1229 | 3300048923 | Ga0496120_0059051 | Ga0496120_0059051_216_1040 | 274 |
| 1230 | 3300048923 | Ga0496120_0154338 | Ga0496120_0154338_102_977 | 274 |
| 1231 | 3300048924 | Ga0496121_0000341 | Ga0496121_0000341_31170_32018 | 274 |
| 1232 | 3300048924 | Ga0496121_0024997 | Ga0496121_0024997_2751_3602 | 274 |
| 1233 | 3300048924 | Ga0496121_0159027 | Ga0496121_0159027_585_1436 | 274 |
| 1234 | 3300048927 | Ga0496124_0000519 | Ga0496124_0000519_10263_11090 | 274 |
| 1235 | 3300048928 | Ga0496125_0057558 | Ga0496125_0057558_34_861 | 274 |
| 1236 | 3300048928 | Ga0496125_0127996 | Ga0496125_0127996_603_1478 | 274 |
| 1237 | 3300048929 | Ga0496126_0000412 | Ga0496126_0000412_11776_12603 | 274 |
| 1238 | 3300048929 | Ga0496126_0000996 | Ga0496126_0000996_18038_18904 | 274 |
| 1239 | 3300048929 | Ga0496126_0004035 | Ga0496126_0004035_1332_2171 | 274 |
| 1240 | 3300048929 | Ga0496126_0034921 | Ga0496126_0034921_2855_3703 | 274 |
| 1241 | 3300048929 | Ga0496126_0092056 | Ga0496126_0092056_1182_2009 | 274 |
| 1242 | 3300049570 | Ga0501033_0058238 | Ga0501033_0058238_1664_2491 | 274 |
| 1243 | 3300049571 | Ga0501034_0547310 | Ga0501034_0547310_43_870 | 274 |
| 1244 | 3300049579 | Ga0501043_0142602 | Ga0501043_0142602_251_1078 | 274 |
| 1245 | 3300049582 | Ga0501048_0001756 | Ga0501048_0001756_14408_15244 | 274 |
| 1246 | 3300049742 | Ga0501080_0707343 | Ga0501080_0707343_40_867 | 274 |
| 1247 | 3300050490 | nmdc:mga03n38_1460_c1 | nmdc:mga03n38_1460_c1_1115_1969 | 274 |
| 1248 | 3300050493 | nmdc:mga0k408_119964_c1 | nmdc:mga0k408_119964_c1_321_1175 | 274 |
| 1249 | 3300050494 | nmdc:mga06z11_13554_c1 | nmdc:mga06z11_13554_c1_373_1227 | 274 |
| 1250 | 3300050495 | nmdc:mga04h51_139194_c1 | nmdc:mga04h51_139194_c1_23_871 | 274 |
| 1251 | 3300050496 | nmdc:mga07m45_2086_c1 | nmdc:mga07m45_2086_c1_5361_6215 | 274 |
| 1252 | 3300050512 | nmdc:mga0n895_512243_c1 | nmdc:mga0n895_512243_c1_142_993 | 274 |
| 1253 | 3300050514 | nmdc:mga08x19_95087_c1 | nmdc:mga08x19_95087_c1_1024_1875 | 274 |
| 1254 | 3300050516 | nmdc:mga0sz30_73784_c1 | nmdc:mga0sz30_73784_c1_486_1328 | 274 |
| 1255 | 3300053094 | Ga0500566_0036407 | Ga0500566_0036407_508_1368 | 274 |
| 1256 | 3300053119 | Ga0500595_002644 | Ga0500595_002644_3186_4046 | 274 |
| 1257 | 3300053119 | Ga0500595_008876 | Ga0500595_008876_2366_3214 | 274 |
| 1258 | 3300053130 | Ga0500642_0009322 | Ga0500642_0009322_2421_3254 | 274 |
| 1259 | 3300053130 | Ga0500642_0010049 | Ga0500642_0010049_1623_2462 | 274 |
| 1260 | 3300053134 | Ga0500658_0050060 | Ga0500658_0050060_826_1680 | 274 |
| 1261 | 3300053136 | Ga0500559_0012928 | Ga0500559_0012928_1183_2010 | 274 |
| 1262 | 3300053136 | Ga0500559_0092836 | Ga0500559_0092836_498_1364 | 274 |
| 1263 | 3300053162 | Ga0500638_000308 | Ga0500638_000308_4841_5701 | 274 |
| 1264 | 3300053177 | Ga0500636_0136612 | Ga0500636_0136612_123_986 | 274 |
| 1265 | 3300053178 | Ga0500637_0002745 | Ga0500637_0002745_604_1464 | 274 |
| 1266 | 3300055283 | Ga0500661_000113 | Ga0500661_000113_534_1394 | 274 |
| 1267 | 3300061719 | Ga0466962_0030728 | Ga0466962_0030728_1368_2207 | 274 |
| 1268 | iso_pu_bacteria | 2936381700 | 2936386734 | 274 |
| 1269 | 3300002987 | JGI25159J45721_1000905 | JGI25159J45721_10009059 | 275 |
| 1270 | 3300003215 | JGI25153J46596_10027768 | JGI25153J46596_100277682 | 275 |
| 1271 | 3300003354 | JGI25160J50197_1000040 | JGI25160J50197_1000040135 | 275 |
| 1272 | 3300003374 | JGI25161J50226_1000023 | JGI25161J50226_1000023135 | 275 |
| 1273 | 3300003773 | Ga0055537_1001993 | Ga0055537_10019932 | 275 |
| 1274 | 3300004625 | Ga0055543_1000475 | Ga0055543_100047524 | 275 |
| 1275 | 3300005262 | Ga0065165_1000484 | Ga0065165_100048451 | 275 |
| 1276 | 3300005335 | Ga0070666_10393887 | Ga0070666_103938871 | 275 |
| 1277 | 3300005347 | Ga0070668_100115768 | Ga0070668_1001157682 | 275 |
| 1278 | 3300005355 | Ga0070671_100275443 | Ga0070671_1002754432 | 275 |
| 1279 | 3300005617 | Ga0068859_100342410 | Ga0068859_1003424102 | 275 |
| 1280 | 3300005842 | Ga0068858_100121251 | Ga0068858_1001212512 | 275 |
| 1281 | 3300005983 | Ga0081540_1012326 | Ga0081540_10123264 | 275 |
| 1282 | 3300006051 | Ga0075364_10014894 | Ga0075364_100148942 | 275 |
| 1283 | 3300006177 | Ga0075362_10050490 | Ga0075362_100504902 | 275 |
| 1284 | 3300006931 | Ga0097620_100342427 | Ga0097620_1003424272 | 275 |
| 1285 | 3300009101 | Ga0105247_10173540 | Ga0105247_101735402 | 275 |
| 1286 | 3300009551 | Ga0105238_10132971 | Ga0105238_101329714 | 275 |
| 1287 | 3300009553 | Ga0105249_10198558 | Ga0105249_101985582 | 275 |
| 1288 | 3300013308 | Ga0157375_10648729 | Ga0157375_106487292 | 275 |
| 1289 | 3300014968 | Ga0157379_10116279 | Ga0157379_101162792 | 275 |
| 1290 | 3300014969 | Ga0157376_10398976 | Ga0157376_103989762 | 275 |
| 1291 | 3300021358 | Ga0213873_10003441 | Ga0213873_100034412 | 275 |
| 1292 | 3300025261 | Ga0209233_1028404 | Ga0209233_10284042 | 275 |
| 1293 | 3300025273 | Ga0209673_1004907 | Ga0209673_10049076 | 275 |
| 1294 | 3300025273 | Ga0209673_1006226 | Ga0209673_10062263 | 275 |
| 1295 | 3300025284 | Ga0209130_1000142 | Ga0209130_100014299 | 275 |
| 1296 | 3300025295 | Ga0209564_1000021 | Ga0209564_1000021170 | 275 |
| 1297 | 3300025297 | Ga0209758_1002555 | Ga0209758_100255514 | 275 |
| 1298 | 3300025302 | Ga0207426_1000076 | Ga0207426_1000076285 | 275 |
| 1299 | 3300025924 | Ga0207694_10351902 | Ga0207694_103519022 | 275 |
| 1300 | 3300025931 | Ga0207644_10305534 | Ga0207644_103055341 | 275 |
| 1301 | 3300025936 | Ga0207670_10091957 | Ga0207670_100919572 | 275 |
| 1302 | 3300026035 | Ga0207703_10072639 | Ga0207703_100726393 | 275 |
| 1303 | 3300026067 | Ga0207678_10098500 | Ga0207678_100985003 | 275 |
| 1304 | 3300031903 | Ga0307407_10117837 | Ga0307407_101178372 | 275 |
| 1305 | 3300031911 | Ga0307412_10088437 | Ga0307412_100884372 | 275 |
| 1306 | 3300037312 | Ga0395899_0125427 | Ga0395899_0125427_322_1194 | 275 |
| 1307 | 3300037418 | Ga0395900_0193738 | Ga0395900_0193738_529_1401 | 275 |
| 1308 | 3300037466 | Ga0395898_0072686 | Ga0395898_0072686_621_1493 | 275 |
| 1309 | 3300038443 | Ga0395901_0045021 | Ga0395901_0045021_2095_2967 | 275 |
| 1310 | 3300039438 | Ga0436360_1375098 | Ga0436360_1375098_10474_11304 | 275 |
| 1311 | 3300039447 | Ga0436361_0816491 | Ga0436361_0816491_748_1578 | 275 |
| 1312 | 3300039453 | Ga0436362_0687917 | Ga0436362_0687917_2020_2850 | 275 |
| 1313 | 3300046459 | Ga0495629_0078860 | Ga0495629_0078860_1207_2061 | 275 |
| 1314 | 3300046471 | Ga0495650_0080079 | Ga0495650_0080079_294_1148 | 275 |
| 1315 | 3300046492 | Ga0495585_0143957 | Ga0495585_0143957_334_1182 | 275 |
| 1316 | 3300046506 | Ga0495583_0000109 | Ga0495583_0000109_124949_125821 | 275 |
| 1317 | 3300046518 | Ga0495631_0090419 | Ga0495631_0090419_187_1038 | 275 |
| 1318 | 3300046519 | Ga0495632_0000635 | Ga0495632_0000635_18419_19291 | 275 |
| 1319 | 3300046519 | Ga0495632_0097990 | Ga0495632_0097990_163_1008 | 275 |
| 1320 | 3300046519 | Ga0495632_0106518 | Ga0495632_0106518_357_1205 | 275 |
| 1321 | 3300046520 | Ga0495637_0002699 | Ga0495637_0002699_3182_4042 | 275 |
| 1322 | 3300046520 | Ga0495637_0027777 | Ga0495637_0027777_312_1184 | 275 |
| 1323 | 3300046533 | Ga0495640_0035889 | Ga0495640_0035889_103_1029 | 275 |
| 1324 | 3300046663 | Ga0495635_0193796 | Ga0495635_0193796_133_987 | 275 |
| 1325 | 3300046665 | Ga0495661_0000144 | Ga0495661_0000144_74157_75029 | 275 |
| 1326 | 3300046665 | Ga0495661_0033283 | Ga0495661_0033283_1085_1936 | 275 |
| 1327 | 3300046691 | Ga0495670_0127238 | Ga0495670_0127238_367_1218 | 275 |
| 1328 | 3300046810 | Ga0495660_0085077 | Ga0495660_0085077_679_1527 | 275 |
| 1329 | 3300047472 | Ga0495686_0059825 | Ga0495686_0059825_1234_2082 | 275 |
| 1330 | 3300047673 | Ga0495593_0097054 | Ga0495593_0097054_545_1399 | 275 |
| 1331 | 3300048088 | Ga0495602_0124858 | Ga0495602_0124858_596_1444 | 275 |
| 1332 | 3300048907 | Ga0496104_0157196 | Ga0496104_0157196_781_1635 | 275 |
| 1333 | 3300048910 | Ga0496107_0361136 | Ga0496107_0361136_46_894 | 275 |
| 1334 | 3300048911 | Ga0496108_0331983 | Ga0496108_0331983_340_1194 | 275 |
| 1335 | 3300048913 | Ga0496110_0208556 | Ga0496110_0208556_768_1622 | 275 |
| 1336 | 3300048915 | Ga0496112_0364095 | Ga0496112_0364095_362_1216 | 275 |
| 1337 | 3300048918 | Ga0496115_0001891 | Ga0496115_0001891_2715_3557 | 275 |
| 1338 | 3300048918 | Ga0496115_0035224 | Ga0496115_0035224_2001_2846 | 275 |
| 1339 | 3300048919 | Ga0496116_0011507 | Ga0496116_0011507_4277_5122 | 275 |
| 1340 | 3300048920 | Ga0496117_0030168 | Ga0496117_0030168_2487_3374 | 275 |
| 1341 | 3300048920 | Ga0496117_0087500 | Ga0496117_0087500_454_1302 | 275 |
| 1342 | 3300048921 | Ga0496118_0010237 | Ga0496118_0010237_1442_2311 | 275 |
| 1343 | 3300048921 | Ga0496118_0017638 | Ga0496118_0017638_924_1775 | 275 |
| 1344 | 3300048921 | Ga0496118_0060289 | Ga0496118_0060289_1323_2210 | 275 |
| 1345 | 3300048922 | Ga0496119_0107169 | Ga0496119_0107169_298_1143 | 275 |
| 1346 | 3300048924 | Ga0496121_0002861 | Ga0496121_0002861_19878_20765 | 275 |
| 1347 | 3300048924 | Ga0496121_0041642 | Ga0496121_0041642_2840_3688 | 275 |
| 1348 | 3300048924 | Ga0496121_0142300 | Ga0496121_0142300_284_1129 | 275 |
| 1349 | 3300048925 | Ga0496122_0016538 | Ga0496122_0016538_265_1116 | 275 |
| 1350 | 3300048926 | Ga0496123_0081921 | Ga0496123_0081921_953_1798 | 275 |
| 1351 | 3300048927 | Ga0496124_0116816 | Ga0496124_0116816_439_1284 | 275 |
| 1352 | 3300048928 | Ga0496125_0001951 | Ga0496125_0001951_15937_16782 | 275 |
| 1353 | 3300048928 | Ga0496125_0007113 | Ga0496125_0007113_4264_5109 | 275 |
| 1354 | 3300048929 | Ga0496126_0077562 | Ga0496126_0077562_107_952 | 275 |
| 1355 | 3300049580 | Ga0501046_0225640 | Ga0501046_0225640_191_1027 | 275 |
| 1356 | 3300050491 | nmdc:mga00v17_200076_c1 | nmdc:mga00v17_200076_c1_307_1152 | 275 |
| 1357 | 3300050492 | nmdc:mga0yw44_373759_c1 | nmdc:mga0yw44_373759_c1_18_908 | 275 |
| 1358 | 3300050492 | nmdc:mga0yw44_5143_c1 | nmdc:mga0yw44_5143_c1_1178_2023 | 275 |
| 1359 | 3300050494 | nmdc:mga06z11_114010_c1 | nmdc:mga06z11_114010_c1_325_1215 | 275 |
| 1360 | 3300053077 | Ga0495601_0040276 | Ga0495601_0040276_705_1631 | 275 |
| 1361 | 3300053087 | Ga0500643_033965 | Ga0500643_033965_394_1245 | 275 |
| 1362 | 3300053090 | Ga0500646_0040496 | Ga0500646_0040496_191_1042 | 275 |
| 1363 | 3300053093 | Ga0500651_0002351 | Ga0500651_0002351_5297_6148 | 275 |
| 1364 | 3300053094 | Ga0500566_0000499 | Ga0500566_0000499_1913_2761 | 275 |
| 1365 | 3300053096 | Ga0500641_0017967 | Ga0500641_0017967_644_1498 | 275 |
| 1366 | 3300053096 | Ga0500641_0025202 | Ga0500641_0025202_58_906 | 275 |
| 1367 | 3300053098 | Ga0500650_0000457 | Ga0500650_0000457_1840_2688 | 275 |
| 1368 | 3300053109 | Ga0500569_001911 | Ga0500569_001911_1241_2086 | 275 |
| 1369 | 3300053116 | Ga0500592_008090 | Ga0500592_008090_460_1308 | 275 |
| 1370 | 3300053118 | Ga0500594_0057800 | Ga0500594_0057800_73_927 | 275 |
| 1371 | 3300053119 | Ga0500595_002275 | Ga0500595_002275_6378_7217 | 275 |
| 1372 | 3300053119 | Ga0500595_018265 | Ga0500595_018265_1246_2127 | 275 |
| 1373 | 3300053122 | Ga0500608_001344 | Ga0500608_001344_6635_7483 | 275 |
| 1374 | 3300053130 | Ga0500642_0000010 | Ga0500642_0000010_150911_151759 | 275 |
| 1375 | 3300053134 | Ga0500658_0078373 | Ga0500658_0078373_169_1023 | 275 |
| 1376 | 3300053136 | Ga0500559_0004374 | Ga0500559_0004374_3653_4501 | 275 |
| 1377 | 3300053139 | Ga0500568_0002443 | Ga0500568_0002443_4727_5662 | 275 |
| 1378 | 3300053142 | Ga0500577_0107746 | Ga0500577_0107746_153_1007 | 275 |
| 1379 | 3300053145 | Ga0500586_001821 | Ga0500586_001821_1456_2313 | 275 |
| 1380 | 3300053147 | Ga0500589_027273 | Ga0500589_027273_447_1301 | 275 |
| 1381 | 3300053151 | Ga0500604_0020105 | Ga0500604_0020105_862_1716 | 275 |
| 1382 | 3300053153 | Ga0500616_0000014 | Ga0500616_0000014_75172_76017 | 275 |
| 1383 | 3300053156 | Ga0500622_0000266 | Ga0500622_0000266_38558_39406 | 275 |
| 1384 | 3300053156 | Ga0500622_0007539 | Ga0500622_0007539_3530_4432 | 275 |
| 1385 | 3300053161 | Ga0500634_0111099 | Ga0500634_0111099_153_1007 | 275 |
| 1386 | 3300053178 | Ga0500637_0034021 | Ga0500637_0034021_366_1214 | 275 |
| 1387 | iso_pu_bacteria | 2524023228 | 2524534375 | 275 |
| 1388 | iso_pu_bacteria | 2831864461 | 2831867807 | 275 |
| 1389 | iso_pu_bacteria | 2904699407 | 2904705668 | 275 |
| 1390 | iso_pu_bacteria | 8055431914 | 8055434644 | 275 |
| 1391 | iso_pu_bacteria | 8057575449 | 8057579340 | 275 |
| 1392 | 3300001979 | JGI24740J21852_10012680 | JGI24740J21852_100126803 | 276 |
| 1393 | 3300002737 | JGI25162J39368_1000353 | JGI25162J39368_10003534 | 276 |
| 1394 | 3300003214 | JGI25165J46597_1000390 | JGI25165J46597_100039021 | 276 |
| 1395 | 3300003322 | rootL2_10007895 | rootL2_100078959 | 276 |
| 1396 | 3300003578 | Ga0006562J51391_1101058 | Ga0006562J51391_11010583 | 276 |
| 1397 | 3300003578 | Ga0006562J51391_1101059 | Ga0006562J51391_11010592 | 276 |
| 1398 | 3300003790 | Ga0055528_1000044 | Ga0055528_100004490 | 276 |
| 1399 | 3300003791 | Ga0055530_10003087 | Ga0055530_100030873 | 276 |
| 1400 | 3300005262 | Ga0065165_1000041 | Ga0065165_100004153 | 276 |
| 1401 | 3300005355 | Ga0070671_100083820 | Ga0070671_1000838202 | 276 |
| 1402 | 3300006186 | Ga0075369_10021344 | Ga0075369_100213442 | 276 |
| 1403 | 3300006186 | Ga0075369_10049490 | Ga0075369_100494902 | 276 |
| 1404 | 3300006941 | Ga0099825_1037378 | Ga0099825_10373782 | 276 |
| 1405 | 3300006942 | Ga0099824_1004900 | Ga0099824_100490010 | 276 |
| 1406 | 3300006943 | Ga0099822_1000677 | Ga0099822_100067722 | 276 |
| 1407 | 3300009093 | Ga0105240_10506060 | Ga0105240_105060602 | 276 |
| 1408 | 3300009177 | Ga0105248_10113603 | Ga0105248_101136033 | 276 |
| 1409 | 3300009545 | Ga0105237_10306545 | Ga0105237_103065452 | 276 |
| 1410 | 3300009551 | Ga0105238_10005661 | Ga0105238_100056616 | 276 |
| 1411 | 3300009551 | Ga0105238_10274011 | Ga0105238_102740112 | 276 |
| 1412 | 3300010375 | Ga0105239_10305988 | Ga0105239_103059882 | 276 |
| 1413 | 3300013307 | Ga0157372_10336585 | Ga0157372_103365852 | 276 |
| 1414 | 3300014325 | Ga0163163_10395967 | Ga0163163_103959671 | 276 |
| 1415 | 3300014968 | Ga0157379_10033678 | Ga0157379_100336782 | 276 |
| 1416 | 3300025233 | Ga0209437_100050 | Ga0209437_10005064 | 276 |
| 1417 | 3300025261 | Ga0209233_1000037 | Ga0209233_1000037106 | 276 |
| 1418 | 3300025272 | Ga0209455_1025050 | Ga0209455_10250501 | 276 |
| 1419 | 3300025273 | Ga0209673_1000013 | Ga0209673_100001321 | 276 |
| 1420 | 3300025295 | Ga0209564_1000167 | Ga0209564_100016779 | 276 |
| 1421 | 3300025297 | Ga0209758_1000908 | Ga0209758_100090828 | 276 |
| 1422 | 3300025298 | Ga0209050_1000034 | Ga0209050_1000034259 | 276 |
| 1423 | 3300025299 | Ga0209256_1001227 | Ga0209256_100122720 | 276 |
| 1424 | 3300025304 | Ga0209257_1000052 | Ga0209257_1000052151 | 276 |
| 1425 | 3300025304 | Ga0209257_1000100 | Ga0209257_100010016 | 276 |
| 1426 | 3300025913 | Ga0207695_10468866 | Ga0207695_104688662 | 276 |
| 1427 | 3300025914 | Ga0207671_10068898 | Ga0207671_100688982 | 276 |
| 1428 | 3300025914 | Ga0207671_10085199 | Ga0207671_100851991 | 276 |
| 1429 | 3300027312 | Ga0209371_1003791 | Ga0209371_10037913 | 276 |
| 1430 | 3300027357 | Ga0209589_1000006 | Ga0209589_1000006273 | 276 |
| 1431 | 3300027361 | Ga0209489_100007 | Ga0209489_100007273 | 276 |
| 1432 | 3300027363 | Ga0209700_100008 | Ga0209700_100008273 | 276 |
| 1433 | 3300028379 | Ga0268266_10004137 | Ga0268266_1000413710 | 276 |
| 1434 | 3300028800 | Ga0265338_10267575 | Ga0265338_102675752 | 276 |
| 1435 | 3300030500 | Ga0268256_1003015 | Ga0268256_10030157 | 276 |
| 1436 | 3300031249 | Ga0265339_10040735 | Ga0265339_100407353 | 276 |
| 1437 | 3300031251 | Ga0265327_10000039 | Ga0265327_10000039109 | 276 |
| 1438 | 3300031712 | Ga0265342_10012050 | Ga0265342_100120502 | 276 |
| 1439 | 3300031730 | Ga0307516_10066047 | Ga0307516_100660473 | 276 |
| 1440 | 3300033442 | Ga0315911_1000010 | Ga0315911_1000010268 | 276 |
| 1441 | 3300037418 | Ga0395900_0022337 | Ga0395900_0022337_4662_5561 | 276 |
| 1442 | 3300037466 | Ga0395898_0109634 | Ga0395898_0109634_738_1637 | 276 |
| 1443 | 3300039438 | Ga0436360_0659817 | Ga0436360_0659817_217_1065 | 276 |
| 1444 | 3300041413 | Ga0439465_0000436 | Ga0439465_0000436_11222_12058 | 276 |
| 1445 | 3300044684 | Ga0466966_0126202 | Ga0466966_0126202_377_1210 | 276 |
| 1446 | 3300044719 | Ga0466971_0128557 | Ga0466971_0128557_242_1075 | 276 |
| 1447 | 3300044765 | Ga0466970_0000808 | Ga0466970_0000808_8416_9249 | 276 |
| 1448 | 3300045049 | Ga0466959_0205153 | Ga0466959_0205153_178_1011 | 276 |
| 1449 | 3300046528 | Ga0495642_0080362 | Ga0495642_0080362_220_1062 | 276 |
| 1450 | 3300046678 | Ga0495599_0286625 | Ga0495599_0286625_88_927 | 276 |
| 1451 | 3300047445 | Ga0495677_0060799 | Ga0495677_0060799_414_1256 | 276 |
| 1452 | 3300048909 | Ga0496106_0005325 | Ga0496106_0005325_3538_4377 | 276 |
| 1453 | 3300048915 | Ga0496112_0310368 | Ga0496112_0310368_16_858 | 276 |
| 1454 | 3300048920 | Ga0496117_0017228 | Ga0496117_0017228_1333_2172 | 276 |
| 1455 | 3300048920 | Ga0496117_0035813 | Ga0496117_0035813_2067_2900 | 276 |
| 1456 | 3300048921 | Ga0496118_0005800 | Ga0496118_0005800_10289_11119 | 276 |
| 1457 | 3300048921 | Ga0496118_0005874 | Ga0496118_0005874_2062_2901 | 276 |
| 1458 | 3300048922 | Ga0496119_0014656 | Ga0496119_0014656_745_1578 | 276 |
| 1459 | 3300048923 | Ga0496120_0043278 | Ga0496120_0043278_1605_2438 | 276 |
| 1460 | 3300048924 | Ga0496121_0000667 | Ga0496121_0000667_24336_25175 | 276 |
| 1461 | 3300048925 | Ga0496122_0013339 | Ga0496122_0013339_2463_3296 | 276 |
| 1462 | 3300048926 | Ga0496123_0083530 | Ga0496123_0083530_293_1126 | 276 |
| 1463 | 3300048927 | Ga0496124_0040044 | Ga0496124_0040044_2951_3784 | 276 |
| 1464 | 3300048929 | Ga0496126_0006811 | Ga0496126_0006811_6208_7047 | 276 |
| 1465 | 3300048929 | Ga0496126_0053580 | Ga0496126_0053580_2369_3226 | 276 |
| 1466 | 3300049570 | Ga0501033_0025341 | Ga0501033_0025341_1588_2436 | 276 |
| 1467 | 3300049571 | Ga0501034_0121216 | Ga0501034_0121216_443_1291 | 276 |
| 1468 | 3300049572 | Ga0501036_0222596 | Ga0501036_0222596_294_1142 | 276 |
| 1469 | 3300049573 | Ga0501037_0248019 | Ga0501037_0248019_109_957 | 276 |
| 1470 | 3300049576 | Ga0501040_0076211 | Ga0501040_0076211_541_1389 | 276 |
| 1471 | 3300049581 | Ga0501047_0066312 | Ga0501047_0066312_862_1710 | 276 |
| 1472 | 3300049582 | Ga0501048_0142240 | Ga0501048_0142240_509_1357 | 276 |
| 1473 | 3300049590 | Ga0501074_0113977 | Ga0501074_0113977_230_1078 | 276 |
| 1474 | 3300049741 | Ga0501079_0213929 | Ga0501079_0213929_110_958 | 276 |
| 1475 | 3300049822 | Ga0501035_0016883 | Ga0501035_0016883_1593_2441 | 276 |
| 1476 | 3300049823 | Ga0501044_0046990 | Ga0501044_0046990_2031_2879 | 276 |
| 1477 | 3300049824 | Ga0501045_0013913 | Ga0501045_0013913_2580_3428 | 276 |
| 1478 | 3300050516 | nmdc:mga0sz30_11749_c1 | nmdc:mga0sz30_11749_c1_335_1198 | 276 |
| 1479 | 3300053136 | Ga0500559_0007675 | Ga0500559_0007675_3649_4488 | 276 |
| 1480 | 3300053139 | Ga0500568_0010135 | Ga0500568_0010135_3030_3884 | 276 |
| 1481 | 3300053140 | Ga0500573_0012261 | Ga0500573_0012261_855_1694 | 276 |
| 1482 | 3300053146 | Ga0500588_0007669 | Ga0500588_0007669_988_1824 | 276 |
| 1483 | 3300053153 | Ga0500616_0000635 | Ga0500616_0000635_32584_33438 | 276 |
| 1484 | 3300053163 | Ga0500639_037476 | Ga0500639_037476_1427_2266 | 276 |
| 1485 | 3300053177 | Ga0500636_0039252 | Ga0500636_0039252_1476_2315 | 276 |
| 1486 | 3300053735 | Ga0500596_000940 | Ga0500596_000940_1760_2599 | 276 |
| 1487 | 3300054114 | Ga0501084_0401174 | Ga0501084_0401174_161_1009 | 276 |
| 1488 | iso_pu_bacteria | 2884411467 | 2884414197 | 276 |
| 1489 | iso_pu_bacteria | 8019555841 | 8019559428 | 276 |
| 1490 | 3300001979 | JGI24740J21852_10000570 | JGI24740J21852_100005709 | 277 |
| 1491 | 3300003214 | JGI25165J46597_1001069 | JGI25165J46597_100106915 | 277 |
| 1492 | 3300003756 | Ga0055533_1002720 | Ga0055533_10027205 | 277 |
| 1493 | 3300005355 | Ga0070671_100063246 | Ga0070671_1000632461 | 277 |
| 1494 | 3300005435 | Ga0070714_100026154 | Ga0070714_1000261542 | 277 |
| 1495 | 3300005436 | Ga0070713_100048994 | Ga0070713_1000489942 | 277 |
| 1496 | 3300005456 | Ga0070678_100028137 | Ga0070678_1000281372 | 277 |
| 1497 | 3300005539 | Ga0068853_100010248 | Ga0068853_1000102482 | 277 |
| 1498 | 3300005563 | Ga0068855_100021449 | Ga0068855_1000214493 | 277 |
| 1499 | 3300005564 | Ga0070664_100091297 | Ga0070664_1000912972 | 277 |
| 1500 | 3300005577 | Ga0068857_100017788 | Ga0068857_1000177884 | 277 |
| 1501 | 3300005578 | Ga0068854_100013343 | Ga0068854_1000133432 | 277 |
| 1502 | 3300005614 | Ga0068856_100002838 | Ga0068856_1000028386 | 277 |
| 1503 | 3300005616 | Ga0068852_100023118 | Ga0068852_1000231184 | 277 |
| 1504 | 3300005617 | Ga0068859_100614424 | Ga0068859_1006144242 | 277 |
| 1505 | 3300005618 | Ga0068864_100061876 | Ga0068864_1000618762 | 277 |
| 1506 | 3300005834 | Ga0068851_10000402 | Ga0068851_100004027 | 277 |
| 1507 | 3300005841 | Ga0068863_100093973 | Ga0068863_1000939732 | 277 |
| 1508 | 3300005843 | Ga0068860_100250103 | Ga0068860_1002501031 | 277 |
| 1509 | 3300006028 | Ga0070717_10038335 | Ga0070717_100383353 | 277 |
| 1510 | 3300006931 | Ga0097620_100614444 | Ga0097620_1006144442 | 277 |
| 1511 | 3300009093 | Ga0105240_10000301 | Ga0105240_1000030185 | 277 |
| 1512 | 3300009093 | Ga0105240_10004430 | Ga0105240_1000443010 | 277 |
| 1513 | 3300009093 | Ga0105240_10076156 | Ga0105240_100761563 | 277 |
| 1514 | 3300009174 | Ga0105241_10001668 | Ga0105241_100016683 | 277 |
| 1515 | 3300009176 | Ga0105242_10087007 | Ga0105242_100870072 | 277 |
| 1516 | 3300009545 | Ga0105237_10023955 | Ga0105237_100239554 | 277 |
| 1517 | 3300009551 | Ga0105238_10009609 | Ga0105238_100096097 | 277 |
| 1518 | 3300010375 | Ga0105239_10000769 | Ga0105239_1000076938 | 277 |
| 1519 | 3300010375 | Ga0105239_10015010 | Ga0105239_100150107 | 277 |
| 1520 | 3300010375 | Ga0105239_10213229 | Ga0105239_102132293 | 277 |
| 1521 | 3300021384 | Ga0213876_10144265 | Ga0213876_101442651 | 277 |
| 1522 | 3300025226 | Ga0209674_100048 | Ga0209674_100048247 | 277 |
| 1523 | 3300025233 | Ga0209437_100205 | Ga0209437_10020568 | 277 |
| 1524 | 3300025256 | Ga0209759_1000032 | Ga0209759_100003294 | 277 |
| 1525 | 3300025261 | Ga0209233_1000187 | Ga0209233_100018788 | 277 |
| 1526 | 3300025321 | Ga0207656_10005096 | Ga0207656_100050963 | 277 |
| 1527 | 3300025903 | Ga0207680_10093612 | Ga0207680_100936123 | 277 |
| 1528 | 3300025911 | Ga0207654_10000058 | Ga0207654_1000005818 | 277 |
| 1529 | 3300025913 | Ga0207695_10000399 | Ga0207695_1000039984 | 277 |
| 1530 | 3300025913 | Ga0207695_10000453 | Ga0207695_100004534 | 277 |
| 1531 | 3300025913 | Ga0207695_10117754 | Ga0207695_101177543 | 277 |
| 1532 | 3300025914 | Ga0207671_10003232 | Ga0207671_1000323210 | 277 |
| 1533 | 3300025924 | Ga0207694_10000564 | Ga0207694_1000056415 | 277 |
| 1534 | 3300025929 | Ga0207664_10008230 | Ga0207664_100082303 | 277 |
| 1535 | 3300025931 | Ga0207644_10031439 | Ga0207644_100314394 | 277 |
| 1536 | 3300025933 | Ga0207706_10035523 | Ga0207706_100355232 | 277 |
| 1537 | 3300025934 | Ga0207686_10051132 | Ga0207686_100511322 | 277 |
| 1538 | 3300025945 | Ga0207679_10086271 | Ga0207679_100862712 | 277 |
| 1539 | 3300025949 | Ga0207667_10009339 | Ga0207667_100093398 | 277 |
| 1540 | 3300026023 | Ga0207677_10050505 | Ga0207677_100505052 | 277 |
| 1541 | 3300026041 | Ga0207639_10001424 | Ga0207639_1000142411 | 277 |
| 1542 | 3300026078 | Ga0207702_10000004 | Ga0207702_10000004201 | 277 |
| 1543 | 3300026088 | Ga0207641_10087690 | Ga0207641_100876902 | 277 |
| 1544 | 3300026095 | Ga0207676_10000732 | Ga0207676_100007322 | 277 |
| 1545 | 3300026116 | Ga0207674_10005590 | Ga0207674_100055904 | 277 |
| 1546 | 3300028381 | Ga0268264_10180693 | Ga0268264_101806932 | 277 |
| 1547 | 3300035113 | Ga0373936_0013440 | Ga0373936_0013440_467_1315 | 277 |
| 1548 | 3300039437 | Ga0436365_1846448 | Ga0436365_1846448_156_1025 | 277 |
| 1549 | 3300048905 | Ga0496102_0012820 | Ga0496102_0012820_2243_3145 | 277 |
| 1550 | 3300048908 | Ga0496105_0183879 | Ga0496105_0183879_695_1597 | 277 |
| 1551 | 3300048909 | Ga0496106_0145724 | Ga0496106_0145724_486_1388 | 277 |
| 1552 | 3300048912 | Ga0496109_0001563 | Ga0496109_0001563_13652_14554 | 277 |
| 1553 | 3300048915 | Ga0496112_0041328 | Ga0496112_0041328_1997_2899 | 277 |
| 1554 | 3300048915 | Ga0496112_0187915 | Ga0496112_0187915_714_1571 | 277 |
| 1555 | 3300048921 | Ga0496118_0129515 | Ga0496118_0129515_26_859 | 277 |
| 1556 | 3300048924 | Ga0496121_0004961 | Ga0496121_0004961_2999_3832 | 277 |
| 1557 | 3300048929 | Ga0496126_0013337 | Ga0496126_0013337_1901_2734 | 277 |
| 1558 | 3300053125 | Ga0500618_012652 | Ga0500618_012652_188_1054 | 277 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ltz-assembly1.cif.gz_A | induced dna bending by unique dimerization of higa antitoxin | 0.8331 | 39 | 80 |
| 1y7y-assembly1.cif.gz_B | high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila | 0.8258 | 8 | 85 |
| 1y7y-assembly1.cif.gz_A | high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila | 0.821 | 3 | 85 |
| 3zkc-assembly1.cif.gz_B | crystal structure of the master regulator for biofilm formation sinr in complex with dna. | 0.8178 | 11 | 81 |
| 7ewe-assembly3.cif.gz_E | mycobacterium tuberculosis higa2 (form iii) | 0.8084 | 39 | 79 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1y7yB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8258 | 8 | 85 | 1.10.260.40 |
| 1y7yA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.821 | 3 | 85 | 1.10.260.40 |
| 1adrA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8197 | 11 | 89 | 1.10.260.40 |
| 3zkcB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8178 | 11 | 81 | 1.10.260.40 |
| 2ofyB01 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8038 | 1 | 85 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3A3H3R9-F1-model_v4 | XRE family transcriptional regulator | 0.9768 | 9 | 276 |
GO:0003677
|
| AF-A0A6P1ZK00-F1-model_v4 | Transcriptional regulator | 0.9603 | 1 | 275 |
GO:0003677
|
| AF-A0A807LGQ6-F1-model_v4 | Transcriptional regulator | 0.9591 | 6 | 277 |
GO:0003677
|
| AF-A0A353U7Q5-F1-model_v4 | deleted | 0.9543 | 65 | 276 |
|
| AF-A0A2W4REA5-F1-model_v4 | Transcriptional regulator | 0.954 | 5 | 91 |
GO:0003677
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar